US20200277358A1 - Engineered polypeptides and uses thereof - Google Patents
Engineered polypeptides and uses thereof Download PDFInfo
- Publication number
- US20200277358A1 US20200277358A1 US16/845,894 US202016845894A US2020277358A1 US 20200277358 A1 US20200277358 A1 US 20200277358A1 US 202016845894 A US202016845894 A US 202016845894A US 2020277358 A1 US2020277358 A1 US 2020277358A1
- Authority
- US
- United States
- Prior art keywords
- polypeptide
- region
- antibody molecule
- mutation
- antibody
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 545
- 102000004196 processed proteins & peptides Human genes 0.000 title claims abstract description 529
- 229920001184 polypeptide Polymers 0.000 title claims abstract description 528
- 108020001507 fusion proteins Proteins 0.000 claims abstract description 116
- 102000037865 fusion proteins Human genes 0.000 claims abstract description 115
- 230000035772 mutation Effects 0.000 claims description 397
- 238000000034 method Methods 0.000 claims description 83
- 241000282414 Homo sapiens Species 0.000 claims description 60
- 150000007523 nucleic acids Chemical class 0.000 claims description 47
- 102000039446 nucleic acids Human genes 0.000 claims description 42
- 108020004707 nucleic acids Proteins 0.000 claims description 42
- 239000000203 mixture Substances 0.000 claims description 41
- 239000012634 fragment Substances 0.000 claims description 26
- 108060003951 Immunoglobulin Proteins 0.000 claims description 24
- 102000018358 immunoglobulin Human genes 0.000 claims description 24
- 239000013598 vector Substances 0.000 claims description 23
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 claims description 11
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 claims description 11
- 238000004519 manufacturing process Methods 0.000 claims description 10
- 238000012258 culturing Methods 0.000 claims description 5
- 239000003937 drug carrier Substances 0.000 claims description 5
- 241001529936 Murinae Species 0.000 claims description 4
- 230000027455 binding Effects 0.000 description 192
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 description 164
- 101710177940 IgG receptor FcRn large subunit p51 Proteins 0.000 description 157
- 210000004027 cell Anatomy 0.000 description 101
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 81
- 208000035475 disorder Diseases 0.000 description 73
- 108090000623 proteins and genes Proteins 0.000 description 64
- 102000004169 proteins and genes Human genes 0.000 description 58
- 235000018102 proteins Nutrition 0.000 description 56
- 238000003556 assay Methods 0.000 description 50
- 230000006870 function Effects 0.000 description 46
- 239000003814 drug Substances 0.000 description 45
- 230000003993 interaction Effects 0.000 description 44
- 125000003729 nucleotide group Chemical group 0.000 description 40
- 239000012636 effector Substances 0.000 description 37
- 235000001014 amino acid Nutrition 0.000 description 36
- 125000000539 amino acid group Chemical group 0.000 description 36
- 125000003275 alpha amino acid group Chemical group 0.000 description 35
- 150000001413 amino acids Chemical class 0.000 description 35
- 230000007423 decrease Effects 0.000 description 35
- 229940024606 amino acid Drugs 0.000 description 34
- 239000002773 nucleotide Substances 0.000 description 34
- 229940079593 drug Drugs 0.000 description 33
- 239000000427 antigen Substances 0.000 description 28
- 108091007433 antigens Proteins 0.000 description 28
- 102000036639 antigens Human genes 0.000 description 28
- 230000001965 increasing effect Effects 0.000 description 27
- 108091006020 Fc-tagged proteins Proteins 0.000 description 26
- 238000011282 treatment Methods 0.000 description 26
- 238000010494 dissociation reaction Methods 0.000 description 25
- 230000005593 dissociations Effects 0.000 description 25
- 230000000694 effects Effects 0.000 description 25
- 230000001225 therapeutic effect Effects 0.000 description 25
- 101710117290 Aldo-keto reductase family 1 member C4 Proteins 0.000 description 24
- -1 e.g. Substances 0.000 description 22
- 102100023431 E3 ubiquitin-protein ligase TRIM21 Human genes 0.000 description 21
- 101710164941 E3 ubiquitin-protein ligase TRIM21 Proteins 0.000 description 21
- 229960001521 motavizumab Drugs 0.000 description 21
- 206010028980 Neoplasm Diseases 0.000 description 20
- 230000008827 biological function Effects 0.000 description 20
- 238000001727 in vivo Methods 0.000 description 20
- 102000005962 receptors Human genes 0.000 description 20
- 108020003175 receptors Proteins 0.000 description 20
- 230000002378 acidificating effect Effects 0.000 description 18
- 238000000423 cell based assay Methods 0.000 description 18
- 239000003795 chemical substances by application Substances 0.000 description 18
- 102000040430 polynucleotide Human genes 0.000 description 18
- 108091033319 polynucleotide Proteins 0.000 description 18
- 239000002157 polynucleotide Substances 0.000 description 18
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 16
- 230000001419 dependent effect Effects 0.000 description 16
- 102000009109 Fc receptors Human genes 0.000 description 15
- 108010087819 Fc receptors Proteins 0.000 description 15
- 108010073807 IgG Receptors Proteins 0.000 description 15
- 241000699670 Mus sp. Species 0.000 description 15
- 108091028043 Nucleic acid sequence Proteins 0.000 description 14
- 230000001976 improved effect Effects 0.000 description 14
- 208000015181 infectious disease Diseases 0.000 description 14
- 102100029204 Low affinity immunoglobulin gamma Fc region receptor II-a Human genes 0.000 description 13
- 230000014509 gene expression Effects 0.000 description 13
- 230000001404 mediated effect Effects 0.000 description 13
- 108010068617 neonatal Fc receptor Proteins 0.000 description 13
- 239000000126 substance Substances 0.000 description 13
- 102100029193 Low affinity immunoglobulin gamma Fc region receptor III-A Human genes 0.000 description 12
- 201000011510 cancer Diseases 0.000 description 12
- 235000014304 histidine Nutrition 0.000 description 12
- 239000000463 material Substances 0.000 description 12
- 239000000523 sample Substances 0.000 description 12
- 238000002965 ELISA Methods 0.000 description 11
- 108010021468 Fc gamma receptor IIA Proteins 0.000 description 11
- 101710099301 Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 11
- 238000004458 analytical method Methods 0.000 description 11
- 238000010171 animal model Methods 0.000 description 11
- 230000002209 hydrophobic effect Effects 0.000 description 11
- 238000000338 in vitro Methods 0.000 description 11
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 10
- 241000699666 Mus <mouse, genus> Species 0.000 description 10
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 10
- 150000001875 compounds Chemical class 0.000 description 10
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 10
- 239000008194 pharmaceutical composition Substances 0.000 description 10
- 230000004044 response Effects 0.000 description 10
- 239000001393 triammonium citrate Substances 0.000 description 10
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 9
- 238000006386 neutralization reaction Methods 0.000 description 9
- 238000002560 therapeutic procedure Methods 0.000 description 9
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 8
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 8
- 102000009490 IgG Receptors Human genes 0.000 description 8
- 230000002776 aggregation Effects 0.000 description 8
- 238000004220 aggregation Methods 0.000 description 8
- 239000013078 crystal Substances 0.000 description 8
- 201000010099 disease Diseases 0.000 description 8
- 230000004927 fusion Effects 0.000 description 8
- 230000013595 glycosylation Effects 0.000 description 8
- 238000006206 glycosylation reaction Methods 0.000 description 8
- 238000001802 infusion Methods 0.000 description 8
- 239000000243 solution Substances 0.000 description 8
- 102000004190 Enzymes Human genes 0.000 description 7
- 108090000790 Enzymes Proteins 0.000 description 7
- 241000700605 Viruses Species 0.000 description 7
- 238000010521 absorption reaction Methods 0.000 description 7
- 230000005888 antibody-dependent cellular phagocytosis Effects 0.000 description 7
- 230000008859 change Effects 0.000 description 7
- 230000000295 complement effect Effects 0.000 description 7
- 238000002022 differential scanning fluorescence spectroscopy Methods 0.000 description 7
- 229940088598 enzyme Drugs 0.000 description 7
- 238000009396 hybridization Methods 0.000 description 7
- 230000003834 intracellular effect Effects 0.000 description 7
- 238000002372 labelling Methods 0.000 description 7
- 239000000178 monomer Substances 0.000 description 7
- 230000000069 prophylactic effect Effects 0.000 description 7
- 210000002966 serum Anatomy 0.000 description 7
- 239000002904 solvent Substances 0.000 description 7
- 238000006467 substitution reaction Methods 0.000 description 7
- 229940124597 therapeutic agent Drugs 0.000 description 7
- 239000003053 toxin Substances 0.000 description 7
- 231100000765 toxin Toxicity 0.000 description 7
- 108700012359 toxins Proteins 0.000 description 7
- 102100032937 CD40 ligand Human genes 0.000 description 6
- 108010073816 IgE Receptors Proteins 0.000 description 6
- 102000009438 IgE Receptors Human genes 0.000 description 6
- 241000700159 Rattus Species 0.000 description 6
- 230000008030 elimination Effects 0.000 description 6
- 238000003379 elimination reaction Methods 0.000 description 6
- 238000001990 intravenous administration Methods 0.000 description 6
- 208000028454 lice infestation Diseases 0.000 description 6
- 239000011159 matrix material Substances 0.000 description 6
- 210000002381 plasma Anatomy 0.000 description 6
- 230000002829 reductive effect Effects 0.000 description 6
- 208000024891 symptom Diseases 0.000 description 6
- 210000001519 tissue Anatomy 0.000 description 6
- 238000011830 transgenic mouse model Methods 0.000 description 6
- 102100025390 Integrin beta-2 Human genes 0.000 description 5
- 206010025323 Lymphomas Diseases 0.000 description 5
- 241000699660 Mus musculus Species 0.000 description 5
- 206010057249 Phagocytosis Diseases 0.000 description 5
- 241000725643 Respiratory syncytial virus Species 0.000 description 5
- 241000283984 Rodentia Species 0.000 description 5
- 208000002474 Tinea Diseases 0.000 description 5
- 230000009286 beneficial effect Effects 0.000 description 5
- 230000008901 benefit Effects 0.000 description 5
- 230000015572 biosynthetic process Effects 0.000 description 5
- 210000004369 blood Anatomy 0.000 description 5
- 239000008280 blood Substances 0.000 description 5
- 230000015556 catabolic process Effects 0.000 description 5
- 210000003169 central nervous system Anatomy 0.000 description 5
- 230000004540 complement-dependent cytotoxicity Effects 0.000 description 5
- 208000022993 cryopyrin-associated periodic syndrome Diseases 0.000 description 5
- 230000003247 decreasing effect Effects 0.000 description 5
- 238000006731 degradation reaction Methods 0.000 description 5
- 238000001514 detection method Methods 0.000 description 5
- 239000006185 dispersion Substances 0.000 description 5
- 210000001163 endosome Anatomy 0.000 description 5
- 238000005516 engineering process Methods 0.000 description 5
- 230000002708 enhancing effect Effects 0.000 description 5
- 239000013604 expression vector Substances 0.000 description 5
- 210000004408 hybridoma Anatomy 0.000 description 5
- 230000002401 inhibitory effect Effects 0.000 description 5
- 239000003446 ligand Substances 0.000 description 5
- 238000002844 melting Methods 0.000 description 5
- 230000008018 melting Effects 0.000 description 5
- 230000004048 modification Effects 0.000 description 5
- 238000012986 modification Methods 0.000 description 5
- 201000005962 mycosis fungoides Diseases 0.000 description 5
- 230000002093 peripheral effect Effects 0.000 description 5
- 230000008782 phagocytosis Effects 0.000 description 5
- 230000005588 protonation Effects 0.000 description 5
- 241000894007 species Species 0.000 description 5
- 210000002700 urine Anatomy 0.000 description 5
- 208000023275 Autoimmune disease Diseases 0.000 description 4
- 241000894006 Bacteria Species 0.000 description 4
- 108010029697 CD40 Ligand Proteins 0.000 description 4
- 241000282836 Camelus dromedarius Species 0.000 description 4
- 208000035473 Communicable disease Diseases 0.000 description 4
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 4
- 108020004414 DNA Proteins 0.000 description 4
- 241000709661 Enterovirus Species 0.000 description 4
- 108010021472 Fc gamma receptor IIB Proteins 0.000 description 4
- 208000007465 Giant cell arteritis Diseases 0.000 description 4
- 206010072579 Granulomatosis with polyangiitis Diseases 0.000 description 4
- 241000701806 Human papillomavirus Species 0.000 description 4
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 4
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 4
- 102100029205 Low affinity immunoglobulin gamma Fc region receptor II-b Human genes 0.000 description 4
- 239000001825 Polyoxyethene (8) stearate Substances 0.000 description 4
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 description 4
- 239000002253 acid Substances 0.000 description 4
- 230000003213 activating effect Effects 0.000 description 4
- 125000003118 aryl group Chemical group 0.000 description 4
- 238000012575 bio-layer interferometry Methods 0.000 description 4
- 229960002685 biotin Drugs 0.000 description 4
- 235000020958 biotin Nutrition 0.000 description 4
- 239000011616 biotin Substances 0.000 description 4
- 210000001124 body fluid Anatomy 0.000 description 4
- 239000010839 body fluid Substances 0.000 description 4
- 239000002299 complementary DNA Substances 0.000 description 4
- 230000021615 conjugation Effects 0.000 description 4
- 238000006073 displacement reaction Methods 0.000 description 4
- 238000009826 distribution Methods 0.000 description 4
- 210000003979 eosinophil Anatomy 0.000 description 4
- 208000026278 immune system disease Diseases 0.000 description 4
- 239000004615 ingredient Substances 0.000 description 4
- 238000002347 injection Methods 0.000 description 4
- 239000007924 injection Substances 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 210000000056 organ Anatomy 0.000 description 4
- 201000008968 osteosarcoma Diseases 0.000 description 4
- 239000002245 particle Substances 0.000 description 4
- 229920000642 polymer Polymers 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 239000000047 product Substances 0.000 description 4
- 238000000159 protein binding assay Methods 0.000 description 4
- 230000002285 radioactive effect Effects 0.000 description 4
- 206010039073 rheumatoid arthritis Diseases 0.000 description 4
- 239000010948 rhodium Substances 0.000 description 4
- 206010043207 temporal arteritis Diseases 0.000 description 4
- 238000012360 testing method Methods 0.000 description 4
- 229960003989 tocilizumab Drugs 0.000 description 4
- 230000031998 transcytosis Effects 0.000 description 4
- 238000001890 transfection Methods 0.000 description 4
- 102000003298 tumor necrosis factor receptor Human genes 0.000 description 4
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
- 108010088751 Albumins Proteins 0.000 description 3
- 102000009027 Albumins Human genes 0.000 description 3
- 102100034452 Alternative prion protein Human genes 0.000 description 3
- 206010001935 American trypanosomiasis Diseases 0.000 description 3
- 241000193738 Bacillus anthracis Species 0.000 description 3
- 208000009299 Benign Mucous Membrane Pemphigoid Diseases 0.000 description 3
- 108010039209 Blood Coagulation Factors Proteins 0.000 description 3
- 102000015081 Blood Coagulation Factors Human genes 0.000 description 3
- 108010021064 CTLA-4 Antigen Proteins 0.000 description 3
- 229940045513 CTLA4 antagonist Drugs 0.000 description 3
- 206010007134 Candida infections Diseases 0.000 description 3
- 208000024172 Cardiovascular disease Diseases 0.000 description 3
- 241000606153 Chlamydia trachomatis Species 0.000 description 3
- 241000193468 Clostridium perfringens Species 0.000 description 3
- 241000223205 Coccidioides immitis Species 0.000 description 3
- 206010009944 Colon cancer Diseases 0.000 description 3
- 108091035707 Consensus sequence Proteins 0.000 description 3
- 208000003407 Creutzfeldt-Jakob Syndrome Diseases 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- 108010008165 Etanercept Proteins 0.000 description 3
- 208000006168 Ewing Sarcoma Diseases 0.000 description 3
- 241000233866 Fungi Species 0.000 description 3
- 208000021309 Germ cell tumor Diseases 0.000 description 3
- 102100039939 Growth/differentiation factor 8 Human genes 0.000 description 3
- 206010019939 Herpes gestationis Diseases 0.000 description 3
- 101000935040 Homo sapiens Integrin beta-2 Proteins 0.000 description 3
- 241000046923 Human bocavirus Species 0.000 description 3
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 3
- 241000342334 Human metapneumovirus Species 0.000 description 3
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 3
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 3
- 108050003558 Interleukin-17 Proteins 0.000 description 3
- 102000013691 Interleukin-17 Human genes 0.000 description 3
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 3
- 208000007766 Kaposi sarcoma Diseases 0.000 description 3
- 208000004204 Larva Migrans Diseases 0.000 description 3
- 208000016604 Lyme disease Diseases 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- 102100034256 Mucin-1 Human genes 0.000 description 3
- 108010056852 Myostatin Proteins 0.000 description 3
- 208000034176 Neoplasms, Germ Cell and Embryonal Diseases 0.000 description 3
- 241000243985 Onchocerca volvulus Species 0.000 description 3
- 241000283973 Oryctolagus cuniculus Species 0.000 description 3
- 206010033128 Ovarian cancer Diseases 0.000 description 3
- 206010061535 Ovarian neoplasm Diseases 0.000 description 3
- 208000008223 Pemphigoid Gestationis Diseases 0.000 description 3
- 206010035148 Plague Diseases 0.000 description 3
- 241000288906 Primates Species 0.000 description 3
- 102100040678 Programmed cell death protein 1 Human genes 0.000 description 3
- 108020004511 Recombinant DNA Proteins 0.000 description 3
- 102100034136 Serine/threonine-protein kinase receptor R3 Human genes 0.000 description 3
- 101710082813 Serine/threonine-protein kinase receptor R3 Proteins 0.000 description 3
- 208000001203 Smallpox Diseases 0.000 description 3
- 241000191940 Staphylococcus Species 0.000 description 3
- 108010090804 Streptavidin Proteins 0.000 description 3
- 208000031673 T-Cell Cutaneous Lymphoma Diseases 0.000 description 3
- 206010043561 Thrombocytopenic purpura Diseases 0.000 description 3
- 206010044269 Toxocariasis Diseases 0.000 description 3
- 241000893966 Trichophyton verrucosum Species 0.000 description 3
- 241000223109 Trypanosoma cruzi Species 0.000 description 3
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 3
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 3
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 3
- VWQVUPCCIRVNHF-OUBTZVSYSA-N Yttrium-90 Chemical compound [90Y] VWQVUPCCIRVNHF-OUBTZVSYSA-N 0.000 description 3
- 206010061418 Zygomycosis Diseases 0.000 description 3
- 229960003697 abatacept Drugs 0.000 description 3
- 229950004283 actoxumab Drugs 0.000 description 3
- 239000000654 additive Substances 0.000 description 3
- 230000000996 additive effect Effects 0.000 description 3
- 229960002833 aflibercept Drugs 0.000 description 3
- 108010081667 aflibercept Proteins 0.000 description 3
- 229960002459 alefacept Drugs 0.000 description 3
- 230000004075 alteration Effects 0.000 description 3
- 208000006730 anaplasmosis Diseases 0.000 description 3
- 230000001580 bacterial effect Effects 0.000 description 3
- 210000003651 basophil Anatomy 0.000 description 3
- 229960005347 belatacept Drugs 0.000 description 3
- 239000012472 biological sample Substances 0.000 description 3
- 238000001574 biopsy Methods 0.000 description 3
- 239000003114 blood coagulation factor Substances 0.000 description 3
- 238000004422 calculation algorithm Methods 0.000 description 3
- 201000003984 candidiasis Diseases 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 3
- 238000012512 characterization method Methods 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 229940038705 chlamydia trachomatis Drugs 0.000 description 3
- 230000001684 chronic effect Effects 0.000 description 3
- 238000002648 combination therapy Methods 0.000 description 3
- 239000000039 congener Substances 0.000 description 3
- 239000013068 control sample Substances 0.000 description 3
- 239000012228 culture supernatant Substances 0.000 description 3
- 201000007241 cutaneous T cell lymphoma Diseases 0.000 description 3
- 231100000433 cytotoxic Toxicity 0.000 description 3
- 230000001472 cytotoxic effect Effects 0.000 description 3
- 201000001981 dermatomyositis Diseases 0.000 description 3
- 229960000403 etanercept Drugs 0.000 description 3
- 238000011156 evaluation Methods 0.000 description 3
- 230000029142 excretion Effects 0.000 description 3
- 239000012530 fluid Substances 0.000 description 3
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 3
- 238000009472 formulation Methods 0.000 description 3
- 238000007918 intramuscular administration Methods 0.000 description 3
- 208000012987 lip and oral cavity carcinoma Diseases 0.000 description 3
- OHSVLFRHMCKCQY-NJFSPNSNSA-N lutetium-177 Chemical compound [177Lu] OHSVLFRHMCKCQY-NJFSPNSNSA-N 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 201000001441 melanoma Diseases 0.000 description 3
- 208000030159 metabolic disease Diseases 0.000 description 3
- 238000002625 monoclonal antibody therapy Methods 0.000 description 3
- 201000009240 nasopharyngitis Diseases 0.000 description 3
- 238000003012 network analysis Methods 0.000 description 3
- 208000008795 neuromyelitis optica Diseases 0.000 description 3
- 230000003472 neutralizing effect Effects 0.000 description 3
- 244000052769 pathogen Species 0.000 description 3
- 230000037361 pathway Effects 0.000 description 3
- 239000000816 peptidomimetic Substances 0.000 description 3
- 230000008884 pinocytosis Effects 0.000 description 3
- 208000025638 primary cutaneous T-cell non-Hodgkin lymphoma Diseases 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 238000001959 radiotherapy Methods 0.000 description 3
- 238000010188 recombinant method Methods 0.000 description 3
- 238000004064 recycling Methods 0.000 description 3
- 230000009467 reduction Effects 0.000 description 3
- 229960001886 rilonacept Drugs 0.000 description 3
- 108010046141 rilonacept Proteins 0.000 description 3
- 229960004641 rituximab Drugs 0.000 description 3
- 108010017584 romiplostim Proteins 0.000 description 3
- 229960004262 romiplostim Drugs 0.000 description 3
- WUWDLXZGHZSWQZ-WQLSENKSSA-N semaxanib Chemical compound N1C(C)=CC(C)=C1\C=C/1C2=CC=CC=C2NC\1=O WUWDLXZGHZSWQZ-WQLSENKSSA-N 0.000 description 3
- 238000003998 size exclusion chromatography high performance liquid chromatography Methods 0.000 description 3
- 238000007920 subcutaneous administration Methods 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- 230000002195 synergetic effect Effects 0.000 description 3
- BXTJCSYMGFJEID-XMTADJHZSA-N (2s)-2-[[(2r,3r)-3-[(2s)-1-[(3r,4s,5s)-4-[[(2s)-2-[[(2s)-2-[6-[3-[(2r)-2-amino-2-carboxyethyl]sulfanyl-2,5-dioxopyrrolidin-1-yl]hexanoyl-methylamino]-3-methylbutanoyl]amino]-3-methylbutanoyl]-methylamino]-3-methoxy-5-methylheptanoyl]pyrrolidin-2-yl]-3-met Chemical compound C([C@H](NC(=O)[C@H](C)[C@@H](OC)[C@@H]1CCCN1C(=O)C[C@H]([C@H]([C@@H](C)CC)N(C)C(=O)[C@@H](NC(=O)[C@H](C(C)C)N(C)C(=O)CCCCCN1C(C(SC[C@H](N)C(O)=O)CC1=O)=O)C(C)C)OC)C(O)=O)C1=CC=CC=C1 BXTJCSYMGFJEID-XMTADJHZSA-N 0.000 description 2
- MZZYGYNZAOVRTG-UHFFFAOYSA-N 2-hydroxy-n-(1h-1,2,4-triazol-5-yl)benzamide Chemical compound OC1=CC=CC=C1C(=O)NC1=NC=NN1 MZZYGYNZAOVRTG-UHFFFAOYSA-N 0.000 description 2
- 102100030310 5,6-dihydroxyindole-2-carboxylic acid oxidase Human genes 0.000 description 2
- ZCYVEMRRCGMTRW-UHFFFAOYSA-N 7553-56-2 Chemical compound [I] ZCYVEMRRCGMTRW-UHFFFAOYSA-N 0.000 description 2
- 208000030507 AIDS Diseases 0.000 description 2
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 2
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 2
- 208000000230 African Trypanosomiasis Diseases 0.000 description 2
- 102100025683 Alkaline phosphatase, tissue-nonspecific isozyme Human genes 0.000 description 2
- 102000013455 Amyloid beta-Peptides Human genes 0.000 description 2
- 108010090849 Amyloid beta-Peptides Proteins 0.000 description 2
- 244000303258 Annona diversifolia Species 0.000 description 2
- 235000002198 Annona diversifolia Nutrition 0.000 description 2
- 208000003343 Antiphospholipid Syndrome Diseases 0.000 description 2
- 241001135700 Arcanobacterium haemolyticum Species 0.000 description 2
- 206010003571 Astrocytoma Diseases 0.000 description 2
- 201000008271 Atypical teratoid rhabdoid tumor Diseases 0.000 description 2
- 108090001008 Avidin Proteins 0.000 description 2
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 2
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 2
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 2
- 208000004429 Bacillary Dysentery Diseases 0.000 description 2
- 208000004926 Bacterial Vaginosis Diseases 0.000 description 2
- 208000035143 Bacterial infection Diseases 0.000 description 2
- 206010044583 Bartonella Infections Diseases 0.000 description 2
- 102100032412 Basigin Human genes 0.000 description 2
- 206010005098 Blastomycosis Diseases 0.000 description 2
- 208000003508 Botulism Diseases 0.000 description 2
- 208000011691 Burkitt lymphomas Diseases 0.000 description 2
- 108700012439 CA9 Proteins 0.000 description 2
- 102100038078 CD276 antigen Human genes 0.000 description 2
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 description 2
- 241000282832 Camelidae Species 0.000 description 2
- 241000222122 Candida albicans Species 0.000 description 2
- 241000283707 Capra Species 0.000 description 2
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 2
- 102100024423 Carbonic anhydrase 9 Human genes 0.000 description 2
- 206010007279 Carcinoid tumour of the gastrointestinal tract Diseases 0.000 description 2
- 208000005024 Castleman disease Diseases 0.000 description 2
- 241000282693 Cercopithecidae Species 0.000 description 2
- 208000024699 Chagas disease Diseases 0.000 description 2
- 241001647372 Chlamydia pneumoniae Species 0.000 description 2
- 208000017667 Chronic Disease Diseases 0.000 description 2
- 208000030939 Chronic inflammatory demyelinating polyneuropathy Diseases 0.000 description 2
- 201000000724 Chronic recurrent multifocal osteomyelitis Diseases 0.000 description 2
- 241000193163 Clostridioides difficile Species 0.000 description 2
- 102100022641 Coagulation factor IX Human genes 0.000 description 2
- 241001522757 Coccidioides posadasii Species 0.000 description 2
- 108091033380 Coding strand Proteins 0.000 description 2
- 206010009900 Colitis ulcerative Diseases 0.000 description 2
- 208000009802 Colorado tick fever Diseases 0.000 description 2
- 241000204955 Colorado tick fever virus Species 0.000 description 2
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 2
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 2
- 208000001528 Coronaviridae Infections Diseases 0.000 description 2
- 208000009798 Craniopharyngioma Diseases 0.000 description 2
- 208000020406 Creutzfeldt Jacob disease Diseases 0.000 description 2
- 208000010859 Creutzfeldt-Jakob disease Diseases 0.000 description 2
- 208000000307 Crimean Hemorrhagic Fever Diseases 0.000 description 2
- 201000003075 Crimean-Congo hemorrhagic fever Diseases 0.000 description 2
- 201000007336 Cryptococcosis Diseases 0.000 description 2
- 241000221204 Cryptococcus neoformans Species 0.000 description 2
- 206010059547 Cutaneous larva migrans Diseases 0.000 description 2
- 241000701022 Cytomegalovirus Species 0.000 description 2
- 208000001490 Dengue Diseases 0.000 description 2
- 206010012310 Dengue fever Diseases 0.000 description 2
- YZCKVEUIGOORGS-OUBTZVSYSA-N Deuterium Chemical group [2H] YZCKVEUIGOORGS-OUBTZVSYSA-N 0.000 description 2
- 208000021866 Dressler syndrome Diseases 0.000 description 2
- 241001115402 Ebolavirus Species 0.000 description 2
- 208000031912 Endemic Flea-Borne Typhus Diseases 0.000 description 2
- 241000194033 Enterococcus Species 0.000 description 2
- 241001529459 Enterovirus A71 Species 0.000 description 2
- 206010064212 Eosinophilic oesophagitis Diseases 0.000 description 2
- 102100023688 Eotaxin Human genes 0.000 description 2
- 206010014967 Ependymoma Diseases 0.000 description 2
- 201000005866 Exanthema Subitum Diseases 0.000 description 2
- 201000006353 Filariasis Diseases 0.000 description 2
- 241000710831 Flavivirus Species 0.000 description 2
- 102000010451 Folate receptor alpha Human genes 0.000 description 2
- 108050001931 Folate receptor alpha Proteins 0.000 description 2
- 102000012673 Follicle Stimulating Hormone Human genes 0.000 description 2
- 108010079345 Follicle Stimulating Hormone Proteins 0.000 description 2
- 201000000628 Gas Gangrene Diseases 0.000 description 2
- 206010051066 Gastrointestinal stromal tumour Diseases 0.000 description 2
- 208000003736 Gerstmann-Straussler-Scheinker Disease Diseases 0.000 description 2
- 206010072075 Gerstmann-Straussler-Scheinker syndrome Diseases 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 2
- 206010018693 Granuloma inguinale Diseases 0.000 description 2
- 206010019143 Hantavirus pulmonary infection Diseases 0.000 description 2
- 241001335250 Heartland virus Species 0.000 description 2
- 101710154606 Hemagglutinin Proteins 0.000 description 2
- 208000032759 Hemolytic-Uremic Syndrome Diseases 0.000 description 2
- 208000032982 Hemorrhagic Fever with Renal Syndrome Diseases 0.000 description 2
- 201000004331 Henoch-Schoenlein purpura Diseases 0.000 description 2
- 206010019617 Henoch-Schonlein purpura Diseases 0.000 description 2
- 241000700721 Hepatitis B virus Species 0.000 description 2
- 208000007514 Herpes zoster Diseases 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 208000017604 Hodgkin disease Diseases 0.000 description 2
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 2
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101000773083 Homo sapiens 5,6-dihydroxyindole-2-carboxylic acid oxidase Proteins 0.000 description 2
- 101000690301 Homo sapiens Aldo-keto reductase family 1 member C4 Proteins 0.000 description 2
- 101000574445 Homo sapiens Alkaline phosphatase, tissue-nonspecific isozyme Proteins 0.000 description 2
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 2
- 101000914324 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 5 Proteins 0.000 description 2
- 101000914321 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 7 Proteins 0.000 description 2
- 101000746373 Homo sapiens Granulocyte-macrophage colony-stimulating factor Proteins 0.000 description 2
- 101000913079 Homo sapiens IgG receptor FcRn large subunit p51 Proteins 0.000 description 2
- 101000878605 Homo sapiens Low affinity immunoglobulin epsilon Fc receptor Proteins 0.000 description 2
- 101000917826 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-a Proteins 0.000 description 2
- 101000917824 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-b Proteins 0.000 description 2
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 2
- 101001133056 Homo sapiens Mucin-1 Proteins 0.000 description 2
- 101001116548 Homo sapiens Protein CBFA2T1 Proteins 0.000 description 2
- 101000934346 Homo sapiens T-cell surface antigen CD2 Proteins 0.000 description 2
- 101000658622 Homo sapiens Testis-specific Y-encoded-like protein 2 Proteins 0.000 description 2
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 2
- 101000808011 Homo sapiens Vascular endothelial growth factor A Proteins 0.000 description 2
- 101000851007 Homo sapiens Vascular endothelial growth factor receptor 2 Proteins 0.000 description 2
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 2
- 108090000144 Human Proteins Proteins 0.000 description 2
- 102000003839 Human Proteins Human genes 0.000 description 2
- 241000700588 Human alphaherpesvirus 1 Species 0.000 description 2
- 241000701074 Human alphaherpesvirus 2 Species 0.000 description 2
- 241000701085 Human alphaherpesvirus 3 Species 0.000 description 2
- 241000701041 Human betaherpesvirus 7 Species 0.000 description 2
- 241000701027 Human herpesvirus 6 Species 0.000 description 2
- 241000725303 Human immunodeficiency virus Species 0.000 description 2
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 2
- 108010031794 IGF Type 1 Receptor Proteins 0.000 description 2
- 208000031814 IgA Vasculitis Diseases 0.000 description 2
- 102000037982 Immune checkpoint proteins Human genes 0.000 description 2
- 108091008036 Immune checkpoint proteins Proteins 0.000 description 2
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 2
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 2
- 102100039688 Insulin-like growth factor 1 receptor Human genes 0.000 description 2
- 102100025306 Integrin alpha-IIb Human genes 0.000 description 2
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 description 2
- 108010074328 Interferon-gamma Proteins 0.000 description 2
- 102100039880 Interleukin-1 receptor accessory protein Human genes 0.000 description 2
- 101710180389 Interleukin-1 receptor accessory protein Proteins 0.000 description 2
- 102100036705 Interleukin-23 subunit alpha Human genes 0.000 description 2
- 108090000978 Interleukin-4 Proteins 0.000 description 2
- 102000004388 Interleukin-4 Human genes 0.000 description 2
- 108010038501 Interleukin-6 Receptors Proteins 0.000 description 2
- 102000010781 Interleukin-6 Receptors Human genes 0.000 description 2
- 208000005615 Interstitial Cystitis Diseases 0.000 description 2
- 206010061252 Intraocular melanoma Diseases 0.000 description 2
- 208000009164 Islet Cell Adenoma Diseases 0.000 description 2
- 206010023076 Isosporiasis Diseases 0.000 description 2
- 208000011200 Kawasaki disease Diseases 0.000 description 2
- 241000589014 Kingella kingae Species 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- 102100033467 L-selectin Human genes 0.000 description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 2
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- 201000005099 Langerhans cell histiocytosis Diseases 0.000 description 2
- 208000004023 Legionellosis Diseases 0.000 description 2
- 208000007764 Legionnaires' Disease Diseases 0.000 description 2
- 208000012309 Linear IgA disease Diseases 0.000 description 2
- 102100038007 Low affinity immunoglobulin epsilon Fc receptor Human genes 0.000 description 2
- 229910052765 Lutetium Inorganic materials 0.000 description 2
- 108010064548 Lymphocyte Function-Associated Antigen-1 Proteins 0.000 description 2
- 241000712899 Lymphocytic choriomeningitis mammarenavirus Species 0.000 description 2
- 239000012515 MabSelect SuRe Substances 0.000 description 2
- 206010025557 Malignant fibrous histiocytoma of bone Diseases 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 208000000932 Marburg Virus Disease Diseases 0.000 description 2
- 201000011013 Marburg hemorrhagic fever Diseases 0.000 description 2
- 241000712079 Measles morbillivirus Species 0.000 description 2
- 102100027159 Membrane primary amine oxidase Human genes 0.000 description 2
- 208000002030 Merkel cell carcinoma Diseases 0.000 description 2
- 208000025370 Middle East respiratory syndrome Diseases 0.000 description 2
- 208000003250 Mixed connective tissue disease Diseases 0.000 description 2
- 241000700560 Molluscum contagiosum virus Species 0.000 description 2
- 208000003445 Mouth Neoplasms Diseases 0.000 description 2
- 206010028282 Murine typhus Diseases 0.000 description 2
- 208000008756 Mycetoma Diseases 0.000 description 2
- 201000007224 Myeloproliferative neoplasm Diseases 0.000 description 2
- OVRNDRQMDRJTHS-RTRLPJTCSA-N N-acetyl-D-glucosamine Chemical compound CC(=O)N[C@H]1C(O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-RTRLPJTCSA-N 0.000 description 2
- 241000588652 Neisseria gonorrhoeae Species 0.000 description 2
- 206010029266 Neuroendocrine carcinoma of the skin Diseases 0.000 description 2
- 241000187654 Nocardia Species 0.000 description 2
- 208000010195 Onychomycosis Diseases 0.000 description 2
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 2
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 2
- 208000002606 Paramyxoviridae Infections Diseases 0.000 description 2
- 206010048705 Paraneoplastic cerebellar degeneration Diseases 0.000 description 2
- 208000000733 Paroxysmal Hemoglobinuria Diseases 0.000 description 2
- 241000517307 Pediculus humanus Species 0.000 description 2
- 208000029082 Pelvic Inflammatory Disease Diseases 0.000 description 2
- 206010034277 Pemphigoid Diseases 0.000 description 2
- 108091005804 Peptidases Proteins 0.000 description 2
- 102000035195 Peptidases Human genes 0.000 description 2
- 208000031845 Pernicious anaemia Diseases 0.000 description 2
- 201000005702 Pertussis Diseases 0.000 description 2
- 102100036050 Phosphatidylinositol N-acetylglucosaminyltransferase subunit A Human genes 0.000 description 2
- OAICVXFJPJFONN-UHFFFAOYSA-N Phosphorus Chemical compound [P] OAICVXFJPJFONN-UHFFFAOYSA-N 0.000 description 2
- 108010004729 Phycoerythrin Proteins 0.000 description 2
- 241001326499 Piedraia hortae Species 0.000 description 2
- 208000005384 Pneumocystis Pneumonia Diseases 0.000 description 2
- 206010073755 Pneumocystis jirovecii pneumonia Diseases 0.000 description 2
- 229910052777 Praseodymium Inorganic materials 0.000 description 2
- 102100022019 Pregnancy-specific beta-1-glycoprotein 2 Human genes 0.000 description 2
- 241000605861 Prevotella Species 0.000 description 2
- 108091000054 Prion Proteins 0.000 description 2
- RJKFOVLPORLFTN-LEKSSAKUSA-N Progesterone Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H](C(=O)C)[C@@]1(C)CC2 RJKFOVLPORLFTN-LEKSSAKUSA-N 0.000 description 2
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 2
- 206010060862 Prostate cancer Diseases 0.000 description 2
- 101710176177 Protein A56 Proteins 0.000 description 2
- 108010076504 Protein Sorting Signals Proteins 0.000 description 2
- 241000589517 Pseudomonas aeruginosa Species 0.000 description 2
- 201000004681 Psoriasis Diseases 0.000 description 2
- 208000003670 Pure Red-Cell Aplasia Diseases 0.000 description 2
- 101900083372 Rabies virus Glycoprotein Proteins 0.000 description 2
- 102100029986 Receptor tyrosine-protein kinase erbB-3 Human genes 0.000 description 2
- 101710100969 Receptor tyrosine-protein kinase erbB-3 Proteins 0.000 description 2
- 208000005793 Restless legs syndrome Diseases 0.000 description 2
- 201000000582 Retinoblastoma Diseases 0.000 description 2
- 108091028664 Ribonucleotide Proteins 0.000 description 2
- 241000606701 Rickettsia Species 0.000 description 2
- 241000606723 Rickettsia akari Species 0.000 description 2
- 208000000705 Rift Valley Fever Diseases 0.000 description 2
- 206010039207 Rocky Mountain Spotted Fever Diseases 0.000 description 2
- 206010039491 Sarcoma Diseases 0.000 description 2
- 102100034201 Sclerostin Human genes 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- PXIPVTKHYLBLMZ-UHFFFAOYSA-N Sodium azide Chemical compound [Na+].[N-]=[N+]=[N-] PXIPVTKHYLBLMZ-UHFFFAOYSA-N 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 206010072148 Stiff-Person syndrome Diseases 0.000 description 2
- 206010061372 Streptococcal infection Diseases 0.000 description 2
- 206010042276 Subacute endocarditis Diseases 0.000 description 2
- 206010042742 Sympathetic ophthalmia Diseases 0.000 description 2
- 102100025237 T-cell surface antigen CD2 Human genes 0.000 description 2
- GKLVYJBZJHMRIY-OUBTZVSYSA-N Technetium-99 Chemical compound [99Tc] GKLVYJBZJHMRIY-OUBTZVSYSA-N 0.000 description 2
- 208000024313 Testicular Neoplasms Diseases 0.000 description 2
- 206010057644 Testis cancer Diseases 0.000 description 2
- 102100034917 Testis-specific Y-encoded-like protein 2 Human genes 0.000 description 2
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 2
- 239000004473 Threonine Substances 0.000 description 2
- 102000036693 Thrombopoietin Human genes 0.000 description 2
- 108010041111 Thrombopoietin Proteins 0.000 description 2
- 208000007712 Tinea Versicolor Diseases 0.000 description 2
- 201000010618 Tinea cruris Diseases 0.000 description 2
- 206010056131 Tinea versicolour Diseases 0.000 description 2
- 206010051526 Tolosa-Hunt syndrome Diseases 0.000 description 2
- 208000004938 Trematode Infections Diseases 0.000 description 2
- 241000223229 Trichophyton rubrum Species 0.000 description 2
- YZCKVEUIGOORGS-NJFSPNSNSA-N Tritium Chemical compound [3H] YZCKVEUIGOORGS-NJFSPNSNSA-N 0.000 description 2
- 241000223105 Trypanosoma brucei Species 0.000 description 2
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 2
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 2
- 201000006704 Ulcerative Colitis Diseases 0.000 description 2
- 208000025851 Undifferentiated connective tissue disease Diseases 0.000 description 2
- 208000017379 Undifferentiated connective tissue syndrome Diseases 0.000 description 2
- 241000202921 Ureaplasma urealyticum Species 0.000 description 2
- 201000005969 Uveal melanoma Diseases 0.000 description 2
- 206010046851 Uveitis Diseases 0.000 description 2
- 108091008605 VEGF receptors Proteins 0.000 description 2
- 208000037009 Vaginitis bacterial Diseases 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 208000018756 Variant Creutzfeldt-Jakob disease Diseases 0.000 description 2
- 102000009484 Vascular Endothelial Growth Factor Receptors Human genes 0.000 description 2
- 102100033178 Vascular endothelial growth factor receptor 1 Human genes 0.000 description 2
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 description 2
- 241000607272 Vibrio parahaemolyticus Species 0.000 description 2
- 208000036142 Viral infection Diseases 0.000 description 2
- 241000244005 Wuchereria bancrofti Species 0.000 description 2
- 241000607479 Yersinia pestis Species 0.000 description 2
- 230000021736 acetylation Effects 0.000 description 2
- 238000006640 acetylation reaction Methods 0.000 description 2
- 229910052767 actinium Inorganic materials 0.000 description 2
- QQINRWTZWGJFDB-UHFFFAOYSA-N actinium atom Chemical compound [Ac] QQINRWTZWGJFDB-UHFFFAOYSA-N 0.000 description 2
- 230000006978 adaptation Effects 0.000 description 2
- 230000003281 allosteric effect Effects 0.000 description 2
- 239000012491 analyte Substances 0.000 description 2
- 230000000844 anti-bacterial effect Effects 0.000 description 2
- 230000000692 anti-sense effect Effects 0.000 description 2
- 230000006907 apoptotic process Effects 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 210000001106 artificial yeast chromosome Anatomy 0.000 description 2
- 229910052789 astatine Inorganic materials 0.000 description 2
- RYXHOMYVWAEKHL-UHFFFAOYSA-N astatine atom Chemical compound [At] RYXHOMYVWAEKHL-UHFFFAOYSA-N 0.000 description 2
- 208000027625 autoimmune inner ear disease Diseases 0.000 description 2
- 208000022362 bacterial infectious disease Diseases 0.000 description 2
- 208000007456 balantidiasis Diseases 0.000 description 2
- 238000004638 bioanalytical method Methods 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 238000013378 biophysical characterization Methods 0.000 description 2
- 229910052797 bismuth Inorganic materials 0.000 description 2
- JCXGWMGPZLAOME-UHFFFAOYSA-N bismuth atom Chemical compound [Bi] JCXGWMGPZLAOME-UHFFFAOYSA-N 0.000 description 2
- 238000006664 bond formation reaction Methods 0.000 description 2
- 238000004364 calculation method Methods 0.000 description 2
- 125000001314 canonical amino-acid group Chemical group 0.000 description 2
- 229910052799 carbon Inorganic materials 0.000 description 2
- 230000003915 cell function Effects 0.000 description 2
- 210000000170 cell membrane Anatomy 0.000 description 2
- 238000002659 cell therapy Methods 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 210000003850 cellular structure Anatomy 0.000 description 2
- 239000007795 chemical reaction product Substances 0.000 description 2
- 239000000460 chlorine Substances 0.000 description 2
- 208000006990 cholangiocarcinoma Diseases 0.000 description 2
- 201000005795 chronic inflammatory demyelinating polyneuritis Diseases 0.000 description 2
- 201000003486 coccidioidomycosis Diseases 0.000 description 2
- 238000013270 controlled release Methods 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 208000017763 cutaneous neuroendocrine carcinoma Diseases 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 208000025729 dengue disease Diseases 0.000 description 2
- 239000005547 deoxyribonucleotide Substances 0.000 description 2
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 2
- 229910052805 deuterium Inorganic materials 0.000 description 2
- 238000002405 diagnostic procedure Methods 0.000 description 2
- 239000002612 dispersion medium Substances 0.000 description 2
- 238000012377 drug delivery Methods 0.000 description 2
- 230000036267 drug metabolism Effects 0.000 description 2
- 108010005794 dulaglutide Proteins 0.000 description 2
- 239000000975 dye Substances 0.000 description 2
- 208000000292 ehrlichiosis Diseases 0.000 description 2
- 230000009881 electrostatic interaction Effects 0.000 description 2
- 238000010828 elution Methods 0.000 description 2
- 239000002158 endotoxin Substances 0.000 description 2
- 206010014881 enterobiasis Diseases 0.000 description 2
- 201000000708 eosinophilic esophagitis Diseases 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 108700007283 factor IX Fc fusion Proteins 0.000 description 2
- 201000006061 fatal familial insomnia Diseases 0.000 description 2
- 230000002349 favourable effect Effects 0.000 description 2
- 210000003754 fetus Anatomy 0.000 description 2
- 238000000684 flow cytometry Methods 0.000 description 2
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 2
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 2
- 229940028334 follicle stimulating hormone Drugs 0.000 description 2
- 230000005714 functional activity Effects 0.000 description 2
- 201000011243 gastrointestinal stromal tumor Diseases 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 210000003714 granulocyte Anatomy 0.000 description 2
- 201000009277 hairy cell leukemia Diseases 0.000 description 2
- 201000005648 hantavirus pulmonary syndrome Diseases 0.000 description 2
- 239000000185 hemagglutinin Substances 0.000 description 2
- 208000002672 hepatitis B Diseases 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- 210000003630 histaminocyte Anatomy 0.000 description 2
- 150000002411 histidines Chemical class 0.000 description 2
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 2
- 230000013632 homeostatic process Effects 0.000 description 2
- 208000029080 human African trypanosomiasis Diseases 0.000 description 2
- 102000054751 human RUNX1T1 Human genes 0.000 description 2
- 201000009163 human granulocytic anaplasmosis Diseases 0.000 description 2
- 208000022340 human granulocytic ehrlichiosis Diseases 0.000 description 2
- 230000028993 immune response Effects 0.000 description 2
- 208000015446 immunoglobulin a vasculitis Diseases 0.000 description 2
- 238000009169 immunotherapy Methods 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- 230000002779 inactivation Effects 0.000 description 2
- 201000008319 inclusion body myositis Diseases 0.000 description 2
- APFVFJFRJDLVQX-AHCXROLUSA-N indium-111 Chemical compound [111In] APFVFJFRJDLVQX-AHCXROLUSA-N 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 201000006747 infectious mononucleosis Diseases 0.000 description 2
- 206010022000 influenza Diseases 0.000 description 2
- 238000007912 intraperitoneal administration Methods 0.000 description 2
- 229910052740 iodine Inorganic materials 0.000 description 2
- 239000011630 iodine Substances 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 230000029226 lipidation Effects 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- 206010025135 lupus erythematosus Diseases 0.000 description 2
- OHSVLFRHMCKCQY-UHFFFAOYSA-N lutetium atom Chemical compound [Lu] OHSVLFRHMCKCQY-UHFFFAOYSA-N 0.000 description 2
- 238000013507 mapping Methods 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 201000004015 melioidosis Diseases 0.000 description 2
- 230000004060 metabolic process Effects 0.000 description 2
- 239000002207 metabolite Substances 0.000 description 2
- 206010063344 microscopic polyangiitis Diseases 0.000 description 2
- 208000008588 molluscum contagiosum Diseases 0.000 description 2
- 210000001616 monocyte Anatomy 0.000 description 2
- 208000001725 mucocutaneous lymph node syndrome Diseases 0.000 description 2
- 201000007524 mucormycosis Diseases 0.000 description 2
- 201000006417 multiple sclerosis Diseases 0.000 description 2
- 208000018795 nasal cavity and paranasal sinus carcinoma Diseases 0.000 description 2
- 230000001537 neural effect Effects 0.000 description 2
- 230000007935 neutral effect Effects 0.000 description 2
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 2
- 229960003347 obinutuzumab Drugs 0.000 description 2
- 201000002575 ocular melanoma Diseases 0.000 description 2
- 206010030861 ophthalmia neonatorum Diseases 0.000 description 2
- 238000005457 optimization Methods 0.000 description 2
- 239000001048 orange dye Substances 0.000 description 2
- 201000005580 palindromic rheumatism Diseases 0.000 description 2
- 208000022102 pancreatic neuroendocrine neoplasm Diseases 0.000 description 2
- 208000021010 pancreatic neuroendocrine tumor Diseases 0.000 description 2
- 238000007911 parenteral administration Methods 0.000 description 2
- 201000003045 paroxysmal nocturnal hemoglobinuria Diseases 0.000 description 2
- 229960002621 pembrolizumab Drugs 0.000 description 2
- 238000002823 phage display Methods 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- 229910052698 phosphorus Inorganic materials 0.000 description 2
- 239000011574 phosphorus Substances 0.000 description 2
- 230000026731 phosphorylation Effects 0.000 description 2
- 238000006366 phosphorylation reaction Methods 0.000 description 2
- 238000001126 phototherapy Methods 0.000 description 2
- 208000005814 piedra Diseases 0.000 description 2
- 230000036470 plasma concentration Effects 0.000 description 2
- 201000000317 pneumocystosis Diseases 0.000 description 2
- 238000006116 polymerization reaction Methods 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- PUDIUYLPXJFUGB-UHFFFAOYSA-N praseodymium atom Chemical compound [Pr] PUDIUYLPXJFUGB-UHFFFAOYSA-N 0.000 description 2
- 230000002035 prolonged effect Effects 0.000 description 2
- 235000019833 protease Nutrition 0.000 description 2
- 230000006432 protein unfolding Effects 0.000 description 2
- 210000001938 protoplast Anatomy 0.000 description 2
- 239000012857 radioactive material Substances 0.000 description 2
- 238000003127 radioimmunoassay Methods 0.000 description 2
- 208000002574 reactive arthritis Diseases 0.000 description 2
- 230000010837 receptor-mediated endocytosis Effects 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 230000000717 retained effect Effects 0.000 description 2
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 2
- WUAPFZMCVAUBPE-IGMARMGPSA-N rhenium-186 Chemical compound [186Re] WUAPFZMCVAUBPE-IGMARMGPSA-N 0.000 description 2
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 2
- 229910052703 rhodium Inorganic materials 0.000 description 2
- MHOVAHRLVXNVSD-UHFFFAOYSA-N rhodium atom Chemical compound [Rh] MHOVAHRLVXNVSD-UHFFFAOYSA-N 0.000 description 2
- 239000002336 ribonucleotide Substances 0.000 description 2
- 125000002652 ribonucleotide group Chemical group 0.000 description 2
- 230000035945 sensitivity Effects 0.000 description 2
- 201000005113 shigellosis Diseases 0.000 description 2
- 230000011664 signaling Effects 0.000 description 2
- 238000001542 size-exclusion chromatography Methods 0.000 description 2
- 201000002612 sleeping sickness Diseases 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 238000009168 stem cell therapy Methods 0.000 description 2
- 238000009580 stem-cell therapy Methods 0.000 description 2
- 208000008467 subacute bacterial endocarditis Diseases 0.000 description 2
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 239000003826 tablet Substances 0.000 description 2
- 208000004441 taeniasis Diseases 0.000 description 2
- 201000003120 testicular cancer Diseases 0.000 description 2
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 2
- 230000008646 thermal stress Effects 0.000 description 2
- 238000000015 thermotherapy Methods 0.000 description 2
- 208000008732 thymoma Diseases 0.000 description 2
- 201000004647 tinea pedis Diseases 0.000 description 2
- 201000005882 tinea unguium Diseases 0.000 description 2
- 238000003146 transient transfection Methods 0.000 description 2
- 230000007704 transition Effects 0.000 description 2
- 238000002054 transplantation Methods 0.000 description 2
- 230000032258 transport Effects 0.000 description 2
- 238000011277 treatment modality Methods 0.000 description 2
- 229950007217 tremelimumab Drugs 0.000 description 2
- 208000009920 trichuriasis Diseases 0.000 description 2
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 2
- 229910052722 tritium Inorganic materials 0.000 description 2
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 208000018417 undifferentiated high grade pleomorphic sarcoma of bone Diseases 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 229940124676 vascular endothelial growth factor receptor Drugs 0.000 description 2
- 230000009385 viral infection Effects 0.000 description 2
- 230000003612 virological effect Effects 0.000 description 2
- 238000012800 visualization Methods 0.000 description 2
- 201000000752 white piedra Diseases 0.000 description 2
- LLXVXPPXELIDGQ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(2,5-dioxopyrrol-1-yl)benzoate Chemical compound C=1C=CC(N2C(C=CC2=O)=O)=CC=1C(=O)ON1C(=O)CCC1=O LLXVXPPXELIDGQ-UHFFFAOYSA-N 0.000 description 1
- NQUUPTGRJYIXSL-YPDXTJLXSA-N (2R)-3-[(3R)-1-[3-[2-[2-[2-[2-[2-[2-[2-[2-[3-[[(2S)-1-[[(2S)-1-[4-[[(6S,6aS)-3-[5-[[(6aS)-2-methoxy-8-methyl-11-oxo-6a,7-dihydropyrrolo[2,1-c][1,4]benzodiazepin-3-yl]oxy]pentoxy]-6-hydroxy-2-methoxy-8-methyl-11-oxo-6a,7-dihydro-6H-pyrrolo[2,1-c][1,4]benzodiazepine-5-carbonyl]oxymethyl]anilino]-1-oxopropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-3-oxopropoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethylamino]-3-oxopropyl]-2,5-dioxopyrrolidin-3-yl]sulfanyl-2-aminopropanoic acid Chemical compound COc1cc2c(cc1OCCCCCOc1cc3N([C@@H](O)[C@@H]4CC(C)=CN4C(=O)c3cc1OC)C(=O)OCc1ccc(NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)CCOCCOCCOCCOCCOCCOCCOCCOCCNC(=O)CCN3C(=O)C[C@@H](SC[C@H](N)C(O)=O)C3=O)C(C)C)cc1)N=C[C@@H]1CC(C)=CN1C2=O NQUUPTGRJYIXSL-YPDXTJLXSA-N 0.000 description 1
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- MFZSNESUTRVBQX-XEURHVNRSA-N (2S)-2-amino-6-[4-[[3-[[(2S)-1-[[(1S,2R,3S,5S,6S,16E,18E,20R,21S)-11-chloro-21-hydroxy-12,20-dimethoxy-2,5,9,16-tetramethyl-8,23-dioxo-4,24-dioxa-9,22-diazatetracyclo[19.3.1.110,14.03,5]hexacosa-10,12,14(26),16,18-pentaen-6-yl]oxy]-1-oxopropan-2-yl]-methylamino]-3-oxopropyl]disulfanyl]pentanoylamino]hexanoic acid Chemical compound CO[C@@H]1\C=C\C=C(C)\Cc2cc(OC)c(Cl)c(c2)N(C)C(=O)C[C@H](OC(=O)[C@H](C)N(C)C(=O)CCSSC(C)CCC(=O)NCCCC[C@H](N)C(O)=O)[C@]2(C)O[C@H]2[C@H](C)[C@@H]2C[C@@]1(O)NC(=O)O2 MFZSNESUTRVBQX-XEURHVNRSA-N 0.000 description 1
- FOIAQXXUVRINCI-LBAQZLPGSA-N (2S)-2-amino-6-[[4-[2-[bis(carboxymethyl)amino]-3-[2-[bis(carboxymethyl)amino]ethyl-(carboxymethyl)amino]propyl]phenyl]carbamothioylamino]hexanoic acid Chemical compound N[C@@H](CCCCNC(=S)Nc1ccc(CC(CN(CCN(CC(O)=O)CC(O)=O)CC(O)=O)N(CC(O)=O)CC(O)=O)cc1)C(O)=O FOIAQXXUVRINCI-LBAQZLPGSA-N 0.000 description 1
- ZMEWRPBAQVSBBB-GOTSBHOMSA-N (2s)-2-[[(2s)-2-[(2-aminoacetyl)amino]-3-(4-hydroxyphenyl)propanoyl]amino]-6-[[2-[2-[2-[bis(carboxymethyl)amino]ethyl-(carboxymethyl)amino]ethyl-(carboxymethyl)amino]acetyl]amino]hexanoic acid Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CCN(CC(O)=O)CC(=O)NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)CN)CC1=CC=C(O)C=C1 ZMEWRPBAQVSBBB-GOTSBHOMSA-N 0.000 description 1
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 1
- LPAUOXUZGSBGDU-ULCCENQXSA-N (5z)-5-[[3-chloro-4-[(2r)-2,3-dihydroxypropoxy]phenyl]methylidene]-3-(2-methylphenyl)-2-propylimino-1,3-thiazolidin-4-one Chemical compound O=C1N(C=2C(=CC=CC=2)C)C(=NCCC)S\C1=C/C1=CC=C(OC[C@H](O)CO)C(Cl)=C1 LPAUOXUZGSBGDU-ULCCENQXSA-N 0.000 description 1
- TZCPCKNHXULUIY-RGULYWFUSA-N 1,2-distearoyl-sn-glycero-3-phosphoserine Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(=O)OC[C@H](N)C(O)=O)OC(=O)CCCCCCCCCCCCCCCCC TZCPCKNHXULUIY-RGULYWFUSA-N 0.000 description 1
- ZOHXWSHGANNQGO-DSIKUUPMSA-N 1-amino-4-[[5-[[(2S)-1-[[(1S,2R,3S,5S,6S,16E,18E,20R,21S)-11-chloro-21-hydroxy-12,20-dimethoxy-2,5,9,16-tetramethyl-8,23-dioxo-4,24-dioxa-9,22-diazatetracyclo[19.3.1.110,14.03,5]hexacosa-10,12,14(26),16,18-pentaen-6-yl]oxy]-1-oxopropan-2-yl]-methylamino]-2-methyl-5-oxopentan-2-yl]disulfanyl]-1-oxobutane-2-sulfonic acid Chemical compound CO[C@@H]([C@@]1(O)C[C@H](OC(=O)N1)[C@@H](C)[C@@H]1O[C@@]1(C)[C@@H](OC(=O)[C@H](C)N(C)C(=O)CCC(C)(C)SSCCC(C(N)=O)S(O)(=O)=O)CC(=O)N1C)\C=C\C=C(C)\CC2=CC(OC)=C(Cl)C1=C2 ZOHXWSHGANNQGO-DSIKUUPMSA-N 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- RTQWWZBSTRGEAV-PKHIMPSTSA-N 2-[[(2s)-2-[bis(carboxymethyl)amino]-3-[4-(methylcarbamoylamino)phenyl]propyl]-[2-[bis(carboxymethyl)amino]propyl]amino]acetic acid Chemical compound CNC(=O)NC1=CC=C(C[C@@H](CN(CC(C)N(CC(O)=O)CC(O)=O)CC(O)=O)N(CC(O)=O)CC(O)=O)C=C1 RTQWWZBSTRGEAV-PKHIMPSTSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 108010068327 4-hydroxyphenylpyruvate dioxygenase Proteins 0.000 description 1
- MJZJYWCQPMNPRM-UHFFFAOYSA-N 6,6-dimethyl-1-[3-(2,4,5-trichlorophenoxy)propoxy]-1,6-dihydro-1,3,5-triazine-2,4-diamine Chemical compound CC1(C)N=C(N)N=C(N)N1OCCCOC1=CC(Cl)=C(Cl)C=C1Cl MJZJYWCQPMNPRM-UHFFFAOYSA-N 0.000 description 1
- CJIJXIFQYOPWTF-UHFFFAOYSA-N 7-hydroxycoumarin Natural products O1C(=O)C=CC2=CC(O)=CC=C21 CJIJXIFQYOPWTF-UHFFFAOYSA-N 0.000 description 1
- 230000035502 ADME Effects 0.000 description 1
- 102000000074 ADP-ribosyl Cyclase Human genes 0.000 description 1
- 108010080394 ADP-ribosyl Cyclase Proteins 0.000 description 1
- 102100031585 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Human genes 0.000 description 1
- 208000002008 AIDS-Related Lymphoma Diseases 0.000 description 1
- 108010009522 AMG623 peptibody Proteins 0.000 description 1
- 206010063409 Acarodermatitis Diseases 0.000 description 1
- 108010022752 Acetylcholinesterase Proteins 0.000 description 1
- 102000012440 Acetylcholinesterase Human genes 0.000 description 1
- 208000034950 Acinetobacter Infections Diseases 0.000 description 1
- 208000029329 Acinetobacter infectious disease Diseases 0.000 description 1
- 241000511654 Actinomyces gerencseriae Species 0.000 description 1
- 241000186041 Actinomyces israelii Species 0.000 description 1
- 241000251468 Actinopterygii Species 0.000 description 1
- 102100027647 Activin receptor type-2B Human genes 0.000 description 1
- 108010059616 Activins Proteins 0.000 description 1
- 102000005606 Activins Human genes 0.000 description 1
- 208000026872 Addison Disease Diseases 0.000 description 1
- 108010000239 Aequorin Proteins 0.000 description 1
- 208000008190 Agammaglobulinemia Diseases 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 102100035248 Alpha-(1,3)-fucosyltransferase 4 Human genes 0.000 description 1
- 102100023635 Alpha-fetoprotein Human genes 0.000 description 1
- 241000710929 Alphavirus Species 0.000 description 1
- 208000004881 Amebiasis Diseases 0.000 description 1
- 208000003829 American Hemorrhagic Fever Diseases 0.000 description 1
- 206010001980 Amoebiasis Diseases 0.000 description 1
- 206010061424 Anal cancer Diseases 0.000 description 1
- 241000606646 Anaplasma Species 0.000 description 1
- 241000605281 Anaplasma phagocytophilum Species 0.000 description 1
- 241001511271 Ancylostoma braziliense Species 0.000 description 1
- 241000498253 Ancylostoma duodenale Species 0.000 description 1
- 201000002045 Ancylostomiasis Diseases 0.000 description 1
- 102100034608 Angiopoietin-2 Human genes 0.000 description 1
- 108010048036 Angiopoietin-2 Proteins 0.000 description 1
- 102100025665 Angiopoietin-related protein 1 Human genes 0.000 description 1
- 108010009906 Angiopoietins Proteins 0.000 description 1
- 102000009840 Angiopoietins Human genes 0.000 description 1
- 241000243791 Angiostrongylus Species 0.000 description 1
- 241000244023 Anisakis Species 0.000 description 1
- 206010002556 Ankylosing Spondylitis Diseases 0.000 description 1
- 208000033211 Ankylostomiasis Diseases 0.000 description 1
- 208000007860 Anus Neoplasms Diseases 0.000 description 1
- 206010073360 Appendix cancer Diseases 0.000 description 1
- 101100067974 Arabidopsis thaliana POP2 gene Proteins 0.000 description 1
- 201000009695 Argentine hemorrhagic fever Diseases 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 206010003267 Arthritis reactive Diseases 0.000 description 1
- 208000008715 Ascaridida Infections Diseases 0.000 description 1
- 241000244185 Ascaris lumbricoides Species 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 201000002909 Aspergillosis Diseases 0.000 description 1
- 241000228212 Aspergillus Species 0.000 description 1
- 208000036641 Aspergillus infections Diseases 0.000 description 1
- 241001533362 Astroviridae Species 0.000 description 1
- 206010003827 Autoimmune hepatitis Diseases 0.000 description 1
- 208000031212 Autoimmune polyendocrinopathy Diseases 0.000 description 1
- 208000022106 Autoimmune polyendocrinopathy type 2 Diseases 0.000 description 1
- 102100027203 B-cell antigen receptor complex-associated protein beta chain Human genes 0.000 description 1
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 1
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 1
- 206010055181 BK virus infection Diseases 0.000 description 1
- 241000223836 Babesia Species 0.000 description 1
- 241000193830 Bacillus <bacterium> Species 0.000 description 1
- 241000193755 Bacillus cereus Species 0.000 description 1
- 206010060976 Bacillus infection Diseases 0.000 description 1
- 201000001178 Bacterial Pneumonia Diseases 0.000 description 1
- 241000606125 Bacteroides Species 0.000 description 1
- 208000034974 Bacteroides Infections Diseases 0.000 description 1
- 241001235572 Balantioides coli Species 0.000 description 1
- 241000606660 Bartonella Species 0.000 description 1
- 241000606685 Bartonella bacilliformis Species 0.000 description 1
- 241001518086 Bartonella henselae Species 0.000 description 1
- 206010004146 Basal cell carcinoma Diseases 0.000 description 1
- 208000023328 Basedow disease Diseases 0.000 description 1
- 108010064528 Basigin Proteins 0.000 description 1
- 241001448491 Batrachochytrium Species 0.000 description 1
- 241000244181 Baylisascaris Species 0.000 description 1
- 208000009137 Behcet syndrome Diseases 0.000 description 1
- 102100026189 Beta-galactosidase Human genes 0.000 description 1
- 206010004593 Bile duct cancer Diseases 0.000 description 1
- 208000008439 Biliary Liver Cirrhosis Diseases 0.000 description 1
- 208000033222 Biliary cirrhosis primary Diseases 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 241000726108 Blastocystis Species 0.000 description 1
- 241000228405 Blastomyces dermatitidis Species 0.000 description 1
- 206010005913 Body tinea Diseases 0.000 description 1
- 208000034200 Bolivian hemorrhagic fever Diseases 0.000 description 1
- 206010005949 Bone cancer Diseases 0.000 description 1
- 208000018084 Bone neoplasm Diseases 0.000 description 1
- 241000588832 Bordetella pertussis Species 0.000 description 1
- 241000589968 Borrelia Species 0.000 description 1
- 241000589978 Borrelia hermsii Species 0.000 description 1
- 241000180135 Borrelia recurrentis Species 0.000 description 1
- 241001148604 Borreliella afzelii Species 0.000 description 1
- 241000589969 Borreliella burgdorferi Species 0.000 description 1
- 241001148605 Borreliella garinii Species 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 241000701822 Bovine papillomavirus Species 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 206010006143 Brain stem glioma Diseases 0.000 description 1
- 201000010424 Brazilian hemorrhagic fever Diseases 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 241000589562 Brucella Species 0.000 description 1
- 206010006500 Brucellosis Diseases 0.000 description 1
- 241000244038 Brugia malayi Species 0.000 description 1
- 241001453380 Burkholderia Species 0.000 description 1
- 241000589513 Burkholderia cepacia Species 0.000 description 1
- 206010073031 Burkholderia infection Diseases 0.000 description 1
- 241000722910 Burkholderia mallei Species 0.000 description 1
- 206010069747 Burkholderia mallei infection Diseases 0.000 description 1
- 241001136175 Burkholderia pseudomallei Species 0.000 description 1
- 206010069748 Burkholderia pseudomallei infection Diseases 0.000 description 1
- 208000006448 Buruli Ulcer Diseases 0.000 description 1
- 208000023081 Buruli ulcer disease Diseases 0.000 description 1
- 102100031151 C-C chemokine receptor type 2 Human genes 0.000 description 1
- 101710149815 C-C chemokine receptor type 2 Proteins 0.000 description 1
- 101710149863 C-C chemokine receptor type 4 Proteins 0.000 description 1
- 102100035875 C-C chemokine receptor type 5 Human genes 0.000 description 1
- 101710149870 C-C chemokine receptor type 5 Proteins 0.000 description 1
- 102100021943 C-C motif chemokine 2 Human genes 0.000 description 1
- 101710155857 C-C motif chemokine 2 Proteins 0.000 description 1
- 108090000342 C-Type Lectins Proteins 0.000 description 1
- 102000003930 C-Type Lectins Human genes 0.000 description 1
- 102100031650 C-X-C chemokine receptor type 4 Human genes 0.000 description 1
- 101710082513 C-X-C chemokine receptor type 4 Proteins 0.000 description 1
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 1
- 102100024217 CAMPATH-1 antigen Human genes 0.000 description 1
- 102100031168 CCN family member 2 Human genes 0.000 description 1
- 102100032976 CCR4-NOT transcription complex subunit 6 Human genes 0.000 description 1
- 102100027207 CD27 antigen Human genes 0.000 description 1
- 101150013553 CD40 gene Proteins 0.000 description 1
- 102100032912 CD44 antigen Human genes 0.000 description 1
- 108010065524 CD52 Antigen Proteins 0.000 description 1
- 102100025221 CD70 antigen Human genes 0.000 description 1
- 201000003274 CINCA syndrome Diseases 0.000 description 1
- 108010077360 CNTO 530 Proteins 0.000 description 1
- 201000002829 CREST Syndrome Diseases 0.000 description 1
- 102000055006 Calcitonin Human genes 0.000 description 1
- 102100038518 Calcitonin Human genes 0.000 description 1
- 108060001064 Calcitonin Proteins 0.000 description 1
- 108090000932 Calcitonin Gene-Related Peptide Proteins 0.000 description 1
- 241000714198 Caliciviridae Species 0.000 description 1
- 208000006339 Caliciviridae Infections Diseases 0.000 description 1
- 241000589876 Campylobacter Species 0.000 description 1
- 206010051226 Campylobacter infection Diseases 0.000 description 1
- 241000222120 Candida <Saccharomycetales> Species 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 241000467053 Capillaria aerophila Species 0.000 description 1
- 241000472096 Capillaria hepatica Species 0.000 description 1
- 206010007187 Capillariasis Diseases 0.000 description 1
- 108090000565 Capsid Proteins Proteins 0.000 description 1
- 206010007275 Carcinoid tumour Diseases 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 102000013602 Cardiac Myosins Human genes 0.000 description 1
- 108010051609 Cardiac Myosins Proteins 0.000 description 1
- 208000028737 Carrion disease Diseases 0.000 description 1
- 208000003732 Cat-scratch disease Diseases 0.000 description 1
- 241000700198 Cavia Species 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 206010007882 Cellulitis Diseases 0.000 description 1
- 208000037138 Central nervous system embryonal tumor Diseases 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 108010082548 Chemokine CCL11 Proteins 0.000 description 1
- 201000006082 Chickenpox Diseases 0.000 description 1
- 201000009182 Chikungunya Diseases 0.000 description 1
- 241000606161 Chlamydia Species 0.000 description 1
- 241001647378 Chlamydia psittaci Species 0.000 description 1
- ZAMOUSCENKQFHK-UHFFFAOYSA-N Chlorine atom Chemical compound [Cl] ZAMOUSCENKQFHK-UHFFFAOYSA-N 0.000 description 1
- 206010008609 Cholangitis sclerosing Diseases 0.000 description 1
- 206010008631 Cholera Diseases 0.000 description 1
- 241000251730 Chondrichthyes Species 0.000 description 1
- 201000009047 Chordoma Diseases 0.000 description 1
- 206010008761 Choriomeningitis lymphocytic Diseases 0.000 description 1
- VYZAMTAEIAYCRO-BJUDXGSMSA-N Chromium-51 Chemical compound [51Cr] VYZAMTAEIAYCRO-BJUDXGSMSA-N 0.000 description 1
- 206010008803 Chromoblastomycosis Diseases 0.000 description 1
- 208000015116 Chromomycosis Diseases 0.000 description 1
- NYNKCGWJPNZJMI-UHFFFAOYSA-N Clebopride malate Chemical compound [O-]C(=O)C(O)CC(O)=O.COC1=CC(N)=C(Cl)C=C1C(=O)NC1CC[NH+](CC=2C=CC=CC=2)CC1 NYNKCGWJPNZJMI-UHFFFAOYSA-N 0.000 description 1
- 206010009344 Clonorchiasis Diseases 0.000 description 1
- 241001327965 Clonorchis sinensis Species 0.000 description 1
- 241001112695 Clostridiales Species 0.000 description 1
- 241000193403 Clostridium Species 0.000 description 1
- 241000193155 Clostridium botulinum Species 0.000 description 1
- 206010009657 Clostridium difficile colitis Diseases 0.000 description 1
- 241000193449 Clostridium tetani Species 0.000 description 1
- 101710198480 Clumping factor A Proteins 0.000 description 1
- 102100026735 Coagulation factor VIII Human genes 0.000 description 1
- 208000015943 Coeliac disease Diseases 0.000 description 1
- 208000010007 Cogan syndrome Diseases 0.000 description 1
- 208000011038 Cold agglutinin disease Diseases 0.000 description 1
- 206010009868 Cold type haemolytic anaemia Diseases 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 102000000989 Complement System Proteins Human genes 0.000 description 1
- 108010069112 Complement System Proteins Proteins 0.000 description 1
- 102100035436 Complement factor D Human genes 0.000 description 1
- 208000013586 Complex regional pain syndrome type 1 Diseases 0.000 description 1
- RYGMFSIKBFXOCR-UHFFFAOYSA-N Copper Chemical compound [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 description 1
- 241000711573 Coronaviridae Species 0.000 description 1
- 241000186227 Corynebacterium diphtheriae Species 0.000 description 1
- 241000606678 Coxiella burnetii Species 0.000 description 1
- 206010011258 Coxsackie myocarditis Diseases 0.000 description 1
- 241000150230 Crimean-Congo hemorrhagic fever orthonairovirus Species 0.000 description 1
- 208000011231 Crohn disease Diseases 0.000 description 1
- 239000004971 Cross linker Substances 0.000 description 1
- 208000019707 Cryoglobulinemic vasculitis Diseases 0.000 description 1
- 208000008953 Cryptosporidiosis Diseases 0.000 description 1
- 206010011502 Cryptosporidiosis infection Diseases 0.000 description 1
- 241000223935 Cryptosporidium Species 0.000 description 1
- 241000016605 Cyclospora cayetanensis Species 0.000 description 1
- 206010061802 Cyclosporidium infection Diseases 0.000 description 1
- 201000000077 Cysticercosis Diseases 0.000 description 1
- 241000205707 Cystoisospora belli Species 0.000 description 1
- 108010015742 Cytochrome P-450 Enzyme System Proteins 0.000 description 1
- 102000003849 Cytochrome P450 Human genes 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 206010011831 Cytomegalovirus infection Diseases 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- SHZGCJCMOBCMKK-UHFFFAOYSA-N D-mannomethylose Natural products CC1OC(O)C(O)C(O)C1O SHZGCJCMOBCMKK-UHFFFAOYSA-N 0.000 description 1
- XPDXVDYUQZHFPV-UHFFFAOYSA-N Dansyl Chloride Chemical compound C1=CC=C2C(N(C)C)=CC=CC2=C1S(Cl)(=O)=O XPDXVDYUQZHFPV-UHFFFAOYSA-N 0.000 description 1
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 1
- 102100036466 Delta-like protein 3 Human genes 0.000 description 1
- 102100033553 Delta-like protein 4 Human genes 0.000 description 1
- 241000710829 Dengue virus group Species 0.000 description 1
- 201000004624 Dermatitis Diseases 0.000 description 1
- 206010012468 Dermatitis herpetiformis Diseases 0.000 description 1
- 241000305506 Desmodesmus Species 0.000 description 1
- 241000167176 Desmodesmus armatus Species 0.000 description 1
- 241000157306 Dientamoeba fragilis Species 0.000 description 1
- 102100025012 Dipeptidyl peptidase 4 Human genes 0.000 description 1
- 206010013029 Diphyllobothriasis Diseases 0.000 description 1
- 241001137876 Diphyllobothrium Species 0.000 description 1
- 241001319090 Dracunculus medinensis Species 0.000 description 1
- 102000001301 EGF receptor Human genes 0.000 description 1
- 101150029707 ERBB2 gene Proteins 0.000 description 1
- 241000710945 Eastern equine encephalitis virus Species 0.000 description 1
- 201000011001 Ebola Hemorrhagic Fever Diseases 0.000 description 1
- 208000030820 Ebola disease Diseases 0.000 description 1
- 206010014096 Echinococciasis Diseases 0.000 description 1
- 208000009366 Echinococcosis Diseases 0.000 description 1
- 241000244160 Echinococcus Species 0.000 description 1
- 241000605314 Ehrlichia Species 0.000 description 1
- 241000605310 Ehrlichia chaffeensis Species 0.000 description 1
- 241000605282 Ehrlichia ewingii Species 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 206010014611 Encephalitis venezuelan equine Diseases 0.000 description 1
- 102100037241 Endoglin Human genes 0.000 description 1
- 108010036395 Endoglin Proteins 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 201000009273 Endometriosis Diseases 0.000 description 1
- 102100038083 Endosialin Human genes 0.000 description 1
- 208000000966 Enoplida Infections Diseases 0.000 description 1
- 241000224432 Entamoeba histolytica Species 0.000 description 1
- 208000004232 Enteritis Diseases 0.000 description 1
- 241000588921 Enterobacteriaceae Species 0.000 description 1
- 241000498255 Enterobius vermicularis Species 0.000 description 1
- 241000991587 Enterovirus C Species 0.000 description 1
- 206010014909 Enterovirus infection Diseases 0.000 description 1
- 241000235577 Entomophthorales Species 0.000 description 1
- 206010014954 Eosinophilic fasciitis Diseases 0.000 description 1
- 102000050554 Eph Family Receptors Human genes 0.000 description 1
- 108091008815 Eph receptors Proteins 0.000 description 1
- 206010014979 Epidemic typhus Diseases 0.000 description 1
- 102100032031 Epidermal growth factor-like protein 7 Human genes 0.000 description 1
- 241001480036 Epidermophyton floccosum Species 0.000 description 1
- 108010066687 Epithelial Cell Adhesion Molecule Proteins 0.000 description 1
- 102000018651 Epithelial Cell Adhesion Molecule Human genes 0.000 description 1
- 208000007985 Erythema Infectiosum Diseases 0.000 description 1
- 206010015226 Erythema nodosum Diseases 0.000 description 1
- 241001646719 Escherichia coli O157:H7 Species 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- 229910052693 Europium Inorganic materials 0.000 description 1
- 208000004332 Evans syndrome Diseases 0.000 description 1
- 208000017259 Extragonadal germ cell tumor Diseases 0.000 description 1
- 108010076282 Factor IX Proteins 0.000 description 1
- 108010054218 Factor VIII Proteins 0.000 description 1
- 102000001690 Factor VIII Human genes 0.000 description 1
- 201000003542 Factor VIII deficiency Diseases 0.000 description 1
- 201000001342 Fallopian tube cancer Diseases 0.000 description 1
- 208000013452 Fallopian tube neoplasm Diseases 0.000 description 1
- 208000035690 Familial cold urticaria Diseases 0.000 description 1
- 241000204939 Fasciola gigantica Species 0.000 description 1
- 241000242711 Fasciola hepatica Species 0.000 description 1
- 241001126302 Fasciolopsis buski Species 0.000 description 1
- 101150050927 Fcgrt gene Proteins 0.000 description 1
- 102000009123 Fibrin Human genes 0.000 description 1
- 108010073385 Fibrin Proteins 0.000 description 1
- BWGVNKXGVNDBDI-UHFFFAOYSA-N Fibrin monomer Chemical compound CNC(=O)CNC(=O)CN BWGVNKXGVNDBDI-UHFFFAOYSA-N 0.000 description 1
- 208000001640 Fibromyalgia Diseases 0.000 description 1
- 102100037362 Fibronectin Human genes 0.000 description 1
- 108010067306 Fibronectins Proteins 0.000 description 1
- 206010053717 Fibrous histiocytoma Diseases 0.000 description 1
- 206010016675 Filariasis lymphatic Diseases 0.000 description 1
- 241000244009 Filarioidea Species 0.000 description 1
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 1
- 241000122864 Fonsecaea pedrosoi Species 0.000 description 1
- 206010016952 Food poisoning Diseases 0.000 description 1
- 208000019331 Foodborne disease Diseases 0.000 description 1
- 208000007212 Foot-and-Mouth Disease Diseases 0.000 description 1
- 241000710198 Foot-and-mouth disease virus Species 0.000 description 1
- 241000589602 Francisella tularensis Species 0.000 description 1
- 102000005698 Frizzled receptors Human genes 0.000 description 1
- 108010045438 Frizzled receptors Proteins 0.000 description 1
- PNNNRSAQSRJVSB-SLPGGIOYSA-N Fucose Natural products C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)C=O PNNNRSAQSRJVSB-SLPGGIOYSA-N 0.000 description 1
- 206010017533 Fungal infection Diseases 0.000 description 1
- 241000605909 Fusobacterium Species 0.000 description 1
- 206010017564 Fusobacterium infections Diseases 0.000 description 1
- 102100025101 GATA-type zinc finger protein 1 Human genes 0.000 description 1
- 208000022072 Gallbladder Neoplasms Diseases 0.000 description 1
- GYHNNYVSQQEPJS-OIOBTWANSA-N Gallium-67 Chemical compound [67Ga] GYHNNYVSQQEPJS-OIOBTWANSA-N 0.000 description 1
- 206010017915 Gastroenteritis shigella Diseases 0.000 description 1
- 206010017916 Gastroenteritis staphylococcal Diseases 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 201000003950 Geotrichosis Diseases 0.000 description 1
- 244000168141 Geotrichum candidum Species 0.000 description 1
- 235000017388 Geotrichum candidum Nutrition 0.000 description 1
- 241000224467 Giardia intestinalis Species 0.000 description 1
- 201000003641 Glanders Diseases 0.000 description 1
- 208000032612 Glial tumor Diseases 0.000 description 1
- 206010018338 Glioma Diseases 0.000 description 1
- 206010018364 Glomerulonephritis Diseases 0.000 description 1
- 102100040890 Glucagon receptor Human genes 0.000 description 1
- 108010015776 Glucose oxidase Proteins 0.000 description 1
- 239000004366 Glucose oxidase Substances 0.000 description 1
- 102000016354 Glucuronosyltransferase Human genes 0.000 description 1
- 108010092364 Glucuronosyltransferase Proteins 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- ZWZWYGMENQVNFU-UHFFFAOYSA-N Glycerophosphorylserin Natural products OC(=O)C(N)COP(O)(=O)OCC(O)CO ZWZWYGMENQVNFU-UHFFFAOYSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 102000010956 Glypican Human genes 0.000 description 1
- 108050001154 Glypican Proteins 0.000 description 1
- 108050007237 Glypican-3 Proteins 0.000 description 1
- 241000497087 Gnathostoma hispidum Species 0.000 description 1
- 241001276383 Gnathostoma spinigerum Species 0.000 description 1
- 208000000807 Gnathostomiasis Diseases 0.000 description 1
- 206010018612 Gonorrhoea Diseases 0.000 description 1
- 208000024869 Goodpasture syndrome Diseases 0.000 description 1
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 description 1
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 1
- 208000015023 Graves' disease Diseases 0.000 description 1
- 102000009465 Growth Factor Receptors Human genes 0.000 description 1
- 108010009202 Growth Factor Receptors Proteins 0.000 description 1
- 241000190708 Guanarito mammarenavirus Species 0.000 description 1
- 102100022662 Guanylyl cyclase C Human genes 0.000 description 1
- 208000035895 Guillain-Barré syndrome Diseases 0.000 description 1
- 102100030595 HLA class II histocompatibility antigen gamma chain Human genes 0.000 description 1
- 102000006354 HLA-DR Antigens Human genes 0.000 description 1
- 108010058597 HLA-DR Antigens Proteins 0.000 description 1
- 206010061190 Haemophilus infection Diseases 0.000 description 1
- 241000606768 Haemophilus influenzae Species 0.000 description 1
- 208000030836 Hashimoto thyroiditis Diseases 0.000 description 1
- 206010019263 Heart block congenital Diseases 0.000 description 1
- 102100034051 Heat shock protein HSP 90-alpha Human genes 0.000 description 1
- 206010019375 Helicobacter infections Diseases 0.000 description 1
- 241000590002 Helicobacter pylori Species 0.000 description 1
- 208000035186 Hemolytic Autoimmune Anemia Diseases 0.000 description 1
- 208000009292 Hemophilia A Diseases 0.000 description 1
- 241000711549 Hepacivirus C Species 0.000 description 1
- 208000005176 Hepatitis C Diseases 0.000 description 1
- 208000005331 Hepatitis D Diseases 0.000 description 1
- 241000724675 Hepatitis E virus Species 0.000 description 1
- 208000037262 Hepatitis delta Diseases 0.000 description 1
- 241000724709 Hepatitis delta virus Species 0.000 description 1
- 241000709721 Hepatovirus A Species 0.000 description 1
- 208000009889 Herpes Simplex Diseases 0.000 description 1
- 102100038030 High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor Human genes 0.000 description 1
- 101710136666 High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor Proteins 0.000 description 1
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 description 1
- 108091016366 Histone-lysine N-methyltransferase EHMT1 Proteins 0.000 description 1
- 108010033040 Histones Proteins 0.000 description 1
- 241000228404 Histoplasma capsulatum Species 0.000 description 1
- 201000002563 Histoplasmosis Diseases 0.000 description 1
- 101000777636 Homo sapiens ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Proteins 0.000 description 1
- 101000937269 Homo sapiens Activin receptor type-2B Proteins 0.000 description 1
- 101001022185 Homo sapiens Alpha-(1,3)-fucosyltransferase 4 Proteins 0.000 description 1
- 101000924727 Homo sapiens Alternative prion protein Proteins 0.000 description 1
- 101000914491 Homo sapiens B-cell antigen receptor complex-associated protein beta chain Proteins 0.000 description 1
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 1
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 1
- 101000798441 Homo sapiens Basigin Proteins 0.000 description 1
- 101000777550 Homo sapiens CCN family member 2 Proteins 0.000 description 1
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 description 1
- 101000868273 Homo sapiens CD44 antigen Proteins 0.000 description 1
- 101000934356 Homo sapiens CD70 antigen Proteins 0.000 description 1
- 101000911390 Homo sapiens Coagulation factor VIII Proteins 0.000 description 1
- 101000737554 Homo sapiens Complement factor D Proteins 0.000 description 1
- 101000928513 Homo sapiens Delta-like protein 3 Proteins 0.000 description 1
- 101000872077 Homo sapiens Delta-like protein 4 Proteins 0.000 description 1
- 101000908391 Homo sapiens Dipeptidyl peptidase 4 Proteins 0.000 description 1
- 101100118549 Homo sapiens EGFR gene Proteins 0.000 description 1
- 101000884275 Homo sapiens Endosialin Proteins 0.000 description 1
- 101000978392 Homo sapiens Eotaxin Proteins 0.000 description 1
- 101000921195 Homo sapiens Epidermal growth factor-like protein 7 Proteins 0.000 description 1
- 101001040075 Homo sapiens Glucagon receptor Proteins 0.000 description 1
- 101000899808 Homo sapiens Guanylyl cyclase C Proteins 0.000 description 1
- 101001082627 Homo sapiens HLA class II histocompatibility antigen gamma chain Proteins 0.000 description 1
- 101001016865 Homo sapiens Heat shock protein HSP 90-alpha Proteins 0.000 description 1
- 101000898034 Homo sapiens Hepatocyte growth factor Proteins 0.000 description 1
- 101000972946 Homo sapiens Hepatocyte growth factor receptor Proteins 0.000 description 1
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 description 1
- 101001019455 Homo sapiens ICOS ligand Proteins 0.000 description 1
- 101000878602 Homo sapiens Immunoglobulin alpha Fc receptor Proteins 0.000 description 1
- 101001055308 Homo sapiens Immunoglobulin heavy constant epsilon Proteins 0.000 description 1
- 101001034652 Homo sapiens Insulin-like growth factor 1 receptor Proteins 0.000 description 1
- 101001078133 Homo sapiens Integrin alpha-2 Proteins 0.000 description 1
- 101001078143 Homo sapiens Integrin alpha-IIb Proteins 0.000 description 1
- 101001046677 Homo sapiens Integrin alpha-V Proteins 0.000 description 1
- 101000599852 Homo sapiens Intercellular adhesion molecule 1 Proteins 0.000 description 1
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 1
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 1
- 101000852980 Homo sapiens Interleukin-23 subunit alpha Proteins 0.000 description 1
- 101001043821 Homo sapiens Interleukin-31 Proteins 0.000 description 1
- 101001043817 Homo sapiens Interleukin-31 receptor subunit alpha Proteins 0.000 description 1
- 101000960936 Homo sapiens Interleukin-5 receptor subunit alpha Proteins 0.000 description 1
- 101001076408 Homo sapiens Interleukin-6 Proteins 0.000 description 1
- 101001018097 Homo sapiens L-selectin Proteins 0.000 description 1
- 101000777628 Homo sapiens Leukocyte antigen CD37 Proteins 0.000 description 1
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- 101000764535 Homo sapiens Lymphotoxin-alpha Proteins 0.000 description 1
- 101001043352 Homo sapiens Lysyl oxidase homolog 2 Proteins 0.000 description 1
- 101000916644 Homo sapiens Macrophage colony-stimulating factor 1 receptor Proteins 0.000 description 1
- 101001106413 Homo sapiens Macrophage-stimulating protein receptor Proteins 0.000 description 1
- 101000573901 Homo sapiens Major prion protein Proteins 0.000 description 1
- 101000694615 Homo sapiens Membrane primary amine oxidase Proteins 0.000 description 1
- 101000576802 Homo sapiens Mesothelin Proteins 0.000 description 1
- 101000628547 Homo sapiens Metalloreductase STEAP1 Proteins 0.000 description 1
- 101000623901 Homo sapiens Mucin-16 Proteins 0.000 description 1
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 description 1
- 101001109508 Homo sapiens NKG2-A/NKG2-B type II integral membrane protein Proteins 0.000 description 1
- 101000581981 Homo sapiens Neural cell adhesion molecule 1 Proteins 0.000 description 1
- 101001098352 Homo sapiens OX-2 membrane glycoprotein Proteins 0.000 description 1
- 101000622137 Homo sapiens P-selectin Proteins 0.000 description 1
- 101001126417 Homo sapiens Platelet-derived growth factor receptor alpha Proteins 0.000 description 1
- 101000617725 Homo sapiens Pregnancy-specific beta-1-glycoprotein 2 Proteins 0.000 description 1
- 101000611936 Homo sapiens Programmed cell death protein 1 Proteins 0.000 description 1
- 101001098868 Homo sapiens Proprotein convertase subtilisin/kexin type 9 Proteins 0.000 description 1
- 101000727472 Homo sapiens Reticulon-4 Proteins 0.000 description 1
- 101000633784 Homo sapiens SLAM family member 7 Proteins 0.000 description 1
- 101000711796 Homo sapiens Sclerostin Proteins 0.000 description 1
- 101000884271 Homo sapiens Signal transducer CD24 Proteins 0.000 description 1
- 101000868152 Homo sapiens Son of sevenless homolog 1 Proteins 0.000 description 1
- 101000874179 Homo sapiens Syndecan-1 Proteins 0.000 description 1
- 101000934376 Homo sapiens T-cell differentiation antigen CD6 Proteins 0.000 description 1
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 description 1
- 101000934341 Homo sapiens T-cell surface glycoprotein CD5 Proteins 0.000 description 1
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 1
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 1
- 101000845170 Homo sapiens Thymic stromal lymphopoietin Proteins 0.000 description 1
- 101000904724 Homo sapiens Transmembrane glycoprotein NMB Proteins 0.000 description 1
- 101000611183 Homo sapiens Tumor necrosis factor Proteins 0.000 description 1
- 101000610605 Homo sapiens Tumor necrosis factor receptor superfamily member 10A Proteins 0.000 description 1
- 101000610604 Homo sapiens Tumor necrosis factor receptor superfamily member 10B Proteins 0.000 description 1
- 101000611023 Homo sapiens Tumor necrosis factor receptor superfamily member 6 Proteins 0.000 description 1
- 101000851018 Homo sapiens Vascular endothelial growth factor receptor 1 Proteins 0.000 description 1
- 206010020376 Hookworm infection Diseases 0.000 description 1
- 241000308514 Hortaea werneckii Species 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- 206010020429 Human ehrlichiosis Diseases 0.000 description 1
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 1
- 241000702617 Human parvovirus B19 Species 0.000 description 1
- 241000829111 Human polyomavirus 1 Species 0.000 description 1
- 102000004157 Hydrolases Human genes 0.000 description 1
- 108090000604 Hydrolases Proteins 0.000 description 1
- 241000244166 Hymenolepis diminuta Species 0.000 description 1
- 241001464384 Hymenolepis nana Species 0.000 description 1
- 206010020751 Hypersensitivity Diseases 0.000 description 1
- 206010020772 Hypertension Diseases 0.000 description 1
- 206010020983 Hypogammaglobulinaemia Diseases 0.000 description 1
- 206010021042 Hypopharyngeal cancer Diseases 0.000 description 1
- 206010056305 Hypopharyngeal neoplasm Diseases 0.000 description 1
- 102100034980 ICOS ligand Human genes 0.000 description 1
- 102000038455 IGF Type 1 Receptor Human genes 0.000 description 1
- 102000026633 IL6 Human genes 0.000 description 1
- 201000009794 Idiopathic Pulmonary Fibrosis Diseases 0.000 description 1
- 208000010159 IgA glomerulonephritis Diseases 0.000 description 1
- 206010021263 IgA nephropathy Diseases 0.000 description 1
- 208000021330 IgG4-related disease Diseases 0.000 description 1
- 208000014919 IgG4-related retroperitoneal fibrosis Diseases 0.000 description 1
- 208000031781 Immunoglobulin G4 related sclerosing disease Diseases 0.000 description 1
- 208000004187 Immunoglobulin G4-Related Disease Diseases 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 102000012745 Immunoglobulin Subunits Human genes 0.000 description 1
- 108010079585 Immunoglobulin Subunits Proteins 0.000 description 1
- 102100038005 Immunoglobulin alpha Fc receptor Human genes 0.000 description 1
- 102100026212 Immunoglobulin heavy constant epsilon Human genes 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 101900159346 Influenza A virus Hemagglutinin Proteins 0.000 description 1
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 description 1
- 102000004218 Insulin-Like Growth Factor I Human genes 0.000 description 1
- 102100025305 Integrin alpha-2 Human genes 0.000 description 1
- 102100032818 Integrin alpha-4 Human genes 0.000 description 1
- 102100022337 Integrin alpha-V Human genes 0.000 description 1
- 108010041012 Integrin alpha4 Proteins 0.000 description 1
- 108010042918 Integrin alpha5beta1 Proteins 0.000 description 1
- 108010047852 Integrin alphaVbeta3 Proteins 0.000 description 1
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 description 1
- 108010054267 Interferon Receptors Proteins 0.000 description 1
- 102000001617 Interferon Receptors Human genes 0.000 description 1
- 108010086140 Interferon alpha-beta Receptor Proteins 0.000 description 1
- 102000007438 Interferon alpha-beta Receptor Human genes 0.000 description 1
- 102100037850 Interferon gamma Human genes 0.000 description 1
- 102000006992 Interferon-alpha Human genes 0.000 description 1
- 108010047761 Interferon-alpha Proteins 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- 102100027268 Interferon-stimulated gene 20 kDa protein Human genes 0.000 description 1
- 102000000589 Interleukin-1 Human genes 0.000 description 1
- 108010002352 Interleukin-1 Proteins 0.000 description 1
- 102000019223 Interleukin-1 receptor Human genes 0.000 description 1
- 108050006617 Interleukin-1 receptor Proteins 0.000 description 1
- 102000013462 Interleukin-12 Human genes 0.000 description 1
- 108010065805 Interleukin-12 Proteins 0.000 description 1
- 102000003816 Interleukin-13 Human genes 0.000 description 1
- 108090000176 Interleukin-13 Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 102000000588 Interleukin-2 Human genes 0.000 description 1
- 108010038453 Interleukin-2 Receptors Proteins 0.000 description 1
- 102000010789 Interleukin-2 Receptors Human genes 0.000 description 1
- 102100030703 Interleukin-22 Human genes 0.000 description 1
- 108010065637 Interleukin-23 Proteins 0.000 description 1
- 102100021596 Interleukin-31 Human genes 0.000 description 1
- 102100021594 Interleukin-31 receptor subunit alpha Human genes 0.000 description 1
- 108010002616 Interleukin-5 Proteins 0.000 description 1
- 102000000743 Interleukin-5 Human genes 0.000 description 1
- 102100039881 Interleukin-5 receptor subunit alpha Human genes 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 108010002335 Interleukin-9 Proteins 0.000 description 1
- 206010022557 Intermediate uveitis Diseases 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- 241000701460 JC polyomavirus Species 0.000 description 1
- 241000712890 Junin mammarenavirus Species 0.000 description 1
- 208000003456 Juvenile Arthritis Diseases 0.000 description 1
- 206010059176 Juvenile idiopathic arthritis Diseases 0.000 description 1
- 102000001399 Kallikrein Human genes 0.000 description 1
- 108060005987 Kallikrein Proteins 0.000 description 1
- 208000008839 Kidney Neoplasms Diseases 0.000 description 1
- 241001534216 Klebsiella granulomatis Species 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- 108010092694 L-Selectin Proteins 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- SHZGCJCMOBCMKK-DHVFOXMCSA-N L-fucopyranose Chemical compound C[C@@H]1OC(O)[C@@H](O)[C@H](O)[C@@H]1O SHZGCJCMOBCMKK-DHVFOXMCSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- 239000012741 Laemmli sample buffer Substances 0.000 description 1
- 241000282852 Lama guanicoe Species 0.000 description 1
- 201000010743 Lambert-Eaton myasthenic syndrome Diseases 0.000 description 1
- 206010023825 Laryngeal cancer Diseases 0.000 description 1
- 206010023927 Lassa fever Diseases 0.000 description 1
- 241000712902 Lassa mammarenavirus Species 0.000 description 1
- 241000589242 Legionella pneumophila Species 0.000 description 1
- 241000222722 Leishmania <genus> Species 0.000 description 1
- 208000004554 Leishmaniasis Diseases 0.000 description 1
- 206010024229 Leprosy Diseases 0.000 description 1
- 241000589902 Leptospira Species 0.000 description 1
- 206010024238 Leptospirosis Diseases 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 102100031586 Leukocyte antigen CD37 Human genes 0.000 description 1
- 208000032514 Leukocytoclastic vasculitis Diseases 0.000 description 1
- 206010024434 Lichen sclerosus Diseases 0.000 description 1
- 206010061523 Lip and/or oral cavity cancer Diseases 0.000 description 1
- 241000186779 Listeria monocytogenes Species 0.000 description 1
- 206010024641 Listeriosis Diseases 0.000 description 1
- 101001089108 Lotus tetragonolobus Anti-H(O) lectin Proteins 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 1
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 1
- 208000037263 Lymphatic filariasis Diseases 0.000 description 1
- 206010025312 Lymphoma AIDS related Diseases 0.000 description 1
- 102100026238 Lymphotoxin-alpha Human genes 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 102100021948 Lysyl oxidase homolog 2 Human genes 0.000 description 1
- 102000043129 MHC class I family Human genes 0.000 description 1
- 108091054437 MHC class I family Proteins 0.000 description 1
- 102000034655 MIF Human genes 0.000 description 1
- 108060004872 MIF Proteins 0.000 description 1
- 241000282567 Macaca fascicularis Species 0.000 description 1
- 241000712898 Machupo mammarenavirus Species 0.000 description 1
- 102100028198 Macrophage colony-stimulating factor 1 receptor Human genes 0.000 description 1
- 102100021435 Macrophage-stimulating protein receptor Human genes 0.000 description 1
- 241000555676 Malassezia Species 0.000 description 1
- 208000004059 Male Breast Neoplasms Diseases 0.000 description 1
- 208000006644 Malignant Fibrous Histiocytoma Diseases 0.000 description 1
- 208000032271 Malignant tumor of penis Diseases 0.000 description 1
- 241001115401 Marburgvirus Species 0.000 description 1
- 201000005505 Measles Diseases 0.000 description 1
- 101710132836 Membrane primary amine oxidase Proteins 0.000 description 1
- 208000027530 Meniere disease Diseases 0.000 description 1
- 201000009906 Meningitis Diseases 0.000 description 1
- 102000003735 Mesothelin Human genes 0.000 description 1
- 108090000015 Mesothelin Proteins 0.000 description 1
- 102100025096 Mesothelin Human genes 0.000 description 1
- 206010027406 Mesothelioma Diseases 0.000 description 1
- 241001660197 Metagonimus Species 0.000 description 1
- 102100026712 Metalloreductase STEAP1 Human genes 0.000 description 1
- 206010066226 Metapneumovirus infection Diseases 0.000 description 1
- 241000736262 Microbiota Species 0.000 description 1
- 241000243190 Microsporidia Species 0.000 description 1
- 201000000090 Microsporidiosis Diseases 0.000 description 1
- 241000127282 Middle East respiratory syndrome-related coronavirus Species 0.000 description 1
- 206010049567 Miller Fisher syndrome Diseases 0.000 description 1
- 241000700627 Monkeypox virus Species 0.000 description 1
- 206010060880 Monoclonal gammopathy Diseases 0.000 description 1
- 208000024599 Mooren ulcer Diseases 0.000 description 1
- 241000713333 Mouse mammary tumor virus Species 0.000 description 1
- 108010008707 Mucin-1 Proteins 0.000 description 1
- 102100023123 Mucin-16 Human genes 0.000 description 1
- 102000015728 Mucins Human genes 0.000 description 1
- 108010063954 Mucins Proteins 0.000 description 1
- 201000002795 Muckle-Wells syndrome Diseases 0.000 description 1
- 241000235388 Mucorales Species 0.000 description 1
- 208000012192 Mucous membrane pemphigoid Diseases 0.000 description 1
- 208000034578 Multiple myelomas Diseases 0.000 description 1
- 208000005647 Mumps Diseases 0.000 description 1
- 241000711386 Mumps virus Species 0.000 description 1
- 241000238367 Mya arenaria Species 0.000 description 1
- 241000041810 Mycetoma Species 0.000 description 1
- 241000186362 Mycobacterium leprae Species 0.000 description 1
- 241000178382 Mycobacterium lepromatosis Species 0.000 description 1
- 241000187479 Mycobacterium tuberculosis Species 0.000 description 1
- 241000187917 Mycobacterium ulcerans Species 0.000 description 1
- 206010066289 Mycobacterium ulcerans infection Diseases 0.000 description 1
- 208000001572 Mycoplasma Pneumonia Diseases 0.000 description 1
- 241000202934 Mycoplasma pneumoniae Species 0.000 description 1
- 201000008235 Mycoplasma pneumoniae pneumonia Diseases 0.000 description 1
- 208000031888 Mycoses Diseases 0.000 description 1
- 108010013731 Myelin-Associated Glycoprotein Proteins 0.000 description 1
- 102100021831 Myelin-associated glycoprotein Human genes 0.000 description 1
- 201000003793 Myelodysplastic syndrome Diseases 0.000 description 1
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 description 1
- 208000006123 Myiasis Diseases 0.000 description 1
- 201000002481 Myositis Diseases 0.000 description 1
- QPCDCPDFJACHGM-UHFFFAOYSA-N N,N-bis{2-[bis(carboxymethyl)amino]ethyl}glycine Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(=O)O)CCN(CC(O)=O)CC(O)=O QPCDCPDFJACHGM-UHFFFAOYSA-N 0.000 description 1
- OVRNDRQMDRJTHS-UHFFFAOYSA-N N-acelyl-D-glucosamine Natural products CC(=O)NC1C(O)OC(CO)C(O)C1O OVRNDRQMDRJTHS-UHFFFAOYSA-N 0.000 description 1
- BKAYIFDRRZZKNF-VIFPVBQESA-N N-acetylcarnosine Chemical compound CC(=O)NCCC(=O)N[C@H](C(O)=O)CC1=CN=CN1 BKAYIFDRRZZKNF-VIFPVBQESA-N 0.000 description 1
- MBLBDJOUHNCFQT-LXGUWJNJSA-N N-acetylglucosamine Natural products CC(=O)N[C@@H](C=O)[C@@H](O)[C@H](O)[C@H](O)CO MBLBDJOUHNCFQT-LXGUWJNJSA-N 0.000 description 1
- SUHQNCLNRUAGOO-UHFFFAOYSA-N N-glycoloyl-neuraminic acid Natural products OCC(O)C(O)C(O)C(NC(=O)CO)C(O)CC(=O)C(O)=O SUHQNCLNRUAGOO-UHFFFAOYSA-N 0.000 description 1
- FDJKUWYYUZCUJX-UHFFFAOYSA-N N-glycolyl-beta-neuraminic acid Natural products OCC(O)C(O)C1OC(O)(C(O)=O)CC(O)C1NC(=O)CO FDJKUWYYUZCUJX-UHFFFAOYSA-N 0.000 description 1
- FDJKUWYYUZCUJX-KVNVFURPSA-N N-glycolylneuraminic acid Chemical compound OC[C@H](O)[C@H](O)[C@@H]1O[C@](O)(C(O)=O)C[C@H](O)[C@H]1NC(=O)CO FDJKUWYYUZCUJX-KVNVFURPSA-N 0.000 description 1
- 230000004988 N-glycosylation Effects 0.000 description 1
- 102100022682 NKG2-A/NKG2-B type II integral membrane protein Human genes 0.000 description 1
- 241000224438 Naegleria fowleri Species 0.000 description 1
- 208000001894 Nasopharyngeal Neoplasms Diseases 0.000 description 1
- 206010061306 Nasopharyngeal cancer Diseases 0.000 description 1
- 241000498270 Necator americanus Species 0.000 description 1
- 241000588650 Neisseria meningitidis Species 0.000 description 1
- 208000012902 Nervous system disease Diseases 0.000 description 1
- 102100027347 Neural cell adhesion molecule 1 Human genes 0.000 description 1
- 206010029260 Neuroblastoma Diseases 0.000 description 1
- 208000033383 Neuroendocrine tumor of pancreas Diseases 0.000 description 1
- 102100023181 Neurogenic locus notch homolog protein 1 Human genes 0.000 description 1
- 108700037638 Neurogenic locus notch homolog protein 1 Proteins 0.000 description 1
- 206010071579 Neuronal neuropathy Diseases 0.000 description 1
- 108090000772 Neuropilin-1 Proteins 0.000 description 1
- 206010029443 Nocardia Infections Diseases 0.000 description 1
- 206010029444 Nocardiosis Diseases 0.000 description 1
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 1
- 241001263478 Norovirus Species 0.000 description 1
- 102000005650 Notch Receptors Human genes 0.000 description 1
- 108010070047 Notch Receptors Proteins 0.000 description 1
- 108091005461 Nucleic proteins Chemical group 0.000 description 1
- 102100037589 OX-2 membrane glycoprotein Human genes 0.000 description 1
- 206010030113 Oedema Diseases 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 208000000160 Olfactory Esthesioneuroblastoma Diseases 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 241001324821 Opisthorchis felineus Species 0.000 description 1
- 241000242726 Opisthorchis viverrini Species 0.000 description 1
- 208000003435 Optic Neuritis Diseases 0.000 description 1
- 208000007027 Oral Candidiasis Diseases 0.000 description 1
- 206010031096 Oropharyngeal cancer Diseases 0.000 description 1
- 206010057444 Oropharyngeal neoplasm Diseases 0.000 description 1
- 208000010598 Oroya fever Diseases 0.000 description 1
- 241000712464 Orthomyxoviridae Species 0.000 description 1
- 108010077077 Osteonectin Proteins 0.000 description 1
- 102000009890 Osteonectin Human genes 0.000 description 1
- 208000007571 Ovarian Epithelial Carcinoma Diseases 0.000 description 1
- CBENFWSGALASAD-UHFFFAOYSA-N Ozone Chemical compound [O-][O+]=O CBENFWSGALASAD-UHFFFAOYSA-N 0.000 description 1
- 102100023472 P-selectin Human genes 0.000 description 1
- 108091008606 PDGF receptors Proteins 0.000 description 1
- 206010053869 POEMS syndrome Diseases 0.000 description 1
- 238000009193 PUVA therapy Methods 0.000 description 1
- 208000002193 Pain Diseases 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 206010067517 Pancreatic neuroendocrine tumour Diseases 0.000 description 1
- 241000593811 Paracapillaria philippinensis Species 0.000 description 1
- 241000526686 Paracoccidioides brasiliensis Species 0.000 description 1
- 206010033767 Paracoccidioides infections Diseases 0.000 description 1
- 201000000301 Paracoccidioidomycosis Diseases 0.000 description 1
- 206010061332 Paraganglion neoplasm Diseases 0.000 description 1
- 241001480233 Paragonimus Species 0.000 description 1
- 241001480234 Paragonimus westermani Species 0.000 description 1
- 208000002774 Paraproteinemias Diseases 0.000 description 1
- 208000000821 Parathyroid Neoplasms Diseases 0.000 description 1
- 208000004788 Pars Planitis Diseases 0.000 description 1
- 241000606860 Pasteurella Species 0.000 description 1
- 206010034107 Pasteurella infections Diseases 0.000 description 1
- 101150071746 Pbsn gene Proteins 0.000 description 1
- 241000517324 Pediculidae Species 0.000 description 1
- 201000000376 Pediculus humanus capitis infestation Diseases 0.000 description 1
- 241000517306 Pediculus humanus corporis Species 0.000 description 1
- 241000721454 Pemphigus Species 0.000 description 1
- 208000002471 Penile Neoplasms Diseases 0.000 description 1
- 206010034299 Penile cancer Diseases 0.000 description 1
- 241000150350 Peribunyaviridae Species 0.000 description 1
- 208000009565 Pharyngeal Neoplasms Diseases 0.000 description 1
- 206010034811 Pharyngeal cancer Diseases 0.000 description 1
- 241001674048 Phthiraptera Species 0.000 description 1
- 208000007913 Pituitary Neoplasms Diseases 0.000 description 1
- 208000000766 Pityriasis Lichenoides Diseases 0.000 description 1
- 206010048895 Pityriasis lichenoides et varioliformis acuta Diseases 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 241000224016 Plasmodium Species 0.000 description 1
- 108010022425 Platelet Glycoprotein GPIIb-IIIa Complex Proteins 0.000 description 1
- 108010035030 Platelet Membrane Glycoprotein IIb Proteins 0.000 description 1
- 102100030485 Platelet-derived growth factor receptor alpha Human genes 0.000 description 1
- 102100026547 Platelet-derived growth factor receptor beta Human genes 0.000 description 1
- 101710164680 Platelet-derived growth factor receptor beta Proteins 0.000 description 1
- 201000008199 Pleuropulmonary blastoma Diseases 0.000 description 1
- 208000035109 Pneumococcal Infections Diseases 0.000 description 1
- 241000142787 Pneumocystis jirovecii Species 0.000 description 1
- 206010035664 Pneumonia Diseases 0.000 description 1
- 206010035737 Pneumonia viral Diseases 0.000 description 1
- 208000000474 Poliomyelitis Diseases 0.000 description 1
- 229920002732 Polyanhydride Polymers 0.000 description 1
- 206010065159 Polychondritis Diseases 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 208000007048 Polymyalgia Rheumatica Diseases 0.000 description 1
- 206010036105 Polyneuropathy Diseases 0.000 description 1
- 241001505332 Polyomavirus sp. Species 0.000 description 1
- 229920001710 Polyorthoester Polymers 0.000 description 1
- 206010054161 Pontiac fever Diseases 0.000 description 1
- 208000004347 Postpericardiotomy Syndrome Diseases 0.000 description 1
- 208000012654 Primary biliary cholangitis Diseases 0.000 description 1
- 102100024216 Programmed cell death 1 ligand 1 Human genes 0.000 description 1
- 208000037534 Progressive hemifacial atrophy Diseases 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 102100038955 Proprotein convertase subtilisin/kexin type 9 Human genes 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 102220470494 Proteasome subunit beta type-3_M34L_mutation Human genes 0.000 description 1
- 101710194807 Protective antigen Proteins 0.000 description 1
- 102100023068 Protein kinase C-binding protein NELL1 Human genes 0.000 description 1
- 208000003251 Pruritus Diseases 0.000 description 1
- 241000186336 Pseudopropionibacterium propionicum Species 0.000 description 1
- 206010037151 Psittacosis Diseases 0.000 description 1
- 201000001263 Psoriatic Arthritis Diseases 0.000 description 1
- 208000036824 Psoriatic arthropathy Diseases 0.000 description 1
- 241000517305 Pthiridae Species 0.000 description 1
- 241000517304 Pthirus pubis Species 0.000 description 1
- 201000004360 Pthirus pubis infestation Diseases 0.000 description 1
- 206010037688 Q fever Diseases 0.000 description 1
- 102000014128 RANK Ligand Human genes 0.000 description 1
- 108010025832 RANK Ligand Proteins 0.000 description 1
- 206010037742 Rabies Diseases 0.000 description 1
- 241000711798 Rabies lyssavirus Species 0.000 description 1
- 208000012322 Raynaud phenomenon Diseases 0.000 description 1
- 208000015634 Rectal Neoplasms Diseases 0.000 description 1
- 201000001947 Reflex Sympathetic Dystrophy Diseases 0.000 description 1
- 208000033464 Reiter syndrome Diseases 0.000 description 1
- 206010038389 Renal cancer Diseases 0.000 description 1
- 208000006265 Renal cell carcinoma Diseases 0.000 description 1
- 206010061603 Respiratory syncytial virus infection Diseases 0.000 description 1
- 102100029831 Reticulon-4 Human genes 0.000 description 1
- 206010038979 Retroperitoneal fibrosis Diseases 0.000 description 1
- 208000004364 Rhinosporidiosis Diseases 0.000 description 1
- 241000293824 Rhinosporidium seeberi Species 0.000 description 1
- 206010061494 Rhinovirus infection Diseases 0.000 description 1
- 102000006382 Ribonucleases Human genes 0.000 description 1
- 108010083644 Ribonucleases Proteins 0.000 description 1
- 241000606697 Rickettsia prowazekii Species 0.000 description 1
- 241000606695 Rickettsia rickettsii Species 0.000 description 1
- 241000606726 Rickettsia typhi Species 0.000 description 1
- 241000606651 Rickettsiales Species 0.000 description 1
- 201000004282 Rickettsialpox Diseases 0.000 description 1
- 241000713124 Rift Valley fever virus Species 0.000 description 1
- 241000702670 Rotavirus Species 0.000 description 1
- 206010067470 Rotavirus infection Diseases 0.000 description 1
- 241000714474 Rous sarcoma virus Species 0.000 description 1
- 241000710799 Rubella virus Species 0.000 description 1
- 241000315672 SARS coronavirus Species 0.000 description 1
- 102100029198 SLAM family member 7 Human genes 0.000 description 1
- 241000736032 Sabia <angiosperm> Species 0.000 description 1
- 101100123851 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) HER1 gene Proteins 0.000 description 1
- 208000004337 Salivary Gland Neoplasms Diseases 0.000 description 1
- 206010061934 Salivary gland cancer Diseases 0.000 description 1
- 241000607142 Salmonella Species 0.000 description 1
- 206010039438 Salmonella Infections Diseases 0.000 description 1
- 241000607361 Salmonella enterica subsp. enterica Species 0.000 description 1
- 241000369757 Sapovirus Species 0.000 description 1
- 241000509427 Sarcoptes scabiei Species 0.000 description 1
- 241000447727 Scabies Species 0.000 description 1
- 241000242678 Schistosoma Species 0.000 description 1
- 206010039705 Scleritis Diseases 0.000 description 1
- 206010039710 Scleroderma Diseases 0.000 description 1
- 108050006698 Sclerostin Proteins 0.000 description 1
- BUGBHKTXTAQXES-UHFFFAOYSA-N Selenium Chemical compound [Se] BUGBHKTXTAQXES-UHFFFAOYSA-N 0.000 description 1
- 241000710961 Semliki Forest virus Species 0.000 description 1
- 206010040047 Sepsis Diseases 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 201000003176 Severe Acute Respiratory Syndrome Diseases 0.000 description 1
- 208000009359 Sezary Syndrome Diseases 0.000 description 1
- 208000021388 Sezary disease Diseases 0.000 description 1
- 241000607768 Shigella Species 0.000 description 1
- 206010040550 Shigella infections Diseases 0.000 description 1
- 102100038081 Signal transducer CD24 Human genes 0.000 description 1
- 108010029389 Simplexvirus glycoprotein B Proteins 0.000 description 1
- 241000150288 Sin Nombre orthohantavirus Species 0.000 description 1
- 208000021386 Sjogren Syndrome Diseases 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- 206010041067 Small cell lung cancer Diseases 0.000 description 1
- 208000021712 Soft tissue sarcoma Diseases 0.000 description 1
- 241001149963 Sporothrix schenckii Species 0.000 description 1
- 206010041736 Sporotrichosis Diseases 0.000 description 1
- 208000008582 Staphylococcal Food Poisoning Diseases 0.000 description 1
- 206010041925 Staphylococcal infections Diseases 0.000 description 1
- 241000191967 Staphylococcus aureus Species 0.000 description 1
- 241000194017 Streptococcus Species 0.000 description 1
- 241000193985 Streptococcus agalactiae Species 0.000 description 1
- 241000193998 Streptococcus pneumoniae Species 0.000 description 1
- 241000193996 Streptococcus pyogenes Species 0.000 description 1
- 241001505901 Streptococcus sp. 'group A' Species 0.000 description 1
- 241000244177 Strongyloides stercoralis Species 0.000 description 1
- 206010042254 Strongyloidiasis Diseases 0.000 description 1
- 208000037065 Subacute sclerosing leukoencephalitis Diseases 0.000 description 1
- 206010042297 Subacute sclerosing panencephalitis Diseases 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- 208000002286 Susac Syndrome Diseases 0.000 description 1
- 102000003673 Symporters Human genes 0.000 description 1
- 108090000088 Symporters Proteins 0.000 description 1
- 102100035721 Syndecan-1 Human genes 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 102100025131 T-cell differentiation antigen CD6 Human genes 0.000 description 1
- 208000027585 T-cell non-Hodgkin lymphoma Diseases 0.000 description 1
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 description 1
- 102100025244 T-cell surface glycoprotein CD5 Human genes 0.000 description 1
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 1
- 238000009174 TK cell therapy Methods 0.000 description 1
- 108010014401 TWEAK Receptor Proteins 0.000 description 1
- 229940126624 Tacatuzumab tetraxetan Drugs 0.000 description 1
- 241000244155 Taenia Species 0.000 description 1
- 241000244157 Taenia solium Species 0.000 description 1
- 208000001106 Takayasu Arteritis Diseases 0.000 description 1
- 102000007000 Tenascin Human genes 0.000 description 1
- 108010008125 Tenascin Proteins 0.000 description 1
- 206010071574 Testicular autoimmunity Diseases 0.000 description 1
- 206010043376 Tetanus Diseases 0.000 description 1
- 206010043515 Throat cancer Diseases 0.000 description 1
- 108010000499 Thromboplastin Proteins 0.000 description 1
- 102000002262 Thromboplastin Human genes 0.000 description 1
- 201000009365 Thymic carcinoma Diseases 0.000 description 1
- 102100031294 Thymic stromal lymphopoietin Human genes 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 241000130764 Tinea Species 0.000 description 1
- 206010043865 Tinea blanca Diseases 0.000 description 1
- 206010043866 Tinea capitis Diseases 0.000 description 1
- 206010043871 Tinea nigra Diseases 0.000 description 1
- 102100030951 Tissue factor pathway inhibitor Human genes 0.000 description 1
- 241000244030 Toxocara canis Species 0.000 description 1
- 241000244020 Toxocara cati Species 0.000 description 1
- 241000223997 Toxoplasma gondii Species 0.000 description 1
- 201000005485 Toxoplasmosis Diseases 0.000 description 1
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 1
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 1
- 102000046299 Transforming Growth Factor beta1 Human genes 0.000 description 1
- 101800002279 Transforming growth factor beta-1 Proteins 0.000 description 1
- 206010044407 Transitional cell cancer of the renal pelvis and ureter Diseases 0.000 description 1
- 102100023935 Transmembrane glycoprotein NMB Human genes 0.000 description 1
- 206010052779 Transplant rejections Diseases 0.000 description 1
- 241000589884 Treponema pallidum Species 0.000 description 1
- 241000243777 Trichinella spiralis Species 0.000 description 1
- 206010044608 Trichiniasis Diseases 0.000 description 1
- 208000005448 Trichomonas Infections Diseases 0.000 description 1
- 241000224527 Trichomonas vaginalis Species 0.000 description 1
- 206010044620 Trichomoniasis Diseases 0.000 description 1
- 241000223238 Trichophyton Species 0.000 description 1
- 241001045770 Trichophyton mentagrophytes Species 0.000 description 1
- 241001480048 Trichophyton tonsurans Species 0.000 description 1
- 241000223231 Trichosporon beigelii Species 0.000 description 1
- 241001489145 Trichuris trichiura Species 0.000 description 1
- 206010044684 Trismus Diseases 0.000 description 1
- 208000034784 Tularaemia Diseases 0.000 description 1
- 102100040113 Tumor necrosis factor receptor superfamily member 10A Human genes 0.000 description 1
- 102100040112 Tumor necrosis factor receptor superfamily member 10B Human genes 0.000 description 1
- 102100028786 Tumor necrosis factor receptor superfamily member 12A Human genes 0.000 description 1
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 1
- 102100040403 Tumor necrosis factor receptor superfamily member 6 Human genes 0.000 description 1
- 102100027212 Tumor-associated calcium signal transducer 2 Human genes 0.000 description 1
- 241000287411 Turdidae Species 0.000 description 1
- 208000026928 Turner syndrome Diseases 0.000 description 1
- 108700036309 Type I Plasminogen Deficiency Proteins 0.000 description 1
- 108091005906 Type I transmembrane proteins Proteins 0.000 description 1
- 108010069584 Type III Secretion Systems Proteins 0.000 description 1
- 241001467018 Typhis Species 0.000 description 1
- 208000037386 Typhoid Diseases 0.000 description 1
- 206010064996 Ulcerative keratitis Diseases 0.000 description 1
- 208000015778 Undifferentiated pleomorphic sarcoma Diseases 0.000 description 1
- 206010046431 Urethral cancer Diseases 0.000 description 1
- 206010046458 Urethral neoplasms Diseases 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- 101150045640 VWF gene Proteins 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- 206010046980 Varicella Diseases 0.000 description 1
- 241000870995 Variola Species 0.000 description 1
- 241000700647 Variola virus Species 0.000 description 1
- 108010053096 Vascular Endothelial Growth Factor Receptor-1 Proteins 0.000 description 1
- 102100039037 Vascular endothelial growth factor A Human genes 0.000 description 1
- 206010047115 Vasculitis Diseases 0.000 description 1
- 208000002687 Venezuelan Equine Encephalomyelitis Diseases 0.000 description 1
- 201000009145 Venezuelan equine encephalitis Diseases 0.000 description 1
- 241000710959 Venezuelan equine encephalitis virus Species 0.000 description 1
- 201000009693 Venezuelan hemorrhagic fever Diseases 0.000 description 1
- 241000607626 Vibrio cholerae Species 0.000 description 1
- 241000607265 Vibrio vulnificus Species 0.000 description 1
- 241001416177 Vicugna pacos Species 0.000 description 1
- 108010065472 Vimentin Proteins 0.000 description 1
- 102000013127 Vimentin Human genes 0.000 description 1
- 206010047504 Visceral Larva Migrans Diseases 0.000 description 1
- 206010047642 Vitiligo Diseases 0.000 description 1
- 206010047741 Vulval cancer Diseases 0.000 description 1
- 208000004354 Vulvar Neoplasms Diseases 0.000 description 1
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 description 1
- 201000006449 West Nile encephalitis Diseases 0.000 description 1
- 206010057293 West Nile viral infection Diseases 0.000 description 1
- 241000710886 West Nile virus Species 0.000 description 1
- 208000000208 Wet Macular Degeneration Diseases 0.000 description 1
- 208000003152 Yellow Fever Diseases 0.000 description 1
- 241000710772 Yellow fever virus Species 0.000 description 1
- 241000607447 Yersinia enterocolitica Species 0.000 description 1
- 206010048249 Yersinia infections Diseases 0.000 description 1
- 208000025079 Yersinia infectious disease Diseases 0.000 description 1
- 241000607477 Yersinia pseudotuberculosis Species 0.000 description 1
- 208000035994 Yersinia pseudotuberculosis Infections Diseases 0.000 description 1
- 208000025087 Yersinia pseudotuberculosis infectious disease Diseases 0.000 description 1
- 208000001455 Zika Virus Infection Diseases 0.000 description 1
- 201000004296 Zika fever Diseases 0.000 description 1
- 241000907316 Zika virus Species 0.000 description 1
- XYVNHPYNSPGYLI-UUOKFMHZSA-N [(2r,3s,4r,5r)-5-(2-amino-6-oxo-3h-purin-9-yl)-4-hydroxy-2-(phosphonooxymethyl)oxolan-3-yl] dihydrogen phosphate Chemical compound C1=2NC(N)=NC(=O)C=2N=CN1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](OP(O)(O)=O)[C@H]1O XYVNHPYNSPGYLI-UUOKFMHZSA-N 0.000 description 1
- SXEHKFHPFVVDIR-UHFFFAOYSA-N [4-(4-hydrazinylphenyl)phenyl]hydrazine Chemical compound C1=CC(NN)=CC=C1C1=CC=C(NN)C=C1 SXEHKFHPFVVDIR-UHFFFAOYSA-N 0.000 description 1
- 241000606834 [Haemophilus] ducreyi Species 0.000 description 1
- 229950005186 abagovomab Drugs 0.000 description 1
- 229960000446 abciximab Drugs 0.000 description 1
- 229950005008 abituzumab Drugs 0.000 description 1
- 229950008347 abrilumab Drugs 0.000 description 1
- 239000003070 absorption delaying agent Substances 0.000 description 1
- 231100000796 accumulate in body tissue Toxicity 0.000 description 1
- 229940022698 acetylcholinesterase Drugs 0.000 description 1
- 201000007691 actinomycosis Diseases 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 239000000488 activin Substances 0.000 description 1
- 208000002552 acute disseminated encephalomyelitis Diseases 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 208000027137 acute motor axonal neuropathy Diseases 0.000 description 1
- 229960002964 adalimumab Drugs 0.000 description 1
- 229950009084 adecatumumab Drugs 0.000 description 1
- 208000009956 adenocarcinoma Diseases 0.000 description 1
- 208000020990 adrenal cortex carcinoma Diseases 0.000 description 1
- 208000007128 adrenocortical carcinoma Diseases 0.000 description 1
- 229950008995 aducanumab Drugs 0.000 description 1
- 229950008714 afasevikumab Drugs 0.000 description 1
- 229960003227 afelimomab Drugs 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 206010064930 age-related macular degeneration Diseases 0.000 description 1
- 230000001270 agonistic effect Effects 0.000 description 1
- 229950008459 alacizumab pegol Drugs 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 229960000548 alemtuzumab Drugs 0.000 description 1
- 229960004539 alirocumab Drugs 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- 208000004631 alopecia areata Diseases 0.000 description 1
- 108010026331 alpha-Fetoproteins Proteins 0.000 description 1
- MXKCYTKUIDTFLY-ZNNSSXPHSA-N alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-D-Galp Chemical compound O[C@H]1[C@H](O)[C@H](O)[C@H](C)O[C@H]1O[C@H]1[C@H](O[C@H]2[C@@H]([C@@H](NC(C)=O)[C@H](O[C@H]3[C@H]([C@@H](CO)OC(O)[C@@H]3O)O)O[C@@H]2CO)O[C@H]2[C@H]([C@H](O)[C@H](O)[C@H](C)O2)O)O[C@H](CO)[C@H](O)[C@@H]1O MXKCYTKUIDTFLY-ZNNSSXPHSA-N 0.000 description 1
- 229950009106 altumomab Drugs 0.000 description 1
- 229950001537 amatuximab Drugs 0.000 description 1
- 206010002022 amyloidosis Diseases 0.000 description 1
- 229950006061 anatumomab mafenatox Drugs 0.000 description 1
- 238000009165 androgen replacement therapy Methods 0.000 description 1
- 229950006588 anetumab ravtansine Drugs 0.000 description 1
- 108010069801 angiopoietin 4 Proteins 0.000 description 1
- 201000010645 angiostrongyliasis Diseases 0.000 description 1
- 229950010117 anifrolumab Drugs 0.000 description 1
- 208000005067 anisakiasis Diseases 0.000 description 1
- 229950005794 anrukinzumab Drugs 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000000845 anti-microbial effect Effects 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 230000005809 anti-tumor immunity Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 230000009830 antibody antigen interaction Effects 0.000 description 1
- 238000011091 antibody purification Methods 0.000 description 1
- 230000005875 antibody response Effects 0.000 description 1
- 210000000612 antigen-presenting cell Anatomy 0.000 description 1
- 238000009166 antihormone therapy Methods 0.000 description 1
- 238000009176 antiserum therapy Methods 0.000 description 1
- 201000011165 anus cancer Diseases 0.000 description 1
- 229950003145 apolizumab Drugs 0.000 description 1
- 208000021780 appendiceal neoplasm Diseases 0.000 description 1
- 229950005725 arcitumomab Drugs 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 201000009361 ascariasis Diseases 0.000 description 1
- 229950000847 ascrinvacumab Drugs 0.000 description 1
- 229950002882 aselizumab Drugs 0.000 description 1
- 229960003554 asfotase alfa Drugs 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 229940009098 aspartate Drugs 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-L aspartate group Chemical group N[C@@H](CC(=O)[O-])C(=O)[O-] CKLJMWTZIZZHCS-REOHCLBHSA-L 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 244000309743 astrovirus Species 0.000 description 1
- 229950004993 asunercept Drugs 0.000 description 1
- 229960003852 atezolizumab Drugs 0.000 description 1
- 229950005122 atinumab Drugs 0.000 description 1
- 229950000103 atorolimumab Drugs 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- 201000009780 autoimmune polyendocrine syndrome type 2 Diseases 0.000 description 1
- 230000005784 autoimmunity Effects 0.000 description 1
- 238000009173 autologous immune enhancement therapy Methods 0.000 description 1
- 229950002916 avelumab Drugs 0.000 description 1
- 230000003376 axonal effect Effects 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 201000008680 babesiosis Diseases 0.000 description 1
- 229940065181 bacillus anthracis Drugs 0.000 description 1
- 229950001863 bapineuzumab Drugs 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- 229940092528 bartonella bacilliformis Drugs 0.000 description 1
- 229940092524 bartonella henselae Drugs 0.000 description 1
- 206010004145 bartonellosis Diseases 0.000 description 1
- 229960004669 basiliximab Drugs 0.000 description 1
- 229950007843 bavituximab Drugs 0.000 description 1
- 229950003269 bectumomab Drugs 0.000 description 1
- 229960004965 begelomab Drugs 0.000 description 1
- 229960003270 belimumab Drugs 0.000 description 1
- 208000001119 benign fibrous histiocytoma Diseases 0.000 description 1
- 229950000321 benralizumab Drugs 0.000 description 1
- 229950010015 bertilimumab Drugs 0.000 description 1
- 229950010559 besilesomab Drugs 0.000 description 1
- 108010079452 beta Adrenergic Receptors Proteins 0.000 description 1
- 102000012740 beta Adrenergic Receptors Human genes 0.000 description 1
- CXQCLLQQYTUUKJ-ALWAHNIESA-N beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-Glcp-(1<->1')-Cer(d18:1/18:0) Chemical compound O[C@@H]1[C@@H](O)[C@H](OC[C@H](NC(=O)CCCCCCCCCCCCCCCCC)[C@H](O)\C=C\CCCCCCCCCCCCC)O[C@H](CO)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@]2(O[C@H]([C@H](NC(C)=O)[C@@H](O)C2)[C@H](O)[C@@H](CO)O[C@]2(O[C@H]([C@H](NC(C)=O)[C@@H](O)C2)[C@H](O)[C@H](O)CO)C(O)=O)C(O)=O)[C@@H](O[C@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](CO)O1 CXQCLLQQYTUUKJ-ALWAHNIESA-N 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 229960000397 bevacizumab Drugs 0.000 description 1
- 229950008086 bezlotoxumab Drugs 0.000 description 1
- 229950001303 biciromab Drugs 0.000 description 1
- 208000026900 bile duct neoplasm Diseases 0.000 description 1
- 229950006326 bimagrumab Drugs 0.000 description 1
- 229950002853 bimekizumab Drugs 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 239000003139 biocide Substances 0.000 description 1
- 229920000249 biocompatible polymer Polymers 0.000 description 1
- 238000001815 biotherapy Methods 0.000 description 1
- 230000036983 biotransformation Effects 0.000 description 1
- OWMVSZAMULFTJU-UHFFFAOYSA-N bis-tris Chemical compound OCCN(CCO)C(CO)(CO)CO OWMVSZAMULFTJU-UHFFFAOYSA-N 0.000 description 1
- 229960005522 bivatuzumab mertansine Drugs 0.000 description 1
- 206010004975 black piedra Diseases 0.000 description 1
- 239000012496 blank sample Substances 0.000 description 1
- 229950000009 bleselumab Drugs 0.000 description 1
- 229960003008 blinatumomab Drugs 0.000 description 1
- 229950004201 blisibimod Drugs 0.000 description 1
- 229950007686 blontuvetmab Drugs 0.000 description 1
- 230000017531 blood circulation Effects 0.000 description 1
- 238000009194 blood irradiation therapy Methods 0.000 description 1
- 229950005042 blosozumab Drugs 0.000 description 1
- 229950011350 bococizumab Drugs 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 201000008873 bone osteosarcoma Diseases 0.000 description 1
- 238000002725 brachytherapy Methods 0.000 description 1
- 229950009342 brazikumab Drugs 0.000 description 1
- 229960000455 brentuximab vedotin Drugs 0.000 description 1
- 229960002874 briakinumab Drugs 0.000 description 1
- 229960003735 brodalumab Drugs 0.000 description 1
- 229950000025 brolucizumab Drugs 0.000 description 1
- 229950001478 brontictuzumab Drugs 0.000 description 1
- 201000006824 bubonic plague Diseases 0.000 description 1
- 239000006189 buccal tablet Substances 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 208000000594 bullous pemphigoid Diseases 0.000 description 1
- 229940074375 burkholderia mallei Drugs 0.000 description 1
- DQXBYHZEEUGOBF-UHFFFAOYSA-N but-3-enoic acid;ethene Chemical compound C=C.OC(=O)CC=C DQXBYHZEEUGOBF-UHFFFAOYSA-N 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 229940126608 cBR96-doxorubicin immunoconjugate Drugs 0.000 description 1
- 229950010831 cabiralizumab Drugs 0.000 description 1
- 229960004015 calcitonin Drugs 0.000 description 1
- BBBFJLBPOGFECG-VJVYQDLKSA-N calcitonin Chemical compound N([C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(N)=O)C(C)C)C(=O)[C@@H]1CSSC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1 BBBFJLBPOGFECG-VJVYQDLKSA-N 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 201000004927 campylobacteriosis Diseases 0.000 description 1
- 229960001838 canakinumab Drugs 0.000 description 1
- 229940095731 candida albicans Drugs 0.000 description 1
- 229950007296 cantuzumab mertansine Drugs 0.000 description 1
- 229950011547 cantuzumab ravtansine Drugs 0.000 description 1
- 229950002176 caplacizumab Drugs 0.000 description 1
- 108010023376 caplacizumab Proteins 0.000 description 1
- 229940034605 capromab pendetide Drugs 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 208000002458 carcinoid tumor Diseases 0.000 description 1
- 230000000747 cardiac effect Effects 0.000 description 1
- 238000009125 cardiac resynchronization therapy Methods 0.000 description 1
- 229950000771 carlumab Drugs 0.000 description 1
- 229950005629 carotuximab Drugs 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 229960000419 catumaxomab Drugs 0.000 description 1
- 229950006754 cedelizumab Drugs 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 238000009172 cell transfer therapy Methods 0.000 description 1
- 201000007455 central nervous system cancer Diseases 0.000 description 1
- 201000010353 central nervous system germ cell tumor Diseases 0.000 description 1
- 208000025997 central nervous system neoplasm Diseases 0.000 description 1
- 229950002256 cergutuzumab amunaleukin Drugs 0.000 description 1
- 229960003115 certolizumab pegol Drugs 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 229960005395 cetuximab Drugs 0.000 description 1
- 201000004308 chancroid Diseases 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 238000002655 chelation therapy Methods 0.000 description 1
- 238000012412 chemical coupling Methods 0.000 description 1
- 238000001311 chemical methods and process Methods 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 229910052801 chlorine Inorganic materials 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 208000025302 chronic primary adrenal insufficiency Diseases 0.000 description 1
- 238000000900 chrysotherapy Methods 0.000 description 1
- 201000010002 cicatricial pemphigoid Diseases 0.000 description 1
- 230000004087 circulation Effects 0.000 description 1
- 229950010905 citatuzumab bogatox Drugs 0.000 description 1
- 229950006647 cixutumumab Drugs 0.000 description 1
- 229950001565 clazakizumab Drugs 0.000 description 1
- 229950002334 clenoliximab Drugs 0.000 description 1
- 229950002595 clivatuzumab tetraxetan Drugs 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 229910017052 cobalt Inorganic materials 0.000 description 1
- 239000010941 cobalt Substances 0.000 description 1
- GUTLYIVDDKVIGB-UHFFFAOYSA-N cobalt atom Chemical compound [Co] GUTLYIVDDKVIGB-UHFFFAOYSA-N 0.000 description 1
- 238000009200 cobalt therapy Methods 0.000 description 1
- 229950007906 codrituzumab Drugs 0.000 description 1
- 238000002667 cold compression therapy Methods 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 229950005458 coltuximab ravtansine Drugs 0.000 description 1
- 238000004891 communication Methods 0.000 description 1
- 230000004154 complement system Effects 0.000 description 1
- 230000009918 complex formation Effects 0.000 description 1
- 238000013329 compounding Methods 0.000 description 1
- 229950007276 conatumumab Drugs 0.000 description 1
- 229950009735 concizumab Drugs 0.000 description 1
- 201000004395 congenital heart block Diseases 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 229910052802 copper Inorganic materials 0.000 description 1
- 239000010949 copper Substances 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 229950001954 crenezumab Drugs 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 229950000938 crotedumab Drugs 0.000 description 1
- 201000003278 cryoglobulinemia Diseases 0.000 description 1
- 238000000315 cryotherapy Methods 0.000 description 1
- 201000002641 cyclosporiasis Diseases 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- 201000008167 cystoisosporiasis Diseases 0.000 description 1
- 102000003675 cytokine receptors Human genes 0.000 description 1
- 108010057085 cytokine receptors Proteins 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 108091007930 cytoplasmic receptors Proteins 0.000 description 1
- 239000000824 cytostatic agent Substances 0.000 description 1
- 230000001085 cytostatic effect Effects 0.000 description 1
- YBSJFWOBGCMAKL-UHFFFAOYSA-N dabigatran Chemical compound N=1C2=CC(C(=O)N(CCC(O)=O)C=3N=CC=CC=3)=CC=C2N(C)C=1CNC1=CC=C(C(N)=N)C=C1 YBSJFWOBGCMAKL-UHFFFAOYSA-N 0.000 description 1
- 229960003850 dabigatran Drugs 0.000 description 1
- 229950007409 dacetuzumab Drugs 0.000 description 1
- 229960002806 daclizumab Drugs 0.000 description 1
- 229950009076 dalantercept Drugs 0.000 description 1
- 229960002482 dalotuzumab Drugs 0.000 description 1
- 229950005026 dapirolizumab pegol Drugs 0.000 description 1
- 108010048522 dapirolizumab pegol Proteins 0.000 description 1
- 229960002204 daratumumab Drugs 0.000 description 1
- 229950008135 dectrekumab Drugs 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 229940127276 delta-like ligand 3 Drugs 0.000 description 1
- 229950007998 demcizumab Drugs 0.000 description 1
- 238000004925 denaturation Methods 0.000 description 1
- 230000036425 denaturation Effects 0.000 description 1
- 210000004443 dendritic cell Anatomy 0.000 description 1
- 229950004079 denintuzumab mafodotin Drugs 0.000 description 1
- 229960001251 denosumab Drugs 0.000 description 1
- 238000001212 derivatisation Methods 0.000 description 1
- 229940126610 derlotuximab biotin Drugs 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 230000001627 detrimental effect Effects 0.000 description 1
- 229950008962 detumomab Drugs 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 239000000032 diagnostic agent Substances 0.000 description 1
- 229940039227 diagnostic agent Drugs 0.000 description 1
- 201000004587 dientamoebiasis Diseases 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 238000000113 differential scanning calorimetry Methods 0.000 description 1
- FOCAHLGSDWHSAH-UHFFFAOYSA-N difluoromethanethione Chemical compound FC(F)=S FOCAHLGSDWHSAH-UHFFFAOYSA-N 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 229960004497 dinutuximab Drugs 0.000 description 1
- 229940090124 dipeptidyl peptidase 4 (dpp-4) inhibitors for blood glucose lowering Drugs 0.000 description 1
- 206010013023 diphtheria Diseases 0.000 description 1
- 229950011037 diridavumab Drugs 0.000 description 1
- ZWIBGKZDAWNIFC-UHFFFAOYSA-N disuccinimidyl suberate Chemical compound O=C1CCC(=O)N1OC(=O)CCCCCCC(=O)ON1C(=O)CCC1=O ZWIBGKZDAWNIFC-UHFFFAOYSA-N 0.000 description 1
- 229950000274 domagrozumab Drugs 0.000 description 1
- 229950005168 dorlimomab aritox Drugs 0.000 description 1
- 208000008576 dracunculiasis Diseases 0.000 description 1
- 229950009964 drozitumab Drugs 0.000 description 1
- 238000007876 drug discovery Methods 0.000 description 1
- 241001493065 dsRNA viruses Species 0.000 description 1
- 208000028715 ductal breast carcinoma in situ Diseases 0.000 description 1
- 229960005175 dulaglutide Drugs 0.000 description 1
- 229950003468 dupilumab Drugs 0.000 description 1
- 229950009791 durvalumab Drugs 0.000 description 1
- 229950011453 dusigitumab Drugs 0.000 description 1
- 229950000006 ecromeximab Drugs 0.000 description 1
- 229960002224 eculizumab Drugs 0.000 description 1
- 229950011109 edobacomab Drugs 0.000 description 1
- 229960001776 edrecolomab Drugs 0.000 description 1
- 229960000284 efalizumab Drugs 0.000 description 1
- 239000012893 effector ligand Substances 0.000 description 1
- 229950002209 efungumab Drugs 0.000 description 1
- 229950010217 eldelumab Drugs 0.000 description 1
- 238000002635 electroconvulsive therapy Methods 0.000 description 1
- 238000000940 electromagnetic therapy Methods 0.000 description 1
- 238000009201 electron therapy Methods 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 238000001827 electrotherapy Methods 0.000 description 1
- 208000006036 elephantiasis Diseases 0.000 description 1
- 229950002519 elgemtumab Drugs 0.000 description 1
- 229960004137 elotuzumab Drugs 0.000 description 1
- 229950002507 elsilimomab Drugs 0.000 description 1
- 229950004647 emactuzumab Drugs 0.000 description 1
- 208000014616 embryonal neoplasm Diseases 0.000 description 1
- 229950004255 emibetuzumab Drugs 0.000 description 1
- 229950006925 emicizumab Drugs 0.000 description 1
- 229950003048 enavatuzumab Drugs 0.000 description 1
- 206010014599 encephalitis Diseases 0.000 description 1
- 201000005901 endemic typhus Diseases 0.000 description 1
- 208000030172 endocrine system disease Diseases 0.000 description 1
- 230000002357 endometrial effect Effects 0.000 description 1
- 229950004930 enfortumab vedotin Drugs 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 229950000565 enlimomab pegol Drugs 0.000 description 1
- 229950004270 enoblituzumab Drugs 0.000 description 1
- 229950007313 enokizumab Drugs 0.000 description 1
- 229950001752 enoticumab Drugs 0.000 description 1
- 229950010640 ensituximab Drugs 0.000 description 1
- 229940007078 entamoeba histolytica Drugs 0.000 description 1
- 238000002641 enzyme replacement therapy Methods 0.000 description 1
- 208000028104 epidemic louse-borne typhus Diseases 0.000 description 1
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 description 1
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 description 1
- 210000003426 epidermal langerhans cell Anatomy 0.000 description 1
- 238000009162 epigenetic therapy Methods 0.000 description 1
- 210000000981 epithelium Anatomy 0.000 description 1
- 229950006414 epitumomab cituxetan Drugs 0.000 description 1
- 229950009760 epratuzumab Drugs 0.000 description 1
- 229950001616 erenumab Drugs 0.000 description 1
- 229950004292 erlizumab Drugs 0.000 description 1
- 229950008579 ertumaxomab Drugs 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- 235000020776 essential amino acid Nutrition 0.000 description 1
- 239000003797 essential amino acid Substances 0.000 description 1
- 208000032099 esthesioneuroblastoma Diseases 0.000 description 1
- 238000009164 estrogen replacement therapy Methods 0.000 description 1
- 229950009569 etaracizumab Drugs 0.000 description 1
- 239000005038 ethylene vinyl acetate Substances 0.000 description 1
- 229950004912 etrolizumab Drugs 0.000 description 1
- 201000005889 eumycotic mycetoma Diseases 0.000 description 1
- OGPBJKLSAFTDLK-UHFFFAOYSA-N europium atom Chemical compound [Eu] OGPBJKLSAFTDLK-UHFFFAOYSA-N 0.000 description 1
- 229950004341 evinacumab Drugs 0.000 description 1
- 229960002027 evolocumab Drugs 0.000 description 1
- 229950005562 exbivirumab Drugs 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 238000009213 extracorporeal shockwave therapy Methods 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- 208000030533 eye disease Diseases 0.000 description 1
- 208000024519 eye neoplasm Diseases 0.000 description 1
- 208000002980 facial hemiatrophy Diseases 0.000 description 1
- 108700019309 factor VIII-Fc fusion Proteins 0.000 description 1
- 229960004222 factor ix Drugs 0.000 description 1
- 229960000301 factor viii Drugs 0.000 description 1
- 206010064570 familial cold autoinflammatory syndrome Diseases 0.000 description 1
- 229940093443 fanolesomab Drugs 0.000 description 1
- 229950001488 faralimomab Drugs 0.000 description 1
- 229950009929 farletuzumab Drugs 0.000 description 1
- 206010016235 fasciolopsiasis Diseases 0.000 description 1
- 229950000335 fasinumab Drugs 0.000 description 1
- 238000009204 fast neutron therapy Methods 0.000 description 1
- 229950001563 felvizumab Drugs 0.000 description 1
- 229950010512 fezakinumab Drugs 0.000 description 1
- 229940126612 fibatuzumab Drugs 0.000 description 1
- 229950003499 fibrin Drugs 0.000 description 1
- 229950002846 ficlatuzumab Drugs 0.000 description 1
- 229950008085 figitumumab Drugs 0.000 description 1
- 208000005239 filarial elephantiasis Diseases 0.000 description 1
- 229950004409 firivumab Drugs 0.000 description 1
- 229950010320 flanvotumab Drugs 0.000 description 1
- 229950010043 fletikumab Drugs 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 238000002666 fluoride therapy Methods 0.000 description 1
- 229940014144 folate Drugs 0.000 description 1
- 102000006815 folate receptor Human genes 0.000 description 1
- 108020005243 folate receptor Proteins 0.000 description 1
- 235000019152 folic acid Nutrition 0.000 description 1
- 239000011724 folic acid Substances 0.000 description 1
- 229950004923 fontolizumab Drugs 0.000 description 1
- 210000002683 foot Anatomy 0.000 description 1
- 229950004356 foralumab Drugs 0.000 description 1
- 229950011078 foravirumab Drugs 0.000 description 1
- 230000037433 frameshift Effects 0.000 description 1
- 229940118764 francisella tularensis Drugs 0.000 description 1
- 229950004003 fresolimumab Drugs 0.000 description 1
- 229950009370 fulranumab Drugs 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- ZZUFCTLCJUWOSV-UHFFFAOYSA-N furosemide Chemical compound C1=C(Cl)C(S(=O)(=O)N)=CC(C(O)=O)=C1NCC1=CC=CO1 ZZUFCTLCJUWOSV-UHFFFAOYSA-N 0.000 description 1
- 229950002140 futuximab Drugs 0.000 description 1
- 229930182830 galactose Natural products 0.000 description 1
- 229950000118 galcanezumab Drugs 0.000 description 1
- 229950001109 galiximab Drugs 0.000 description 1
- 201000010175 gallbladder cancer Diseases 0.000 description 1
- 229950004896 ganitumab Drugs 0.000 description 1
- 229950002508 gantenerumab Drugs 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 229950004792 gavilimomab Drugs 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 239000007903 gelatin capsule Substances 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 229960003297 gemtuzumab ozogamicin Drugs 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 239000003168 generic drug Substances 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 208000003884 gestational trophoblastic disease Diseases 0.000 description 1
- 229950003717 gevokizumab Drugs 0.000 description 1
- 208000018090 giant cell myocarditis Diseases 0.000 description 1
- 229940085435 giardia lamblia Drugs 0.000 description 1
- 201000006592 giardiasis Diseases 0.000 description 1
- 229950002026 girentuximab Drugs 0.000 description 1
- 229950009672 glembatumumab vedotin Drugs 0.000 description 1
- 229940116332 glucose oxidase Drugs 0.000 description 1
- 235000019420 glucose oxidase Nutrition 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-L glutamate group Chemical group N[C@@H](CCC(=O)[O-])C(=O)[O-] WHUUTDBJXJRKMK-VKHMYHEASA-L 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 201000000128 gnathomiasis Diseases 0.000 description 1
- 229960001743 golimumab Drugs 0.000 description 1
- 229940126613 gomiliximab Drugs 0.000 description 1
- 208000001786 gonorrhea Diseases 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 229950010864 guselkumab Drugs 0.000 description 1
- 229940047650 haemophilus influenzae Drugs 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 208000014829 head and neck neoplasm Diseases 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 229910001385 heavy metal Inorganic materials 0.000 description 1
- 229940037467 helicobacter pylori Drugs 0.000 description 1
- 238000009235 helminthic therapy Methods 0.000 description 1
- 201000005787 hematologic cancer Diseases 0.000 description 1
- 208000006750 hematuria Diseases 0.000 description 1
- 208000007475 hemolytic anemia Diseases 0.000 description 1
- 208000009429 hemophilia B Diseases 0.000 description 1
- 208000005252 hepatitis A Diseases 0.000 description 1
- 201000010284 hepatitis E Diseases 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 238000002657 hormone replacement therapy Methods 0.000 description 1
- 238000001794 hormone therapy Methods 0.000 description 1
- 238000009170 host modulatory therapy Methods 0.000 description 1
- 108700014293 human ALK1-Fc fusion Proteins 0.000 description 1
- 102000045556 human ALK1-Fc fusion Human genes 0.000 description 1
- 102000057041 human TNF Human genes 0.000 description 1
- 102000058223 human VEGFA Human genes 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 201000009162 human monocytic ehrlichiosis Diseases 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- 230000005661 hydrophobic surface Effects 0.000 description 1
- 208000007188 hymenolepiasis Diseases 0.000 description 1
- 238000002639 hyperbaric oxygen therapy Methods 0.000 description 1
- 201000006362 hypersensitivity vasculitis Diseases 0.000 description 1
- 238000009217 hyperthermia therapy Methods 0.000 description 1
- 201000006866 hypopharynx cancer Diseases 0.000 description 1
- 229950010245 ibalizumab Drugs 0.000 description 1
- 229960001001 ibritumomab tiuxetan Drugs 0.000 description 1
- 229950006359 icrucumab Drugs 0.000 description 1
- 229960002308 idarucizumab Drugs 0.000 description 1
- 229950002200 igovomab Drugs 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 229950003680 imalumab Drugs 0.000 description 1
- 229950007354 imciromab Drugs 0.000 description 1
- 229950005646 imgatuzumab Drugs 0.000 description 1
- 230000002519 immonomodulatory effect Effects 0.000 description 1
- 229940126546 immune checkpoint molecule Drugs 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000008073 immune recognition Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 238000002650 immunosuppressive therapy Methods 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 238000000126 in silico method Methods 0.000 description 1
- 238000000099 in vitro assay Methods 0.000 description 1
- 238000011503 in vivo imaging Methods 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 229950009230 inclacumab Drugs 0.000 description 1
- 201000001371 inclusion conjunctivitis Diseases 0.000 description 1
- 229950011428 indatuximab ravtansine Drugs 0.000 description 1
- 229910052738 indium Inorganic materials 0.000 description 1
- APFVFJFRJDLVQX-UHFFFAOYSA-N indium atom Chemical compound [In] APFVFJFRJDLVQX-UHFFFAOYSA-N 0.000 description 1
- 229950000932 indusatumab vedotin Drugs 0.000 description 1
- 229950005015 inebilizumab Drugs 0.000 description 1
- 239000003701 inert diluent Substances 0.000 description 1
- 201000011422 infant botulism Diseases 0.000 description 1
- 208000027866 inflammatory disease Diseases 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 229960000598 infliximab Drugs 0.000 description 1
- 208000019715 inherited Creutzfeldt-Jakob disease Diseases 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 229950007937 inolimomab Drugs 0.000 description 1
- 229950004101 inotuzumab ozogamicin Drugs 0.000 description 1
- 238000007689 inspection Methods 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 108010043603 integrin alpha4beta7 Proteins 0.000 description 1
- 102000006495 integrins Human genes 0.000 description 1
- 108010044426 integrins Proteins 0.000 description 1
- 229960003130 interferon gamma Drugs 0.000 description 1
- 102000014909 interleukin-1 receptor activity proteins Human genes 0.000 description 1
- 108040006732 interleukin-1 receptor activity proteins Proteins 0.000 description 1
- 108010074109 interleukin-22 Proteins 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- 229950001014 intetumumab Drugs 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 102000027411 intracellular receptors Human genes 0.000 description 1
- 108091008582 intracellular receptors Proteins 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 201000008893 intraocular retinoblastoma Diseases 0.000 description 1
- 238000009202 intraoperative electron radiation therapy Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 238000009208 inversion therapy Methods 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 229960005386 ipilimumab Drugs 0.000 description 1
- 229950010939 iratumumab Drugs 0.000 description 1
- 229910052742 iron Inorganic materials 0.000 description 1
- 230000002427 irreversible effect Effects 0.000 description 1
- 229950007752 isatuximab Drugs 0.000 description 1
- 201000002529 islet cell tumor Diseases 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 229950003818 itolizumab Drugs 0.000 description 1
- 229960005435 ixekizumab Drugs 0.000 description 1
- 229950010828 keliximab Drugs 0.000 description 1
- 206010023332 keratitis Diseases 0.000 description 1
- 208000022013 kidney Wilms tumor Diseases 0.000 description 1
- 201000010982 kidney cancer Diseases 0.000 description 1
- 210000001865 kupffer cell Anatomy 0.000 description 1
- 206010023497 kuru Diseases 0.000 description 1
- 229950000518 labetuzumab Drugs 0.000 description 1
- 229950000482 lampalizumab Drugs 0.000 description 1
- 108010032674 lampalizumab Proteins 0.000 description 1
- 229950005287 lanadelumab Drugs 0.000 description 1
- 229950006481 landogrozumab Drugs 0.000 description 1
- 229950010860 laprituximab emtansine Drugs 0.000 description 1
- 206010023841 laryngeal neoplasm Diseases 0.000 description 1
- 238000002647 laser therapy Methods 0.000 description 1
- 229950002183 lebrikizumab Drugs 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 229940115932 legionella pneumophila Drugs 0.000 description 1
- 229950001275 lemalesomab Drugs 0.000 description 1
- 229940126615 lendalizumab Drugs 0.000 description 1
- 229950007439 lenzilumab Drugs 0.000 description 1
- 229950010470 lerdelimumab Drugs 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 229940058170 letolizumab Drugs 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 229950002884 lexatumumab Drugs 0.000 description 1
- 229950005173 libivirumab Drugs 0.000 description 1
- 201000011486 lichen planus Diseases 0.000 description 1
- 229950004529 lifastuzumab vedotin Drugs 0.000 description 1
- 108020001756 ligand binding domains Proteins 0.000 description 1
- 229950009923 ligelizumab Drugs 0.000 description 1
- 206010071570 ligneous conjunctivitis Diseases 0.000 description 1
- 229950001237 lilotomab Drugs 0.000 description 1
- 229940126616 lilotomab satetraxetan Drugs 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 229950002950 lintuzumab Drugs 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 229920006008 lipopolysaccharide Polymers 0.000 description 1
- 108010013555 lipoprotein-associated coagulation inhibitor Proteins 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 1
- 239000008297 liquid dosage form Substances 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 229950011263 lirilumab Drugs 0.000 description 1
- 238000009136 lithium therapy Methods 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 201000007270 liver cancer Diseases 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 230000033001 locomotion Effects 0.000 description 1
- 229950006208 lodelcizumab Drugs 0.000 description 1
- 229950000359 lokivetmab Drugs 0.000 description 1
- 229950003526 lorvotuzumab mertansine Drugs 0.000 description 1
- 238000009196 low level laser therapy Methods 0.000 description 1
- 229950004563 lucatumumab Drugs 0.000 description 1
- 229950008140 lulizumab pegol Drugs 0.000 description 1
- 229950000128 lumiliximab Drugs 0.000 description 1
- HWYHZTIRURJOHG-UHFFFAOYSA-N luminol Chemical compound O=C1NNC(=O)C2=C1C(N)=CC=C2 HWYHZTIRURJOHG-UHFFFAOYSA-N 0.000 description 1
- 229950010079 lumretuzumab Drugs 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 208000001419 lymphocytic choriomeningitis Diseases 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 210000003712 lysosome Anatomy 0.000 description 1
- 230000001868 lysosomic effect Effects 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 238000009189 magnetic resonance therapy Methods 0.000 description 1
- 238000002653 magnetic therapy Methods 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 201000004792 malaria Diseases 0.000 description 1
- 201000003175 male breast cancer Diseases 0.000 description 1
- 208000010907 male breast carcinoma Diseases 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 208000026045 malignant tumor of parathyroid gland Diseases 0.000 description 1
- 229950001869 mapatumumab Drugs 0.000 description 1
- 229950003135 margetuximab Drugs 0.000 description 1
- 229950008083 maslimomab Drugs 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 229950008001 matuzumab Drugs 0.000 description 1
- 229950007254 mavrilimumab Drugs 0.000 description 1
- 238000009152 medical gas therapy Methods 0.000 description 1
- 238000009179 medical nutrition therapy Methods 0.000 description 1
- 208000037941 meningococcal disease Diseases 0.000 description 1
- 201000011475 meningoencephalitis Diseases 0.000 description 1
- 229960005108 mepolizumab Drugs 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 201000001198 metagonimiasis Diseases 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 230000001394 metastastic effect Effects 0.000 description 1
- 206010061289 metastatic neoplasm Diseases 0.000 description 1
- 208000037970 metastatic squamous neck cancer Diseases 0.000 description 1
- 229950005555 metelimumab Drugs 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 238000002493 microarray Methods 0.000 description 1
- 238000001768 microscale thermophoresis Methods 0.000 description 1
- 229950003734 milatuzumab Drugs 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- 229950002142 minretumomab Drugs 0.000 description 1
- 229950000035 mirvetuximab soravtansine Drugs 0.000 description 1
- 230000000116 mitigating effect Effects 0.000 description 1
- 229950003063 mitumomab Drugs 0.000 description 1
- 229950005674 modotuximab Drugs 0.000 description 1
- 229950007699 mogamulizumab Drugs 0.000 description 1
- 230000009149 molecular binding Effects 0.000 description 1
- 238000009127 molecular chaperone therapy Methods 0.000 description 1
- 230000004001 molecular interaction Effects 0.000 description 1
- 238000009126 molecular therapy Methods 0.000 description 1
- 229950001907 monalizumab Drugs 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 208000005871 monkeypox Diseases 0.000 description 1
- 229950008897 morolimumab Drugs 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 229950000720 moxetumomab pasudotox Drugs 0.000 description 1
- 206010051747 multiple endocrine neoplasia Diseases 0.000 description 1
- 208000010805 mumps infectious disease Diseases 0.000 description 1
- 229960003816 muromonab-cd3 Drugs 0.000 description 1
- 206010028320 muscle necrosis Diseases 0.000 description 1
- 206010028417 myasthenia gravis Diseases 0.000 description 1
- 201000006462 myelodysplastic/myeloproliferative neoplasm Diseases 0.000 description 1
- ZTLGJPIZUOVDMT-UHFFFAOYSA-N n,n-dichlorotriazin-4-amine Chemical compound ClN(Cl)C1=CC=NN=N1 ZTLGJPIZUOVDMT-UHFFFAOYSA-N 0.000 description 1
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 description 1
- OHDXDNUPVVYWOV-UHFFFAOYSA-N n-methyl-1-(2-naphthalen-1-ylsulfanylphenyl)methanamine Chemical compound CNCC1=CC=CC=C1SC1=CC=CC2=CC=CC=C12 OHDXDNUPVVYWOV-UHFFFAOYSA-N 0.000 description 1
- 229950003027 nacolomab tafenatox Drugs 0.000 description 1
- 229950007708 namilumab Drugs 0.000 description 1
- 229950009793 naptumomab estafenatox Drugs 0.000 description 1
- 229950001422 naratuximab emtansine Drugs 0.000 description 1
- 201000003631 narcolepsy Diseases 0.000 description 1
- 229950008353 narnatumab Drugs 0.000 description 1
- 229960005027 natalizumab Drugs 0.000 description 1
- 229950005790 navicixizumab Drugs 0.000 description 1
- 229950010591 navivumab Drugs 0.000 description 1
- 229960002915 nebacumab Drugs 0.000 description 1
- 229960000513 necitumumab Drugs 0.000 description 1
- 238000009182 negative air ionization therapy Methods 0.000 description 1
- 229950010012 nemolizumab Drugs 0.000 description 1
- 201000008383 nephritis Diseases 0.000 description 1
- 229950009675 nerelimomab Drugs 0.000 description 1
- 229950002697 nesvacumab Drugs 0.000 description 1
- 238000009203 neutron therapy Methods 0.000 description 1
- 208000004235 neutropenia Diseases 0.000 description 1
- 210000000440 neutrophil Anatomy 0.000 description 1
- 229950010203 nimotuzumab Drugs 0.000 description 1
- 229960003301 nivolumab Drugs 0.000 description 1
- 244000309711 non-enveloped viruses Species 0.000 description 1
- 230000009871 nonspecific binding Effects 0.000 description 1
- 229960003419 obiltoxaximab Drugs 0.000 description 1
- 229950009090 ocaratuzumab Drugs 0.000 description 1
- 229950005751 ocrelizumab Drugs 0.000 description 1
- 201000008106 ocular cancer Diseases 0.000 description 1
- 208000015200 ocular cicatricial pemphigoid Diseases 0.000 description 1
- 208000003177 ocular onchocerciasis Diseases 0.000 description 1
- 229950010465 odulimomab Drugs 0.000 description 1
- 229960002450 ofatumumab Drugs 0.000 description 1
- 229950008516 olaratumab Drugs 0.000 description 1
- 229920001542 oligosaccharide Polymers 0.000 description 1
- 150000002482 oligosaccharides Chemical class 0.000 description 1
- 229950010006 olokizumab Drugs 0.000 description 1
- 229960000470 omalizumab Drugs 0.000 description 1
- 229950000846 onartuzumab Drugs 0.000 description 1
- 208000002042 onchocerciasis Diseases 0.000 description 1
- 229950002104 ontuxizumab Drugs 0.000 description 1
- 229950010704 opicinumab Drugs 0.000 description 1
- 208000003692 opisthorchiasis Diseases 0.000 description 1
- 229950009057 oportuzumab monatox Drugs 0.000 description 1
- 238000002671 oral rehydration therapy Methods 0.000 description 1
- 229950007283 oregovomab Drugs 0.000 description 1
- 201000000901 ornithosis Diseases 0.000 description 1
- 201000006958 oropharynx cancer Diseases 0.000 description 1
- 229950009007 orticumab Drugs 0.000 description 1
- 229950002610 otelixizumab Drugs 0.000 description 1
- 229950000121 otlertuzumab Drugs 0.000 description 1
- 229950003709 oxelumab Drugs 0.000 description 1
- 238000002640 oxygen therapy Methods 0.000 description 1
- 229950009723 ozanezumab Drugs 0.000 description 1
- 229950004327 ozoralizumab Drugs 0.000 description 1
- 229950010626 pagibaximab Drugs 0.000 description 1
- 229960000402 palivizumab Drugs 0.000 description 1
- 238000009116 palliative therapy Methods 0.000 description 1
- 229950003481 pamrevlumab Drugs 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 208000008443 pancreatic carcinoma Diseases 0.000 description 1
- 229960001972 panitumumab Drugs 0.000 description 1
- 229940126618 pankomab Drugs 0.000 description 1
- 229950003570 panobacumab Drugs 0.000 description 1
- 208000003154 papilloma Diseases 0.000 description 1
- 208000029211 papillomatosis Diseases 0.000 description 1
- 208000007312 paraganglioma Diseases 0.000 description 1
- 206010033794 paragonimiasis Diseases 0.000 description 1
- 230000003071 parasitic effect Effects 0.000 description 1
- 229950004260 parsatuzumab Drugs 0.000 description 1
- 238000002727 particle therapy Methods 0.000 description 1
- 229950011485 pascolizumab Drugs 0.000 description 1
- 229950000037 pasotuxizumab Drugs 0.000 description 1
- 201000005115 pasteurellosis Diseases 0.000 description 1
- 229950003522 pateclizumab Drugs 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 230000001991 pathophysiological effect Effects 0.000 description 1
- 229950010966 patritumab Drugs 0.000 description 1
- 229960005570 pemtumomab Drugs 0.000 description 1
- 229950011098 pendetide Drugs 0.000 description 1
- 229940067082 pentetate Drugs 0.000 description 1
- 229950005079 perakizumab Drugs 0.000 description 1
- 208000033808 peripheral neuropathy Diseases 0.000 description 1
- 201000002628 peritoneum cancer Diseases 0.000 description 1
- 229960002087 pertuzumab Drugs 0.000 description 1
- 229950003203 pexelizumab Drugs 0.000 description 1
- 238000001066 phage therapy Methods 0.000 description 1
- 239000008177 pharmaceutical agent Substances 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 230000003285 pharmacodynamic effect Effects 0.000 description 1
- 208000028591 pheochromocytoma Diseases 0.000 description 1
- 238000009143 phonemic neurological hypochromium therapy Methods 0.000 description 1
- 238000002428 photodynamic therapy Methods 0.000 description 1
- 238000007626 photothermal therapy Methods 0.000 description 1
- 238000000554 physical therapy Methods 0.000 description 1
- 230000001766 physiological effect Effects 0.000 description 1
- 229950010773 pidilizumab Drugs 0.000 description 1
- 229950010074 pinatuzumab vedotin Drugs 0.000 description 1
- 229940126620 pintumomab Drugs 0.000 description 1
- 208000010916 pituitary tumor Diseases 0.000 description 1
- 201000000508 pityriasis versicolor Diseases 0.000 description 1
- 210000002826 placenta Anatomy 0.000 description 1
- 230000003169 placental effect Effects 0.000 description 1
- 229950008092 placulumab Drugs 0.000 description 1
- 208000010626 plasma cell neoplasm Diseases 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229950004423 plozalizumab Drugs 0.000 description 1
- 229940126621 pogalizumab Drugs 0.000 description 1
- 229950009416 polatuzumab vedotin Drugs 0.000 description 1
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 201000006292 polyarteritis nodosa Diseases 0.000 description 1
- 239000004633 polyglycolic acid Substances 0.000 description 1
- 229920002704 polyhistidine Polymers 0.000 description 1
- 239000004626 polylactic acid Substances 0.000 description 1
- 208000005987 polymyositis Diseases 0.000 description 1
- 230000007824 polyneuropathy Effects 0.000 description 1
- 229950003486 ponezumab Drugs 0.000 description 1
- 231100000683 possible toxicity Toxicity 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 238000004321 preservation Methods 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 229940126623 prezalizumab Drugs 0.000 description 1
- 229950003700 priliximab Drugs 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 201000000742 primary sclerosing cholangitis Diseases 0.000 description 1
- 229950011407 pritoxaximab Drugs 0.000 description 1
- 229950009904 pritumumab Drugs 0.000 description 1
- 239000000186 progesterone Substances 0.000 description 1
- 229960003387 progesterone Drugs 0.000 description 1
- 206010036807 progressive multifocal leukoencephalopathy Diseases 0.000 description 1
- 239000012562 protein A resin Substances 0.000 description 1
- 238000009163 protein therapy Methods 0.000 description 1
- 231100000654 protein toxin Toxicity 0.000 description 1
- 238000002661 proton therapy Methods 0.000 description 1
- 208000005069 pulmonary fibrosis Diseases 0.000 description 1
- 238000009188 pulsed electromagnetic field therapy Methods 0.000 description 1
- 208000009954 pyoderma gangrenosum Diseases 0.000 description 1
- 229950003033 quilizumab Drugs 0.000 description 1
- 229950011613 racotumomab Drugs 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 230000004223 radioprotective effect Effects 0.000 description 1
- 229950011639 radretumab Drugs 0.000 description 1
- 229950002786 rafivirumab Drugs 0.000 description 1
- 229950009885 ralpancizumab Drugs 0.000 description 1
- 229960002633 ramucirumab Drugs 0.000 description 1
- 238000002708 random mutagenesis Methods 0.000 description 1
- 229960003876 ranibizumab Drugs 0.000 description 1
- 229960004910 raxibacumab Drugs 0.000 description 1
- 206010038038 rectal cancer Diseases 0.000 description 1
- 201000001275 rectum cancer Diseases 0.000 description 1
- 230000000306 recurrent effect Effects 0.000 description 1
- 229950000987 refanezumab Drugs 0.000 description 1
- 239000013074 reference sample Substances 0.000 description 1
- 229950005854 regavirumab Drugs 0.000 description 1
- 238000009155 rehydration therapy Methods 0.000 description 1
- 208000007865 relapsing fever Diseases 0.000 description 1
- 208000009169 relapsing polychondritis Diseases 0.000 description 1
- 208000015347 renal cell adenocarcinoma Diseases 0.000 description 1
- 208000030859 renal pelvis/ureter urothelial carcinoma Diseases 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 229960003254 reslizumab Drugs 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 208000030925 respiratory syncytial virus infectious disease Diseases 0.000 description 1
- 238000002644 respiratory therapy Methods 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- 201000003068 rheumatic fever Diseases 0.000 description 1
- 229940046939 rickettsia prowazekii Drugs 0.000 description 1
- 229940075118 rickettsia rickettsii Drugs 0.000 description 1
- 229950003238 rilotumumab Drugs 0.000 description 1
- 229950005978 rinucumab Drugs 0.000 description 1
- 229950007943 risankizumab Drugs 0.000 description 1
- 229950004441 rivabazumab pegol Drugs 0.000 description 1
- 229950001808 robatumumab Drugs 0.000 description 1
- 229950010699 roledumab Drugs 0.000 description 1
- 229950010968 romosozumab Drugs 0.000 description 1
- 229950010316 rontalizumab Drugs 0.000 description 1
- 229950006765 rovalpituzumab tesirine Drugs 0.000 description 1
- 229950009092 rovelizumab Drugs 0.000 description 1
- 201000005404 rubella Diseases 0.000 description 1
- 239000012146 running buffer Substances 0.000 description 1
- 229950005374 ruplizumab Drugs 0.000 description 1
- 229950000143 sacituzumab govitecan Drugs 0.000 description 1
- ULRUOUDIQPERIJ-PQURJYPBSA-N sacituzumab govitecan Chemical compound N([C@@H](CCCCN)C(=O)NC1=CC=C(C=C1)COC(=O)O[C@]1(CC)C(=O)OCC2=C1C=C1N(C2=O)CC2=C(C3=CC(O)=CC=C3N=C21)CC)C(=O)COCC(=O)NCCOCCOCCOCCOCCOCCOCCOCCOCCN(N=N1)C=C1CNC(=O)C(CC1)CCC1CN1C(=O)CC(SC[C@H](N)C(O)=O)C1=O ULRUOUDIQPERIJ-PQURJYPBSA-N 0.000 description 1
- 206010039447 salmonellosis Diseases 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 238000009118 salvage therapy Methods 0.000 description 1
- 229950000106 samalizumab Drugs 0.000 description 1
- 238000005070 sampling Methods 0.000 description 1
- 201000000306 sarcoidosis Diseases 0.000 description 1
- 229950006348 sarilumab Drugs 0.000 description 1
- 229950007308 satumomab Drugs 0.000 description 1
- 208000005687 scabies Diseases 0.000 description 1
- 210000004761 scalp Anatomy 0.000 description 1
- 201000004409 schistosomiasis Diseases 0.000 description 1
- 208000010157 sclerosing cholangitis Diseases 0.000 description 1
- 229960004540 secukinumab Drugs 0.000 description 1
- 229910052711 selenium Inorganic materials 0.000 description 1
- 239000011669 selenium Substances 0.000 description 1
- 239000008299 semisolid dosage form Substances 0.000 description 1
- 229950008834 seribantumab Drugs 0.000 description 1
- 238000002333 serotherapy Methods 0.000 description 1
- 229950003850 setoxaximab Drugs 0.000 description 1
- 229950004951 sevirumab Drugs 0.000 description 1
- 125000005629 sialic acid group Chemical group 0.000 description 1
- 229950008684 sibrotuzumab Drugs 0.000 description 1
- 229950010077 sifalimumab Drugs 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 229960003323 siltuximab Drugs 0.000 description 1
- 229950009513 simtuzumab Drugs 0.000 description 1
- 238000009097 single-agent therapy Methods 0.000 description 1
- 229950003804 siplizumab Drugs 0.000 description 1
- 229950006094 sirukumab Drugs 0.000 description 1
- 238000004513 sizing Methods 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 201000008261 skin carcinoma Diseases 0.000 description 1
- 208000000587 small cell lung carcinoma Diseases 0.000 description 1
- 201000002314 small intestine cancer Diseases 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- 229950003763 sofituzumab vedotin Drugs 0.000 description 1
- 229950007874 solanezumab Drugs 0.000 description 1
- 239000007909 solid dosage form Substances 0.000 description 1
- 229950011267 solitomab Drugs 0.000 description 1
- 229950006551 sontuzumab Drugs 0.000 description 1
- 238000001179 sorption measurement Methods 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- DUYSYHSSBDVJSM-KRWOKUGFSA-N sphingosine 1-phosphate Chemical compound CCCCCCCCCCCCC\C=C\[C@@H](O)[C@@H](N)COP(O)(O)=O DUYSYHSSBDVJSM-KRWOKUGFSA-N 0.000 description 1
- 210000004988 splenocyte Anatomy 0.000 description 1
- 206010041823 squamous cell carcinoma Diseases 0.000 description 1
- 229950002549 stamulumab Drugs 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 201000002190 staphyloenterotoxemia Diseases 0.000 description 1
- 230000003068 static effect Effects 0.000 description 1
- 238000009199 stereotactic radiation therapy Methods 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 229940031000 streptococcus pneumoniae Drugs 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 229950010708 sulesomab Drugs 0.000 description 1
- 229910052717 sulfur Inorganic materials 0.000 description 1
- 239000011593 sulfur Substances 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 229950001915 suvizumab Drugs 0.000 description 1
- 230000008961 swelling Effects 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 208000006379 syphilis Diseases 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 229950010265 tabalumab Drugs 0.000 description 1
- 229950001072 tadocizumab Drugs 0.000 description 1
- 101150047061 tag-72 gene Proteins 0.000 description 1
- 229950004218 talizumab Drugs 0.000 description 1
- 229950009696 tamtuvetmab Drugs 0.000 description 1
- 238000004885 tandem mass spectrometry Methods 0.000 description 1
- 229950008160 tanezumab Drugs 0.000 description 1
- 229950001603 taplitumomab paptox Drugs 0.000 description 1
- 229950007435 tarextumab Drugs 0.000 description 1
- 238000002626 targeted therapy Methods 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 229950000864 technetium (99mtc) nofetumomab merpentan Drugs 0.000 description 1
- 229950001788 tefibazumab Drugs 0.000 description 1
- 229950008300 telimomab aritox Drugs 0.000 description 1
- CBPNZQVSJQDFBE-HGVVHKDOSA-N temsirolimus Chemical compound C1C[C@@H](OC(=O)C(C)(CO)CO)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CCC2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 CBPNZQVSJQDFBE-HGVVHKDOSA-N 0.000 description 1
- 229950001289 tenatumomab Drugs 0.000 description 1
- 229950000301 teneliximab Drugs 0.000 description 1
- 229950010127 teplizumab Drugs 0.000 description 1
- 229950010259 teprotumumab Drugs 0.000 description 1
- BWMISRWJRUSYEX-SZKNIZGXSA-N terbinafine hydrochloride Chemical compound Cl.C1=CC=C2C(CN(C\C=C\C#CC(C)(C)C)C)=CC=CC2=C1 BWMISRWJRUSYEX-SZKNIZGXSA-N 0.000 description 1
- 229950009054 tesidolumab Drugs 0.000 description 1
- 238000012956 testing procedure Methods 0.000 description 1
- 229950008998 tezepelumab Drugs 0.000 description 1
- 229940126585 therapeutic drug Drugs 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- 229950004742 tigatuzumab Drugs 0.000 description 1
- 229950005515 tildrakizumab Drugs 0.000 description 1
- 229950006757 timolumab Drugs 0.000 description 1
- 201000009642 tinea barbae Diseases 0.000 description 1
- 201000003875 tinea corporis Diseases 0.000 description 1
- 229950004269 tisotumab vedotin Drugs 0.000 description 1
- 230000003614 tolerogenic effect Effects 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 229950001802 toralizumab Drugs 0.000 description 1
- 229950008836 tosatoxumab Drugs 0.000 description 1
- 229960005267 tositumomab Drugs 0.000 description 1
- 229950005808 tovetumab Drugs 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 206010044325 trachoma Diseases 0.000 description 1
- 229950000835 tralokinumab Drugs 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 238000009148 transdermal continuous oxygen therapy Methods 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 208000009174 transverse myelitis Diseases 0.000 description 1
- 229960000575 trastuzumab Drugs 0.000 description 1
- 229960001612 trastuzumab emtansine Drugs 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- 108010075758 trebananib Proteins 0.000 description 1
- 229950010086 tregalizumab Drugs 0.000 description 1
- 229950006444 trevogrumab Drugs 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 229940096911 trichinella spiralis Drugs 0.000 description 1
- 208000003982 trichinellosis Diseases 0.000 description 1
- 201000007588 trichinosis Diseases 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- 201000008827 tuberculosis Diseases 0.000 description 1
- 229950003364 tucotuzumab celmoleukin Drugs 0.000 description 1
- 108700008509 tucotuzumab celmoleukin Proteins 0.000 description 1
- 229950005082 tuvirumab Drugs 0.000 description 1
- 201000008297 typhoid fever Diseases 0.000 description 1
- 206010061393 typhus Diseases 0.000 description 1
- 229950004593 ublituximab Drugs 0.000 description 1
- 229950010095 ulocuplumab Drugs 0.000 description 1
- 238000009192 ultraviolet light therapy Methods 0.000 description 1
- ORHBXUUXSCNDEV-UHFFFAOYSA-N umbelliferone Chemical compound C1=CC(=O)OC2=CC(O)=CC=C21 ORHBXUUXSCNDEV-UHFFFAOYSA-N 0.000 description 1
- HFTAFOQKODTIJY-UHFFFAOYSA-N umbelliferone Natural products Cc1cc2C=CC(=O)Oc2cc1OCC=CC(C)(C)O HFTAFOQKODTIJY-UHFFFAOYSA-N 0.000 description 1
- 108020005087 unfolded proteins Proteins 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 229950005972 urelumab Drugs 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 229950004362 urtoxazumab Drugs 0.000 description 1
- 229960003824 ustekinumab Drugs 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 208000037965 uterine sarcoma Diseases 0.000 description 1
- 229950003520 utomilumab Drugs 0.000 description 1
- 238000001291 vacuum drying Methods 0.000 description 1
- 238000009777 vacuum freeze-drying Methods 0.000 description 1
- 229950001694 vadastuximab talirine Drugs 0.000 description 1
- BNJNAEJASPUJTO-DUOHOMBCSA-N vadastuximab talirine Chemical compound COc1ccc(cc1)C2=CN3[C@@H](C2)C=Nc4cc(OCCCOc5cc6N=C[C@@H]7CC(=CN7C(=O)c6cc5OC)c8ccc(NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)CCCCCN9C(=O)C[C@@H](SC[C@H](N)C(=O)O)C9=O)C(C)C)cc8)c(OC)cc4C3=O BNJNAEJASPUJTO-DUOHOMBCSA-N 0.000 description 1
- 206010046885 vaginal cancer Diseases 0.000 description 1
- 208000013139 vaginal neoplasm Diseases 0.000 description 1
- 238000010200 validation analysis Methods 0.000 description 1
- 229950001876 vandortuzumab vedotin Drugs 0.000 description 1
- 229950008718 vantictumab Drugs 0.000 description 1
- 229950000449 vanucizumab Drugs 0.000 description 1
- 229950000386 vapaliximab Drugs 0.000 description 1
- 201000006266 variola major Diseases 0.000 description 1
- 201000000627 variola minor Diseases 0.000 description 1
- 208000014016 variola minor infection Diseases 0.000 description 1
- 229950001067 varlilumab Drugs 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 210000003556 vascular endothelial cell Anatomy 0.000 description 1
- 229950002148 vatelizumab Drugs 0.000 description 1
- 229960004914 vedolizumab Drugs 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 229950000815 veltuzumab Drugs 0.000 description 1
- 229950005208 vepalimomab Drugs 0.000 description 1
- 210000003501 vero cell Anatomy 0.000 description 1
- 229950010789 vesencumab Drugs 0.000 description 1
- 229940118696 vibrio cholerae Drugs 0.000 description 1
- 208000016808 vibrio vulnificus infectious disease Diseases 0.000 description 1
- 210000005048 vimentin Anatomy 0.000 description 1
- 208000009421 viral pneumonia Diseases 0.000 description 1
- 238000000316 virotherapy Methods 0.000 description 1
- 229950004393 visilizumab Drugs 0.000 description 1
- 229950007269 vobarilizumab Drugs 0.000 description 1
- 229950001212 volociximab Drugs 0.000 description 1
- 102100036537 von Willebrand factor Human genes 0.000 description 1
- 229950003511 votumumab Drugs 0.000 description 1
- 201000005102 vulva cancer Diseases 0.000 description 1
- 235000012431 wafers Nutrition 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 229950008915 xentuzumab Drugs 0.000 description 1
- 229940051021 yellow-fever virus Drugs 0.000 description 1
- 229940098232 yersinia enterocolitica Drugs 0.000 description 1
- 229950008250 zalutumumab Drugs 0.000 description 1
- 229950009002 zanolimumab Drugs 0.000 description 1
- 229950009083 ziralimumab Drugs 0.000 description 1
- 229950001346 zolimomab aritox Drugs 0.000 description 1
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
- C07K16/1002—Coronaviridae
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
- C07K16/1027—Paramyxoviridae, e.g. respiratory syncytial virus
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
- C07K16/1081—Togaviridae, e.g. flavivirus, rubella virus, hog cholera virus
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/12—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from bacteria
- C07K16/1267—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from bacteria from Gram-positive bacteria
- C07K16/1282—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from bacteria from Gram-positive bacteria from Clostridium (G)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/524—CH2 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/72—Increased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/734—Complement-dependent cytotoxicity [CDC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
-
- Y02A50/403—
-
- Y02A50/416—
-
- Y02A50/487—
Definitions
- Monoclonal antibody therapies are a class of immunotherapies that involve monoclonal antibodies (mAbs) that are capable of specifically interacting with disease-relevant biological molecules.
- mAbs monoclonal antibodies
- the disease areas that therapeutic antibodies can target have significantly expanded, and a number of monoclonal antibodies and antibody-derivative products have been approved for therapeutic use in the United States and many other countries.
- Monoclonal antibody therapies are currently used or investigated for treating various diseases or conditions, including, for example, infectious diseases, cancer, immune diseases, organ transplantation, cardiovascular diseases, and metabolic diseases.
- monoclonal antibodies can be achieved by different mechanisms of action (Suzuki et al. J Toxicol Pathol. 2015; 28(3): 133-139). Many therapeutic antibodies neutralize the pathophysiological function of their target molecules or cells. In recent years, monoclonal antibodies that block immune checkpoints have been used to enhance antitumor immunity in cancer patients with the potential to produce durable clinical responses. Certain monoclonal antibodies can trigger antibody-dependent cell-mediated cytotoxic (ADCC) activity or complement-dependent cytotoxic (CDC) activity. Monoclonal antibodies can also be used as drug delivery carriers, for example, when conjugated to radioisotopes, toxins, or other therapeutic or diagnostic agents.
- ADCC antibody-dependent cell-mediated cytotoxic
- CDC complement-dependent cytotoxic
- polypeptides e.g., antibody molecules or fusion proteins
- polypeptides e.g., antibody molecules or fusion proteins
- polypeptides that comprise an Fc region of an immunoglobulin, and that comprise one or more of the structural or functional properties disclosed herein.
- nucleic acid molecules encoding the polypeptides, expression vectors, host cells, compositions (e.g., pharmaceutical compositions), kits, containers, and methods for making the polypeptides (e.g., antibody molecules or fusion proteins), are also provided.
- the polypeptides (e.g., antibody molecules or fusion proteins) disclosed herein can be used (alone or in combination with other agents or therapeutic modalities) to treat, prevent, and/or diagnose disorders, such as disorders and conditions disclosed herein.
- the disclosure features a polypeptide, e.g., an antibody molecule or fusion protein, comprising an Fc region, wherein the Fc region comprises a mutation, and wherein the polypeptide has one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or all) of the following properties:
- a) has an increased binding affinity (e.g., a decreased dissociation constant (K d )) for a neonatal Fc receptor (FcRn), e.g., at a pH between 6.0 and 6.5 (e.g., at pH 6.0), e.g., at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, or 50-fold increase, compared to a reference polypeptide, e.g., as determined by an octet-based assay or a cell-based assay;
- K d dissociation constant
- FcRn neonatal Fc receptor
- b) has a higher binding affinity (e.g., a lower dissociation constant (K d )) for an FcRn at a pH between 6.0 and 6.5 (e.g., at pH 6.0), e.g., at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold higher, than the binding affinity at a pH between 7.0 and 7.4 (e.g., at pH 7.4), e.g., as determined by an octet-based assay or a cell-based assay;
- K d dissociation constant
- c) binds to an FcRn with high affinity, e.g., at a pH between 6.0 and 6.5 (e.g., at pH 6.0), e.g., with a dissociation constant (K d ) of 300 nM or less, e.g., 250 nM or less, 200 nM or less, 150 nM or less, 100 nM or less, 50 nM or less, e.g., 25 nM or less, 10 nM or less, 5 nM or less, 2 nM or less, 1 nM or less, 0.5 nM or less, 0.2 nM or less, 0.1 nM or less, 0.05 nM or less, 0.02 nM or less, or 0.01 nM or less, e.g., between 25 nM and 0.1 nM, between 20 nM and 0.5 nM, between 15 nM and 1 nM, between 10 nM and 5 nM, or
- d) binds to an FcRn with low affinity e.g., at a pH between 7.0 and 7.4 (e.g., at pH 7.4), e.g., with a K d of 50 nM or more, e.g., 60 nM or more, 80 nM or more, 100 nM or more, 150 nM or more, 200 nM or more, 500 nM or more, e.g., between 50 nM and 500 nM or between 100 nM and 250 nM, e.g., as determined by an octet-based assay or a cell-based assay;
- e has the same binding affinity, does not substantially alter (e.g., decreases or increases by no more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) the binding affinity, or increases the binding affinity (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), for an Fc ⁇ receptor (e.g., one, two, or all of Fc ⁇ RI, Fc ⁇ RIIa/b, or Fc ⁇ RIII), compared to a reference polypeptide, e.g., as determined by an octet-based assay or a cell-based assay;
- f has the same thermal stability, or does not substantially alter (e.g., increases or decreases the melting temperature by no more than 1° C., 2° C., 3° C., 4° C., 5° C., 6° C., 7° C., 8° C., 9° C., or 10° C.), the thermal stability, compared to a reference polypeptide, e.g., as determined by a sypro orange assay;
- g has the same binding affinity, does not substantially alter (e.g., decreases or increases by no more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) the binding affinity, or increases the binding affinity (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), for C1q, compared to a reference polypeptide, e.g., as determined by ELISA;
- h has the same binding affinity, does not substantially alter (e.g., decreases or increases by no more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) the binding affinity, or increases the binding affinity (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), for TRIM21, compared to a reference polypeptide, e.g., as determined by ELISA;
- i) has the same effector function, or does not substantially alter (e.g., decreases or increases by more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) an effector function, or increases an effector function (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), e.g., one or more (e.g., two, three, or all) of a complement dependent cytotoxicity (CDC), an antibody dependent cell mediated cytotoxicity (ADCC), an antibody dependent cell mediated phagocytosis (ADCP), or an antibody dependent intracellular neutralization (ADIN), compared to a reference polypeptide;
- CDC complement dependent cytotoxicity
- ADCC antibody dependent cell mediated cytotoxicity
- ADCP antibody dependent cell mediated phagocytosis
- ADIN antibody dependent intracellular neutralization
- j) has an increased half-life in vivo, e.g., at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, or 10-fold increase, compared to a reference polypeptide, e.g., as determined in an animal model;
- k has the same biological function, does not substantially alter (e.g., decreases or increases by no more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) a biological function, or increases a biological function (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), in vitro, ex vivo, or in vivo, compared to a reference polypeptide;
- l has the same developability characteristic, does not substantially alter (e.g., decreases or increases by no more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) a developability characteristic, or increases a developability characteristic (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), e.g., one or more (e.g., two, three, or all) of stability, solubility, aggregation, or expression level, compared to a reference polypeptide;
- m has the same binding affinity, specificity, or both, or does not substantially alter (e.g., decreases or increases by no more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) the binding affinity, specificity, or both, or increases the binding affinity, specificity, or both (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), for an epitope, compared to a reference polypeptide; or
- n increases mucosal uptake, e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, or 50-fold, compared to a reference polypeptide, e.g., as determined by a transcytosis assay.
- the polypeptide has an increased binding affinity (e.g., a decreased dissociation constant (K d )) for a neonatal Fc receptor (FcRn), e.g., at a pH between 6.0 and 6.5 (e.g., at pH 6.0), e.g., at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, or 50-fold increase, compared to a reference polypeptide, e.g., as determined by an octet-based assay or a cell-based assay.
- K d dissociation constant
- FcRn neonatal Fc receptor
- the polypeptide has a higher binding affinity (e.g., a lower dissociation constant (K d )) for an FcRn at a pH between 6.0 and 6.5 (e.g., at pH 6.0), e.g., at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold higher, than the binding affinity at a pH between 7.0 and 7.4 (e.g., at pH 7.4), e.g., as determined by an octet-based assay or a cell-based assay.
- K d dissociation constant
- the polypeptide binds to an FcRn with high affinity e.g., at a pH between 6.0 and 6.5 (e.g., at pH 6.0), e.g., with a dissociation constant (K d ) of 50 nM or less, e.g., 25 nM or less, 10 nM or less, 5 nM or less, 2 nM or less, 1 nM or less, 0.5 nM or less, 0.2 nM or less, 0.1 nM or less, 0.05 nM or less, 0.02 nM or less, or 0.01 nM or less, e.g., between 25 nM and 0.1 nM, between 20 nM and 0.5 nM, between 15 nM and 1 nM, between 10 nM and 5 nM, or between 20 nM and 10 nM, e.g., as determined by an octet-based assay or a cell-based assay or
- the polypeptide binds to an FcRn with low affinity e.g., at a pH between 7.0 and 7.4 (e.g., at pH 7.4), e.g., with a K d of 50 nM or more, e.g., 60 nM or more, 80 nM or more, 100 nM or more, 150 nM or more, 200 nM or more, 500 nM or more, e.g., between 50 nM and 500 nM or between 100 nM and 250 nM, e.g., as determined by an octet-based assay or a cell-based assay.
- a K d of 50 nM or more, e.g., 60 nM or more, 80 nM or more, 100 nM or more, 150 nM or more, 200 nM or more, 500 nM or more, e.g., between 50 nM and 500 nM or between 100 nM and
- the polypeptide has the same binding affinity, does not substantially alter (e.g., decreases or increases by no more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) the binding affinity, or increases the binding affinity (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), for an Fc ⁇ receptor (e.g., one, two, or all of Fc ⁇ RI, Fc ⁇ RIIa/b, or Fc ⁇ RIII), compared to a reference polypeptide, e.g., as determined by an octet-based assay or a cell-based assay.
- an Fc ⁇ receptor e.g., one, two, or all of Fc ⁇ RI, Fc ⁇ RIIa/b, or Fc ⁇ RIII
- the polypeptide has the same thermal stability, or does not substantially alter (e.g., increases or decreases the melting temperature by no more than 1° C., 2° C., 3° C., 4° C., 5° C., 6° C., 7° C., 8° C., 9° C., or 10° C.), the thermal stability, compared to a reference polypeptide, e.g., as determined by a sypro orange assay.
- the polypeptide has the same binding affinity, does not substantially alter (e.g., decreases or increases by no more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) the binding affinity, or increases the binding affinity (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), for C1q, compared to a reference polypeptide, e.g., as determined by ELISA.
- the polypeptide has the same binding affinity, does not substantially alter (e.g., decreases or increases by no more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) the binding affinity, or increases the binding affinity (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), for TRIM21, compared to a reference polypeptide, e.g., as determined by ELISA.
- the polypeptide has the same effector function, or does not substantially alter (e.g., decreases or increases by more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) an effector function, or increases an effector function (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), e.g., one or more (e.g., two, three, or all) of a complement dependent cytotoxicity (CDC), an antibody dependent cell mediated cytotoxicity (ADCC), an antibody dependent cell mediated phagocytosis (ADCP), or an antibody dependent intracellular neutralization (ADIN), compared to a reference polypeptide.
- CDC complement dependent cytotoxicity
- ADCC antibody dependent cell mediated cytotoxicity
- ADCP antibody dependent cell mediated phagocytosis
- ADIN antibody dependent intracellular neutralization
- the polypeptide has an increased half-life in vivo, e.g., at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, or 10-fold increase, compared to a reference polypeptide, e.g., as determined in an animal model.
- the polypeptide has the same biological function, does not substantially alter (e.g., decreases or increases by no more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) a biological function, or increases a biological function (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), in vitro, ex vivo, or in vivo, compared to a reference polypeptide.
- the biological function comprises an inhibitory (e.g., neutralizing) activity.
- the biological function comprises inhibiting (e.g., neutralizing) a pathogen, e.g., a virus, a bacterium, or a fungus.
- the biological function comprising an anti-tumor activity.
- the biological function comprises inhibiting an immune response.
- the biological function comprises an agonistic activity.
- the biological function comprises activating or restoring an immune response.
- the polypeptide has the same developability characteristic, does not substantially alter (e.g., decreases or increases by no more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) a developability characteristic, or increases a developability characteristic (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), e.g., one or more (e.g., two, three, or all) of stability, solubility, aggregation, or expression level, compared to a reference polypeptide;
- the polypeptide has the same binding affinity, specificity, or both, or does not substantially alter (e.g., decreases or increases by no more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) the binding affinity, specificity, or both, or increases the binding affinity, specificity, or both (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), for an epitope, compared to a reference polypeptide.
- the polypeptide increases mucosal uptake, e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, or 50-fold, compared to a reference polypeptide, e.g., as determined by a transcytosis assay.
- the polypeptide has properties a) or b) above. In an embodiment, the polypeptide has properties a) and b) above. In an embodiment, the polypeptide has one or both of properties a) or b) above, and one or both of properties c) or d) above. In an embodiment, the polypeptide has one or both of properties a) or b) above, and one, two, three, four, or all of properties e), f), g), h), or i) above. In an embodiment, the polypeptide has one or both of properties a) or b) above, and one or both of properties c) or d) above.
- the polypeptide has one or both of properties a) or b) above, and one, two, three, four, five, six, or all of properties c), d), j), k), l), m), or n) above.
- the polypeptide has one or both of properties a) or b) above, one, two, three, four, or all of properties e), f), g), h), or i) above, and one, two, three, four, five, six, or all of properties c), d), j), k), l), m), or n) above.
- the polypeptide has one, two, three, or all of properties a), b), c), or d) above, one, two, three, four, or all of properties e), f), g), h), or i) above, and one, two, three, four, or all of properties j), k), l), m), or n) above.
- the polypeptide has one or both of properties a) or c) above, one or both of properties b) or d) above, one, two, three, four, or all of properties e), f), g), h), or i) above, and one, two, three, four, or all of properties j), k), l), m), or n) above.
- the reference polypeptide is an otherwise identical polypeptide without the mutation, e.g., comprising a wild-type Fc region, e.g., having the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or 15 amino acid residues.
- the mutation is in a residue in a CH2 domain In another embodiment, the mutation is in a residue in a CH3 domain In an embodiment, the polypeptide comprises at least one mutation in a residue in a CH2 domain and at least one mutation in a residue in a CH3 domain In an embodiment, the polypeptide further comprises a mutation in a residue in a region other than a CH2 domain and/or a CH3 domain.
- the mutation does not alter, or does not substantially alter, the conformation of the linker region between the CH2 and CH3 domains. In an embodiment, the mutation does not introduce a cluster (e.g., 3, 4, 5, 6, 7, 8, 9, 10, or more consecutive) of hydrophobic or aromatic residues, e.g., on a surface region (e.g., a region defined as the area covered by amino acid residues that have more than 20% solvent accessible area).
- a cluster e.g., 3, 4, 5, 6, 7, 8, 9, 10, or more consecutive
- a surface region e.g., a region defined as the area covered by amino acid residues that have more than 20% solvent accessible area.
- the polypeptide is an antibody molecule, e.g., an antibody molecule described herein.
- the polypeptide is an IgG, e.g., IgG1, IgG2, IgG3, or IgG4. In an embodiment, the polypeptide is an IgG1. In an embodiment, the polypeptide is an IgG4.
- the polypeptide comprises a heavy chain immunoglobulin variable region, a light chain immunoglobulin variable region, or both. In an embodiment, the polypeptide comprises a tetramer of two heavy chain immunoglobulin variable regions and two light chain immunoglobulin variable regions. In an embodiment, the polypeptide comprises a full length antibody molecule. In an embodiment, the polypeptide comprises a fragment (e.g., an antigen-binding fragment) of an antibody molecule.
- the polypeptide comprises a chimeric antibody molecule. In an embodiment, the polypeptide comprises a humanized antibody molecule. In an embodiment, the polypeptide comprises a human antibody molecule. In an embodiment, the polypeptide comprises a murine antibody molecule. In an embodiment, the polypeptide comprises a bispecific or multispecific antibody molecule.
- polypeptide is a fusion protein, e.g., a fusion protein described herein.
- polypeptide comprises a fragment (e.g., functional fragment) of the fusion polypeptide.
- polypeptide comprises one or more (e.g., 2, 3, 4, or all) of the following:
- a mutation in a residue in a surface region e.g., a region defined as the area covered by amino acid residues that have more than 20% solvent accessible area
- a mutation in a residue in a surface region e.g., a region defined as the area covered by amino acid residues that have more than 20% solvent accessible area
- a mutation in a residue that is a peripheral residue along the Fc-FcRn interface e.g., any amino acid residues on the surface of the Fc region that is less than 7 Angstroms from the FcRn in the Fc-FcRn complex
- a mutation is in a residue that is non-contact residue in Fc-FcRn binding
- a mutation in a residue which is a helix contact reside that enhances the conformational dynamics of 250-helix, e.g., a helix comprising one or more (e.g., 2, 3, 4, 5, or all) of P247, K248, D249, T250, L251, or M252; or
- a mutation which modulates pK of a histidine and/or is an introduction of a histidine along the Fc-FcRn interface (e.g., any amino acid residues on the surface of the Fc region that is less than 7 Angstroms from the FcRn in the Fc-FcRn complex).
- the polypeptide comprises (i) and (ii) above. In an embodiment, the polypeptide comprises (i) and (iii) above. In an embodiment, the polypeptide comprises (i) and (iv) above. In an embodiment, the polypeptide comprises (i) and (v) above. In an embodiment, the polypeptide comprises (ii) and (iii) above. In an embodiment, the polypeptide comprises (ii) and (iv) above. In an embodiment, the polypeptide comprises (ii) and (v) above. In an embodiment, the polypeptide comprises (iii) and (iv) above. In an embodiment, the polypeptide comprises (iii) and (v) above. In an embodiment, the polypeptide comprises (iii) and (v) above. In an embodiment, the polypeptide comprises (iv) and (v) above. In an embodiment, the polypeptide comprises (iv) and (v) above.
- the polypeptide comprises (i), (ii) and (iii) above. In an embodiment, the polypeptide comprises (i), (ii) and (iv) above. In an embodiment, the polypeptide comprises (i), (iii) and (iv) above. In an embodiment, the polypeptide comprises (i), (iii) and (iv) above. In an embodiment, the polypeptide comprises (i), (iii) and (iv) above. In an embodiment, the polypeptide comprises (i), (iii) and (iv) above. In an embodiment, the polypeptide comprises (ii), (iii) and (iv) above. In an embodiment, the polypeptide comprises (ii), (iii) and (v) above. In an embodiment, the polypeptide comprises (ii), (iii) and (v) above. In an embodiment, the polypeptide comprises (ii), (iii) and (v) above. In an embodiment, the polypeptide comprises (ii), (iv) and
- the polypeptide comprises (i), (ii), (iii) and (iv) above. In an embodiment, the polypeptide comprises (i), (ii), (iii) and (v) above. In an embodiment, the polypeptide comprises (i), (ii), (iv) and (v) above. In an embodiment, the polypeptide comprises (i), (iii), (iv) and (v) above. In an embodiment, the polypeptide comprises (ii), (iii), (iv) and (v) above. In an embodiment, the polypeptide comprises (ii), (iii), (iv) and (v) above.
- the polypeptide comprises (i), (ii), (iii), (iv), and (v) above.
- the polypeptide comprises a mutation in a residue in a surface region (e.g., a region defined as the area covered by amino acid residues that have more than 20% solvent accessible area) that interacts with the FcRn, e.g., an FcRn contact residue.
- a surface region e.g., a region defined as the area covered by amino acid residues that have more than 20% solvent accessible area
- the mutation is in a residue chosen from: L251, 1253, R255, P257, H285, N286, K288, T307, V308, L309, Q311, L314, H310, H433, N434, H435, or Y436.
- the polypeptide comprises a plurality of mutations in two or more (e.g., 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, or all) of the residues chosen from L251, 1253, R255, P257, H285, N286, K288, T307, V308, L309, Q311, L314, H310, H433, N434, H435, or Y436.
- the polypeptide comprises a mutation in a residue that is a peripheral residue along the Fc-FcRn interface (e.g., any amino acid residues on the surface of the Fc region that is less than 7 Angstroms from the FcRn in the Fc-FcRn complex).
- the mutation is in a residue chosen from one or more (e.g., 2, 3, 4, 5, 6, or all) of T256, H285, N286, T307, Q311, N315, or A378.
- the polypeptide comprises a plurality of mutations in two or more (e.g., 2, 3, 4, 5, 6, or all) of the residues chosen from T256, H285, N286, T307, Q311, N315, or A378.
- the polypeptide comprises one or more (e.g., 2, 3, 4, 5, 6, or all) of the mutations chosen from T256D, H285N, N286D, T307Q, Q311V, N315D, or A378V.
- the mutation is in a residue chosen from T256, Q311, or A378.
- the polypeptide comprises a plurality of mutations in two or all of the residues chosen from T256, Q311, or A378.
- the polypeptide comprises one, two, or all of the mutations chosen from T256D, Q311V, or A378V.
- the mutation is in a residue chosen from H285, T307, or N315.
- the polypeptide comprises a plurality of mutations in two or all of the residues chosen from H285, T307, or N315.
- the polypeptide comprises one, two, or all of the mutations chosen from H285N, T307Q, or N315D.
- the mutation is in a residue chosen from H285, T307, or A378.
- the polypeptide comprises a plurality of mutations in two or all of the residues chosen from H285, T307, or A378.
- the polypeptide comprises one, two, or all or the mutations chosen from H285D, T307Q, or A378V.
- the mutation is in a residue chosen from T307, Q311, or A378.
- the polypeptide comprises a plurality of mutations in two or all of the residues chosen from T307, Q311, or A378.
- the polypeptide comprises one, two, or all of the mutations chosen from T307Q, Q311V, or A378V.
- the mutation is in a residue chosen from T256, N286, T307, Q311, or A378.
- the polypeptide comprises a plurality of mutations in two, three, four, or all of the residues chosen T256, N286, T307, Q311, or A378.
- the polypeptide comprises one, two, three, four, or all of the mutations chosen from T256D, N286D, T307R, Q311V, or A378V.
- the mutation is in a residue chosen from T256, H285, T307, Q311, or A378.
- the polypeptide comprises a plurality of mutations in two, three, four, or all of the residues chosen T256, H285, T307, Q311, or A378.
- the polypeptide comprises one, two, three, four, or all of the mutations chosen from T256D, H285D, T307R, Q311V, or A378V.
- the mutation is in a residue chosen from M252, T256, T307, L309, Q311, H433, N434, Y436, N286, or K288.
- the polypeptide comprises a plurality of mutations in two or more (e.g., 3, 4, 5, 6, 7, 8, 9, or all) of the residues chosen from M252, T256, T307, L309, Q311, H433, N434, Y436, N286, or K288.
- the polypeptide comprises a mutation is in a residue that is non-contact residue in Fc-FcRn binding.
- the mutation is in a residue chosen from A287, V308, N315, L314, L432, H429, E430, or A431.
- the polypeptide comprises a plurality of mutations in two or more (e.g., 3, 4, 5, 6, 7, or all) of the residues chosen from A287, V308, N315, L314, L432, H429, E430, or A431.
- the polypeptide comprises a mutation in a residue which is a helix contact reside that enhances the conformational dynamics of 250-helix (e.g., a helix comprising one or more (e.g., 2, 3, 4, 5, or all) of P247, K248, D249, T250, L251, or M252), e.g., a lateral displacement or conformational flexibility exhibited by the 250-helix (e.g., as shown by a comparison of the crystal structures of the Fc domain crystallized at pH5.0 (PDB ID: 4J12) and at pH 6.5 (PDB ID: 4Q7D).
- a helix comprising one or more (e.g., 2, 3, 4, 5, or all) of P247, K248, D249, T250, L251, or M252), e.g., a lateral displacement or conformational flexibility exhibited by the 250-helix (e.g., as shown by a comparison of the crystal structures of the Fc domain
- the mutation is in a residue chosen from P244, P245, T250, L251, P247, E380, M428, A378, D376, P257, V308, A287, L306, or H427.
- the polypeptide comprises a plurality of mutations in two or more (e.g., 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or all) of the residues chosen from P244, P245, T250, L251, P247, E380, M428, A378, D376, P257, V308, A287, L306, or H427.
- the polypeptide comprises a mutation which is the introduction of a histidine along the Fc-FcRn interface (e.g., any amino acid residues on the surface of the Fc region that is less than 7 Angstroms from the FcRn in the Fc-FcRn complex).
- the mutation introduces a polar amino acid residue. In another embodiment, the mutation introduces a non-polar amino acid residue. In an embodiment, the mutation introduces a charged amino acid residue. In another embodiment, the mutation introduces a non-charge amino acid residue. In an embodiment, the mutation introduces a positively charged (or basic) amino acid residue. In another embodiment, the mutation introduces a negatively charged (or acidic) amino acid residue. In an embodiment, the mutation introduces a hydrophobic amino acid residue. In another embodiment, the mutation introduces a hydrophilic amino acid residue.
- the polypeptide comprises a mutation in at least one (e.g., 2, 3, 4, 5, or more) FcRn contact residue. In an embodiment, the polypeptide comprises a mutation in one or more (e.g., 2 or all) of residues T256, T307, or N286. In an embodiment, the polypeptide comprises mutations in residues T256 and T307, optionally, further comprises a mutation in residue N286.
- the mutation in residue T256 is a polar residue, e.g., chosen from T256D, T256E, or T256R. In an embodiment, the mutation in residue T256 is T256D.
- the mutation in residue T307 is a polar residue, e.g., chosen from T307D, T307E, or T307R. In an embodiment, the mutation in residue T307 is T307R. In an embodiment, the mutation in residue N286 is N286I. In an embodiment, the polypeptide comprises mutations T256D and T307R. In an embodiment, the polypeptide comprises mutations T256D, T307R, and N286I.
- the polypeptide comprises a mutation in at least one (e.g., 2, 3, 4, 5, or more) FcRn contact residue. In an embodiment, the polypeptide comprises a mutation in one or more (e.g., 2 or all) of residues L309, D312, or N315. In an embodiment, the polypeptide comprises a mutation in residue L309, optionally, further comprises mutations in residues D312 and N315. In an embodiment, the mutation in residue L309 is L309N. In an embodiment, the mutation in residue D312 is D312A. In an embodiment, the mutation in residue N315 is N315D. In an embodiment, the polypeptide comprises mutation L309N. In an embodiment, the polypeptide comprises mutations L309N, D312A and N315D.
- the polypeptide comprises a mutation in at least one (e.g., 1, 2, 3, 4, 5, or more) FcRn non-contact residue. In an embodiment, the polypeptide comprises a mutation in one or more (e.g., 2 or all) of residues L209R, D312, or Q311. In an embodiment, the polypeptide comprises mutations in residues L309 and D312, optionally, further comprising a mutation in residue Q311. In an embodiment, the polypeptide comprises a mutation in residue Q311. In an embodiment, the mutation in residue L309 is L309R. In an embodiment, the mutation in residue D312 is D312E. In an embodiment, the mutation in residue Q311 is Q311P. In an embodiment, the polypeptide comprises mutations L309R and D312E. In an embodiment, the polypeptide comprises mutations L309R, D312E, and Q311P. In an embodiment, the polypeptide comprises mutation Q311P.
- the polypeptide comprises a mutation in at least one (e.g., 2, 3, 4, 5, or more) FcRn contact residue. In an embodiment, the polypeptide comprises a mutation in one or more (e.g., 2, 3, or 4) of residues chosen from 1253, 5254, M252, or R255. In an embodiment, the polypeptide comprises a mutation in residue 1253. In an embodiment, the mutation in residue 1253 is I253M. In an embodiment, the polypeptide comprises a mutation in residue 5254. In an embodiment, the mutation in residue 5254 is S254H or S254M. In an embodiment, the polypeptide comprises mutations in residues M252 and 5254. In an embodiment, the mutation in residue M252 is M252E.
- the mutation in residue 5254 is S254R.
- the polypeptide comprises mutations in residues M252, 5254, and R255.
- the mutation in residue M252 is M252E.
- the mutation in residue 5254 is S254R.
- the mutation in residue R255 is R255Y.
- the polypeptide comprises a mutation in at least one (e.g., 2, 3, 4, 5, or more) FcRn non-contact residue. In an embodiment, the polypeptide comprises mutations that are equivalent of T250Q and M34L. In an embodiment, the polypeptide comprises a mutation in one or more (e.g., 2, 3, 4, or all) of residues chosen from D376, K248, E380, M428, or A328. In an embodiment, the polypeptide comprises a mutation in residue D376 and a mutation in a residue chosen from K248, E380, M428, or A328. In an embodiment, the polypeptide comprises a mutation in residue D376 and a mutation in residue K248.
- the polypeptide comprises a mutation in residue D376 and a mutation in residue K248.
- the polypeptide comprises a mutation in residue D376 and a mutation in residue E380. In an embodiment, the polypeptide comprises a mutation in residue D376 and a mutation in residue M428. In an embodiment, the polypeptide comprises a mutation in residue D376 and a mutation in residue A328. In an embodiment, the mutation in residue D376 is D376Q or D376N. In an embodiment, the mutation in residue K248 is K248S. In an embodiment, the mutation in residue E380 is E380A. In an embodiment, the mutation in residue D376 is D376Q. In an embodiment, the mutation in residue M428 is M428L. In an embodiment, the mutation in residue A328 is A328I.
- the polypeptide comprises mutation D376Q or D376N, and mutation K248S. In an embodiment, the polypeptide comprises mutation D376Q or D376N, and mutation E380A. In an embodiment, the polypeptide comprises mutations D376Q and M428L. In an embodiment, the polypeptide comprises mutations D376Q and A328I.
- the polypeptide comprises a mutation in at least one (e.g., 2, 3, 4, 5, or more) FcRn non-contact residue. In an embodiment, the polypeptide comprises a mutation in one or more (e.g., 2 or all) of residues chosen from K246, P247, or D376. In an embodiment, the polypeptide comprises a mutation in residue K246 and a mutation in residue P247, optionally, further comprising a mutation in residue D376. In an embodiment, the mutation in residue K246 is K246N. In an embodiment, the mutation in residue P247 is P247A. In an embodiment, the mutation in residue D376 is D376N. In an embodiment, the polypeptide comprises mutations K246N and P247A, optionally, further comprising mutation D376N.
- the polypeptide comprises a mutation in one or more (e.g., 2, 3, 4, 5, 6, or all) of residues chosen from T256, T307, N286, A287, P257, Q311, or P247.
- the polypeptide comprises mutations in residues T256, T307, N286, and A287.
- the polypeptide comprises mutations in residues T256, T307, and P257.
- the polypeptide comprises mutations in residues T256, T307, and Q311.
- the polypeptide comprises mutations in residues T256, T307, and P247.
- mutation in residue T256 is T256D.
- the mutation in residue T307 is T307R.
- the mutation in residue N286 is N286I.
- the mutation in residue A287 is A287S.
- the mutation in residue P257 is P257L.
- the mutation in residue Q311 is Q311V or Q311L.
- the mutation in residue P247 is P247D.
- the polypeptide comprises mutations T256D, T307R, N286D, and A287S.
- the polypeptide comprises mutations T256D, T307R, and P257L.
- the polypeptide comprises mutations T256D, T307R, and Q311V or Q311L.
- the polypeptide comprises mutations T256D, T307R, and P247D.
- the polypeptide comprises a mutation in one or more (e.g., 2, 3, 4, 5, 6, 7, or all) of residues chosen from N286, A287, P247, Q311, V308, P257, N315, or V279.
- the polypeptide comprises mutations in residues N286, A287, P247, and Q311.
- the mutation in residue N286 is N286D.
- the mutation in residue A287 is A287S.
- the mutation in residue P247 is P247D.
- the mutation in residue Q311 is Q311V.
- the polypeptide comprises mutations in residues V308 and P257.
- the mutation in residue V308 is V308N.
- the mutation in residue P257 is P257M.
- the polypeptide comprises mutations in residues Q311, N315, and V279.
- the mutation in residue Q311 is Q311L.
- the mutation in residue N315 is N315T.
- the mutation in residue V279 is V279I.
- the polypeptide comprises a mutation in one or more (e.g., 2, 3, or all) of residues chosen from G433 or H433, P434 or G434, G434a, or H435. In an embodiment, the polypeptide comprises mutations in residues G433, P434, and H435. In an embodiment, the polypeptide comprises mutations in residues G433, P434, G434a, and H435. In an embodiment, the polypeptide comprises mutations in residues H433, G434, P434a, and H435.
- the polypeptide comprises one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, or more) mutations, or one or more combination of mutations, as described in Table 1.
- a combination of mutations can include one or more mutations listed under the name FcMutX and one or more mutations listed under the name FcMutY, where X and Y are three-digit numbers shown in Table 1, and X is not equal to Y.
- the polypeptide comprises mutation I253M. In an embodiment, the polypeptide comprises mutations L309H, D312A and N315D. In an embodiment, the polypeptide comprises mutation L309N. In an embodiment, the polypeptide comprises mutations M252E and S254R. In an embodiment, the polypeptide comprises mutations M252E, S254R and R255Y. In an embodiment, the polypeptide comprises mutation S254H. In an embodiment, the polypeptide comprises mutation S254M. In an embodiment, the polypeptide comprises mutations T256D and T307R. In an embodiment, the polypeptide comprises mutations T256L, N286I and T3071.
- the polypeptide comprises mutations T256I, N286I and T3071. In an embodiment, the polypeptide comprises mutations K248S and D376Q. In an embodiment, the polypeptide comprises mutations K248S and D376N. In an embodiment, the polypeptide comprises mutations D376Q and E380A. In an embodiment, the polypeptide comprises mutations D376N and E380A. In an embodiment, the polypeptide comprises mutations D376Q and M428L. In an embodiment, the polypeptide comprises mutations K248S and A378I. In an embodiment, the polypeptide comprises mutation L314K. In an embodiment, the polypeptide comprises mutation M252W.
- the polypeptide comprises mutation V308F. In an embodiment, the polypeptide comprises mutations V308F and N434Y. In an embodiment, the polypeptide comprises mutations T256D, T307R and D376N. In an embodiment, the polypeptide comprises mutations L309R and D312E. In an embodiment, the polypeptide comprises mutations L309R, Q311P and D312E. In an embodiment, the polypeptide comprises mutations K246N and P247A. In an embodiment, the polypeptide comprises mutations K246N, P247A and D376N. In an embodiment, the polypeptide comprises mutations T256E and T307R.
- the polypeptide comprises mutations T256R and T307D. In an embodiment, the polypeptide comprises mutations T256R and T307E. In an embodiment, the polypeptide comprises mutation Q311P. In an embodiment, the polypeptide comprises mutation D376Q. In an embodiment, the polypeptide comprises mutations T256D, N286D, A287S and T307R. In an embodiment, the polypeptide comprises mutations T256D, P257L and T307R. In an embodiment, the polypeptide comprises mutations T256D, T307R and Q311V. In an embodiment, the polypeptide comprises mutations P247D, T256D and T307R.
- the polypeptide comprises mutations P247D, N286D, A287S and Q311V. In an embodiment, the polypeptide comprises mutations P257M and V308N. In an embodiment, the polypeptide comprises mutations V279I, Q311L and N315T. In an embodiment, the polypeptide comprises mutations H433G and N434P. In an embodiment, the polypeptide comprises mutations T256D, N286D and T307R. In an embodiment, the polypeptide comprises mutations T256D, N286E and T307R. In an embodiment, the polypeptide comprises mutations T256D, N286Q and T307R.
- the polypeptide comprises mutations T256D, P257T and T307R. In an embodiment, the polypeptide comprises mutations T256D, P257V and T307R. In an embodiment, the polypeptide comprises mutations T256D, T307R and Q311I. In an embodiment, the polypeptide comprises mutations T256D, T307R and Q311L. In an embodiment, the polypeptide comprises mutations T256D, T307R and Q311M. In an embodiment, the polypeptide comprises mutations T256D, P257L, N286D, T307R and Q311V. In an embodiment, the polypeptide comprises mutations T256D, T307R and M428L
- the mutation is other than M252Y, S254T, T256E, L309N, T250Q, M428L, N434S, N434A, T307A, E380A, N434A, M252Y, S254T, T256E, or a combination thereof.
- the mutation is in a residue other than residue M252, 5254, T256, L309, T250, M428, N434, N434, T307, E380, N434, M252, 5254, T256, or a combination thereof.
- the polypeptide does not have one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, or all) of the following mutation or mutations: (i) M252Y, S254T, and T256E; (ii) L309N; (iii) T250Q and M428L; (iv) M428L and N434A; (v) N434A; (vi) T307A, E380A, and N434A; (vii) M252W; (viii) V308F; (ix) V308F and N434Y; or (x) H435A.
- M252Y, S254T, and T256E e.g., L309N; (iii) T250Q and M428L; (iv) M428L and N434A; (v) N434A; (vi) T307A, E380A, and N434A; (vii) M252W; (viii) V308F; (
- the polypeptide comprises a first mutation chosen from M252Y, S254T, T256E, L309N, T250Q, M428L, N434S, N434A, T307A, E380A, N434A, M252Y, S254T, or T256E, and a second mutation chosen from a mutation in Table 1 other than M252Y, S254T, T256E, L309N, T250Q, M428L, N434S, N434A, T307A, E380A, N434A, M252Y, S254T, and T256E.
- the polypeptide comprises a combination of mutations chosen from M252Y, S254T, T256E, L309N, T250Q, M428L, N434S, N434A, T307A, E380A, N434A, M252Y, S254T, or T256E, wherein the combination is other than (i) M252Y, S254T, and T256E; (ii) L309N; (iii) T250Q and M428L; (iv) M428L and N434A; (v) N434A; (vi) T307A, E380A, and N434A; (vii) M252W; (viii) V308F; (ix) V308F and N434Y; or (x) H435A.
- the polypeptide further comprises a mutation in the Fc region that increases an effector function.
- the mutation is in a residue chosen from 5239 (e.g., S239D), A330 (e.g., A330L), 1332 (e.g., 1332E), F243 (e.g., F243L), G236 (e.g., G236A), or a combination thereof, e.g., to increase an effector function.
- the polypeptide further comprises a mutation in the Fc region that decreases an effector function.
- the mutation is in a residue chosen from K322 (e.g., K322A), L234 (e.g., L234A or L234F), L235 (e.g., L235A or L235E), P331 (e.g., P331S), N297, or a combination thereof, e.g., to decrease an effector function.
- the polypeptide further comprises a mutation in a region other than the Fc region, e.g., in a Fab region.
- the polypeptide further comprises a plurality of mutations, wherein at least one mutation is a compensating mutation, e.g., a compensating mutation described herein.
- polypeptide is an isolated polypeptide. In an embodiment, the polypeptide is a synthetic polypeptide.
- the disclosure features a composition, e.g., pharmaceutical composition, comprising a polypeptide described herein.
- the composition further comprises a pharmaceutical acceptable carrier.
- the disclosure features a nucleic acid molecule encoding a polypeptide described herein.
- the disclosure features a vector comprising a nucleic acid molecule described herein.
- the disclosure features a cell, e.g., an isolated cell, comprising a nucleic acid molecule described herein or a vector described herein.
- the disclosure features a kit comprising a polypeptide described herein and instructions to use of the polypeptide.
- the disclosure features a container comprising a polypeptide described herein.
- the disclosure features a method of producing a polypeptide described herein, the method comprising culturing a cell described herein under conditions that allow production of an antibody molecule, thereby producing the polypeptide.
- the method further comprises isolating or purifying the polypeptide.
- the disclosure features a method of treating a disorder (e.g., a disorder described herein), the method comprising administering to a subject in need thereof an effective amount of a polypeptide described herein or a composition described herein, thereby treating the disorder.
- a disorder e.g., a disorder described herein
- the disclosure features a polypeptide described herein for use in a method of treating a disorder (e.g., a disorder described herein).
- a disorder described herein e.g., a disorder described herein.
- the disclosure features use of a polypeptide described herein in the manufacture of a medicament in the treatment of a disorder (e.g., a disorder described herein).
- the disclosure features a method of detecting a molecule, the method comprising contacting a cell or a sample from a subject with polypeptide described herein, thereby detecting the molecule.
- FIG. 1 depicts the binding between FcRn and IgG1.
- FIG. 2 depicts various binding sites in the Fc region.
- FIG. 3 depicts the structural basis for pH specific engagement of FcRn.
- FIG. 4 depicts mapping of Fc-FcRn interaction interface. CH2 and CH3 domains are indicated and shown by different gray shades.
- FIG. 5 depicts a network view of Fc-FcRn engagement.
- FIG. 6 depicts FcRn binding to anti-CH1 immobilized antibody and pH specific enhancement.
- FIG. 7 depicts the results of a cell-based FcRn binding competition assay.
- FIG. 8 depicts the binding of exemplary antibody molecules to Fc ⁇ RI and Fc ⁇ RIIIa.
- FIG. 9 depicts the thermal stability of exemplary antibody molecules.
- FIG. 10 depicts the half-lives of exemplary antibody molecules in Tg32 mice.
- FIG. 11A depicts K d , k on and k off of exemplary Fc engineered antibodies. Values presented as fold change as compared to IgG containing WT Fc.
- FIG. 11B depicts improved binding to FcRn at pH 6.0 and poor binding to FcRn at pH 7.4 of a representative Fc engineered antibody.
- FIG. 11C depicts the interaction of the CH2 domain of the antibody Fc with the FcRn molecule.
- FIG. 12 depicts biophysical properties of Fc engineered variants.
- FIG. 13A depicts improved in vivo half-life of 3 Motavizumab Fc variants in comparison to WT Motavizumab (Mota-WT).
- FIG. 13B depicts pharmacokinetic properties of 2 Motavizumab Fc variants and WT Motavizumab.
- FIG. 14A depicts improved in vivo half-life of later stage Motavizumab Fc variants in comparison to WT Motavizumab (Mota-WT) administered at a dose of 5 mg/kg.
- FIG. 14B depicts pharmacokinetic properties of later stage Motavizumab Fc variants and WT Motavizumab administered at a dose of 5 mg/kg.
- FIG. 14C depicts improved in vivo half-life of later stage Motavizumab Fc variants in comparison to WT Motavizumab (Mota-WT) administered at a dose of 2 mg/kg.
- FIG. 14D depicts pharmacokinetic properties of later stage Motavizumab Fc variants and WT Motavizumab administered at a dose of 2 mg/kg.
- FIG. 15 depicts longer in vivo half-life of the ZVB Zika antibody.
- FIG. 16 depicts a similar half-life of ZKB-LS (ZVB antibody with LS Fc mutation) and ZKB-156 (ZVB antibody with Visterra 156 Fc mutation). Both of these antibodies had a longer half-life than the parental ZVB antibody (ZKB) and WT Motavizumab.
- FIG. 17A depicts the binding of exemplary Fc variants to Fc ⁇ RI, Fc ⁇ RIIA, Fc ⁇ RIIB, Fc ⁇ RIIIA, and C1q.
- FIG. 17B depicts the binding of FcMut213 to Fc ⁇ RIIIA compared to wild-type.
- FIG. 17C depicts the binding of FcMut213 to Fc ⁇ RIIA compared to wild-type.
- FIG. 17D depicts the binding of FcMut213 to C1q compared to wild-type.
- FIG. 18 depicts the CDC activity of exemplary Fc variants (Rituximab Fab). Calculation is based on concentration that achieves 50% lysis, not the mid-point of the four-parameter fit.
- FIGS. 19A-19B depict the ADCC activity of exemplary Fc variants (Rituximab Fab).
- FIG. 20A depicts the IgG Fc structure and Fc-FcRn interaction.
- FIG. 20B depicts the structures of Fc at two different pHs.
- FIG. 21A depicts the types of residues with potential to mediate Fc-FcRn interaction.
- FIG. 21B depicts the molecular interaction of key residues of exemplary engineered Fc variants.
- FIG. 22 depicts an exemplary Octet sensogram.
- FIG. 23 depicts the SEC profile and Tm of exemplary Fc variants.
- FIG. 24 depicts the binding of Fc variants to Fc ⁇ RIIIa (ADCC activity) and to C1q (CDC activity).
- FIG. 25A depicts the pharmacokinetic characterization of IgGs with Fc variants. Plot shows change in concentration of IgG over time.
- FIG. 25B depicts the PK characterization of exemplary Fc variants.
- FIG. 26 depicts binding of motavizumab Fab with Fc variants to TRIM21.
- FIG. 27A depicts the structures of the FcRn-Fc complex, Protein A-Fc complex, Trim21-Fc complex, and Fc-Fc hexamer complex.
- FIG. 27B depicts the superposition of crystal structures of Fc domain highlighting Fc domain dynamics.
- polypeptides e.g., antibody molecules or fusion proteins
- a target molecule or cell e.g., a human protein or cell
- several of the polypeptides e.g., antibody molecules or fusion proteins
- polypeptides can have a range of circulating half-lives in humans, and circulating half-life can affect, e.g., interaction with serum and cell components, rate of fluid phase pinocytosis, interaction with FcRn, receptor mediated endocytosis, drug doses, and generation of anti-drug antibodies.
- Nucleic acid molecules encoding the polypeptides e.g., antibody molecules or fusion proteins
- expression vectors e.g., host cells, compositions (e.g., pharmaceutical compositions), kits, containers, and methods for making the polypeptides (e.g., antibody molecules or fusion proteins) are also provided.
- polypeptides e.g., antibody molecules or fusion proteins
- pharmaceutical compositions disclosed herein can be used (alone or in combination with other agents or therapeutic modalities) to treat, prevent, and/or diagnose disorders and conditions, e.g., disorders and conditions associated with a target molecule (e.g., protein) or cell, e.g., a disorder or condition described herein.
- disorders and conditions e.g., disorders and conditions associated with a target molecule (e.g., protein) or cell, e.g., a disorder or condition described herein.
- FcRn neonatal Fc receptor
- the Fc domain of an antibody is primarily responsible for binding to FcRn to facilitate antibody recycling.
- antibodies with identical Fc regions can have different circulating half-lives, at least in part, because a number of factors such as thermal stability, interaction with serum and cell components, presence of anti-drug antibodies, high dose, receptor mediated endocytosis, and fluid phase pinocytosis, can promote antibody degradation and negatively influence its half-life.
- the interaction of IgG with FcRn can serve to protect the antibody from endosomal degradation and extend the half-life of the antibody. Modification of Fc can be used to promote FcRn interaction and therefore extend the half-life of antibodies (Ghetie et al., Nat Biotechnol, 1997. 15(7): p.
- the Fc of IgG can also bind to various other receptors such as Fc ⁇ RI, Fc ⁇ RIIa, Fc ⁇ RIIb, Fc ⁇ RIII, C1q, and TRIM21, and these interactions mediate various effector functions such as antibody dependent cellular cytotoxicity (ADCC), complement dependent cytotoxicity (CDC), antibody dependent cellular phagocytosis (ADCP), and antibody dependent intracellular neutralization (ADIN).
- ADCC antibody dependent cellular cytotoxicity
- CDC complement dependent cytotoxicity
- ADCP antibody dependent cellular phagocytosis
- ADIN antibody dependent intracellular neutralization
- Traditional approaches used to identify the Fc variants have largely relied on random mutagenesis and display formats and often compromise certain important attributes of the antibody, be it effector functions or biophysical stability.
- the engineering of Fc for FcRn binding or half-life extension as disclosed herein is performed in the context of the various effector functions mediated by Fc.
- a structural and network based framework can be used to interrogate the interaction of Fc with FcRn at neutral and acidic pH.
- different pathways for improving FcRn binding e.g., decreasing the k off of interaction, can be identified.
- the interaction networks of mutations can be mapped and mutations can be combined and assessed for binding to FcRn and other Fc receptors.
- Fc variants that confer enhancement in half-life and retain and in some cases enhance effector functions such as ADCC and CDC can be identified.
- the articles “a” and “an” refer to one or to more than one (e.g., to at least one) of the grammatical object of the article.
- “About” and “approximately” shall generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Exemplary degrees of error are within 20 percent (%), typically, within 10%, and more typically, within 5% of a given value or range of values.
- compositions and methods disclosed herein encompass polypeptides and nucleic acids having the sequences specified, or sequences substantially identical or similar thereto, e.g., sequences at least 85%, 90%, 95% identical or higher to the sequence specified.
- amino acid sequence in the context of an amino acid sequence, the term “substantially identical” is used herein to refer to a first amino acid that contains a sufficient or minimum number of amino acid residues that are i) identical to, or ii) conservative substitutions of aligned amino acid residues in a second amino acid sequence such that the first and second amino acid sequences can have a common structural domain and/or common functional activity.
- amino acid sequences that contain a common structural domain having at least about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to a reference sequence, e.g., a sequence provided herein.
- nucleotide sequence in the context of nucleotide sequence, the term “substantially identical” is used herein to refer to a first nucleic acid sequence that contains a sufficient or minimum number of nucleotides that are identical to aligned nucleotides in a second nucleic acid sequence such that the first and second nucleotide sequences encode a polypeptide having common functional activity, or encode a common structural polypeptide domain or a common functional polypeptide activity.
- the term “functional variant” refers polypeptides that have a substantially identical amino acid sequence to the naturally-occurring sequence, or are encoded by a substantially identical nucleotide sequence, and are capable of having one or more activities of the naturally-occurring sequence.
- the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes).
- the length of a reference sequence aligned for comparison purposes is at least 30%, e.g., at least 40%, 50%, 60%, e.g., at least 70%, 80%, 90%, 100% of the length of the reference sequence.
- the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position.
- the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
- the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
- the percent identity between two amino acid sequences is determined using the Needleman and Wunsch ((1970) J. Mol. Biol. 48:444-453) algorithm which has been incorporated into the GAP program in the GCG software package (available at gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6.
- the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (available at gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6.
- One suitable set of parameters are a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
- the percent identity between two amino acid or nucleotide sequences can be determined using the algorithm of E. Meyers and W. Miller ((1989) CABIOS, 4:11-17) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- nucleic acid and protein sequences described herein can be used as a “query sequence” to perform a search against public databases to, for example, identify other family members or related sequences.
- Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) J. Mol. Biol. 215:403-10.
- Gapped BLAST can be utilized as described in Altschul et al., (1997) Nucleic Acids Res. 25:3389-3402.
- the default parameters of the respective programs e.g., XBLAST and NBLAST
- XBLAST and NBLAST can be used. See ncbi.nlm.nih.gov.
- hybridizes under low stringency, medium stringency, high stringency, or very high stringency conditions describes conditions for hybridization and washing.
- Guidance for performing hybridization reactions can be found in Current Protocols in Molecular Biology , John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6, which is incorporated by reference. Aqueous and nonaqueous methods are described in that reference and either can be used.
- Specific hybridization conditions referred to herein are as follows: 1) low stringency hybridization conditions in 6 ⁇ sodium chloride/sodium citrate (SSC) at about 45° C., followed by two washes in 0.2 ⁇ SSC, 0.1% SDS at least at 50° C.
- SSC 6 ⁇ sodium chloride/sodium citrate
- the temperature of the washes can be increased to 55° C. for low stringency conditions); 2) medium stringency hybridization conditions in 6 ⁇ SSC at about 45° C., followed by one or more washes in 0.2 ⁇ SSC, 0.1% SDS at 60° C.; 3) high stringency hybridization conditions in 6 ⁇ SSC at about 45° C., followed by one or more washes in 0.2 ⁇ SSC, 0.1% SDS at 65° C.; and preferably 4) very high stringency hybridization conditions are 0.5M sodium phosphate, 7% SDS at 65° C., followed by one or more washes at 0.2 ⁇ SSC, 1% SDS at 65° C. Very high stringency conditions 4) are suitable conditions and the ones that should be used unless otherwise specified.
- amino acid is intended to embrace all molecules, whether natural or synthetic, which include both an amino functionality and an acid functionality and capable of being included in a polymer of naturally-occurring amino acids.
- exemplary amino acids include naturally-occurring amino acids; analogs, derivatives and congeners thereof; amino acid analogs having variant side chains; and all stereoisomers of any of any of the foregoing.
- amino acid includes both the D- or L-optical isomers and peptidomimetics.
- a “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
- Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- polypeptide “peptide” and “protein” (if single chain) are used interchangeably herein to refer to polymers of amino acids of any length.
- the polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids.
- the terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component.
- the polypeptide can be isolated from natural sources, can be a produced by recombinant techniques from a eukaryotic or prokaryotic host, or can be a product of synthetic procedures.
- the polypeptide is an antibody molecule.
- the polypeptide is a fusion protein.
- nucleic acid refers to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof.
- the polynucleotide may be either single-stranded or double-stranded, and if single-stranded may be the coding strand or non-coding (antisense) strand.
- a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs.
- the sequence of nucleotides may be interrupted by non-nucleotide components.
- a polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component.
- the nucleic acid may be a recombinant polynucleotide, or a polynucleotide of genomic, cDNA, semisynthetic, or synthetic origin which either does not occur in nature or is linked to another polynucleotide in a non-natural arrangement.
- isolated refers to material that is removed from its original or native environment (e.g., the natural environment if it is naturally occurring).
- a naturally-occurring polynucleotide or polypeptide present in a living animal is not isolated, but the same polynucleotide or polypeptide, separated by human intervention from some or all of the co-existing materials in the natural system, is isolated.
- Such polynucleotides could be part of a vector and/or such polynucleotides or polypeptides could be part of a composition, and still be isolated in that such vector or composition is not part of the environment in which it is found in nature.
- the term “treat,” e.g., a disorder described herein, means that a subject (e.g., a human) who has a disorder, e.g., a disorder described herein, and/or experiences a symptom of a disorder, e.g., a disorder described herein, will, in an embodiment, suffer less a severe symptom and/or recover faster when an antibody molecule is administered than if the antibody molecule were never administered.
- Treatment can, e.g., partially or completely, alleviate, ameliorate, relieve, inhibit, or reduce the severity of, and/or reduce incidence, and optionally, delay onset of, one or more manifestations of the effects or symptoms, features, and/or causes of the disorder.
- treatment is of a subject who does not exhibit certain signs of the disorder, and/or of a subject who exhibits only early signs of the disorder. In an embodiment, treatment is of a subject who exhibits one or more established signs of a disorder. In an embodiment, treatment is of a subject diagnosed as suffering from a disorder.
- the term “prevent,” a disorder means that a subject (e.g., a human) is less likely to have the disorder, if the subject receives a polypeptide (e.g., antibody molecule).
- a polypeptide e.g., antibody molecule
- antibody molecules e.g., antibody molecules comprising an Fc region, e.g. an Fc region having one or more mutations described herein, and/or having one or more structural or functional properties described herein.
- the antibody molecule is engineered or derived from an antibody molecule (e.g., a parental antibody molecule) that contains an Fc region.
- the engineered antibody molecule, or antibody molecule derivative can have a different Fc region than the parental antibody molecule.
- the antibody molecule is engineered or derived from an antibody molecule (e.g., a parental antibody molecule) that does not contain an Fc region.
- the engineered antibody molecule, or antibody molecule derivative can have an Fc region, directly or indirectly, fused to the parental antibody molecule or a functional fragment thereof.
- antibody molecule refers to a protein, e.g., an immunoglobulin chain or a fragment thereof, comprising at least one immunoglobulin variable domain sequence.
- antibody molecule includes, for example, full-length, mature antibodies and antigen-binding fragments of an antibody.
- an antibody molecule can include a heavy (H) chain variable domain sequence (abbreviated herein as VH), and a light (L) chain variable domain sequence (abbreviated herein as VL).
- an antibody molecule in another example, includes two heavy (H) chain variable domain sequences and two light (L) chain variable domain sequence, thereby forming two antigen binding sites, such as Fab, Fab′, F(ab′) 2 , Fc, Fd, Fd′, Fv, single chain antibodies (scFv for example), single variable domain antibodies, diabodies (Dab) (bivalent and bispecific), and chimeric (e.g., humanized) antibodies, which may be produced by the modification of whole antibodies or those synthesized de novo using recombinant DNA technologies. These functional antibody fragments retain the ability to selectively bind with their respective antigen or receptor.
- Antibodies and antibody fragments can be from any class of antibodies including, but not limited to, IgG, IgA, IgM, IgD, and IgE, and from any subclass (e.g., IgG1, IgG2, IgG3, and IgG4) of antibodies.
- the antibody molecules can be monoclonal or polyclonal.
- the antibody molecule can also be a human, humanized, CDR-grafted, or in vitro generated antibody.
- the antibody molecule can have a heavy chain constant region chosen from, e.g., IgG1, IgG2, IgG3, or IgG4.
- the antibody molecule can also have a light chain chosen from, e.g., kappa or lambda.
- immunoglobulin (Ig) is used interchangeably with the term “antibody” herein.
- antigen-binding fragments include: (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab′)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a diabody (dAb) fragment, which consists of a VH domain; (vi) a camelid or camelized variable domain; (vii) a single chain Fv (scFv), see e.g., Bird et al.
- a Fab fragment a monovalent fragment consisting of the VL, VH, CL and CH1 domains
- a F(ab′)2 fragment a bivalent fragment comprising two Fab fragments linked by a
- antibody includes intact molecules as well as functional fragments thereof. Constant regions of the antibodies can be altered, e.g., mutated, to modify the properties of the antibody (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, or complement function).
- the antibody molecule can be a single chain antibody.
- a single-chain antibody (scFV) may be engineered (see, for example, Colcher, D. et al. (1999) Ann N Y Acad Sci 880:263-80; and Reiter, Y. (1996) Clin Cancer Res 2:245-52).
- the single chain antibody can be dimerized or multimerized to generate multivalent antibodies having specificities for different epitopes of the same target protein.
- the antibody molecules disclosed herein can also be single domain antibodies.
- Single domain antibodies can include antibodies whose complementary determining regions are part of a single domain polypeptide. Examples include, but are not limited to, heavy chain antibodies, antibodies naturally devoid of light chains, single domain antibodies derived from conventional 4-chain antibodies, engineered antibodies and single domain scaffolds other than those derived from antibodies.
- Single domain antibodies may be any of the art, or any future single domain antibodies.
- Single domain antibodies may be derived from any species including, but not limited to mouse, human, camel, llama, fish, shark, goat, rabbit, and bovine.
- a single domain antibody is a naturally occurring single domain antibody known as heavy chain antibody devoid of light chains. Such single domain antibodies are disclosed in WO 94/04678, for example.
- variable domain derived from a heavy chain antibody naturally devoid of light chain is known herein as a VHH or nanobody to distinguish it from the conventional VH of four chain immunoglobulins.
- VHH molecule can be derived from antibodies raised in Camelidae species, for example in camel, llama, dromedary, alpaca and guanaco. Other species besides Camelidae may produce heavy chain antibodies naturally devoid of light chain; such VHHs are also contemplated.
- VH and VL regions can be subdivided into regions of hypervariability, termed “complementarity determining regions” (CDR), interspersed with regions that are more conserved, termed “framework regions” (FR or FW).
- CDR complementarity determining region
- FR framework regions
- CDR complementarity determining region
- each VH and VL typically includes three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4.
- an “immunoglobulin variable domain sequence” refers to an amino acid sequence which can form the structure of an immunoglobulin variable domain.
- the sequence may include all or part of the amino acid sequence of a naturally-occurring variable domain.
- the sequence may or may not include one, two, or more N- or C-terminal amino acids, or may include other alterations that are compatible with formation of the protein structure.
- antigen-binding region refers to the part of an antibody molecule that comprises determinants that form an interface that binds to an antigen, or an epitope thereof.
- the antigen-binding region typically includes one or more loops (of at least, e.g., four amino acids or amino acid mimics) that form an interface that binds to the antigen.
- the antigen-binding region of an antibody molecule includes at least one or two CDRs and/or hypervariable loops, or more typically at least three, four, five or six CDRs and/or hypervariable loops.
- Compet or “cross-compete” are used interchangeably herein to refer to the ability of an antibody molecule to interfere with binding of another antibody molecule, to a target.
- the interference with binding can be direct or indirect (e.g., through an allosteric modulation of the antibody molecule or the target).
- the extent to which an antibody molecule is able to interfere with the binding of another antibody molecule to the target, and therefore whether it can be said to compete, can be determined using a competition binding assay, for example, a FACS assay, an ELISA or BIACORE assay.
- a competition binding assay is a quantitative competition assay.
- a first antibody molecule is said to compete for binding to the target with a second antibody molecule when the binding of the first antibody molecule to the target is reduced by 10% or more, e.g., 20% or more, 30% or more, 40% or more, 50% or more, 55% or more, 60% or more, 65% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 98% or more, 99% or more in a competition binding assay (e.g., a competition assay described herein).
- a competition binding assay e.g., a competition assay described herein.
- monoclonal antibody or “monoclonal antibody composition” as used herein refer to a preparation of antibody molecules of single molecular composition.
- a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
- a monoclonal antibody can be made by hybridoma technology or by methods that do not use hybridoma technology (e.g., recombinant methods).
- An “effectively human” protein is a protein that does not evoke a neutralizing antibody response, e.g., the human anti-murine antibody (HAMA) response.
- HAMA can be problematic in a number of circumstances, e.g., if the antibody molecule is administered repeatedly, e.g., in treatment of a chronic or recurrent disease condition.
- a HAMA response can make repeated antibody administration potentially ineffective because of an increased antibody clearance from the serum (see, e.g., Saleh et al., Cancer Immunol. Immunother. 32:180-190 (1990)) and also because of potential allergic reactions (see, e.g., LoBuglio et al., Hybridoma, 5:5117-5123 (1986)).
- the antibody molecule can be a polyclonal or a monoclonal antibody.
- the antibody can be recombinantly produced, e.g., produced by any suitable phage display or combinatorial methods.
- the antibody molecule is a fully human antibody (e.g., an antibody made in a mouse which has been genetically engineered to produce an antibody from a human immunoglobulin sequence), or a non-human antibody, e.g., a rodent (mouse or rat), goat, primate (e.g., monkey), camel antibody.
- the non-human antibody is a rodent (mouse or rat antibody). Methods of producing rodent antibodies are known in the art.
- Human monoclonal antibodies can be generated using transgenic mice carrying the human immunoglobulin genes rather than the mouse system. Splenocytes from these transgenic mice immunized with the antigen of interest are used to produce hybridomas that secrete human mAbs with specific affinities for epitopes from a human protein (see e.g., Wood et al. International Application WO 91/00906, Kucherlapati et al. PCT publication WO 91/10741; Lonberg et al. International Application WO 92/03918; Kay et al. International Application 92/03917; Lonberg et al. 1994 Nature 368:856-859; Green, L. L. et al. 1994 Nature Genet.
- An antibody can be one in which the variable region, or a portion thereof, e.g., the CDRs, are generated in a non-human organism, e.g., a rat or mouse. Chimeric, CDR-grafted, and humanized antibodies are within the invention. Antibodies generated in a non-human organism, e.g., a rat or mouse, and then modified, e.g., in the variable framework or constant region, to decrease antigenicity in a human are within the invention.
- Chimeric antibodies can be produced by any suitable recombinant DNA technique.
- Several are known in the art see Robinson et al., International Patent Publication PCT/US86/02269; Akira, et al., European Patent Application 184,187; Taniguchi, M., European Patent Application 171,496; Morrison et al., European Patent Application 173,494; Neuberger et al., International Application WO 86/01533; Cabilly et al. U.S. Pat. No. 4,816,567; Cabilly et al., European Patent Application 125,023; Better et al. (1988 Science 240:1041-1043); Liu et al.
- a humanized or CDR-grafted antibody will have at least one or two but generally all three recipient CDRs (of heavy and or light immunoglobulin chains) replaced with a donor CDR.
- the antibody may be replaced with at least a portion of a non-human CDR or only some of the CDRs may be replaced with non-human CDRs. It is only necessary to replace the number of CDRs required for binding of the humanized antibody to lipopolysaccharide.
- the donor will be a rodent antibody, e.g., a rat or mouse antibody
- the recipient will be a human framework or a human consensus framework.
- the immunoglobulin providing the CDRs is called the “donor” and the immunoglobulin providing the framework is called the “acceptor.”
- the donor immunoglobulin is a non-human (e.g., rodent).
- the acceptor framework is typically a naturally-occurring (e.g., a human) framework or a consensus framework, or a sequence about 85% or higher, e.g., 90%, 95%, 99% or higher identical thereto.
- the term “consensus sequence” refers to the sequence formed from the most frequently occurring amino acids (or nucleotides) in a family of related sequences (See e.g., Winnaker, From Genes to Clones (Verlagsgesellschaft, Weinheim, Germany 1987). In a family of proteins, each position in the consensus sequence is occupied by the amino acid occurring most frequently at that position in the family. If two amino acids occur equally frequently, either can be included in the consensus sequence.
- a “consensus framework” refers to the framework region in the consensus immunoglobulin sequence.
- An antibody can be humanized by any suitable method, and several such methods known in the art (see e.g., Morrison, S. L., 1985 , Science 229:1202-1207, by Oi et al., 1986 , BioTechniques 4:214, and by Queen et al. U.S. Pat. Nos. 5,585,089, 5,693,761 and 5,693,762, the contents of all of which are hereby incorporated by reference).
- Humanized or CDR-grafted antibodies can be produced by CDR-grafting or CDR substitution, wherein one, two, or all CDRs of an immunoglobulin chain can be replaced. See e.g., U.S. Pat. No. 5,225,539; Jones et al. 1986 Nature 321:552-525; Verhoeyan et al. 1988 Science 239:1534; Beidler et al. 1988 J. Immunol. 141:4053-4060; Winter U.S. Pat. No. 5,225,539, the contents of all of which are hereby expressly incorporated by reference. Winter describes a CDR-grafting method which may be used to prepare humanized antibodies (UK Patent Application GB 2188638A, filed on Mar. 26, 1987; Winter U.S. Pat. No. 5,225,539), the contents of which is expressly incorporated by reference.
- humanized antibodies in which specific amino acids have been substituted, deleted or added. Criteria for selecting amino acids from the donor are described in, e.g., U.S. Pat. No. 5,585,089, e.g., columns 12-16 of U.S. Pat. No. 5,585,089, the contents of which are hereby incorporated by reference. Other techniques for humanizing antibodies are described in Padlan et al. EP 519596 A1, published on Dec. 23, 1992.
- the antibody molecule has a heavy chain constant region chosen from, e.g., the heavy chain constant regions of IgG1, IgG2 (e.g., IgG2a), IgG3, IgG4, IgM, IgA1, IgA2, IgD, and IgE; particularly, chosen from, e.g., the (e.g., human) heavy chain constant regions of IgG1, IgG2, IgG3, and IgG4.
- the antibody molecule has a light chain constant region chosen from, e.g., the (e.g., human) light chain constant regions of kappa or lambda.
- the constant region can be altered, e.g., mutated, to modify the properties of the antibody molecule (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, and/or complement function).
- the antibody molecule has effector function and can fix complement.
- the antibody molecule does not recruit effector cells or fix complement.
- the antibody molecule has reduced or no ability to bind an Fc receptor.
- it may be an isotype or subtype, fragment or other mutant, which does not support binding to an Fc receptor, e.g., it has a mutagenized or deleted Fc receptor binding region.
- a constant region of the antibody molecule is altered.
- Methods for altering an antibody constant region are known in the art.
- Antibody molecules s with altered function e.g. altered affinity for an effector ligand, such as FcR on a cell, or the C1 component of complement can be produced by replacing at least one amino acid residue in the constant portion of the antibody with a different residue (see e.g., EP 388,151 A1, U.S. Pat. Nos. 5,624,821 and 5,648,260, the contents of all of which are hereby incorporated by reference)
- Amino acid mutations which stabilize antibody structure such as S228P (EU nomenclature, S241P in Kabat nomenclature) in human IgG4 are also contemplated. Similar type of alterations could be described which if applied to the murine, or other species immunoglobulin would reduce or eliminate these functions.
- the only amino acids in the antibody molecule are canonical amino acids.
- the antibody molecule comprises naturally-occurring amino acids; analogs, derivatives and congeners thereof; amino acid analogs having variant side chains; and/or all stereoisomers of any of any of the foregoing.
- the antibody molecule may comprise the D- or L-optical isomers of amino acids and peptidomimetics.
- a polypeptide of an antibody molecule described herein may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids.
- the antibody molecule may also be modified; for example, by disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component.
- the polypeptide can be isolated from natural sources, can be a produced by recombinant techniques from a eukaryotic or prokaryotic host, or can be a product of synthetic procedures.
- the antibody molecule described herein can be used alone in unconjugated form, or can be bound to a substance, e.g., a toxin or moiety (e.g., a therapeutic drug; a compound emitting radiation; molecules of plant, fungal, or bacterial origin; or a biological protein (e.g., a protein toxin) or particle (e.g., a recombinant viral particle, e.g., via a viral coat protein).
- the antibody molecule can be coupled to a radioactive isotope such as an ⁇ -, ⁇ -, or ⁇ -emitter, or a ⁇ - and ⁇ -emitter.
- an antibody molecule can be derivatized or linked to another functional molecule (e.g., another peptide or protein).
- a “derivatized” antibody molecule is one that has been modified. Methods of derivatization include but are not limited to the addition of a fluorescent moiety, a radionucleotide, a toxin, an enzyme or an affinity ligand such as biotin. Accordingly, the antibody molecules are intended to include derivatized and otherwise modified forms of the antibodies described herein, including immunoadhesion molecules.
- an antibody molecule can be functionally linked (by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other molecular entities, such as another antibody (e.g., a bispecific antibody or a diabody), a detectable agent, a toxin, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
- another antibody e.g., a bispecific antibody or a diabody
- detectable agent e.g., a toxin, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
- Some types of derivatized antibody molecule are produced by crosslinking two or more antibodies (of the same type or of different types, e.g., to create bispecific antibodies).
- Suitable crosslinkers include those that are heterobifunctional, having two distinctly reactive groups separated by an appropriate spacer (e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester) or homobifunctional (e.g., disuccinimidyl suberate).
- Such linkers are available from Pierce Chemical Company, Rockford, Ill.
- Exemplary fluorescent detectable agents include fluorescein, fluorescein isothiocyanate, rhodamine, 5dimethylamine-1-napthalenesulfonyl chloride, phycoerythrin and the like.
- An antibody may also be derivatized with detectable enzymes, such as alkaline phosphatase, horseradish peroxidase, ⁇ -galactosidase, acetylcholinesterase, glucose oxidase and the like.
- detectable enzymes such as alkaline phosphatase, horseradish peroxidase, ⁇ -galactosidase, acetylcholinesterase, glucose oxidase and the like.
- detectable enzymes such as alkaline phosphatase, horseradish peroxidase, ⁇ -galactosidase, acetylcholinesterase, glucose oxidase and the like.
- an antibody is derivatized with a detectable enzyme, it is detected by adding additional reagents that the enzyme uses to produce a detectable reaction product.
- the detectable agent horseradish peroxidase is present, the addition of hydrogen peroxide and diaminobenzidine leads to a
- an antibody may be derivatized with biotin, and detected through indirect measurement of avidin or streptavidin binding.
- suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material includes luminol; and examples of bioluminescent materials include luciferase, luciferin, and aequorin.
- Labeled antibody molecules can be used, for example, diagnostically and/or experimentally in a number of contexts, including (i) to isolate a predetermined antigen by standard techniques, such as affinity chromatography or immunoprecipitation; (ii) to detect a predetermined antigen (e.g., in a cellular lysate or cell supernatant) in order to evaluate the abundance and pattern of expression of the protein; (iii) to monitor protein levels in tissue as part of a clinical testing procedure, e.g., to determine the efficacy of a given treatment regimen.
- a predetermined antigen e.g., in a cellular lysate or cell supernatant
- An antibody molecule may be conjugated to another molecular entity, typically a label or a therapeutic (e.g., antimicrobial (e.g., antibacterial or bactericidal), immunomodulatory, immunostimularoty, cytotoxic, or cytostatic) agent or moiety.
- Radioactive isotopes can be used in diagnostic or therapeutic applications. Radioactive isotopes that can be coupled to the antibody molecules include, but are not limited to ⁇ , ⁇ -, or ⁇ -emitters, or ⁇ - and ⁇ -emitters.
- radioactive isotopes include, but are not limited to iodine ( 131 I or 125 I), yttrium ( 90 Y), lutetium ( 177 Lu), actinium ( 225 Ac), praseodymium, astatine ( 211 At), rhenium ( 186 Re), bismuth ( 212 Bi or 213 Bi), indium ( 111 In), technetium ( 99 mTc), phosphorus ( 32 P), rhodium ( 188 Rh), sulfur ( 35 S), carbon ( 14 C), tritium ( 3 H), chromium ( 51 Cr), chlorine ( 36 Cl), cobalt ( 57 Co or 58 Co), iron ( 59 Fe), selenium ( 75 Se), or gallium ( 67 Ga).
- Radioisotopes useful as therapeutic agents include yttrium ( 90 Y), lutetium ( 177 Lu), actinium ( 225 Ac), praseodymium, astatine ( 211 At), At) rhenium ( 186 Re), bismuth ( 212 Bi or 213 Bi), and rhodium ( 188 Rh).
- Radioisotopes useful as labels include iodine ( 131 I or 125 I), indium ( 111 In), technetium ( 99 mTc), phosphorus ( 32 P), carbon ( 14 C), and tritium ( 3 H), or one or more of the therapeutic isotopes listed above.
- the present disclosure provides radiolabeled antibody molecules and methods of labeling the same.
- a method of labeling an antibody molecule is disclosed. The method includes contacting an antibody molecule, with a chelating agent, to thereby produce a conjugated antibody.
- the conjugated antibody is radiolabeled with a radioisotope, e.g., 111 Indium, 90 Yttrium and 177 Lutetium, to thereby produce a labeled antibody molecule.
- this disclosure provides a method of making an antibody molecule disclosed herein.
- the method includes: providing an antigen, or a fragment thereof; obtaining an antibody molecule that specifically binds to the antigen; evaluating efficacy of the antibody molecule in modulating activity of the antigen and/or organism expressing the antigen.
- the method can further include administering the antibody molecule, including a derivative thereof (e.g., a humanized antibody molecule) to a subject, e.g., a human.
- the nucleic acid molecule includes, but is not limited to, RNA, genomic DNA and cDNA.
- fusion proteins e.g., fusion proteins comprising an Fc region, e.g. an Fc region having one or more mutations described herein, and/or having one or more structural or functional properties described herein.
- the fusion protein is engineered or derived from a polypeptide (e.g., a fusion protein) that contains an Fc region (e.g., a parental polypeptide).
- a polypeptide e.g., a fusion protein
- the engineered polypeptide, or derivative can have a different Fc region than the parental polypeptide.
- the fusion protein is engineered or derived from a polypeptide that does not contain an Fc region (e.g., a parental polypeptide).
- the engineered antibody molecule, or antibody molecule derivative can have an Fc region, directly or indirectly, fused to the parental polypeptide.
- fusion protein refers to a protein, comprising two or more protein or peptide components.
- the two or more protein or peptide components can be obtained from different sources or encoded by different genes.
- a fusion protein is sometimes also referred to as a chimeric protein.
- An Fc-fusion protein (also known as Fc chimeric fusion protein, Fc-Ig, Ig-based chimeric fusion protein, or Fc-tag protein) can include an Fc region of an immunoglobulin (e.g., an Fc region described herein) linked (e.g., fused) to a protein or peptide.
- the Fc region can be linked (e.g., fused genetically) to the protein or peptide directly, or indirectly, e.g., through a linker.
- the Fc region is derived from the Fc region of IgG, e.g., human IgG, e.g., IgG1, IgG2, IgG3, or IgG4.
- the Fc region is derived from the Fc region of IgG1, e.g., human IgG1.
- the Fc-fused binding partner can include a variety of proteins or peptides, or fragments thereof.
- the Fc region can be fused to a peptide (e.g., a therapeutic peptide), a ligand (e.g., a ligand that activates upon binding with a cell surface receptor), a signaling molecule, the extracellular domain of a receptor, or a bait protein (e.g., used to identify a binding partner, e.g., in a protein microarray).
- the Fc fusion protein comprises an extracellular domain of a receptor or a soluble receptor, or a ligand binding portion thereof.
- the receptor is a growth factor receptor.
- the receptor is a cytokine receptor.
- the receptor is an immune checkpoint molecule.
- the fusion protein comprises a vascular endothelia growth factor (VEGF)-binding portion from the extracellular domain of human VEGF receptors 1 and 2, fused to the Fc region of human IgG1.
- VEGF vascular endothelia growth factor
- the fusion protein is aflibercept.
- the fusion protein (e.g., aflibercept) is used to treat a disorder described herein, e.g., an eye disorder (e.g., wet macular degeneration) or a cancer (e.g., a colorectal cancer).
- the fusion protein comprises a soluble tumor necrosis factor (TNF) receptor 2 fused to the Fc region of the human IgG1.
- TNF tumor necrosis factor
- the fusion protein is etanercept.
- the Fc fusion protein (e.g., etanercept) is used to treat a disorder described herein, e.g., an autoimmune disorder (e.g., rheumatoid arthritis).
- the fusion protein comprises ligand-binding domains of the extracellular portions of human interleukin-1 receptor 1 (IL-1R1) and IL-1 receptor accessory protein (IL-1RAcP) fused to the Fc region of human IgG1.
- the fusion protein is rilonacept.
- the fusion protein (e.g., rilonacept) is used to treat a disorder described herein, e.g., a cryopyrin-associated periodic syndrome (CAPS), e.g., familial cold autoinflammatory syndrome, Muckle-Wells syndrome, or a neonatal onset multisystem inflammatory disease.
- CAS cryopyrin-associated periodic syndrome
- the fusion protein comprises the extracellular domain of CTLA-4 fused to the Fc region of human IgG1.
- the fusion protein is abatacept or belatacept.
- the fusion protein (e.g., abatacept or belatacept) is used to treat a disorder described herein, e.g., an organ rejection, an autoimmune disorder (e.g., rheumatoid arthritis), or a cancer.
- the Fc fusion protein comprises a peptide, e.g., a therapeutic peptide.
- the fusion protein comprises a thrombopoietin-binding peptide fused to the Fc region of human IgG1.
- the fusion protein is romiplostim.
- the fusion protein (e.g., romiplostim) is used to treat a disorder described herein, e.g., chronic idiopathic (immune) thrombocytopenic purpura (ITP).
- the fusion protein comprises the extracellular CD2-binding portion of the human leukocyte function antigen-3 (LFA-3) fused to the Fc region of human IgG1.
- the fusion protein is alefacept.
- the fusion protein (e.g., alefacept) is used to treat a disorder described herein, e.g., an autoimmune disorder (e.g., psoriasis) or a cancer (e.g., a cutaneous T-cell lymphoma or a T-cell non-Hodgkin lymphoma).
- the fusion protein comprises a coagulation factor.
- the fusion protein comprises Factor IX fused with the Fc region of IgG1. In another embodiment, the fusion protein comprises Factor VIII fused with the Fc region of IgG1. In an embodiment the fusion protein (e.g., the FIX-Fc fusion or FVIII-Fc fusion) is used to treat a disorder described herein, e.g., hemophilia A or hemophilia B.
- a disorder described herein e.g., hemophilia A or hemophilia B.
- the fusion protein comprises one or more glycosylation sites, or is glycosylated. In another embodiment, the fusion protein does not have a glycosylation site, or is not glycosylated.
- the only amino acids in the fusion protein are canonical amino acids.
- the fusion protein comprises naturally-occurring amino acids; analogs, derivatives and congeners thereof; amino acid analogs having variant side chains; and/or all stereoisomers of any of any of the foregoing.
- the fusion protein may comprise the D- or L-optical isomers of amino acids and peptidomimetics.
- this disclosure provides a method of making a fusion protein disclosed herein.
- the fusion proteins described herein can be produced by any suitable recombinant DNA technique.
- the method includes culturing a cell containing a nucleic acid encoding the fusion protein under conditions that allow production of the fusion protein.
- the method further includes isolating or purifying the fusion protein.
- the method further includes evaluating efficacy of the fusion protein in a cell-based assay or in an animal model.
- the method further includes administering the fusion protein to a subject, e.g., a human.
- the nucleic acid molecule includes, but is not limited to, RNA, genomic DNA and cDNA.
- a fragment crystallizable region, or Fc region refers to a region of an immunoglobulin that is capable of interacting with an Fc receptor.
- the Fc region is also capable of interacting with a protein of the complement system. While without wishing to be bound by theory, it is believed that in an embodiment, the interaction between the Fc region with an Fc receptor, allows for activation of the immune system.
- the naturally-occurring Fc region generally comprises two identical protein fragments, derived from the second and third constant domains of the antibody's two heavy chains.
- Naturally-occurring IgM and IgE Fc regions generally comprise three heavy chain constant domains (C H domains 2-4) in each polypeptide chain.
- the Fc regions of IgGs can contain a highly conserved N-glycosylation site (Stadlmann et al. (2008). Proteomics 8 (14): 2858-2871; Stadlmann (2009) Proteomics 9 (17): 4143-4153).
- glycosylation of the Fc fragment contributes to Fc receptor-mediated activities (Peipp et al. (2008) Blood 112 (6): 2390-2399).
- the N-glycans attached to this site are predominantly core-fucosylated diantennary structures of the complex type.
- small amounts of these N-glycans also contain bisecting GlcNAc and/or ⁇ -2,6 linked sialic acid residues.
- SEQ ID NO: 1 the first amino acid residue in this sequence is referred to as position 118 herein.
- the three Histidines in bold and underlined are positions 310, 433 and 435, respectively.
- a polypeptide e.g., an antibody molecule or fusion protein described herein can have one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or more) of mutations or combinations of mutations described in Table 1.
- the Fc region comprises FcMut001. In an embodiment, the Fc region comprises FcMut002. In an embodiment, the Fc region comprises FcMut003. In an embodiment, the Fc region comprises FcMut004. In an embodiment, the Fc region comprises FcMut005. In an embodiment, the Fc region comprises FcMut006. In an embodiment, the Fc region comprises FcMut007. In an embodiment, the Fc region comprises FcMut008. In an embodiment, the Fc region comprises FcMut009. In an embodiment, the Fc region comprises FcMut010. In an embodiment, the Fc region comprises FcMut011. In an embodiment, the Fc region comprises FcMut012.
- the Fc region comprises FcMut013. In an embodiment, the Fc region comprises FcMut014. In an embodiment, the Fc region comprises FcMut015. In an embodiment, the Fc region comprises FcMut016. In an embodiment, the Fc region comprises FcMut017. In an embodiment, the Fc region comprises FcMut018. In an embodiment, the Fc region comprises FcMut019. In an embodiment, the Fc region comprises FcMut020. In an embodiment, the Fc region comprises FcMut021. In an embodiment, the Fc region comprises FcMut022. In an embodiment, the Fc region comprises FcMut023.
- the Fc region comprises FcMut024. In an embodiment, the Fc region comprises FcMut026. In an embodiment, the Fc region comprises FcMut027. In an embodiment, the Fc region comprises FcMut028. In an embodiment, the Fc region comprises FcMut029. In an embodiment, the Fc region comprises FcMut030. In an embodiment, the Fc region comprises FcMut031. In an embodiment, the Fc region comprises FcMut032. In an embodiment, the Fc region comprises FcMut033. In an embodiment, the Fc region comprises FcMut034. In an embodiment, the Fc region comprises FcMut035.
- the Fc region comprises FcMut036. In an embodiment, the Fc region comprises FcMut037. In an embodiment, the Fc region comprises FcMut038. In an embodiment, the Fc region comprises FcMut039. In an embodiment, the Fc region comprises FcMut040. In an embodiment, the Fc region comprises FcMut041. In an embodiment, the Fc region comprises FcMut042. In an embodiment, the Fc region comprises FcMut043. In an embodiment, the Fc region comprises FcMut044. In an embodiment, the Fc region comprises FcMut045. In an embodiment, the Fc region comprises FcMut046.
- the Fc region comprises FcMut047. In an embodiment, the Fc region comprises FcMut048. In an embodiment, the Fc region comprises FcMut049. In an embodiment, the Fc region comprises FcMut050. In an embodiment, the Fc region comprises FcMut051. In an embodiment, the Fc region comprises FcMut052. In an embodiment, the Fc region comprises FcMut053. In an embodiment, the Fc region comprises FcMut067. In an embodiment, the Fc region comprises FcMut068. In an embodiment, the Fc region comprises FcMut069. In an embodiment, the Fc region comprises FcMut070.
- the Fc region comprises FcMut071. In an embodiment, the Fc region comprises FcMut072. In an embodiment, the Fc region comprises FcMut073. In an embodiment, the Fc region comprises FcMut074. In an embodiment, the Fc region comprises FcMut075. In an embodiment, the Fc region comprises FcMut076. In an embodiment, the Fc region comprises FcMut077. In an embodiment, the Fc region comprises FcMut078. In an embodiment, the Fc region comprises FcMut079. In an embodiment, the Fc region comprises FcMut080. In an embodiment, the Fc region comprises FcMut081.
- the Fc region comprises FcMut082. In an embodiment, the Fc region comprises FcMut083. In an embodiment, the Fc region comprises FcMut084. In an embodiment, the Fc region comprises FcMut085. In an embodiment, the Fc region comprises FcMut086. In an embodiment, the Fc region comprises FcMut087. In an embodiment, the Fc region comprises FcMut088. In an embodiment, the Fc region comprises FcMut089. In an embodiment, the Fc region comprises FcMut090. In an embodiment, the Fc region comprises FcMut091. In an embodiment, the Fc region comprises FcMut093.
- the Fc region comprises FcMut094. In an embodiment, the Fc region comprises FcMut095. In an embodiment, the Fc region comprises FcMut096. In an embodiment, the Fc region comprises FcMut097. In an embodiment, the Fc region comprises FcMut098. In an embodiment, the Fc region comprises FcMut099. In an embodiment, the Fc region comprises FcMut100. In an embodiment, the Fc region comprises FcMut101. In an embodiment, the Fc region comprises FcMut102. In an embodiment, the Fc region comprises FcMut103. In an embodiment, the Fc region comprises FcMut104.
- the Fc region comprises FcMut105. In an embodiment, the Fc region comprises FcMut106. In an embodiment, the Fc region comprises FcMut107. In an embodiment, the Fc region comprises FcMut108. In an embodiment, the Fc region comprises FcMut109. In an embodiment, the Fc region comprises FcMut110. In an embodiment, the Fc region comprises FcMut111. In an embodiment, the Fc region comprises FcMut112. In an embodiment, the Fc region comprises FcMut113. In an embodiment, the Fc region comprises FcMut114. In an embodiment, the Fc region comprises FcMut115. In an embodiment, the Fc region comprises FcMut116.
- the Fc region comprises FcMut117. In an embodiment, the Fc region comprises FcMut118. In an embodiment, the Fc region comprises FcMut119. In an embodiment, the Fc region comprises FcMut120. In an embodiment, the Fc region comprises FcMut121. In an embodiment, the Fc region comprises FcMut122. In an embodiment, the Fc region comprises FcMut123. In an embodiment, the Fc region comprises FcMut124. In an embodiment, the Fc region comprises FcMut125. In an embodiment, the Fc region comprises FcMut126. In an embodiment, the Fc region comprises FcMut127.
- the Fc region comprises FcMut128. In an embodiment, the Fc region comprises FcMut129. In an embodiment, the Fc region comprises FcMut130. In an embodiment, the Fc region comprises FcMut131. In an embodiment, the Fc region comprises FcMut132. In an embodiment, the Fc region comprises FcMut133. In an embodiment, the Fc region comprises FcMut134. In an embodiment, the Fc region comprises FcMut135. In an embodiment, the Fc region comprises FcMut136. In an embodiment, the Fc region comprises FcMut137. In an embodiment, the Fc region comprises FcMut138.
- the Fc region comprises FcMut139. In an embodiment, the Fc region comprises FcMut140. In an embodiment, the Fc region comprises FcMut141. In an embodiment, the Fc region comprises FcMut142. In an embodiment, the Fc region comprises FcMut143. In an embodiment, the Fc region comprises FcMut144. In an embodiment, the Fc region comprises FcMut145. In an embodiment, the Fc region comprises FcMut146. In an embodiment, the Fc region comprises FcMut147. In an embodiment, the Fc region comprises FcMut148. In an embodiment, the Fc region comprises FcMut149. In an embodiment, the Fc region comprises FcMut150.
- the Fc region comprises FcMut151. In an embodiment, the Fc region comprises FcMut152. In an embodiment, the Fc region comprises FcMut153. In an embodiment, the Fc region comprises FcMut154. In an embodiment, the Fc region comprises FcMut155. In an embodiment, the Fc region comprises FcMut156. In an embodiment, the Fc region comprises FcMut157. In an embodiment, the Fc region comprises FcMut158. In an embodiment, the Fc region comprises FcMut159. In an embodiment, the Fc region comprises FcMut160. In an embodiment, the Fc region comprises FcMut161. In an embodiment, the Fc region comprises FcMut162.
- the Fc region comprises FcMut163. In an embodiment, the Fc region comprises FcMut164. In an embodiment, the Fc region comprises FcMut165. In an embodiment, the Fc region comprises FcMut166. In an embodiment, the Fc region comprises FcMut167. In an embodiment, the Fc region comprises FcMut168. In an embodiment, the Fc region comprises FcMut169. In an embodiment, the Fc region comprises FcMut170. In an embodiment, the Fc region comprises FcMut171. In an embodiment, the Fc region comprises FcMut172. In an embodiment, the Fc region comprises FcMut173.
- the Fc region comprises FcMut174. In an embodiment, the Fc region comprises FcMut175. In an embodiment, the Fc region comprises FcMut176. In an embodiment, the Fc region comprises FcMut177. In an embodiment, the Fc region comprises FcMut178. In an embodiment, the Fc region comprises FcMut179. In an embodiment, the Fc region comprises FcMut180. In an embodiment, the Fc region comprises FcMut181. In an embodiment, the Fc region comprises FcMut182. In an embodiment, the Fc region comprises FcMut183. In an embodiment, the Fc region comprises FcMut184. In an embodiment, the Fc region comprises FcMut185.
- the Fc region comprises FcMut186. In an embodiment, the Fc region comprises FcMut187. In an embodiment, the Fc region comprises FcMut188. In an embodiment, the Fc region comprises FcMut189. In an embodiment, the Fc region comprises FcMut190. In an embodiment, the Fc region comprises FcMut191. In an embodiment, the Fc region comprises FcMut192. In an embodiment, the Fc region comprises FcMut193. In an embodiment, the Fc region comprises FcMut194. In an embodiment, the Fc region comprises FcMut195. In an embodiment, the Fc region comprises FcMut196. In an embodiment, the Fc region comprises FcMut197.
- the Fc region comprises FcMut198. In an embodiment, the Fc region comprises FcMut199. In an embodiment, the Fc region comprises FcMut200. In an embodiment, the Fc region comprises FcMut201. In an embodiment, the Fc region comprises FcMut202. In an embodiment, the Fc region comprises FcMut203. In an embodiment, the Fc region comprises FcMut204. In an embodiment, the Fc region comprises FcMut205. In an embodiment, the Fc region comprises FcMut206. In an embodiment, the Fc region comprises FcMut207. In an embodiment, the Fc region comprises FcMut208. In an embodiment, the Fc region comprises FcMut209.
- the Fc region comprises FcMut210. In an embodiment, the Fc region comprises FcMut211. In an embodiment, the Fc region comprises FcMut212. In an embodiment, the Fc region comprises FcMut213. In an embodiment, the Fc region comprises FcMut214. In an embodiment, the Fc region comprises FcMut215. In an embodiment, the Fc region comprises FcMut216. In an embodiment, the Fc region comprises FcMut217. In an embodiment, the Fc region comprises FcMut218. In an embodiment, the Fc region comprises FcMut219. In an embodiment, the Fc region comprises FcMut220.
- the Fc region comprises FcMut221. In an embodiment, the Fc region comprises FcMut222. In an embodiment, the Fc region comprises FcMut223. In an embodiment, the Fc region comprises FcMut224. In an embodiment, the Fc region comprises FcMut225. In an embodiment, the Fc region comprises FcMut226. In an embodiment, the Fc region comprises FcMut227. In an embodiment, the Fc region comprises FcMut228. In an embodiment, the Fc region comprises FcMut229. In an embodiment, the Fc region comprises FcMut230. In an embodiment, the Fc region comprises FcMut231.
- the Fc region comprises FcMut232. In an embodiment, the Fc region comprises FcMut233. In an embodiment, the Fc region comprises FcMut234. In an embodiment, the Fc region comprises FcMut242. In an embodiment, the Fc region comprises FcMut243. In an embodiment, the Fc region comprises FcMut244.
- the Fc region comprises one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, or more) of mutations or combinations of mutations chosen from FcMut045, FcMut171, FcMut183, FcMut186, FcMut190, FcMut197, FcMut213, FcMut215, FcMut216, FcMut219, FcMut222, FcMut223, FcMut224, FcMut226, FcMut227, FcMut228, or FcMut229.
- FcMut045 FcMut171, FcMut183, FcMut186, FcMut190, FcMut197, FcMut213, FcMut215, FcMut216, FcMut219, FcMut222, FcMut223, FcMut224,
- the Fc region comprises one or more (e.g., 2, 3, 4, 5, 6, or all) of mutations or combinations of mutations chosen from FcMut045, FcMut183, FcMut197, FcMut213, FcMut215, FcMut228, or FcMut156. In another embodiment, the Fc region comprises one or more (e.g., 2, 3, 4, 5, or all) of mutations or combinations of mutations chosen from FcMut183, FcMut197, FcMut213, FcMut215, FcMut228, or FcMut229.
- the Fc region does not comprise one or more (e.g., 2, 3, 4, or all) of mutations or combinations of mutations chosen from FcMut018, FcMut021, FcMut050, FcMut102, or YTE.
- the Fc region comprises one or more (e.g., 2, 3, 4, or all) of mutations or combinations of mutations chosen from FcMut018, FcMut021, FcMut050, FcMut102, or YTE, and one or more other mutations or combinations of mutations described in Table 1.
- the Fc region comprises one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more) of mutations or combinations of mutations described in Table 1 that result in a synergistic effect (e.g., binding affinity or circulating half-life) as described herein.
- a synergistic effect e.g., binding affinity or circulating half-life
- the Fc region comprises one or more (e.g., 2, 3, 4, 5, 6, or 7) mutations in residues chosen from T256, H285, N286, T307, Q311, N315, or A378. In an embodiment, the Fc region comprises one or more (e.g., 2, 3, 4, 5, 6, or 7) mutations chosen from T256D, H285N, N286D, T307Q, Q311V, N315D, or A378V.
- the Fc region comprises a half-life enhancing mutation, a mutation that is capable of disrupting an Fc effector function, or both.
- the Fc region comprises one or more mutations or combinations of mutations described herein, e.g., chosen from M252W, V308F/N434Y, R255Y, P257L/N434Y, V308F, P257N/M252Y, G385N, P257N/V308Y, N434Y, M252Y/S254T/T256E (“YTE”), M428L/N434S (“LS”), or any combination thereof.
- the Fc region comprises (a) one or more (e.g., 2, 3, 4, 5, or all) combinations of mutations chosen from: T256D/Q311V/A378V, H285N/T307Q/N315D, H285D/T307Q/A378V, T307Q/Q311V/A378V, T256D/N286D/T307R/Q311V/A378V, or T256D/T307R/Q311V; (b) a mutation or a combination of mutations capable of disrupting an Fc effector function, e.g., L234A/L235A (also known as “LALA” mutation), or (c) both (a) and (b).
- L234A/L235A also known as “LALA” mutation
- the Fc region comprises mutations T256D/Q311V/A378V and a mutation or a combination of mutations capable of disrupting an Fc effector function, e.g., L234A/L235A.
- the Fc region comprises mutations H285N/T307Q/N315D and a mutation or a combination of mutations capable of disrupting an Fc effector function, e.g., L234A/L235A.
- the Fc region comprises mutations H285D/T307Q/A378V and a mutation or a combination of mutations capable of disrupting an Fc effector function, e.g., L234A/L235A.
- the Fc region comprises mutations T307Q/Q311V/A378V and a mutation or a combination of mutations capable of disrupting an Fc effector function, e.g., L234A/L235A.
- the Fc region comprises mutations T256D/N286D/T307R/Q311V/A378V and a mutation or a combination of mutations capable of disrupting an Fc effector function, e.g., L234A/L235A.
- the Fc region comprises mutations T256D/T307R/Q311V and a mutation or a combination of mutations capable of disrupting an Fc effector function, e.g., L234A/L235A.
- a reference Fc region amino acid sequence (including the numbering used herein) is provided below (e.g., for identification of the mutation positions described herein).
- the CH2 domain sequence is underlined; the hinge region sequence is in italics, and the CH3 domain sequence is in bold.
- any of the half-life extension mutations described herein can be used in combination with any Fc mutation capable of enhancing or disrupting an Fc effector function.
- the Fc region can bind to various cell receptors (e.g., Fc receptors) and complement proteins.
- the Fc region can also mediate different physiological effects of antibody molecules, e.g., detection of opsonized particles; cell lysis; degranulation of mast cells, basophils, and eosinophils; and other processes.
- FcR Fc receptors
- Fc ⁇ receptors belong to the immunoglobulin superfamily, and are involved, e.g., in inducing phagocytosis of opsonized microbes.
- This family includes several members, Fc ⁇ RI (CD64), Fc ⁇ RIIA (CD32), Fc ⁇ RIIB (CD32), Fc ⁇ RIIIA (CD16a), Fc ⁇ RIIIB (CD16b), which differ in their antibody affinities due to their different molecular structure.
- Fc ⁇ RI can bind to IgG more strongly than Fc ⁇ RII or Fc ⁇ RIII does.
- Fc ⁇ RI also has an extracellular portion comprising three immunoglobulin (Ig)-like domains, one more domain than Fc ⁇ RII or Fc ⁇ RIII has. This property allows Fc ⁇ RI to bind a sole IgG molecule (or monomer), but Fc ⁇ receptors generally need to bind multiple IgG molecules within an immune complex to be activated.
- Ig immunoglobulin
- the Fc ⁇ receptors differ in their affinity for IgG and the different IgG subclasses can have unique affinities for each of the Fc ⁇ receptors. These interactions can be further tuned by the glycan (oligosaccharide) at certain position of IgG. For example, by creating steric hindrance, fucose containing CH2-84.4 glycans reduce IgG affinity for Fc ⁇ RIIIA, whereas GO glycans, which lack galactose and terminate instead with GlcNAc moieties, have increased affinity for Fc ⁇ RIIIA (Maverakis et al. (2015) Journal of Autoimmunity 57 (6): 1-13)
- the neonatal Fc receptor (FcRn) is expressed on multiple cell types and is similar in structure to MHC class I. This receptor also binds IgG and is involved in preservation of this antibody (Zhu et al. (2001). Journal of Immunology 166 (5): 3266-76.). FcRn is also involved in transferring IgG from a mother either via the placenta to her fetus or in milk to her suckling infant. This receptor may also play a role in the homeostasis of IgG serum levels.
- Fc ⁇ RI (or CD89) belongs to the Fc ⁇ R subgroup.
- Fc ⁇ RI is found on the surface of neutrophils, eosinophils, monocytes, macrophages (including Kupffer cells), and dendritic cells. It comprises two extracellular Ig-like domains, and is a member of both the immunoglobulin superfamily and the multi-chain immune recognition receptor (MIRR) family. It signals by associating with two FcR ⁇ signaling chains.
- Fc-alpha/mu receptor (Fc ⁇ / ⁇ R) is a type I transmembrane protein. It can bind IgA, although it has higher affinity for IgM (Shibuya and Honda (2006) Springer Seminars in Immunopathology 28 (4): 377-82). With one Ig-like domain in its extracellular portion, this Fc receptor is also a member of the immunoglobulin superfamily.
- Fc ⁇ R There are two known types of Fc ⁇ R.
- the high-affinity receptor Fc ⁇ RI is a member of the immunoglobulin superfamily (it has two Ig-like domains). Fc ⁇ RI is found on epidermal Langerhans cells, eosinophils, mast cells and basophils. This receptor can play a role in controlling allergic responses. Fc ⁇ RI is also expressed on antigen-presenting cells, and controls the production of immune mediators, e.g., cytokines that promote inflammation (von Bubnoff et al. (2003) Clinical and Experimental Dermatology 28 (2): 184-7).
- the low-affinity receptor Fc ⁇ RII (CD23) is a C-type lectin.
- Fc ⁇ RII has multiple functions as a membrane-bound or soluble receptor. It can also control B cell growth and differentiation and blocks IgE-binding of eosinophils, monocytes, and basophils (Kikutani et al. (1989) Ciba Foundation Symposium 147: 23-31).
- the Fc region can be engineered to contain an antigen-binding site to generate an Fcab fragment (Wozniak-Knopp et al. (2010) Protein Eng Des 23 (4): 289-297).
- Fcab fragments can be inserted into a full immunoglobulin by swapping the Fc region, thus obtaining a bispecific antibody (with both Fab and Fcab regions containing distinct binding sites).
- FcRn The binding and recycling of FcRn can be illustrated below.
- IgG and albumin are internalized into vascular endothelial cells through pinocytosis.
- the pH of the endosome is 6.0, facilitating association with membrane-bound FcRn.
- the contents of endosomes can be processed in one of two ways: either recycling back to the apical cell membrane or transcytosis from the apical to the basolateral side. IgG not associated with FcRn is degraded by lysosomes.
- FcRn interaction with IgG is mediated through Fc.
- the binding of Fc to FcRn is pH specific, e.g., no significant binding at pH 7.4 and strong binding in acidic environment.
- Structure of FcRn in complex with Fc domain of IgG1 molecule is known in FIG. 1 .
- Each FcRn molecule generally binds to an Fc-monomer.
- Fab domains can also influence binding of IgG to FcRn, e.g., have either a negative or no influence on the affinity of the IgG for FcRn.
- FcRn binds proximal to the linker region between CH2 and CH3 domains of a Fc region. Modifications to the linker can impact Fc engagement with Fc ⁇ receptors. Modifications on the Fc region can impact thermal stability and aggregation properties of the polypeptide.
- the polypeptide (e.g., antibody molecule or fusion protein) described herein has the same affinity function, or does not substantially alter (e.g., decrease by more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) an effector function (e.g., an effector function described herein).
- the effector function is not associated with the binding between an Fc region and an FcRn.
- the amino acid residues to be mutated can be selected, at least in part, based on the structural or functional properties of one or more binding sites on the Fc region.
- binding sites include, but are not limited to, a Protein A binding site, a C1q binding site, an Fc ⁇ RI binding site, an Fc ⁇ RIIa binding site, an Fc ⁇ RIIIa binding site, or an FcRn binding site, e.g., as shown in FIG. 2 .
- the binding sites can also include a TRIM21 binding site, e.g., one or more residues chosen from loop 308-316, loop 252-256, or loop 429-436 of an IgG.
- the linker region between the CH2 and CH3 domain can influence the dynamics of the CH2 domain which impinges on Fc ⁇ R binding.
- the polypeptide e.g., antibody molecule or fusion protein
- the polypeptide comprises a mutation in residue H310, a mutation in residue H433, or both.
- the polypeptide can also include a compensating or beneficial mutation, e.g., a mutation that compensates, or beneficial, for any of the aforesaid mutations, e.g., to reduce a negative consequence of that mutation (e.g., polar vs. non-polar, charged vs. no charge, positively-charged (basic) vs. negatively charged (acidic), or hydrophobic vs. hydrophilic).
- a compensating or beneficial mutation e.g., a mutation that compensates, or beneficial, for any of the aforesaid mutations, e.g., to reduce a negative consequence of that mutation (e.g., polar vs. non-polar, charged vs. no charge, positively-charged (basic) vs. negatively charged (acidic), or hydrophobic vs. hydrophilic).
- P247D can be a compensating or beneficial mutation.
- protonation of histidine can result in additional conformational changes including, e.g., movement/displacement of the linker/CH2/CH3 interface residues.
- Crystal structures of Fc fragments have been crystallized at different pHs. As shown in FIG. 3 , an analysis of two high resolution crystal structures of Fc fragments crystallized and pH 6.5 (cyan) and 5.0 (green) indicated potential differences.
- the polypeptide (e.g., antibody molecule or fusion protein) described herein comprises a mutation that can alter the interaction between an Fc region and an FcRn.
- the mutation is selected based, at least in part, on a structural feature of the Fc-FcRn interaction interface.
- the Fc region of an immunoglobulin monomer can have the structure shown in FIG. 4 .
- the black dotted line indicates the Fc-FcRn interaction interface.
- the structure includes FcRn contact residues and FcRn affinity enhancing Fc residues, e.g., as described herein.
- Residues H310 and H435, which are located in the CH2 and CH3 domains, respectively, are primarily responsible for the pH dependent Fc-FcRn interactions.
- the FcRn binds the Fc region between its CH2 and CH3 domains.
- the Fc-FcRn binding site is located across both the CH2 and CH3 domains of the Fc monomer.
- the polypeptide (e.g., antibody molecule or fusion protein) described herein comprises a plurality of mutations that can alter the interaction between an Fc region and an FcRn.
- the mutation is selected based, at least in part, on a network view of the Fc-FcRn interaction.
- residue H310 plays a central role in engagement with the FcRn, e.g., as determined by a network analysis of the Fc-FcRn complex. As shown in FIG. 5 , residue H310 is highly interconnected to multiple other highly networked residues. In an embodiment, a mutation in the H310 cluster, and neighboring (connected nodes), can strengthen the H310 network. Analysis of sub-networks informs introduction of synergistic mutations for favorable FcRn interaction; with reduced or minimal impact on other Fc residues.
- polypeptide e.g., antibody molecule or fusion protein
- the polypeptide described herein can be designed for optimizing Fc-FcRn binding.
- the polypeptide having a mutation in the Fc region has a pH-specific affinity enhancement, compared to a reference polypeptide (e.g., an otherwise identical polypeptide without the mutation).
- affinity enhancement is achieved by increasing van der Waal interaction.
- affinity enhancement is not achieved by introduction of hydrogen bonds and/or electrostatic interaction.
- the mutation does not alter, or has reduced or minimal perturbation to, the conformation of the linker region between the CH2 and CH3 domains.
- the polypeptide comprises a plurality of mutations across both domains (four quadrants).
- the polypeptide does not contain a large cluster of hydrophobic or aromatic residues on the surface.
- the polypeptide comprises a mutation that enhances the strength of interaction between an Fc region and FcRn or reduces the dissociation constant (K d ) for FcRn, e.g., at an acidic pH.
- the polypeptide comprises a mutation that reduces the rate of dissociation (k off ) for FcRn, e.g., at an acidic pH.
- the polypeptide comprises a mutation that increases the rate of association (k on ) for FcRn, e.g., at an acidic pH.
- the polypeptide comprises a mutation that reduces the rate of dissociation (k off ) for FcRn, and increases the rate of association (k on ) for FcRn, e.g., at an acidic pH. In an embodiment, the polypeptide comprises a mutation that reduces the rate of dissociation (k off ) for FcRn, and does not, or does not significantly, affect the rate of association (k on ) for FcRn, e.g., at an acidic pH.
- the reduction of the dissociation constant K d for FcRn is primarily resulted from the reduction of the rate of dissociation (k off ) for FcRn, rather than the increase of the rate of association (k on ).
- the polypeptides e.g., antibody molecules or fusion proteins
- the pH-specific Fc-FcRn binding e.g., binding at pH6.0 and pH7.4
- the pH-specific Fc-FcRn binding can be determined, e.g., by an Octet-based assay, a competition assay (e.g., flow cytometry), or surface plasmon resonance (SPR).
- Biophysical characterization e.g., thermal stability, aggregation, or expression
- Thermal stability can be determined, e.g., by SYPRO orange.
- Aggregation can be measured, e.g., by SEC or RP-HPLC.
- Effector functions e.g., relating to Fc ⁇ RI (e.g., by an Octet-based assay), Fc ⁇ RIIIa, Fc ⁇ RIIa, Fc ⁇ RIIb (e.g., by ELISA), C1q, ADCC, or CDC, can be tested.
- Fc ⁇ RI e.g., by an Octet-based assay
- Fc ⁇ RIIIa e.g., Fc ⁇ RIIa
- Fc ⁇ RIIb e.g., by ELISA
- C1q e.g., ADCC, or CDC
- Tripartite Motif-Containing Protein 21 binding can be tested.
- TRIM21 is a cytosolic receptor that binds with Fc of IgG.
- TRIM21 plays a role in mediating intracellular recognition and neutralization of Fc bound pathogens such as viruses, bacteria and fungus.
- Fc bound pathogens such as viruses, bacteria and fungus.
- TRIM21 plays an important role in the neutralization of non-enveloped viruses (McEwan et al. Nat Immunol. 2013; 14(4):327-36). Its role has been further expanded to include directing of immune complexes for degradation (McEwan et al. Proc Natl Acad Sci USA. 2017; 114(3):574-579).
- TRIM21 binds to the CH2:CH3 interface of the antibody Fc region, which overlaps with the FcRn binding site.
- Some Fc mutations that increase FcRn affinity decrease TRIM21 affinity (Foss et al. J Immunol. 2016; 196(8):3452-3459).
- Key contact residues include, e.g., positions 253, 433, 434, and 435.
- the LS variant (M428L/N434S) contains a mutation at position 434, and it has been shown that the N434S mutation causes a 10 fold decrease in TRIM21 binding.
- TRIM21-mediated neutralization is known as antibody dependent intracellular neutralization (ADIN).
- FcRn transports IgG across different cellular barriers such as the mucosal epithelium lining the intestine and the alveolar surfaces. Modification of FcRn binding provides a mechanism to enhance mucosal localization that confers immune protection.
- the half-life of the polypeptide can be measured, e.g., using transgenic mice (e.g., Tg32 and Tg276 mice from Jackson's lab), or in primates (e.g., cynomolgus monkeys).
- transgenic mice e.g., Tg32 and Tg276 mice from Jackson's lab
- primates e.g., cynomolgus monkeys
- Immobilization of FcRn to a NiNTA biosensor via a 6 ⁇ histidine tag allows for subsequent interrogation of binding to IgG molecules under acidic (pH 6.0) and physiological (pH 7.4) conditions.
- This strategy has been previously described (1) and this method details an adaptation of the referenced protocol. Briefly, recombinant human FcRn at 5 ⁇ g/mL is loaded onto a NiNTA biosensor for 180 seconds.
- the FcRn loaded tip is exposed to IgG at a concentration of 250 nM (37.5 ⁇ g/mL) for 60 seconds, followed by dissociation for 60 seconds in PBS pH 6.0, and an additional 30 seconds in PBS pH 7.4.
- a quantitative assessment of the affinity constant (K D ) at pH 6.0 is performed using the ForteBio octet software and a qualitative assessment is performed by plotting the response rate over time, allowing for visualization of the association of IgG to FcRn at pH 6.0 and the subsequent dissociation at pH 6.0 and pH 7.4.
- Immobilization of IgG to an anti-CH1 biosensor allows for subsequent interrogation of binding to FcRn molecules under acidic (pH 6.0) and physiological (pH 7.4) conditions.
- This strategy has been previously described (2) and this method details an adaptation of the referenced protocol. Briefly, purified IgG at 5 ⁇ g/mL is loaded onto an anti-CH1 biosensor for 180 seconds. After a 60 second baseline step in 1 ⁇ PBS pH 6.0, the IgG loaded tip is exposed to FcRn at a concentration of 50 ⁇ g/mL for 60 seconds, followed by dissociation for 60 seconds in PBS pH 6.0, and an additional 30 seconds in PBS pH 7.4.
- FcRn and IgG Cell-based assays are also used to analyze the interactions between FcRn and IgG (Ref: PMID: 23384837). Expression of membrane-anchored FcRn on the cell surface closely represents the physiological presentation of FcRn, where the plasma membrane and molecular orientations influence interactions between FcRn and IgG.
- the assay used here is a competition assay in which IgGs of interest are evaluated for their ability to compete with cell binding of a fluorescently-labeled, high affinity Fc competitor reagent (Fc-A488).
- Expi293 cells expressing the full-length, membrane-bound FcRn heterodimer are incubated with mixtures of a static concentration of Fc-A488 (0.5 ug/ml) and varying concentrations of IgG of interest (0.001-10 ⁇ M). Cell-bound fluorescence is detected by flow cytometry. IgGs with improved binding to FcRn will compete off the Fc competitor at lower IgG concentrations. This assay is robust, linear, and specific and can be used to show differences in relative binding of IgG/Fc variants to FcRn.
- DSF Differential Scanning Fluorimetry
- SYPRO® Orange is a fluorescent dye that non-specifically binds to hydrophobic surfaces and its fluorescence is quenched in aqueous environments. Proteins begin to lose their secondary structure and unfold with increasing temperatures thus exposing their hydrophobic core residues, and allowing the dye to fluoresce. Maximum fluorescent signal is attained at complete unfolding, after which the protein begins to aggregate, reducing the exposed hydrophobic residues, and thus reducing the fluorescent signal.
- Tm melt temperature
- factors other than FcRn binding can also affect the observed half-life of a polypeptide (e.g., an antibody molecule or fusion protein). These factors can include, e.g., aggregation propensity, non-specific binding, stability, or Fab composition.
- a mutation in a non-Fc region is introduced, e.g., to provide a substantial improvement in half-life in the context of a suboptimal template.
- polypeptides e.g., antibody molecules or fusion proteins
- engineering efforts can also focus on mitigating the root cause of lower half-life, e.g., to maintain requisite binding profile (e.g., affinity and/or specificity), or to obtain suitable developability characteristics (e.g., stability, solubility, expression level, or aggregation).
- additional engineering is performed for polypeptide (e.g., antibody molecules or fusion proteins) with suboptimal biophysical properties to realize maximal half-life extension.
- polypeptides e.g., antibody molecules or fusion proteins
- the polypeptides described herein can have one or more desired pharmacokinetic properties, e.g., one or more (e.g., 2, 3, 4, 5, or more) of the pharmacokinetic properties described herein.
- Pharmacokinetics can be used to determine the fate of substances administered to a living organism. PK studies can be used to analyze drug metabolism and to identify the fate of a drug from the moment that it is administered up to the point at which it is completely eliminated from the body. Pharmacokinetics describes, e.g., how the body affects a specific drug after administration through the mechanisms of absorption and distribution, the chemical changes of the substance in the body (e.g. by metabolic enzymes such as cytochrome P450 or glucuronosyltransferase enzymes), or the effects and routes of excretion of the metabolites of the drug. Pharmacokinetic properties of drugs may be affected by elements such as the site of administration and the dose of administered drug, which may affect the absorption rate. Pharmacokinetics can be analyzed in conjunction with pharmacodynamics (e.g., the study of the biochemical and physiologic effects of drugs).
- pharmacokinetic modelling can be performed by noncompartmental or compartmental methods.
- Noncompartmental methods estimate the exposure to a drug by estimating the area under the curve of a concentration-time graph.
- Noncompartmental PK analysis is highly dependent on estimation of total drug exposure. Total drug exposure is often estimated by area under the curve (AUC) methods, with the trapezoidal rule (numerical integration) the most common method. Due to the dependence on the length of ‘x’ in the trapezoidal rule, the area estimation is highly dependent on the blood/plasma sampling schedule. That is, the closer time points are, the closer the trapezoids reflect the actual shape of the concentration-time curve.
- Compartmental methods estimate the concentration-time graph using kinetic models.
- Compartmental PK analysis uses kinetic models to describe and predict the concentration-time curve.
- PK compartmental models are often similar to kinetic models used in other scientific disciplines such as chemical kinetics and thermodynamics.
- the advantage of compartmental over some noncompartmental analyses is the ability to predict the concentration at any time. Compartment-free modelling based on curve stripping does not suffer this limitation.
- the simplest PK compartmental model is the one-compartmental PK model with IV bolus administration and first-order elimination.
- the more complex PK models e.g., PBPK models
- PBPK models rely on the use of physiological information to ease development and validation.
- the graph of the relationship between the various factors involved gives a straight line or an approximation to one (i.e., linear pharmacokinetics).
- drugs to be effective they need to be able to move rapidly from blood plasma to other body fluids and tissues.
- the graph for the non-linear relationship between the various factors is represented by a curve, the relationships between the factors can then be found by calculating the dimensions of different areas under the curve.
- the models used in non-linear pharmacokinetics are largely based on Michaelis-Menten kinetics.
- the various compartments that the model is divided into are commonly referred to as the ADME scheme (also referred to as LADME if liberation is included as a separate step from absorption): liberation (e.g., the process of release of a drug from the pharmaceutical formulation); absorption (e.g., the process of a substance entering the blood circulation); distribution (e.g., the dispersion or dissemination of substances throughout the fluids and tissues of the body); metabolism (or biotransformation, or inactivation) (e.g., the recognition by the organism that a foreign substance is present and the irreversible transformation of parent compounds into daughter metabolites); and excretion (e.g., the removal of the substances from the body). In rare cases, some drugs irreversibly accumulate in body tissue. The two phases of metabolism and excretion can also be grouped together under the title elimination.
- the model outputs for a drug can be used in industry (for example, in calculating bioequivalence when designing generic drugs) or in the clinical application of pharmacokinetic concepts.
- Clinical pharmacokinetics provides a number of performance guidelines for effective and efficient use of drugs for human-health professionals and in veterinary medicine.
- Exemplary pharmacokinetic properties include, but are not limited to, dose (e.g., the amount of drug administered), dosing interval (e.g., the time between drug dose administrations), C max (e.g., the peak plasma concentration of a drug after administration), t max (e.g., the time to reach C max ), C min (e.g., the lowest concentration that a drug reaches before the next dose is administered), volume of distribution (e.g., the apparent volume in which a drug is distributed, e.g., relating drug concentration to drug amount in the body), concentration (e.g., the amount of drug in a given volume of plasma), half-life or elimination half-life (e.g., the time required for the concentration of the drug to reach half of its original value), elimination rate constant (e.g., the rate at which a drug is removed from the body), infusion rate (e.g., the rate of infusion required to balance elimination), area under the curve (e.g., the integral of the concentration-time curve,
- Pharmacokinetic properties can be measured by various methods. For example, bioanalytical methods can be used to construct a concentration-time profile. Chemical techniques can be employed to measure the concentration of drugs in biological matrix, e.g., plasma. Proper bioanalytical methods should be selective and sensitive. For example, microscale thermophoresis can be used to quantify how the biological matrix/liquid affects the affinity of a drug to its target (Baaske et al. (2010). Angew. Chem. Int. Ed. 49 (12): 1-5; Wienken et al. (2010). Nature Communications 1 (7): 100).
- Pharmacokinetic properties can also be studied using mass spectrometry, e.g., when there is a need for high sensitivity to observe concentrations after a low dose and a long time period.
- a common instrumentation used in this application is LC-MS with a triple quadrupole mass spectrometer. Tandem mass spectrometry can be employed for added specificity. Standard curves and internal standards can be used for quantitation of a pharmaceutical in the samples. The samples represent different time points as a pharmaceutical is administered and then metabolized or cleared from the body. Blank samples taken before administration are used in determining background and ensuring data integrity with such complex sample matrices.
- the standard curve can be linear, or curve fitting can be used with more complex functions such as quadratics since the response of most mass spectrometers is less than linear across large concentration ranges (Hsieh and Korfmacher (2006) Current Drug Metabolism 7 (5): 479-89; Covey et al. (1986) Anal. Chem. 58 (12): 2453-60; Covey et al. (1985). Anal. Chem. 57 (2): 474-81).
- the methods described herein can be used to engineer a variety of antibody molecules, e.g., any antibody molecule containing an Fc region.
- the antibody molecule is a chimeric antibody molecule, a humanized antibody molecule, or a human antibody molecule.
- the antibody molecule is a whole monoclonal antibody.
- the antibody molecule is an Fc region-containing derivative of an antibody molecule that does not contain an Fc region (e.g., an antigen-binding fragment described herein).
- Exemplary antigen-binding fragments include, but are not limited to, Fab, F(ab′)2, Fab′, scFv, di-scFv, or sdAb.
- the antibody molecule is a bispecific monoclonal antibody, e.g., a trifunctional antibody (3funct) or bi-specific T-cell engager (BiTE).
- the antibody molecule targets a molecule (e.g., a protein) associated with an infectious disease (e.g., a viral infection, a bacterial infection, or a fungal infection).
- the antibody molecule targets a molecule (e.g., a protein) or cell associated with a cancer.
- the antibody molecule targets a molecule (e.g., a protein) or cell associated with an immune disorder.
- the antibody molecule targets a molecule (e.g., a protein) or cell associated with a cardiovascular disorder.
- the antibody molecule targets a molecule (e.g., a protein) or cell associated with a metabolic disorder.
- the antibody molecule targets a molecule (e.g., a protein) or cell associated with a neurological disorder.
- Exemplary antibody molecules include, but are not limited to, antibody molecules that target one or more (e.g., 2) of the following molecules or cells: ⁇ -amyloid, 4-1BB, SAC, 5T4, ACF9, ACFIX, activin receptor-like kinase 1, ACVR2B, an adenocarcinoma antigen, AGS-22M6, alpha-fetoprotein, angiopoietin 2, angiopoietin 3, a protective antigen of anthrax toxin, AOC3 (VAP-1), B7-H3, bacillus anthracisanthrax, BAFF, B-lymphoma cell, C242 antigen, C5, CA-125 (imitation), calcitonin, canis lupus familiaris IL31, carbonic anhydrase 9 (CA-IX), cardiac myosin, CCL11 (eotaxin-1), CCR2, CCR4, CCR5, CD11, CD18, CD125, CD140a, CD147 (bas
- coli shiga toxintype-1 E. coli shiga toxintype-2, EGFL7, EGFR, endoglin, endotoxin, EpCAM, ephrin receptor A3, episialin, ERBB3, Escherichia coli , F protein of respiratory syncytial virus, FAP, fibrin II beta chain, fibronectin extra domain-B, folate hydrolase, folate receptor 1, folate receptor alpha, Frizzled receptor, ganglioside GD2, GCGR, GD2, GD3 ganglioside, GDF-8, glypican 3, GMCSF receptor ⁇ -chain, GPNMB, growth differentiation factor8, GUCY2C, hemagglutinin, hepatitis B surface antigen, hepatitis B virus, HER1, HER2/neu, HER3, HGF, HHGFR, histone complex, HIV-1, HLA-DR, HNGF, Hsp90, human scatter factor receptor kinase, human
- Exemplary antibody molecules include, but are not limited to, antibody molecules that target one or more (e.g., 2) of the following pathogens (e.g., bacteria, viruses, or fungi): Actinomyces gerencseriae, Actinomyces israelii, Actinomycetoma species, Alphavirus, Anaplasma phagocytophilum, Anaplasma species, Ancylostoma braziliense, Ancylostoma duodenale, Angiostrongylus, Anisakis, Arcanobacterium haemolyticum, Ascaris lumbricoides, Aspergillus species, Astroviridae family, Babesia species, Bacillus anthracis, Bacillus cereus , bacterial vaginosis microbiota, Bacteroides species, Balantidium coli, Bartonella, Bartonella bacilliformis, Bartonella henselae, Batracrochytrium dendrabatidis, Bay
- Exemplary antibody molecules include, but are not limited to, 3f8, 8h9, abagovomab, abciximab, abituzumab, abrilumab, actoxumab, adalimumab, adecatumumab, aducanumab, afasevikumab, afelimomab, afutuzumab, alacizumab pegol, a1d518, alemtuzumab, alirocumab, altumomab pentetate, amatuximab, anatumomab mafenatox, anetumab ravtansine, anifrolumab, anrukinzumab (ima-638), apolizumab, arcitumomab, ascrinvacumab, aselizumab, atezolizumab, atinumab, atlizumab (tocilizum
- the antibody molecule comprises one, two, or three CDRs of the VH region of an antibody molecule described herein, using the Kabat or Chothia definitions of CDRs. In an embodiment, the antibody molecule comprises one, two, or three CDRs of the VL region of an antibody molecule described herein, using the Kabat or Chothia definitions of CDRs. In an embodiment, the antibody molecule comprises one or more (e.g., two or three) CDRs of the VH region and/or one or more (e.g., two or three) CDRs of the VL region of an antibody molecule described herein, using the Kabat or Chothia definitions of CDRs.
- the antibody molecule comprises one, two, three, or four frameworks of the VH region of an antibody molecule described herein. In an embodiment, the antibody molecule comprises one, two, three, or four frameworks of the VL region of an antibody molecule described herein. In an embodiment, the antibody molecule comprises one or more (e.g., two, three, or four) frameworks of the VH region and/or one or more (e.g., two, three, or four) frameworks of the VL region of an antibody molecule described herein.
- the antibody molecule comprises a heavy chain variable region of an antibody molecule described herein, or a heavy chain variable region having an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues).
- the antibody molecule comprises a light chain variable region of an antibody molecule described herein, or a light chain variable region having an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues).
- the antibody molecule comprises a heavy chain variable region, or a heavy chain variable region having an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues), and a light chain variable region of an antibody molecule described herein, or a light chain variable region having an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues).
- an amino acid sequence substantially identical thereto e.g., an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues
- the antibody molecule further comprises a heavy chain constant region, e.g., a heavy chain constant region of an antibody molecule described herein, or a heavy chain constant region having an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues).
- a heavy chain constant region e.g., a heavy chain constant region of an antibody molecule described herein, or a heavy chain constant region having an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues).
- the antibody molecule further comprises a light chain constant region, e.g., a light chain constant region of an antibody molecule described herein, or a light chain constant region having an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues).
- a light chain constant region e.g., a light chain constant region of an antibody molecule described herein, or a light chain constant region having an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues).
- the antibody molecule further comprises a heavy chain constant region, or a heavy chain constant region having an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues), and a light chain constant region, or a light chain constant region having an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues).
- the antibody molecule comprises a heavy chain constant region, a light chain constant region, and heavy and light chain variable regions of an antibody molecule, as described herein.
- the antibody molecules described herein can have several advantageous properties, including, but limited to, a desired (e.g., increased) half-life.
- the antibody molecules can be used to effectively treat, prevent or diagnose a disorder described herein.
- the antibody molecule is capable of binding to a target molecule or cell.
- the engineered antibody molecule is capable of binding to the target molecule or cell, with the same, or substantially the same, binding specificity and/or affinity, as compared to the parental antibody molecule.
- the antibody molecule binds to the target molecule or cell with high affinity, e.g., with a dissociation constant (K d ) of less than about 100 nM, typically about 10 nM, and more typically, about 10-0.01 nM, about 5-0.01 nM, about 3-0.05 nM, about 1-0.1 nM, or stronger, e.g., less than about 80, 70, 60, 50, 40, 30, 20, 10, 8, 6, 4, 3, 2, 1, 0.5, 0.2, 0.1, 0.05, or 0.01 nM.
- K d dissociation constant
- the antibody molecule binds to the target molecule or cell with a K off slower than 1 ⁇ 10 ⁇ 4 , 5 ⁇ 10 ⁇ 5 , or 1 ⁇ 10 ⁇ 5 s ⁇ 1 . In an embodiment, the antibody molecule binds to the target molecule or cell with a K on faster than 1 ⁇ 10 4 , 5 ⁇ 10 4 , 1 ⁇ 10 5 , or 5 ⁇ 10 5 M ⁇ 1 s ⁇ 1 .
- the antibody molecule is capable of inhibiting or activating a biological function of a target molecule or cell.
- the engineered antibody molecule is capable of inhibiting or activating a biological function of the target molecule or cell, with the same, or substantially the same, level of effectiveness, as compared to the parental antibody molecule, e.g., as determined by IC50, EC50, or LD50.
- the antibody molecule is capable of binding to an epitope on a target molecule or cell.
- the engineered antibody molecule is capable of binding to the same, or substantially the same, epitope on the target molecule or cell, as compared to the parental antibody molecule.
- the methods described herein can be used to engineer a variety of fusion proteins, e.g., any Fc fusion protein containing an Fc region.
- Exemplary Fc fusion proteins include, but are not limited to, a CTLA-4 Fc fusion protein (e.g., belatacept or abatacept), a vascular endothelial growth factor receptor (VEGFR) Fc fusion protein (e.g., a VEGFR1/VEGFR2 Fc fusion protein, e.g., aflibercept or KH902), an IL-1R Fc fusion protein (e.g., (rilonacept), a thrombopoietin-binding peptide Fc fusion protein (e.g., romiplostim), an LFA-3 Fc fusion protein (e.g., alefacept), an anti-CD40L Fc fusion protein (e.g., a dimeric fusion protein comprising the C-terminus of the domain antibody (dAb) targeting the CD40 ligand (CD40L or CD154) linked to an Fc fragment of IgG1, e.g., BMS
- polypeptides e.g., antibody molecules or fusion proteins
- the polypeptides described herein can be evaluated in vivo, e.g., using various animal models.
- an animal model can be used to test the efficacy of a polypeptide (e.g., antibody molecule or fusion proteins) described herein in modulating a biological function of a target molecule or cell.
- an animal model can also be used to test the efficacy of a polypeptide (e.g., antibody molecule) described herein in in treating, preventing, or diagnosing a disorder described herein.
- Animal models can also be used, e.g., to investigate for side effects, measure concentrations of antibody molecules in situ, demonstrate correlations between a function of a target molecule or cell and a disorder described herein.
- Exemplary animal models for other disorders described herein are also known in the art.
- Exemplary types of animals that can be used to evaluate the antibody molecules described herein include, but are not limited to, mice, rats, rabbits, guinea pigs, and monkeys.
- Non-human primates and transgenic mice expressing human FcRn are typically used as the model of choice for PK analysis (Avery et al. MAbs. 2016; 8(6):1064-78; Fan et al. MAbs. 2016; 8(5):848-53; Tam et al. MAbs. 2013; 5(3):397-405).
- humanized FcRn mice can be established on the C57BL/6J background in a sequential manner, including the creation of a mouse strain carrying a deletion in the mouse FcRn gene, followed by introduction of the human FcRn gene.
- exemplary mouse lines include, e.g., Tg276 and Tg32 (The Jackson Laboratory stock number 004919 and 014565). With further backcrossing and sequential alterations, additional lines can be made.
- Exemplary mouse models that can be used to evaluate the polypeptides described herein include, but are not limited to, FcRn-null mice, humanized Tg276 FcRn mice (e.g., B6.Cg-Fcgrt ⁇ tm1Dcr>Tg(CAG-FCGRT)276Dcr/DcrJ with the Jackson Laboratory stock number 004919), humanized Tg32 FcRn mice (e.g., B6.Cg-Fcgrt ⁇ tm1Dcr>Tg(FCGRT)32Dcr/DcrJ with the Jackson Laboratory stock number 014565), immunodeficient hFcRn mice (e.g., B6.Cg-Fcgrt ⁇ tm1Dcr>Prkdc ⁇ scid>Tg(CAG-FCGRT)276Dcr/DcrJ with the Jackson Laboratory stock number 021146), B6.Cg-Fcgrt ⁇ tm1D
- compositions e.g., pharmaceutically acceptable compositions, which include a polypeptide (e.g., an antibody molecule or fusion protein) described herein, formulated together with a pharmaceutically acceptable carrier.
- a polypeptide e.g., an antibody molecule or fusion protein
- “pharmaceutically acceptable carrier” includes any and all solvents, dispersion media, isotonic and absorption delaying agents, and the like that are physiologically compatible.
- the carrier can be suitable for intravenous, intramuscular, subcutaneous, parenteral, rectal, spinal or epidermal administration (e.g., by injection or infusion).
- less than about 5%, e.g., less than about 4%, 3%, 2%, or 1% of the antibody molecules in the pharmaceutical composition are present as aggregates.
- At least about 95%, e.g., at least about 96%, 97%, 98%, 98.5%, 99%, 99.5%, 99.8%, or more of the antibody molecules in the pharmaceutical composition are present as monomers.
- the level of aggregates or monomers is determined by chromatography, e.g., high performance liquid chromatography size exclusion chromatography (HPLC-SEC).
- compositions set out herein may be in a variety of forms. These include, for example, liquid, semi-solid and solid dosage forms, such as liquid solutions (e.g., injectable and infusible solutions), dispersions or suspensions, liposomes, and suppositories.
- liquid solutions e.g., injectable and infusible solutions
- dispersions or suspensions e.g., liposomes, and suppositories.
- a suitable form depends on the intended mode of administration and therapeutic application. Typical suitable compositions are in the form of injectable or infusible solutions.
- One suitable mode of administration is parenteral (e.g., intravenous, subcutaneous, intraperitoneal, intramuscular).
- the polypeptide e.g., antibody molecule or fusion proteins
- the polypeptide is administered by intravenous infusion or injection.
- the polypeptide e.g., antibody molecule or fusion proteins
- parenteral administration and “administered parenterally” as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion.
- compositions typically should be sterile and stable under the conditions of manufacture and storage.
- the composition can be formulated as a solution, microemulsion, dispersion, liposome, or other ordered structure suitable to high antibody concentration.
- Sterile injectable solutions can be prepared by incorporating the active compound (i.e., antibody or antibody portion) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
- dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
- the preferred methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- the proper fluidity of a solution can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- Prolonged absorption of injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
- the polypeptides e.g., antibody molecules or fusion proteins
- an appropriate route/mode of administration is intravenous injection or infusion.
- the antibody molecules can be administered by intravenous infusion at a rate of less than 10 mg/min; preferably less than or equal to 5 mg/min to reach a dose of about 1 to 100 mg/m 2 , preferably about 5 to 50 mg/m 2 , about 7 to 25 mg/m 2 and more preferably, about 10 mg/m 2 .
- the route and/or mode of administration will vary depending upon the desired results.
- the active compound may be prepared with a carrier that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems.
- a controlled release formulation including implants, transdermal patches, and microencapsulated delivery systems.
- Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are patented or generally known to those skilled in the art. See, e.g., Sustained and Controlled Release Drug Delivery Systems , J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978.
- a polypeptide e.g., an antibody molecule or fusion protein
- an inert diluent or an assimilable edible carrier e.g., an inert diluent or an assimilable edible carrier.
- the antibody molecule (and other ingredients, if desired) may also be enclosed in a hard or soft shell gelatin capsule, compressed into tablets, or incorporated directly into the subject's diet.
- the antibody molecule may be incorporated with excipients and used in the form of ingestible tablets, buccal tablets, troches, capsules, elixirs, suspensions, syrups, wafers, and the like.
- a polypeptide e.g., an antibody molecule
- Therapeutic, prophylactic, or diagnostic compositions can also be administered with medical devices, and several are known in the art.
- Dosage regimens are adjusted to provide the desired response (e.g., a therapeutic, prophylactic, or diagnostic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage.
- Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
- the dosage unit forms are dictated by and directly dependent on (a) the unique characteristics of the antibody molecule and the particular therapeutic, prophylactic, or diagnostic effect to be achieved, and (b) the limitations inherent in the art of compounding such an antibody molecule for the treatment of sensitivity in individuals.
- An exemplary, non-limiting range for a therapeutically, prophylactically, or diagnostically effective amount of an antibody molecule is about 0.1-50 mg/kg, e.g., about 0.1-30 mg/kg, e.g., about 1-30, 1-15, 1-10, 1-5, 5-10, or 1-3 mg/kg, e.g., about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, or 50 mg/kg.
- the antibody molecule can be administered by intravenous infusion at a rate of less than 10 mg/min, e.g., less than or equal to 5 mg/min to reach a dose of about 1 to 100 mg/m 2 , e.g., about 5 to 50 mg/m 2 , about 7 to 25 mg/m 2 , e.g., about 10 mg/m 2 . It is to be noted that dosage values may vary with the type and severity of the condition to be alleviated.
- compositions herein may include a “therapeutically effective amount,” “prophylactically effective amount,” or “diagnostically effectively amount” of a polypeptide (e.g., an antibody molecule) described herein.
- a polypeptide e.g., an antibody molecule
- a “therapeutically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic result.
- a therapeutically effective amount of the polypeptide e.g., antibody molecule or fusion protein
- a therapeutically effective amount may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the antibody or antibody portion to elicit a desired response in the individual.
- a therapeutically effective amount is also one in which any toxic or detrimental effect of the antibody molecule is outweighed by the therapeutically beneficial effects.
- a “therapeutically effective dosage” typically inhibits a measurable parameter by at least about 20%, e.g., by at least about 40%, by at least about 60%, or by at least about 80% relative to untreated subjects.
- the measurable parameter may be, e.g., hematuria, colored urine, foamy urine, pain, swelling (edema) in the hands and feet, or high blood pressure.
- the ability of an antibody molecule to inhibit a measurable parameter can be evaluated in an animal model system predictive of efficacy in treating or preventing a disorder described herein.
- this property of a composition can be evaluated by examining the ability of the polypeptide (e.g., antibody molecule or fusion proteins) to modulate a biological function of a target molecule or cell, e.g., by an in vitro assay.
- prophylactically effective amount refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.
- a “diagnostically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired diagnostic result.
- a diagnostically effective amount is one in which a disorder, e.g., a disorder described herein, can be diagnosed in vitro, ex vivo, or in vivo.
- kits that comprises a polypeptide (e.g., an antibody molecule or fusion protein), described herein.
- the kit can include one or more other elements including: instructions for use; other reagents, e.g., a label, a therapeutic agent, or an agent useful for chelating, or otherwise coupling, an antibody molecule to a label or therapeutic agent, or a radioprotective composition; devices or other materials for preparing the polypeptide (e.g., antibody molecule or fusion protein) for administration; pharmaceutically acceptable carriers; and devices or other materials for administration to a subject.
- nucleic acids comprising nucleotide sequences that encode polypeptides (e.g., antibody molecules or fusion proteins), e.g., Fc regions of the polypeptides, as described herein.
- polypeptides e.g., antibody molecules or fusion proteins
- Fc regions of the polypeptides as described herein.
- the present disclosure features a nucleic acid encoding an Fc region described herein, e.g., an Fc region comprising one or more of the mutations described herein.
- the Fc region can be engineered from an Fc region of an existing polypeptide (e.g., an antibody molecule or fusion protein) described herein.
- the nucleic acid can comprise a nucleotide sequence encoding an amino acid sequence of an Fc region of a polypeptide (e.g., antibody molecule or fusion protein) described herein, or a nucleotide sequence substantially identical thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein).
- a polypeptide e.g., antibody molecule or fusion protein
- the nucleic acid further comprises a nucleotide sequence encoding a heavy chain variable region of a polypeptide (e.g., an antibody molecule or fusion protein) described herein, or having a nucleotide sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein).
- a polypeptide e.g., an antibody molecule or fusion protein
- a nucleotide sequence substantially homologous thereto e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein.
- the nucleic acid further comprises a nucleotide sequence encoding a light chain variable region of a polypeptide (e.g., an antibody molecule or fusion protein) described herein, or a nucleotide sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein).
- a polypeptide e.g., an antibody molecule or fusion protein
- a nucleotide sequence substantially homologous thereto e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein.
- the nucleic acid further comprises a nucleotide sequence encoding a heavy chain variable region and a light chain variable region of a polypeptide (e.g., an antibody molecule or fusion protein) described herein, or a nucleotide sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein).
- a polypeptide e.g., an antibody molecule or fusion protein
- the nucleic acid further comprises a nucleotide sequence encoding at least one, two, or three CDRs from a heavy chain variable region of a polypeptide (e.g., an antibody molecule or fusion protein) described herein, or a nucleotide sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein).
- a polypeptide e.g., an antibody molecule or fusion protein
- a nucleotide sequence substantially homologous thereto e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein.
- the nucleic acid further comprises a nucleotide sequence encoding at least one, two, or three CDRs from a light chain variable region of a polypeptide (e.g., an antibody molecule or fusion protein) described herein, or a nucleotide sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein).
- a polypeptide e.g., an antibody molecule or fusion protein
- a nucleotide sequence substantially homologous thereto e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein.
- the nucleic acid comprises a nucleotide sequence encoding at least one, two, three, four, five, or six CDRs from heavy and light chain variable regions of a polypeptide (e.g., an antibody molecule or fusion protein) described herein, or a nucleotide sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein).
- a polypeptide e.g., an antibody molecule or fusion protein
- a nucleotide sequence substantially homologous thereto e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein.
- the nucleic acid comprises a portion of a nucleotide sequence described herein.
- the portion may encode, for example, an Fc region, a variable region (e.g., VH or VL); one, two, or three or more (e.g., four, five, or six) CDRs; or one, two, three, or four or more framework regions.
- the nucleic acids disclosed herein include deoxyribonucleotides or ribonucleotides, or analogs thereof.
- the polynucleotide may be either single-stranded or double-stranded, and if single-stranded may be the coding strand or non-coding (antisense) strand.
- a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs.
- the sequence of nucleotides may be interrupted by non-nucleotide components.
- a polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component.
- the nucleic acid may be a recombinant polynucleotide, or a polynucleotide of genomic, cDNA, semisynthetic, or synthetic origin which either does not occur in nature or is linked to another polynucleotide in a non-natural arrangement.
- the application features host cells and vectors containing the nucleic acids described herein.
- the nucleic acids may be present in a single vector or separate vectors present in the same host cell or separate host cell, as described in more detail below.
- the present disclosure features vectors that comprise nucleotide sequences encoding polypeptides (e.g., an antibody molecules or fusion proteins), e.g., Fc regions of the polypeptides, as described herein.
- polypeptides e.g., an antibody molecules or fusion proteins
- Fc regions of the polypeptides as described herein.
- the present disclosure features a vector comprising a nucleotide sequence encoding an Fc region described herein, e.g., an Fc region comprising one or more of the mutations described herein.
- the Fc region can be engineered from an Fc region of an existing polypeptide (e.g., an antibody molecule or fusion protein) described herein.
- the vector can comprise a nucleotide sequence encoding an amino acid sequence of an Fc region of a polypeptide (e.g., antibody molecule or fusion protein) described herein, or a nucleotide sequence substantially identical thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein).
- a polypeptide e.g., antibody molecule or fusion protein
- the vectors include, but are not limited to, a virus, plasmid, cosmid, lambda phage or a yeast artificial chromosome (YAC).
- vectors utilize DNA elements which are derived from animal viruses such as, for example, bovine papilloma virus, polyoma virus, adenovirus, vaccinia virus, baculovirus, retroviruses (Rous Sarcoma Virus, MMTV or MOMLV) or SV40 virus.
- DNA elements which are derived from animal viruses such as, for example, bovine papilloma virus, polyoma virus, adenovirus, vaccinia virus, baculovirus, retroviruses (Rous Sarcoma Virus, MMTV or MOMLV) or SV40 virus.
- RNA elements derived from RNA viruses such as Semliki Forest virus, Eastern Equine Encephalitis virus and Flaviviruses.
- cells which have stably integrated the DNA into their chromosomes may be selected by introducing one or more markers which allow for the selection of transfected host cells.
- the marker may provide, for example, prototropy to an auxotrophic host, biocide resistance (e.g., antibiotics), or resistance to heavy metals such as copper, or the like.
- the selectable marker gene can be either directly linked to the DNA sequences to be expressed, or introduced into the same cell by cotransformation. Additional elements may also be needed for optimal synthesis of mRNA. These elements may include splice signals, as well as transcriptional promoters, enhancers, and termination signals.
- the expression vectors may be transfected or introduced into an appropriate host cell.
- Various techniques may be employed to achieve this, such as, for example, protoplast fusion, calcium phosphate precipitation, electroporation, retroviral transduction, viral transfection, gene gun, lipid based transfection or other conventional techniques.
- protoplast fusion the cells are grown in media and screened for the appropriate activity.
- Methods and conditions for culturing the resulting transfected cells and for recovering the polypeptide (e.g., antibody molecule) produced are known to those skilled in the art, and may be varied or optimized depending upon the specific expression vector and mammalian host cell employed, based upon the present description.
- the present disclosure also provides host cells comprising a nucleic acid encoding a polypeptide (e.g., an antibody molecule or fusion protein) as described herein.
- a polypeptide e.g., an antibody molecule or fusion protein
- the polypeptide can be engineered in accordance with a method described herein.
- the host cells may comprise a nucleic acid molecule having a nucleotide sequence of a polypeptide described herein (e.g., an antibody molecule or fusion protein described herein), a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein), or a portion of one of said nucleic acids.
- a nucleic acid molecule having a nucleotide sequence of a polypeptide described herein (e.g., an antibody molecule or fusion protein described herein), a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein), or a portion of one of said nucleic acids.
- the host cells are genetically engineered to comprise nucleic acids encoding the polypeptide (e.g., antibody molecule or fusion protein) described herein.
- polypeptide e.g., antibody molecule or fusion protein
- the host cells are genetically engineered by using an expression cassette.
- expression cassette refers to nucleotide sequences, which are capable of affecting expression of a gene in hosts compatible with such sequences.
- Such cassettes may include a promoter, an open reading frame with or without introns, and a termination signal. Additional factors necessary or helpful in effecting expression may also be used, such as, for example, an inducible promoter.
- the disclosure also provides host cells comprising the vectors described herein.
- the cell can be, but is not limited to, a eukaryotic cell, a bacterial cell, an insect cell, or a human cell.
- Suitable eukaryotic cells include, but are not limited to, Vero cells, HeLa cells, COS cells, CHO cells, HEK293 cells, BHK cells and MDCKII cells.
- Suitable insect cells include, but are not limited to, Sf9 cells.
- polypeptides e.g., antibody molecules or fusion proteins
- pharmaceutical compositions disclosed herein have in vitro, ex vivo, and in vivo therapeutic, prophylactic, and/or diagnostic utilities.
- the polypeptide (e.g., antibody molecule or fusion protein) modulates (e.g., reduces (e.g., inhibits, blocks, or neutralizes) or increases (e.g., activates, initiates, or enhances)) one or more biological activities of a target molecule (e.g., protein) or cell.
- a target molecule e.g., protein
- these polypeptides can be administered to cells in culture, in vitro or ex vivo, or to a subject, e.g., a human subject, e.g., in vivo, to modulate one or more biological activities of the target molecule or cell.
- the disclosure provides a method of treating, preventing, or diagnosing a disorder, e.g., a disorder described herein, in a subject, comprising administering to the subject a polypeptide (e.g., an antibody molecule or fusion protein) described herein, such that the disorder is treated, prevented, or diagnosed.
- a polypeptide e.g., an antibody molecule or fusion protein
- the disclosure provides a method comprising contacting the polypeptide (e.g., antibody molecule or fusion protein) described herein with cells in culture, e.g.
- a subject in vitro or ex vivo, or administering the polypeptide (e.g., antibody molecule or fusion protein) described herein to a subject, e.g., in vivo, to treat, prevent, or diagnose a disorder, e.g., a disorder associated with a target molecule or cell (e.g., a disorder described herein).
- a disorder e.g., a disorder associated with a target molecule or cell (e.g., a disorder described herein).
- the term “subject” is intended to include human and non-human animals.
- the subject is a human subject, e.g., a human patient having a disorder described herein, or at risk of having a disorder described herein.
- non-human animals includes mammals and non-mammals, such as non-human primates.
- the subject is a human.
- the methods and compositions described herein are suitable for treating human patients for a disorder described herein.
- Patients having a disorder described herein include those who have developed a disorder described herein but are (at least temporarily) asymptomatic, patients who have exhibited a symptom of a disorder described herein, or patients having a disorder related to or associated with a disorder described herein.
- polypeptides e.g., antibody molecules or fusion proteins
- the polypeptide has an optimal or improved half-life, which can be desirable for treating or preventing the disorder or condition.
- the polypeptide described herein e.g., the polypeptide having an optimal or improved half-life
- can provide one or more benefits over another polypeptide having the same or similar binding affinity and/or specificity e.g., a polypeptide that does not have, or has not been engineered to have, an optimal or improved half-life.
- benefits can include, but are not limited to, an increased therapeutic or preventive efficacy, a reduced dosage regimen, or an improved pharmacokinetic property.
- the polypeptide includes a mutated Fc region as described herein.
- Exemplary disorders or conditions that can be treated or prevented by the polypeptides described herein include, but are not limited to, a cancer (e.g., a solid tumor or a hematologic cancer), an infectious disease (e.g., a bacterial infection or a viral infection), an immune disorder (e.g., an autoimmune disorder), an inflammatory disorder, a metabolic disorder (e.g., diabetes), a cardiovascular disorder, an organ transplant rejection.
- the disorder is a chronic disorder.
- Exemplary cancers that can be treated or prevented by the polypeptides described herein include, but are not limited to, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), adrenocortical carcinoma, Kaposi sarcoma, an AIDS-related lymphoma, primary central nervous system (CNS) lymphoma, anal cancer, appendix cancer, astrocytoma, atypical teratoid/rhabdoid tumor, basal cell carcinoma, bile duct cancer, bladder cancer, bone cancer (e.g., Ewing sarcoma or osteosarcoma and malignant fibrous histiocytoma), brain tumor (e.g., astrocytomas, brain stem glioma, central nervous system atypical teratoid/rhabdoid tumor, central nervous system embryonal tumor, central nervous system germ cell tumor, craniopharyngioma, or ependymoma), breast cancer, bronchial
- infectious diseases that can be treated or prevented by the polypeptides described herein include, but are not limited to, Acinetobacter infections, actinomycosis, African sleeping sickness (African trypanosomiasis), AIDS (acquired immunodeficiency syndrome), amebiasis, anaplasmosis, angiostrongyliasis, anisakiasis, anthrax, arcanobacterium haemolyticum infection, argentine hemorrhagic fever, ascariasis, aspergillosis, astrovirus infection, babesiosis, Bacillus cereus infection, bacterial pneumonia, bacterial vaginosis, bacteroides infection, balantidiasis, bartonellosis, baylisascaris infection, bk virus infection, black piedra , blastocystosis, blastomycosis, bolivian hemorrhagic fever, botulism (and infant botulism), brazilian hemorr
- Exemplary immune disorders or conditions that can be treated or prevented by the polypeptides described herein include, but are not limited to, Addison's disease, agammaglobulinemia, alopecia areata, amyloidosis, ankylosing spondylitis, anti-GBM/anti-TBM nephritis, antiphospholipid syndrome (APS), autoimmune hepatitis, autoimmune inner ear disease (AIED), axonal & neuronal neuropathy (AMAN), Behcet's disease, Bullous pemphigoid, Castleman disease (CD), Celiac disease, Chagas disease, chronic inflammatory demyelinating polyneuropathy (CIDP), chronic recurrent multifocal osteomyelitis (CRMO), Churg-Strauss, Cicatricial pemphigoid/benign mucosal pemphigoid, Cogan's syndrome, Cold agglutinin disease, Congenital heart block, Coxsackie myocarditis
- polypeptides e.g., antibody molecules or fusion proteins
- the polypeptides are typically administered at a frequency that keeps a therapeutically effective level of polypeptides in the patient's system until the patient recovers.
- the polypeptides may be administered at a frequency that achieves a serum concentration sufficient for at least about 1, 2, 5, 10, 20, 30, or 40 polypeptides to bind each target molecule or cell.
- the polypeptides are administered every 1, 2, 3, 4, 5, 6, or 7 days, every 1, 2, 3, 4, 5, or 6 weeks, or every 1, 2, 3, 4, 5, or 6 months.
- polypeptides e.g., antibody molecules or fusion proteins
- Suitable dosages of the polypeptides used will depend on the age and weight of the subject and the particular drug used.
- the polypeptides can be used by themselves or conjugated to a second agent, e.g., an bacterial agent, toxin, or protein, e.g., a second polypeptide.
- This method includes: administering the polypeptide, alone or conjugated to a second agent, to a subject requiring such treatment.
- the polypeptides can be used to deliver a variety of therapeutic agents, e.g., a toxin, or mixtures thereof.
- the polypeptides can be used in combination with other therapies.
- the combination therapy can include a polypeptide co-formulated with, and/or co-administered with, one or more additional therapeutic agents, e.g., one or more additional therapeutic agents described herein.
- the polypeptides are administered in combination with other therapeutic treatment modalities, e.g., other therapeutic treatment modalities described herein.
- Such combination therapies may advantageously utilize lower dosages of the administered therapeutic agents, thus avoiding possible toxicities or complications associated with the various monotherapies.
- Administered “in combination”, as used herein, means that two (or more) different treatments are delivered to the subject before, or during the course of the subject's affliction with a disorder.
- two or more treatments are delivered prophylactically, e.g., before the subject has the disorder or is diagnosed with the disorder.
- the two or more treatments are delivered after the subject has developed or diagnosed with the disorder.
- the delivery of one treatment is still occurring when the delivery of the second begins, so that there is overlap. This is sometimes referred to herein as “simultaneous” or “concurrent delivery.”
- the delivery of one treatment ends before the delivery of the other treatment begins. In some embodiments of either case, the treatment is more effective because of combined administration.
- the second treatment is more effective, e.g., an equivalent effect is seen with less of the second treatment, or the second treatment reduces symptoms to a greater extent, than would be seen if the second treatment were administered in the absence of the first treatment, or the analogous situation is seen with the first treatment.
- delivery is such that the reduction in a symptom, or other parameter related to the disorder is greater than what would be observed with one treatment delivered in the absence of the other.
- the effect of the two treatments can be partially additive, wholly additive, or greater than additive.
- the delivery can be such that an effect of the first treatment delivered is still detectable when the second is delivered.
- the polypeptide is administered in combination with a second therapy (e.g., an additional agent) to treat or prevent a disorder described herein.
- the additional agent is a second polypeptide (e.g., antibody molecule), e.g., a polypeptide (e.g., an antibody molecule) different from a first polypeptide (e.g., antibody molecule).
- exemplary polypeptides e.g., antibody molecules
- the additional agent is other than a polypeptide (e.g., antibody molecule).
- the additional agent can be a small molecule or a nucleic acid molecule.
- the second therapy is chosen from a surgery, a radiation therapy, a cell therapy (e.g., a stem cell therapy), or an organ or tissue transplantation.
- the second therapy comprises a therapy chosen from one or more of: an androgen replacement therapy, an antihormone therapy, an antiserum therapy, an autologous immune enhancement therapy, a biotherapy, a blood irradiation therapy, a brachytherapy, a cardiac resynchronization therapy, a cell therapy, a cell transfer therapy, a chelation therapy, a chemotherapy, a chrysotherapy, a cobalt therapy, a cold compression therapy, a cryotherapy, an electroconvulsive therapy, an electromagnetic therapy, an electron therapy, an electrotherapy, an enzyme replacement therapy, an epigenetic therapy, an estrogen replacement therapy, an extracorporeal shockwave therapy, a fast neutron therapy, a fluoride therapy, a gene therapy, a heat therapy, a helminthic therapy, a hormone therapy, a hormone replacement therapy, a host modulatory therapy, a hyperbaric oxygen therapy, a hyperthermia therapy, an immunosuppressive therapy, an immunotherapy, an intraoperative electron radiation
- Exemplary therapies that can be used in combination with a polypeptide or composition described herein to treat or prevent other disorders are also described in the section of “Methods of Treating or Preventing Disorders” herein.
- the present disclosure provides a diagnostic method for detecting the presence of a target molecule (e.g., a protein) or cell in vitro (e.g., in a biological sample, such as a biopsy or body fluid (e.g., blood, urine, or cerebrospinal fluid) sample) or in vivo (e.g., in vivo imaging in a subject).
- a target molecule e.g., a protein
- cell in vitro e.g., in a biological sample, such as a biopsy or body fluid (e.g., blood, urine, or cerebrospinal fluid) sample
- in vivo e.g., in vivo imaging in a subject.
- the method includes: (i) contacting the sample with a polypeptide described herein (e.g., an antibody molecule described herein), or administering to the subject, the polypeptide (e.g., antibody molecule); (optionally) (ii) contacting a reference sample, e.g., a control sample (e.g., a control biological sample, such as a biopsy or body fluid (e.g., blood, urine, or cerebrospinal fluid) sample) or a control subject with a polypeptide described herein (e.g., an antibody molecule described herein); and (iii) detecting formation of a complex between the polypeptide (e.g., antibody molecule) and the target molecule or cell in the sample or subject, or the control sample or subject, wherein a change, e.g., a statistically significant change, in the formation of the complex in the sample or subject relative to the control sample or subject is indicative of the presence of the target molecule or cell in the sample.
- the polypeptide (e.g., antibody molecule) can be directly or indirectly labeled with a detectable substance to facilitate detection of the bound or unbound polypeptide (e.g., antibody molecule).
- detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials and radioactive materials, as described herein.
- sample as it refers to samples used for detecting bacteria includes, but is not limited to, cells, cell lysates, proteins or membrane extracts of cells, body fluids such as blood, urine, or CSF, or tissue samples such as biopsies.
- Complex formation between the polypeptide (e.g., antibody molecule), and the target molecule or cell can be detected by measuring or visualizing either the polypeptide (e.g., antibody molecule) bound to the target molecule or cell, or unbound polypeptide (e.g., antibody molecule).
- Any suitable detection assays can be used, and conventional detection assays include an enzyme-linked immunosorbent assays (ELISA), a radioimmunoassay (RIA) or tissue immunohistochemistry.
- ELISA enzyme-linked immunosorbent assays
- RIA radioimmunoassay
- tissue immunohistochemistry Alternative to labeling the polypeptide, the presence of the target molecule or cell can be assayed in a sample by a competition immunoassay utilizing standards labeled with a detectable substance and an unlabeled polypeptide.
- the biological sample, the labeled standards and the polypeptide are combined and the amount of labeled standard bound to the unlabeled binding molecule is determined.
- the amount of the target molecule or cell in the sample is inversely proportional to the amount of labeled standard bound to the polypeptide (e.g., antibody molecule).
- polypeptides e.g., antibody molecules
- the polypeptides described herein can be used to diagnose disorders that can be treated or prevented by the polypeptides described herein.
- the detection or diagnostic methods described herein can be used in combination with other methods described herein to treat or prevent disorders described herein.
- a polypeptide comprising an Fc region, wherein the Fc region comprises a mutation, wherein the polypeptide has 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or all of the following properties:
- a) has an increased binding affinity for a neonatal Fc receptor (FcRn) at a pH between 6.0 and 6.5, compared to a reference polypeptide;
- e has the same, substantially the same, or increased binding affinity for an Fc ⁇ receptor, compared to a reference polypeptide
- f has the same, or substantially the same, thermal stability, compared to a reference polypeptide
- g has the same, substantially the same, or increased binding affinity for C1q, compared to a reference polypeptide
- h has the same, substantially the same, or increased binding affinity for TRIM21, compared to a reference polypeptide.
- i) has an effector function that is the same, substantially the same, or increased, compared to a reference polypeptide
- k has a biological function, in vitro, ex vivo, or in vivo, that is the same, substantially the same, or increased, compared to a reference polypeptide
- m has the same, substantially the same, or increased binding affinity, specificity, or both, for an epitope, compared to a reference polypeptide;
- n increases mucosal uptake, compared to a reference polypeptide
- polypeptide has at least properties a), b), and one, two, three, four, or all of properties e), f), g), h), or i).
- polypeptide of paragraph 1 which has at least properties a), b), c), d), and one, two, three, four, or all of properties e), f), g), h), or i).
- polypeptide of any of paragraphs 1-3 which has at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, or 50-fold increase in the binding affinity for the FcRn at pH 6.0, compared to a reference polypeptide, as determined by an octet-based assay or a cell-based assay.
- polypeptide of any of paragraphs 1-4 which has at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold higher in the binding affinity for the FcRn at pH 6.0 than that at pH 7.4, as determined by an octet-based assay or a cell-based assay.
- polypeptide of any of paragraphs 1-5 which binds to the FcRn at pH 6.0 with a dissociation constant (K d ) of 250 nM or less, 200 nM or less, 150 nM or less, 100 nM or less, 50 nM or less, 25 nM or less, 10 nM or less, 5 nM or less, 2 nM or less, 1 nM or less, 0.5 nM or less, 0.2 nM or less, 0.1 nM or less, 0.05 nM or less, 0.02 nM or less, 0.01 nM or less, between 25 nM and 0.1 nM, between 20 nM and 0.5 nM, between 15 nM and 1 nM, between 10 nM and 5 nM, or between 20 nM and 10 nM, as determined by an octet-based assay or a cell-based assay.
- K d dissociation constant
- polypeptide of any of paragraphs 1-6 which binds to the FcRn at pH 7.4 with a K d of 60 nM or more, 80 nM or more, 100 nM or more, 150 nM or more, 200 nM or more, 500 nM or more, between 50 nM and 500 nM, or between 100 nM and 250 nM, as determined by an octet-based assay or a cell-based assay.
- polypeptide of any of paragraphs 1-12 which has at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, or 10-fold increase in the half-life in vivo, compared to a reference polypeptide, as determined in an animal model.
- polypeptide of any of paragraphs 1-13 which decreases the biological function, in vitro, ex vivo, or in vivo by no more than 10%, 20%, 30%, 40%, or 50%, or increases the biological function, in vitro, ex vivo, or in vivo by at least 1.5, 2, 3, 4, or 5-fold, compared to a reference polypeptide.
- polypeptide of any of paragraphs 1-14 which alters one, two, three, or all of stability, solubility, aggregation, or expression level by no more than 10%, 20%, 30%, 40%, or 50%, compared to a reference polypeptide.
- polypeptide of any of paragraphs 1-4 or 8-17 wherein the reference polypeptide comprises a wild-type Fc region, an Fc region comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues.
- polypeptide of any of paragraphs 1-28 which comprises a tetramer of two heavy chain immunoglobulin variable regions and two light chain immunoglobulin variable regions.
- a mutation is in a residue that is non-contact residue in Fc-FcRn binding
- a mutation in a residue which is a helix contact reside that enhances the conformational dynamics of a helix comprising 1, 2, 3, 4, 5, or all of P247, K248, D249, T250, L251, or M252; or
- polypeptide of any of paragraphs 1-37 comprising a plurality of mutations in 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, or all of the residues chosen from L251, I253, R255, P257, H285, N286, K288, T307, V308, L309, Q311, L314, H310, H433, N434, H435, or Y436.
- polypeptide of any of paragraphs 1-40 comprising a plurality of mutations in 2, 3, 4, 5, 6, 7, 8, 9, or all of the residues chosen from M252, T256, T307, L309, Q311, H433, N434, Y436, N286, or K288.
- polypeptide of any of paragraphs 1-41, comprising a mutation is in a residue that is non-contact residue in Fc-FcRn binding.
- polypeptide of any of paragraphs 1-43, comprising a plurality of mutations in 2, 3, 4, 5, 6, 7, or all of the residues chosen from A287, V308, N315, L314, L432, H429, E430, or A431.
- polypeptide of any of paragraphs 1-44, comprising a mutation in a residue which is a helix contact reside that enhances the conformational dynamics of a helix comprising 1, 2, 3, 4, 5, or all of P247, K248, D249, T250, L251, or M252.
- polypeptide of any of paragraphs 1-46 comprising a plurality of mutations in 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or all of the residues chosen from P244, P245, T250, L251, P247, E380, M428, A378, D376, P257, V308, A287, L306, or H427.
- polypeptide of any of paragraphs 1-48 comprising 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more mutations, or one or more combination of mutations, as described in Table 1.
- polypeptide of any of paragraphs 1-51 which does not have 1, 2, 3, 4, 5, 6, 7, 8, 9, or all of the following mutation or mutations: (i) M252Y, S254T, and T256E; (ii) L309N; (iii) T250Q and M428L; (iv) M428L and N434A; (v) N434A; (vi) T307A, E380A, and N434A; (vii) M252W; (viii) V308F; (ix) V308F and N434Y; or (x) H435A.
- polypeptide of any of paragraphs 1-52 comprising a first mutation chosen from M252Y, S254T, T256E, L309N, T250Q, M428L, N434S, N434A, T307A, E380A, N434A, M252Y, S254T, or T256E, and a second mutation chosen from a mutation in Table 1 other than M252Y, S254T, T256E, L309N, T250Q, M428L, N434S, N434A, T307A, E380A, N434A, M252Y, S254T, and T256E.
- polypeptide of any of paragraphs 1-53 further comprising a mutation in the Fc region that increases an effector function.
- polypeptide of any of paragraphs 1-55 further comprising a mutation in the Fc region that decreases an effector function.
- polypeptide of any of paragraphs 1-58 which comprises mutations in residues chosen from: (i) T256, Q311, and A378; (ii) H285, T307, and N315; (iii) H285, T307, and A378; (iv) T307, Q311, and A378; (v) T256, N286, T307, Q311, and A378; or (vi) T256, H285, T307, Q311, and A378.
- polypeptide of any of paragraphs 1-59 which comprises mutations chosen from: (i) T256D, Q311V, and A378V; (ii) H285N, T307Q, and N315D; (iii) H285D, T307Q, and A378V; (iv) T307Q, Q311V, and A378V; (v) T256D, N286D, T307R, Q311V, and A378V; or (vi) T256D, H285D, T307R, Q311V, and A378V.
- polypeptide of any of paragraphs 1-62 which is a synthetic polypeptide.
- composition comprising a polypeptide of any of paragraphs 1-64.
- composition of paragraph 65 further comprising a pharmaceutical acceptable carrier.
- a vector comprising a nucleic acid molecule of paragraph 67.
- a cell comprising a nucleic acid molecule of paragraph 67 or a vector of paragraph 68.
- kits comprising a polypeptide of any of paragraphs 1-64 and instructions to use of the polypeptide.
- a container comprising a polypeptide of any of paragraphs 1-64.
- a method of producing a polypeptide comprising culturing a cell of paragraph 69 under conditions that allow production of an antibody molecule, thereby producing the polypeptide.
- a method of treating a disorder comprising administering to a subject in need thereof an effective amount of a polypeptide of any of paragraphs 1-64 or a composition of paragraph 65 or 66, thereby treating the disorder.
- a method of detecting a molecule comprising contacting a cell or a sample from a subject with a polypeptide of any of paragraphs 1-64, thereby detecting the molecule.
- a structure and network based framework was developed to interrogate the engagement of IgG with multiple Fc receptors (e.g., FcRn, C1q, TRIM21, Fc ⁇ RI, Fc ⁇ RIIa/b, and Fc ⁇ RIIIa).
- FcRn multiple Fc receptors
- C1q multiple Fc receptors
- TRIM21 Fc ⁇ RI
- Fc ⁇ RIIa/b Fc ⁇ RIIa/b
- Fc ⁇ RIIIa Fc ⁇ RIIIa
- Network analysis provided a lens to study the allosteric impact of FcRn optimization mutations on the distal Fc ⁇ R engagement. Applying these principles, a panel of distinct Fc variants that enhance FcRn binding with robust biophysical properties and wild-type like binding to activating receptors were engineered. Control polypeptides with these Fc variants have shown a half-life improvement of >9 fold and robust effector functions such as ADCC, ADCP, CDC and ADIN mediated by TRIM21.
- FIG. 20A A co-crystal structure of the human FcRn protein in complex with the Fc domain of a human IgG1 and human serum albumin was recently reported (Oganesyan et al., J Biol Chem, 2014. 289 (11): 7812-2). Inspection of the structure ( FIG. 20A ) shows that both the alpha and beta subunits of the FcRn molecule participate in binding to the Fc-domain, making contact with both CH2 and CH3 domains of the Fc. The primary interaction is mediated by the alpha-subunit on the FcRn side and CH2 domain on the Fc side.
- FIG. 21A Towards that, four sets of Fc residues, mutations to which could impinge on FcRn interaction and dissociation rate (k off ), were identified ( FIG. 21A ). This includes residues that make direct contact with FcRn as well as peripheral and non-surface exposed residues that have the potential to modify the interaction surface and residues that have the potential to influence 250-helix dynamics. Indeed, some of these positions have been previously interrogated and half-life enhancing mutants such as M252Y/S254T/T256E (YTE), M428L/N434S (LS), T307A/E380A/N434A (AAA), T250Q/M428L (QL), V308P, include combinations of mutations at the listed sites.
- YTE M252Y/S254T/T256E
- M428L/N434S LS
- T307A/E380A/N434A AAAA
- the FcRn binding site on Fc has overlaps with the binding site of intracellular receptor TRIM21, protein A used for antibody purification and the Fc-Fc interaction interface formed during hexamerization of IgG for CDC activity. Substitution of at each position was assessed for impact on these binding to TRIM21, protein A and Fc. More than 30 distinct positions were chosen for substitutions. Combination of the individual mutations were designed based on the following guiding principles (a) avoiding introduction of large clusters of charge or hydrophobicity to minimize binding to solvent ions and impact on thermal stability of the IgG and (b) incorporate diversity in the types of interaction, not just electrostatic or hydrophobic (c) include mutations across CH2 and CH3 domains. Based on these considerations, more than 150 unique mutant combinations were designed and experimentally evaluated.
- IgG1 s incorporating the designed Fc variants on either actoxumab or motavizumab Fab were recombinantly expressed and evaluated for binding to human FcRn by biolayer interferometry using two different protocols: FcRn on NiNTA biosensor with IgG as the analyte, and IgG on an anti-CH1 biosensor with FcRn as the analyte.
- the assays were used to quantify binding at pH 6.0 followed by dissociation at pH 6.0 and pH 7.4, as well as binding and dissociation at pH 7.4 ( FIG. 11A ).
- Fc variants incorporating mutations at P257 and V308 had high affinity at pH 6.0 but displayed markedly slower off-rates at pH 7.4 and were not considered for further analyses. More than 10 distinct variants had greater than 5-fold decrease in K d as compared to IgG with WT Fc. Further, these variants decreased the k off by more than 2.5-fold ( FIG. 22 ).
- the FcRn binding site on the Fc domain considerably overlaps with the protein A and Trim21 binding sites as determined from their complex crystal structures ( FIG. 27A ).
- the Fc domain also binds to C1q to mediate CDC, however the C1q binding site does note overlap with FcRn binding site on Fc.
- C1q is naturally found as hexamer and a homo-hexamer assembly of Fc domains is expected to not only have a better C1q binding and also CDC.
- the Fc-Fc interface for formation of homo-hexamer overlaps with the FcRn binding site ( FIG. 27A ).
- FcRn binding affinity of Fc variants FcMut008 and FcMut015 was assessed by Octet. Antibody was immobilized on the Octet tip by anti-CH1 antibody and FcRn was in solution. As shown in FIG. 6 , FcMut008 and FcMut015 had increased affinity to FcRn. The binding is pH specific and increased binding at pH 6.0 was observed.
- FcRn-expressing cells were obtained by transient transfection of FcRn alpha and ⁇ 2m. Cells were incubated at pH6.0 with dilutions of IgG and fixed concentration of fluorescently-labeled Fc (Fc-A488). Cell-bound fluorescence was read by FACS. The results are shown in FIG. 7 . FcMut008 and FcMut015 showed improved FcRn binding at pH6.0.
- FcMut008 and FcMut015 retained and in some instance enhanced Fc ⁇ R engagement.
- the thermal stability of exemplary mutant antibody molecules was determined. The thermal stability was measured by SYPRO orange. As shown in FIG. 9 , FcMut008 and FcMut015 retained high melting temperature.
- the DSF experimental results in this Example yielded similar results with a CH2 and CH3 T M of 68.8° C. and 80.8° C., respectively.
- the half-life extending Fc variant YTE has been reported to decrease the T M of the CH2 domain by 6.7° C. (Majumdar et al., MAbs, 2015. 7(1): p. 84-95.).
- the T M of the CH2 domain of YTE was 7.2° C. lower than WT. Additionally, mutations at 247, 257, and 308 significantly impacted the T M of CH2.
- the exemplary Fc variants (FcMut183, FcMut197, FcMut213, FcMut215, FcMut228, FcMut229) were thermally stable with the T M of the CH2 domain>64° C. ( FIG. 23 ).
- mice were homozygous, 8 week old, males. There were 4 mice per test article group.
- the test articles included CDA1-WT, CDA1-FcMut008, and CDA1-FcMut015.
- the mice were dosed at 10 mg/Kg by IV administration. Data were collected at thirteen time points (1 h, 8 h, 1 d, 2 d, 3 d, 4 d, 6 d, 8 d, 10 d, 13 d, 16 d, 19 d, and 22 d).
- Human IgG was quantified by ELISA using an anti-hIgG polyclonal antibody.
- Tg32 is a human FcRn transgenic mouse model that can be used in drug discovery for early assessment and prediction of human pharmacokinetics of monoclonal antibodies.
- Monoclonal antibody clearance in Tg32 homozygous mice has the strongest correlation to monoclonal antibody clearance in humans (Avery et al. MAbs. 2016; 8(6):1064-78).
- CDA1 (actoxumab) is known to have a half-life of >25 days in human In vivo evaluation with additional mAbs in Tg32 model was performed. The different constructs can also be evaluated on Tg276 mice which are reported to have increased half-life differences between IgG variants. The results are shown in Table 2 and FIG. 10 . FcMut015 increased the half-life of CDA1 in Tg32 mice.
- FcRn interaction with IgG is believed to be mediated through Fc.
- the binding of Fc to FcRn is generally pH specific (typically little or no binding at pH7.4 and strong binding in acidic environment).
- Structure of FcRn in complex with Fc domain of IgG1 is known and each FcRn molecule binds to an Fc-monomer.
- Fab domains can also influence binding of IgG to FcRn.
- FIG. 11A The fold increase in on-rate and the fold decrease in off-rate as compared to wild type are listed in the table. Numerous antibody mutations significantly increased and decreased on and off rate, respectively ( FIG. 11A ). Also shown is the binding of a representative Fc variant to FcRn at a pH range of 6.0 to 7.4. It is important that the affinity of the Fc mutant antibodies for FcRn is improved at pH 6.0 but not significantly enhanced at a higher pH such as pH 7.4. FIG. 11B demonstrates that this representative antibody still shows poor binding to FcRn at pH 7.4, a desirable feature.
- FIG. 11C shows the interaction of the CH2 domain of the antibody Fc with the FcRn molecule.
- the engineering efforts described herein attempted to improve shape complementarity (SC), electrostatic charge complementarity (CC), and hydrophobic complementarity (HC).
- SC shape complementarity
- CC electrostatic charge complementarity
- HC hydrophobic complementarity
- a few positions on the Fc are noted as important for the interaction.
- 250 helix This helix is dynamic and moves depending on the pH of the environment. This is important in the binding of the Fc domain to FcRn at pH 6.0 but not pH 7.4.
- Exemplary Fc variants were tested in developability assays, the results of which are summarized in FIG. 12 .
- Assays including Sypro orange, SDS PAGE and SEC-HPLC, were performed.
- constructs were transfected into Expi293 cells in 96 well culture dishes using ExpiFectamine as described by the manufacturer. After 5-7 days, supernatants were quantified using biolayer interferometry (Octet) equipped with anti-human CH1 biosensors using a motavizumab standard curve.
- Octet biolayer interferometry
- protein A binding assessment the following was performed. Constructs were transfected into Expi293 cells in 30 mL cultures using ExpiFectamine as described by the manufacturer. After 5-7 days, supernatants were harvested and antibodies purified. Using biolayer interferometry with protein A biosensors, Fc-modified antibody affinity to protein A was measured and compared to antibody containing a wild type Fc domain.
- HPLC based size exclusion chromatography is an analytical tool used to determine the apparent size of a protein, monomeric purity, and the apparent level non-specific column adsorption between the protein and the silica based sizing resin.
- the impact of Fc mutations on the IgG elution profile was assessed on a Phenomenex Biosep 3000s column. Briefly the IgGs with various Fc variants were diluted to 1 mg/ml in PBS pH 7.4 and 20 tit was injected into the column. The elution time and percentage purity was recorded.
- the thermal stability of the mAbs was determined by differential scanning fluorescence (DSF).
- DSF differential scanning fluorescence
- the dye, SYPRO ORANGE® fluoresces in a hydrophobic environment, such as hydrophobic core residues that are exposed during thermally triggered protein unfolding, or denaturation. By monitoring the fluorescent signal, the unfolding of CH2, CH3 and Fab can be monitored.
- Various Fc variants with Motavizumab Fab were evaluated in a SYPRO orange assay. Briefly 15 ⁇ L of IgG at 0.5 mg/mL was mixed with 15 ⁇ L of 1:500 diluted SYPRO Orange dye and assessed by a thermocycler with fluorescent read capabilities using a 1° C. ramp from 40° C. to 99° C. The midpoint between native state and first unfolding event was reported as the transition temperature or melt temperature (Tm).
- the chromatogram for absorbance at 280 nm was used to identify elution fractions containing the antibody. All antibodies were then dialyzed into 1 ⁇ PBS using 10,000 dalton molecular weight cut-off cassette (Thermo Fisher catalogue #66380).
- Protein A binding was functionally determined by the ability of all antibodies to be purified by FPLC using protein A columns. After purification, protein A binding was further assessed by quantifying a known amount of antibody using the Octet QKe system and protein A biosensors (Pall catalogue #18-5012) following the standard quantitation protocol provided with the Octet data acquisition software.
- Expi293 cells were co-transfected with a plasmid encoding the human ⁇ -FcRn with a 6 ⁇ histidine tag on the C-terminus and a plasmid encoding human 132M.
- Cell culture supernatant was harvested 4 days post transfection.
- FcRn was purified from cell culture supernatant using the AKTA pure FPLC system with a HisTrap HP column (GE catalogue #17-5247-01). Post purification the protein was dialyzed into 1 ⁇ PBS pH 6.0.
- Screening assays were performed using anti-CH1 Fab biosensors on the Octet QKe system. Briefly, purified IgG at 10 ⁇ g/mL is loaded onto an anti-CH1 biosensor for 180 seconds. After a 60 second baseline step in 1 ⁇ PBS pH 6.0, the IgG loaded tip is exposed to FcRn at a concentration of 50 ⁇ g/mL for 60 seconds, followed by dissociation for 60 seconds in PBS pH 6.0, and an additional 30 seconds in PBS pH 7.4. In addition, FcRn binding was performed using NiNTA biosensors. Briefly, recombinant human FcRn at 5 ⁇ g/mL is loaded onto a NiNTA biosensor for 180 seconds.
- the FcRn loaded tip is exposed to IgG at a concentration of 250 nM (37.5 ⁇ g/mL) for 60 seconds, followed by dissociation for 60 seconds in PBS pH 6.0, and an additional 30 seconds in PBS pH 7.4.
- a quantitative assessment of the affinity constant (K D ) at pH 6.0 is performed using the ForteBio octet software and a qualitative assessment is performed by plotting the response rate over time, allowing for visualization of the association of IgG to FcRn at pH 6.0 and the subsequent dissociation at pH 6.0 and pH 7.4.
- Motavizumab wildtype was compared to Motavizumab containing three of Fc engineering mutations in the in vivo assessment of engineered antibody half-life.
- Antibodies (2-5 mg/kg) were administered to mice transgenic for human FcRn and daily samples of mouse serum were obtained (day 0-day 4).
- ELISA was performed on serum to quantify the amount of Motazivumab in the serum.
- the amount of human IgG present in mouse serum was determined using a human IgG quantitation ELISA kit (Bethyl Labs catalogue # E80-104) following the manufacturer's protocol. All serum samples were titrated in a twofold serial dilution starting at 1:50 dilution and ending at a 1:6400 dilution. Each ELISA plate included a human reference standard curve provided with the kit in duplicate or triplicate. The standard curve contains the following concentrations: 500.0, 250.0, 125.0, 62.5, 31.3, 15.6, 7.8, and 3.9 ng/mL. The lower limit of detection was considered to be the A450 nm value obtained for the second to last point on the reference standard, which was 7.8 ng/mL.
- ELISA results were converted to percent of antibody remaining based on the day 0 timepoint representing 100%.
- FIGS. 13A-13B all three antibody variants demonstrated extended half-life in this well-established mouse model of antibody half-life.
- Motavizumab wild-type has a half-life of 32 hours.
- FcMut043 and FcMut045 mutants built on FcMut008 show significant half-life improvement.
- FcMut045 mutant enhanced half-life 5.2 fold (about 166 hours half-life).
- the half-life as well as the other parameters in FIG. 13B were calculated using the Winonlin software.
- Tg276 transgenic mice Transgenic mouse models expressing human FcRn have been developed by the Jackson laboratory (JAX) to study PK of human Fc-containing biotherapeutics.
- the Tg276 mice are null for mouse FcRn alpha chain and express the human FcRn alpha transgene under the control of a constitutive promoter (actin) and use the mouse ⁇ 2microglobulin.
- the Tg276 homozygous or hemizygous mice have been widely used to differentiate half-lives of antibody variants.
- Tg276hemi FcRn transgenic mice were dosed with 2 or 5 mg/kg of mAb intravenously. Each mAb group had 4 mice/group. Blood was collected at several time points between 1 hour and 21 days, and IgG titers were determined by quantitative ELISA as described herein. PK parameters were determined for each group of mice with a non-compartmental model using Phoenix WinNonlin version 7.0 (Certera).
- FIGS. 14A-14D The results are shown in FIGS. 14A-14D .
- ZVA and ZVB Zika antibodies
- MVZ wild type Motavizumab
- ELISA was performed on serum to quantify the amount of Motavizumab. ELISA results were converted to percent of antibody remaining based on the day 0 timepoint representing 100%.
- ZVA antibody represents the A series antibody A-3/2.
- the ZVB antibody represents the A series antibody A-5/1 containing the affinity enhancing light chain modification S92Y. As shown in FIG. 15 , ZVB had a much longer half-life than either Motavizumab or ZVA (both ZVA and ZVB had longer half-life than Motavizumab).
- These antibodies contained wild-type Fc regions so the extended half-life of the ZVB antibody is a property of the antibody itself, and not any Fc engineering.
- Motavizumab wild type (MVZ WT) was tested against the ZVB antibody (ZB-1/4, ZKB in the graph) and the ZVB antibody containing Fc modification 156 (L234A/L235A (“LALA”) and T256D/T307R/Q311V (half-life extension), ZKB-156 in the graph) as well as the “LS” half-life extension Fc mutation (ZKB-LS). Both LS and Fc modification 156 extended half-life significantly compared to the wild-type ZVB ( FIG. 16 ).
- Fc variants were assessed on multiple assays for Fc ⁇ RI, Fc ⁇ RIIA (mediator of opsonophagocytosis), Fc ⁇ RIIB, Fc ⁇ RIIIA (mediator of ADCC), and C1q (mediator of CDC).
- Fc ⁇ receptors I, IIa, IIb, IIIa, and IIIa V176F Binding to Fc ⁇ receptors I, IIa, IIb, IIIa, and IIIa V176F (R&D Systems catalogue #1257-FC-050, 1330-CD-050, 1875-CD-050, 4325-FC-050, and 8894-FC-050) was measured by ELISA. All Fc variants were tested in the context of the Motavizumab, Rituximab, or Actoxumab antibody. Briefly, Fc receptors were coated on an ELISA plate (VWR catalogue #62409-002) at 1 ⁇ g/mL (0.1 ⁇ g/well) in PBS and stored at 4° C. overnight.
- VWR catalogue #62409-002 VWR catalogue #62409-002
- Fc ⁇ IIa and Fc ⁇ IIb were diluted to 5 ⁇ g/mL in PBS.
- the receptors were immobilized via a C-terminal 6 ⁇ histidine tag (SEQ ID NO: 2) to Ni-NTA biosensors (Pall catalogue #18-5101) for 180 seconds followed by a 60 second baseline step in PBS.
- the biosensors were then exposed to the various Fc variants at a concentration of 50 ⁇ g/mL in PBS for 120 seconds followed by a dissociation step in PBS for an additional 120 seconds.
- the max binding response during the association step for each variant was reported and compared to the wild type Fc response.
- Binding to C1q was measured by ELISA. All Fc variants were tested in the context of the Motavizumab antibody. Briefly, antibodies were coated on an ELISA plate (VWR catalogue #62409-002) at 25 ⁇ g/mL (2.5 ⁇ g/well) in PBS and stored at 4° C. overnight. Plates were washed three times with PBST (1 ⁇ PBS 0.05% Tween 20). Purified C1q (Quidel Corporation catalogue # A400) was titrated threefold in PBST-BSA (1 ⁇ PBS 0.05% Tween20 1% BSA) from 12.5 ⁇ g/mL to 0.02 ⁇ g/mL and incubated for 90 minutes at room temperature.
- PBST-BSA 1 ⁇ PBS 0.05% Tween20 1% BSA
- Liquid was aspirated from wells and polyclonal rabbit anti-human C1q (Agilent catalogue # A013602-1) was diluted in PBST-BSA to a final concentration of 1 ⁇ g/mL and 100 ⁇ L was added to each well and incubated for 1 hour at room temperature. Plates were washed three times with PBST. Polyclonal swine anti-rabbit-HRP (Agilent catalogue # P021702-2) was diluted to 0.5 ⁇ g/mL in PBST-BSA and 100 ⁇ L was added to each well and incubated for 1 hour at room temperature. Plates were washed six times with PBST.
- FIGS. 17A-17D The results are shown in FIGS. 17A-17D .
- CDC Complement dependent cytotoxicity
- CDC assays were performed using CD20+ Raji cells and low toxicity guinea pig complement (Cedarlane Laboratories Product # CL4051). Complement induced cell lysis was measured using the CYTOTOX 96® Non-Radioactive Cytotoxicity Assay from Promega (catalogue # G1780) following the manufacturer's protocol. All Fc variants were tested in the context of the anti-CD20 antibody, Rituximab. Briefly, antibody concentrations were titrated fourfold ranging from 20 ⁇ g/mL to 0.005 ⁇ g/mL and incubated with 20,000 target cells per well at 37° C. for 30 minutes. Complement was then added to the cells and incubated an additional 2 hours at 37° C.
- cell lysis buffer provided with the CYTOTOX kit was added to control wells to measure the maximum cell lysis.
- a negative control antibody, Motavizumab was used to measure the background signal of an irrelevant antibody.
- the background signal and maximum lysis signal were used to calculate the percent of cell lysis for each Fc variant.
- the values of antibody concentration (x-axis) and percent lysis (y-axis) were fit to a four parameter logistic regression curve. The curve fit was then used to determine the EC50 (concentration needed to obtain 50% lysis) and the maximum lysis for each Fc variant.
- ADCC Antibody dependent cellular cytotoxicity
- ADCC assays were performed using the ADCC Reporter Bioassay with CD20 + WIL2-S target cells from Promega (catalogue # G7014) following the manufacturer's protocol. All Fc variants were tested in the context of the anti-CD20 antibody, Rituximab. Antibody concentrations were titrated fivefold ranging from 5 ⁇ g/mL to 0.0016 ⁇ g/mL. The values of antibody concentration (x-axis) and fold induction of the luminescent reporter gene (y-axis) were fit to a four parameter logistic regression (4PL) curve. The curve fit was then used to determine the EC50 (the midpoint of the 4PL) and the maximum induction for each Fc variant.
- 4PL four parameter logistic regression
- FIGS. 19A-19B The results are shown in FIGS. 19A-19B .
- Exemplary Fc variants retain and in some cases enhance ADCC activity.
- TRIM21 is a cytosolic receptor that binds with Fc of IgG. TRIM21 plays a role in mediating intracellular recognition and neutralization of Fc bound viruses. TRIM21-mediated neutralization is known as antibody dependent intracellular neutralization (ADIN).
- ADIN antibody dependent intracellular neutralization
- Binding to TRIM21 was measured by ELISA. All Fc variants were tested in the context of the Motavizumab or Actoxumab antibody. Briefly, antibodies were coated on an ELISA plate (VWR catalogue #62409-002) at 25 ⁇ g/mL (2.5 ⁇ g/well) in PBS and stored at 4° C. overnight. Plates were washed three times with PBST (1 ⁇ PBS 0.05% Tween20).
- TRIM21-GST Antibodies Online catalogue # ABIN1323621
- PBST-BSA 1 ⁇ PBS 0.05% Tween20 1% BSA
- Liquid was aspirated from wells and two rabbit anti-TRIM21 antibodies (AbCam catalogue # ab91423 and ab96800) were mix together in PBST-BSA at a final concentration of 1 ⁇ g/mL each and 100 ⁇ L was added to each well and incubated for 1 hour at room temperature. Plates were washed three times with PBST.
- Polyclonal swine anti-rabbit-HRP (Agilent catalogue # P021702-2) was diluted to 0.5 ⁇ g/mL in PBST-BSA and 100 ⁇ L was added to each well and incubated for 1 hour at room temperature. Plates were washed six times with PBST. Plates were developed using the TMB Microwell Peroxidase Substrate Kit (VWR catalogue #95059-156). The reaction was stopped after 10 minutes by the addition of 1N sulfuric acid and absorbance at 450 nm was measured. The values of antibody concentration (x-axis) and absorbance at 450 nm (y-axis) were fit to a four parameter logistic regression (4PL) curve. The curve fit was then used to determine the EC50 (the midpoint of the 4PL) for each Fc variant.
- 4PL four parameter logistic regression
- a TRIM21 binding ELISA was performed to evaluate if the Fc variants impacted binding to TRIM21. The results are shown in FIG. 26 .
- Fc variants FcMut045, FcMut183, FcMut197, FcMut213, FcMut215, FcMut228 had TRIM21 binding EC50s that were within 1.5 fold of WT EC50.
- FcRn transports IgG across different cellular barriers such as the mucosal epithelium lining the intestine and the alveolar surfaces. Modification of FcRn binding provides a mechanism to enhance mucosal localization that confers immune protection. Exemplary Fc mutants are expected to enhance mucosal uptake in a similar fashion
- FcRn affinity enhancing mutations on binding of Fc to other receptors was experimentally evaluated.
- the Fc region of IgG is capable of binding to many different Fc receptors and the mechanism of action for many therapeutic antibodies relies on engagement with Fc receptors. Mutations, even at positions distant from the Fc receptor binding site, can impact engagement of Fc with receptors such as Fc ⁇ RI, Fc ⁇ RIIa/b, Fc ⁇ RIIIa, C1q, TRIM21. While Fc receptor TRIM21 binds to a site that overlaps with FcRn binding site on CH2-CH3, other receptors such Fc ⁇ receptors and C1q engage at the interface formed by dimeric CH2.
- any mutations introduced for enhancing half-life should be assessed for its impact on binding to other receptors. Mutations introduced to enhance half-life can The Fc variants (FcMut183, FcMut197, FcMut213, FcMut215, FcMut228, FcMut229, YTE, LS) were incorporated into rituximab Fab and together with WT rituximab, were evaluated for binding to Fc ⁇ RI, Fc ⁇ RIIa, Fc ⁇ RIIb, Fc ⁇ RIIIa, C1q and TRIM21. As shown in FIG.
- FcMut183, FcMut197, FcMut213, FcMut215, FcMut228 and FcMut229 did not significantly impact engagement with the tested Fc receptors.
- Fc ⁇ RIIIa While binding to Fc receptors is necessary for activities such as ADCC (Fc ⁇ RIIIa), CDC (C1q) and ADIN (TRIM21), it may not be sufficient in mediating these activities.
- a hexameric assembly of Fc is required to elicit CDC activity.
- the Fc hexamer assembly involves formation of an Fc-Fc interface, and residues involved in formation of this interface partially overlaps with FcRn binding site. As such, it was important to evaluate the impact of the Fc mutations on not just binding to Fc receptors but also activities such as CDC and ADCC.
- Transgenic mouse models expressing human FcRn can be used to study PK of human Fc-containing biotherapeutics (Roopenian et al., Methods Mol Biol, 2010. 602: 93-104; Petkova et al., Int Immunol, 2006. 18(12): 1759-69).
- the Tg276 mice are null for mouse FcRn alpha chain and express the human FcRn alpha transgene under the control of a constitutive promoter (actin) and use the mouse ⁇ 2microglobuli.
- the Tg276 homozygous and hemizygous mice can be used to differentiate half-lives of antibody variants.
- Tg276hemi FcRn transgenic mice were intravenously administered with 5 mg/kg of IgG (motavizumab Fab on WT or modified Fc). Retro-orbital blood collection was performed at several time points, and IgG titers were determined by quantitative ELISA.
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Virology (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Pulmonology (AREA)
- Engineering & Computer Science (AREA)
- Public Health (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Veterinary Medicine (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Apparatus Associated With Microorganisms And Enzymes (AREA)
- Medicinal Preparation (AREA)
Abstract
Polypeptides, such as antibody molecules and fusion proteins, comprising an Fc region, are disclosed. The polypeptides can be used to treat, prevent, and/or diagnose disorders.
Description
- This application is a continuation of U.S. application Ser. No. 15/667,309, filed Aug. 2, 2017, which claims the benefit of U.S. Provisional Application No. 62/370,201, filed Aug. 2, 2016, and U.S. Provisional Application No. 62/485,671, filed Apr. 14, 2017. The contents of the aforesaid applications are hereby incorporated by reference in their entirety.
- The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Aug. 1, 2017, is named P2029-701410_SL.txt and is 3,446 bytes in size.
- Monoclonal antibody therapies are a class of immunotherapies that involve monoclonal antibodies (mAbs) that are capable of specifically interacting with disease-relevant biological molecules. In recent years, the disease areas that therapeutic antibodies can target have significantly expanded, and a number of monoclonal antibodies and antibody-derivative products have been approved for therapeutic use in the United States and many other countries. Monoclonal antibody therapies are currently used or investigated for treating various diseases or conditions, including, for example, infectious diseases, cancer, immune diseases, organ transplantation, cardiovascular diseases, and metabolic diseases.
- The efficacy of monoclonal antibodies can be achieved by different mechanisms of action (Suzuki et al. J Toxicol Pathol. 2015; 28(3): 133-139). Many therapeutic antibodies neutralize the pathophysiological function of their target molecules or cells. In recent years, monoclonal antibodies that block immune checkpoints have been used to enhance antitumor immunity in cancer patients with the potential to produce durable clinical responses. Certain monoclonal antibodies can trigger antibody-dependent cell-mediated cytotoxic (ADCC) activity or complement-dependent cytotoxic (CDC) activity. Monoclonal antibodies can also be used as drug delivery carriers, for example, when conjugated to radioisotopes, toxins, or other therapeutic or diagnostic agents.
- Given the ability of monoclonal antibodies and antibody-derivative products in modulating various biological functions, the need exists for developing new approaches for generation of polypeptides (e.g., antibody molecules or fusion proteins) suitable for treating, preventing, and diagnosing disorders.
- This disclosure provides, at least in part, polypeptides (e.g., antibody molecules or fusion proteins) that comprise an Fc region of an immunoglobulin, and that comprise one or more of the structural or functional properties disclosed herein. In an embodiment, nucleic acid molecules encoding the polypeptides, expression vectors, host cells, compositions (e.g., pharmaceutical compositions), kits, containers, and methods for making the polypeptides (e.g., antibody molecules or fusion proteins), are also provided. The polypeptides (e.g., antibody molecules or fusion proteins) disclosed herein can be used (alone or in combination with other agents or therapeutic modalities) to treat, prevent, and/or diagnose disorders, such as disorders and conditions disclosed herein.
- In an aspect, the disclosure features a polypeptide, e.g., an antibody molecule or fusion protein, comprising an Fc region, wherein the Fc region comprises a mutation, and wherein the polypeptide has one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or all) of the following properties:
- a) has an increased binding affinity (e.g., a decreased dissociation constant (Kd)) for a neonatal Fc receptor (FcRn), e.g., at a pH between 6.0 and 6.5 (e.g., at pH 6.0), e.g., at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, or 50-fold increase, compared to a reference polypeptide, e.g., as determined by an octet-based assay or a cell-based assay;
- b) has a higher binding affinity (e.g., a lower dissociation constant (Kd)) for an FcRn at a pH between 6.0 and 6.5 (e.g., at pH 6.0), e.g., at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold higher, than the binding affinity at a pH between 7.0 and 7.4 (e.g., at pH 7.4), e.g., as determined by an octet-based assay or a cell-based assay;
- c) binds to an FcRn with high affinity, e.g., at a pH between 6.0 and 6.5 (e.g., at pH 6.0), e.g., with a dissociation constant (Kd) of 300 nM or less, e.g., 250 nM or less, 200 nM or less, 150 nM or less, 100 nM or less, 50 nM or less, e.g., 25 nM or less, 10 nM or less, 5 nM or less, 2 nM or less, 1 nM or less, 0.5 nM or less, 0.2 nM or less, 0.1 nM or less, 0.05 nM or less, 0.02 nM or less, or 0.01 nM or less, e.g., between 25 nM and 0.1 nM, between 20 nM and 0.5 nM, between 15 nM and 1 nM, between 10 nM and 5 nM, or between 20 nM and 10 nM, e.g., as determined by an octet-based assay or a cell-based assay;
- d) binds to an FcRn with low affinity e.g., at a pH between 7.0 and 7.4 (e.g., at pH 7.4), e.g., with a Kd of 50 nM or more, e.g., 60 nM or more, 80 nM or more, 100 nM or more, 150 nM or more, 200 nM or more, 500 nM or more, e.g., between 50 nM and 500 nM or between 100 nM and 250 nM, e.g., as determined by an octet-based assay or a cell-based assay;
- e) has the same binding affinity, does not substantially alter (e.g., decreases or increases by no more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) the binding affinity, or increases the binding affinity (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), for an Fcγ receptor (e.g., one, two, or all of FcγRI, FcγRIIa/b, or FcγRIII), compared to a reference polypeptide, e.g., as determined by an octet-based assay or a cell-based assay;
- f) has the same thermal stability, or does not substantially alter (e.g., increases or decreases the melting temperature by no more than 1° C., 2° C., 3° C., 4° C., 5° C., 6° C., 7° C., 8° C., 9° C., or 10° C.), the thermal stability, compared to a reference polypeptide, e.g., as determined by a sypro orange assay;
- g) has the same binding affinity, does not substantially alter (e.g., decreases or increases by no more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) the binding affinity, or increases the binding affinity (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), for C1q, compared to a reference polypeptide, e.g., as determined by ELISA;
- h) has the same binding affinity, does not substantially alter (e.g., decreases or increases by no more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) the binding affinity, or increases the binding affinity (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), for TRIM21, compared to a reference polypeptide, e.g., as determined by ELISA;
- i) has the same effector function, or does not substantially alter (e.g., decreases or increases by more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) an effector function, or increases an effector function (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), e.g., one or more (e.g., two, three, or all) of a complement dependent cytotoxicity (CDC), an antibody dependent cell mediated cytotoxicity (ADCC), an antibody dependent cell mediated phagocytosis (ADCP), or an antibody dependent intracellular neutralization (ADIN), compared to a reference polypeptide;
- j) has an increased half-life in vivo, e.g., at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, or 10-fold increase, compared to a reference polypeptide, e.g., as determined in an animal model;
- k) has the same biological function, does not substantially alter (e.g., decreases or increases by no more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) a biological function, or increases a biological function (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), in vitro, ex vivo, or in vivo, compared to a reference polypeptide;
- l) has the same developability characteristic, does not substantially alter (e.g., decreases or increases by no more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) a developability characteristic, or increases a developability characteristic (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), e.g., one or more (e.g., two, three, or all) of stability, solubility, aggregation, or expression level, compared to a reference polypeptide;
- m) has the same binding affinity, specificity, or both, or does not substantially alter (e.g., decreases or increases by no more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) the binding affinity, specificity, or both, or increases the binding affinity, specificity, or both (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), for an epitope, compared to a reference polypeptide; or
- n) increases mucosal uptake, e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, or 50-fold, compared to a reference polypeptide, e.g., as determined by a transcytosis assay.
- In an embodiment, the polypeptide has an increased binding affinity (e.g., a decreased dissociation constant (Kd)) for a neonatal Fc receptor (FcRn), e.g., at a pH between 6.0 and 6.5 (e.g., at pH 6.0), e.g., at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, or 50-fold increase, compared to a reference polypeptide, e.g., as determined by an octet-based assay or a cell-based assay.
- In an embodiment, the polypeptide has a higher binding affinity (e.g., a lower dissociation constant (Kd)) for an FcRn at a pH between 6.0 and 6.5 (e.g., at pH 6.0), e.g., at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold higher, than the binding affinity at a pH between 7.0 and 7.4 (e.g., at pH 7.4), e.g., as determined by an octet-based assay or a cell-based assay.
- In an embodiment, the polypeptide binds to an FcRn with high affinity e.g., at a pH between 6.0 and 6.5 (e.g., at pH 6.0), e.g., with a dissociation constant (Kd) of 50 nM or less, e.g., 25 nM or less, 10 nM or less, 5 nM or less, 2 nM or less, 1 nM or less, 0.5 nM or less, 0.2 nM or less, 0.1 nM or less, 0.05 nM or less, 0.02 nM or less, or 0.01 nM or less, e.g., between 25 nM and 0.1 nM, between 20 nM and 0.5 nM, between 15 nM and 1 nM, between 10 nM and 5 nM, or between 20 nM and 10 nM, e.g., as determined by an octet-based assay or a cell-based assay.
- In an embodiment, the polypeptide binds to an FcRn with low affinity e.g., at a pH between 7.0 and 7.4 (e.g., at pH 7.4), e.g., with a Kd of 50 nM or more, e.g., 60 nM or more, 80 nM or more, 100 nM or more, 150 nM or more, 200 nM or more, 500 nM or more, e.g., between 50 nM and 500 nM or between 100 nM and 250 nM, e.g., as determined by an octet-based assay or a cell-based assay.
- In an embodiment, the polypeptide has the same binding affinity, does not substantially alter (e.g., decreases or increases by no more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) the binding affinity, or increases the binding affinity (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), for an Fcγ receptor (e.g., one, two, or all of FcγRI, FcγRIIa/b, or FcγRIII), compared to a reference polypeptide, e.g., as determined by an octet-based assay or a cell-based assay.
- In an embodiment, the polypeptide has the same thermal stability, or does not substantially alter (e.g., increases or decreases the melting temperature by no more than 1° C., 2° C., 3° C., 4° C., 5° C., 6° C., 7° C., 8° C., 9° C., or 10° C.), the thermal stability, compared to a reference polypeptide, e.g., as determined by a sypro orange assay.
- In an embodiment, the polypeptide has the same binding affinity, does not substantially alter (e.g., decreases or increases by no more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) the binding affinity, or increases the binding affinity (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), for C1q, compared to a reference polypeptide, e.g., as determined by ELISA.
- In an embodiment, the polypeptide has the same binding affinity, does not substantially alter (e.g., decreases or increases by no more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) the binding affinity, or increases the binding affinity (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), for TRIM21, compared to a reference polypeptide, e.g., as determined by ELISA.
- In an embodiment, the polypeptide has the same effector function, or does not substantially alter (e.g., decreases or increases by more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) an effector function, or increases an effector function (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), e.g., one or more (e.g., two, three, or all) of a complement dependent cytotoxicity (CDC), an antibody dependent cell mediated cytotoxicity (ADCC), an antibody dependent cell mediated phagocytosis (ADCP), or an antibody dependent intracellular neutralization (ADIN), compared to a reference polypeptide.
- In an embodiment, the polypeptide has an increased half-life in vivo, e.g., at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, or 10-fold increase, compared to a reference polypeptide, e.g., as determined in an animal model.
- In an embodiment, the polypeptide has the same biological function, does not substantially alter (e.g., decreases or increases by no more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) a biological function, or increases a biological function (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), in vitro, ex vivo, or in vivo, compared to a reference polypeptide. In an embodiment, the biological function comprises an inhibitory (e.g., neutralizing) activity. In an embodiment, the biological function comprises inhibiting (e.g., neutralizing) a pathogen, e.g., a virus, a bacterium, or a fungus. In an embodiment, the biological function comprising an anti-tumor activity. In an embodiment, the biological function comprises inhibiting an immune response. In an embodiment, the biological function comprises an agonistic activity. In an embodiment, the biological function comprises activating or restoring an immune response.
- In an embodiment, the polypeptide has the same developability characteristic, does not substantially alter (e.g., decreases or increases by no more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) a developability characteristic, or increases a developability characteristic (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), e.g., one or more (e.g., two, three, or all) of stability, solubility, aggregation, or expression level, compared to a reference polypeptide;
- In an embodiment, the polypeptide has the same binding affinity, specificity, or both, or does not substantially alter (e.g., decreases or increases by no more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) the binding affinity, specificity, or both, or increases the binding affinity, specificity, or both (e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold), for an epitope, compared to a reference polypeptide.
- In an embodiment, the polypeptide increases mucosal uptake, e.g., by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, or 50-fold, compared to a reference polypeptide, e.g., as determined by a transcytosis assay.
- In an embodiment, the polypeptide has properties a) or b) above. In an embodiment, the polypeptide has properties a) and b) above. In an embodiment, the polypeptide has one or both of properties a) or b) above, and one or both of properties c) or d) above. In an embodiment, the polypeptide has one or both of properties a) or b) above, and one, two, three, four, or all of properties e), f), g), h), or i) above. In an embodiment, the polypeptide has one or both of properties a) or b) above, and one or both of properties c) or d) above. In an embodiment, the polypeptide has one or both of properties a) or b) above, and one, two, three, four, five, six, or all of properties c), d), j), k), l), m), or n) above. In an embodiment, the polypeptide has one or both of properties a) or b) above, one, two, three, four, or all of properties e), f), g), h), or i) above, and one, two, three, four, five, six, or all of properties c), d), j), k), l), m), or n) above. In an embodiment, the polypeptide has one, two, three, or all of properties a), b), c), or d) above, one, two, three, four, or all of properties e), f), g), h), or i) above, and one, two, three, four, or all of properties j), k), l), m), or n) above. In an embodiment, the polypeptide has one or both of properties a) or c) above, one or both of properties b) or d) above, one, two, three, four, or all of properties e), f), g), h), or i) above, and one, two, three, four, or all of properties j), k), l), m), or n) above.
- In an embodiment, the reference polypeptide is an otherwise identical polypeptide without the mutation, e.g., comprising a wild-type Fc region, e.g., having the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or 15 amino acid residues.
- In an embodiment, the mutation is in a residue in a CH2 domain In another embodiment, the mutation is in a residue in a CH3 domain In an embodiment, the polypeptide comprises at least one mutation in a residue in a CH2 domain and at least one mutation in a residue in a CH3 domain In an embodiment, the polypeptide further comprises a mutation in a residue in a region other than a CH2 domain and/or a CH3 domain.
- In an embodiment, the mutation does not alter, or does not substantially alter, the conformation of the linker region between the CH2 and CH3 domains. In an embodiment, the mutation does not introduce a cluster (e.g., 3, 4, 5, 6, 7, 8, 9, 10, or more consecutive) of hydrophobic or aromatic residues, e.g., on a surface region (e.g., a region defined as the area covered by amino acid residues that have more than 20% solvent accessible area).
- In an embodiment, the polypeptide is an antibody molecule, e.g., an antibody molecule described herein.
- In an embodiment, the polypeptide is an IgG, e.g., IgG1, IgG2, IgG3, or IgG4. In an embodiment, the polypeptide is an IgG1. In an embodiment, the polypeptide is an IgG4.
- In an embodiment, the polypeptide comprises a heavy chain immunoglobulin variable region, a light chain immunoglobulin variable region, or both. In an embodiment, the polypeptide comprises a tetramer of two heavy chain immunoglobulin variable regions and two light chain immunoglobulin variable regions. In an embodiment, the polypeptide comprises a full length antibody molecule. In an embodiment, the polypeptide comprises a fragment (e.g., an antigen-binding fragment) of an antibody molecule.
- In an embodiment, the polypeptide comprises a chimeric antibody molecule. In an embodiment, the polypeptide comprises a humanized antibody molecule. In an embodiment, the polypeptide comprises a human antibody molecule. In an embodiment, the polypeptide comprises a murine antibody molecule. In an embodiment, the polypeptide comprises a bispecific or multispecific antibody molecule.
- In another embodiment, the polypeptide is a fusion protein, e.g., a fusion protein described herein. In an embodiment, the polypeptide comprises a fragment (e.g., functional fragment) of the fusion polypeptide.
- In an embodiment, the polypeptide comprises one or more (e.g., 2, 3, 4, or all) of the following:
- (i) a mutation in a residue in a surface region (e.g., a region defined as the area covered by amino acid residues that have more than 20% solvent accessible area) that interacts with the FcRn, e.g., an FcRn contact residue;
- (ii) a mutation in a residue that is a peripheral residue along the Fc-FcRn interface (e.g., any amino acid residues on the surface of the Fc region that is less than 7 Angstroms from the FcRn in the Fc-FcRn complex);
- (iii) a mutation is in a residue that is non-contact residue in Fc-FcRn binding;
- (iv) a mutation in a residue which is a helix contact reside that enhances the conformational dynamics of 250-helix, e.g., a helix comprising one or more (e.g., 2, 3, 4, 5, or all) of P247, K248, D249, T250, L251, or M252; or
- (v) a mutation, which modulates pK of a histidine and/or is an introduction of a histidine along the Fc-FcRn interface (e.g., any amino acid residues on the surface of the Fc region that is less than 7 Angstroms from the FcRn in the Fc-FcRn complex).
- In an embodiment, the polypeptide comprises (i) and (ii) above. In an embodiment, the polypeptide comprises (i) and (iii) above. In an embodiment, the polypeptide comprises (i) and (iv) above. In an embodiment, the polypeptide comprises (i) and (v) above. In an embodiment, the polypeptide comprises (ii) and (iii) above. In an embodiment, the polypeptide comprises (ii) and (iv) above. In an embodiment, the polypeptide comprises (ii) and (v) above. In an embodiment, the polypeptide comprises (iii) and (iv) above. In an embodiment, the polypeptide comprises (iii) and (v) above. In an embodiment, the polypeptide comprises (iv) and (v) above.
- In an embodiment, the polypeptide comprises (i), (ii) and (iii) above. In an embodiment, the polypeptide comprises (i), (ii) and (iv) above. In an embodiment, the polypeptide comprises (i), (ii) and (v) above. In an embodiment, the polypeptide comprises (i), (iii) and (iv) above. In an embodiment, the polypeptide comprises (i), (iii) and (iv) above. In an embodiment, the polypeptide comprises (i), (iv) and (v) above. In an embodiment, the polypeptide comprises (ii), (iii) and (iv) above. In an embodiment, the polypeptide comprises (ii), (iii) and (v) above. In an embodiment, the polypeptide comprises (ii), (iv) and (v) above. In an embodiment, the polypeptide comprises (iii), (iv) and (v) above.
- In an embodiment, the polypeptide comprises (i), (ii), (iii) and (iv) above. In an embodiment, the polypeptide comprises (i), (ii), (iii) and (v) above. In an embodiment, the polypeptide comprises (i), (ii), (iv) and (v) above. In an embodiment, the polypeptide comprises (i), (iii), (iv) and (v) above. In an embodiment, the polypeptide comprises (ii), (iii), (iv) and (v) above.
- In an embodiment, the polypeptide comprises (i), (ii), (iii), (iv), and (v) above.
- In an embodiment, the polypeptide comprises a mutation in a residue in a surface region (e.g., a region defined as the area covered by amino acid residues that have more than 20% solvent accessible area) that interacts with the FcRn, e.g., an FcRn contact residue.
- In an embodiment, the mutation is in a residue chosen from: L251, 1253, R255, P257, H285, N286, K288, T307, V308, L309, Q311, L314, H310, H433, N434, H435, or Y436. In an embodiment, the polypeptide comprises a plurality of mutations in two or more (e.g., 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, or all) of the residues chosen from L251, 1253, R255, P257, H285, N286, K288, T307, V308, L309, Q311, L314, H310, H433, N434, H435, or Y436.
- In an embodiment, the polypeptide comprises a mutation in a residue that is a peripheral residue along the Fc-FcRn interface (e.g., any amino acid residues on the surface of the Fc region that is less than 7 Angstroms from the FcRn in the Fc-FcRn complex).
- In an embodiment, the mutation is in a residue chosen from one or more (e.g., 2, 3, 4, 5, 6, or all) of T256, H285, N286, T307, Q311, N315, or A378. In an embodiment, the polypeptide comprises a plurality of mutations in two or more (e.g., 2, 3, 4, 5, 6, or all) of the residues chosen from T256, H285, N286, T307, Q311, N315, or A378. In an embodiment, the polypeptide comprises one or more (e.g., 2, 3, 4, 5, 6, or all) of the mutations chosen from T256D, H285N, N286D, T307Q, Q311V, N315D, or A378V.
- In an embodiment, the mutation is in a residue chosen from T256, Q311, or A378. In an embodiment, the polypeptide comprises a plurality of mutations in two or all of the residues chosen from T256, Q311, or A378. In an embodiment, the polypeptide comprises one, two, or all of the mutations chosen from T256D, Q311V, or A378V.
- In an embodiment, the mutation is in a residue chosen from H285, T307, or N315. In an embodiment, the polypeptide comprises a plurality of mutations in two or all of the residues chosen from H285, T307, or N315. In an embodiment, the polypeptide comprises one, two, or all of the mutations chosen from H285N, T307Q, or N315D.
- In an embodiment, the mutation is in a residue chosen from H285, T307, or A378. In an embodiment, the polypeptide comprises a plurality of mutations in two or all of the residues chosen from H285, T307, or A378. In an embodiment, the polypeptide comprises one, two, or all or the mutations chosen from H285D, T307Q, or A378V.
- In an embodiment, the mutation is in a residue chosen from T307, Q311, or A378. In an embodiment, the polypeptide comprises a plurality of mutations in two or all of the residues chosen from T307, Q311, or A378. In an embodiment, the polypeptide comprises one, two, or all of the mutations chosen from T307Q, Q311V, or A378V.
- In an embodiment, the mutation is in a residue chosen from T256, N286, T307, Q311, or A378. In an embodiment, the polypeptide comprises a plurality of mutations in two, three, four, or all of the residues chosen T256, N286, T307, Q311, or A378. In an embodiment, the polypeptide comprises one, two, three, four, or all of the mutations chosen from T256D, N286D, T307R, Q311V, or A378V.
- In an embodiment, the mutation is in a residue chosen from T256, H285, T307, Q311, or A378. In an embodiment, the polypeptide comprises a plurality of mutations in two, three, four, or all of the residues chosen T256, H285, T307, Q311, or A378. In an embodiment, the polypeptide comprises one, two, three, four, or all of the mutations chosen from T256D, H285D, T307R, Q311V, or A378V.
- In an embodiment, the mutation is in a residue chosen from M252, T256, T307, L309, Q311, H433, N434, Y436, N286, or K288. In an embodiment, the polypeptide comprises a plurality of mutations in two or more (e.g., 3, 4, 5, 6, 7, 8, 9, or all) of the residues chosen from M252, T256, T307, L309, Q311, H433, N434, Y436, N286, or K288.
- In an embodiment, the polypeptide comprises a mutation is in a residue that is non-contact residue in Fc-FcRn binding.
- In an embodiment, the mutation is in a residue chosen from A287, V308, N315, L314, L432, H429, E430, or A431. In an embodiment, the polypeptide comprises a plurality of mutations in two or more (e.g., 3, 4, 5, 6, 7, or all) of the residues chosen from A287, V308, N315, L314, L432, H429, E430, or A431.
- In an embodiment, the polypeptide comprises a mutation in a residue which is a helix contact reside that enhances the conformational dynamics of 250-helix (e.g., a helix comprising one or more (e.g., 2, 3, 4, 5, or all) of P247, K248, D249, T250, L251, or M252), e.g., a lateral displacement or conformational flexibility exhibited by the 250-helix (e.g., as shown by a comparison of the crystal structures of the Fc domain crystallized at pH5.0 (PDB ID: 4J12) and at pH 6.5 (PDB ID: 4Q7D).
- In an embodiment, the mutation is in a residue chosen from P244, P245, T250, L251, P247, E380, M428, A378, D376, P257, V308, A287, L306, or H427. In an embodiment, the polypeptide comprises a plurality of mutations in two or more (e.g., 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or all) of the residues chosen from P244, P245, T250, L251, P247, E380, M428, A378, D376, P257, V308, A287, L306, or H427.
- In an embodiment, the polypeptide comprises a mutation which is the introduction of a histidine along the Fc-FcRn interface (e.g., any amino acid residues on the surface of the Fc region that is less than 7 Angstroms from the FcRn in the Fc-FcRn complex).
- In an embodiment, the mutation introduces a polar amino acid residue. In another embodiment, the mutation introduces a non-polar amino acid residue. In an embodiment, the mutation introduces a charged amino acid residue. In another embodiment, the mutation introduces a non-charge amino acid residue. In an embodiment, the mutation introduces a positively charged (or basic) amino acid residue. In another embodiment, the mutation introduces a negatively charged (or acidic) amino acid residue. In an embodiment, the mutation introduces a hydrophobic amino acid residue. In another embodiment, the mutation introduces a hydrophilic amino acid residue.
- In an embodiment, the polypeptide comprises a mutation in at least one (e.g., 2, 3, 4, 5, or more) FcRn contact residue. In an embodiment, the polypeptide comprises a mutation in one or more (e.g., 2 or all) of residues T256, T307, or N286. In an embodiment, the polypeptide comprises mutations in residues T256 and T307, optionally, further comprises a mutation in residue N286. In an embodiment, the mutation in residue T256 is a polar residue, e.g., chosen from T256D, T256E, or T256R. In an embodiment, the mutation in residue T256 is T256D. In an embodiment, the mutation in residue T307 is a polar residue, e.g., chosen from T307D, T307E, or T307R. In an embodiment, the mutation in residue T307 is T307R. In an embodiment, the mutation in residue N286 is N286I. In an embodiment, the polypeptide comprises mutations T256D and T307R. In an embodiment, the polypeptide comprises mutations T256D, T307R, and N286I.
- In an embodiment, the polypeptide comprises a mutation in at least one (e.g., 2, 3, 4, 5, or more) FcRn contact residue. In an embodiment, the polypeptide comprises a mutation in one or more (e.g., 2 or all) of residues L309, D312, or N315. In an embodiment, the polypeptide comprises a mutation in residue L309, optionally, further comprises mutations in residues D312 and N315. In an embodiment, the mutation in residue L309 is L309N. In an embodiment, the mutation in residue D312 is D312A. In an embodiment, the mutation in residue N315 is N315D. In an embodiment, the polypeptide comprises mutation L309N. In an embodiment, the polypeptide comprises mutations L309N, D312A and N315D.
- In an embodiment, the polypeptide comprises a mutation in at least one (e.g., 1, 2, 3, 4, 5, or more) FcRn non-contact residue. In an embodiment, the polypeptide comprises a mutation in one or more (e.g., 2 or all) of residues L209R, D312, or Q311. In an embodiment, the polypeptide comprises mutations in residues L309 and D312, optionally, further comprising a mutation in residue Q311. In an embodiment, the polypeptide comprises a mutation in residue Q311. In an embodiment, the mutation in residue L309 is L309R. In an embodiment, the mutation in residue D312 is D312E. In an embodiment, the mutation in residue Q311 is Q311P. In an embodiment, the polypeptide comprises mutations L309R and D312E. In an embodiment, the polypeptide comprises mutations L309R, D312E, and Q311P. In an embodiment, the polypeptide comprises mutation Q311P.
- In an embodiment, the polypeptide comprises a mutation in at least one (e.g., 2, 3, 4, 5, or more) FcRn contact residue. In an embodiment, the polypeptide comprises a mutation in one or more (e.g., 2, 3, or 4) of residues chosen from 1253, 5254, M252, or R255. In an embodiment, the polypeptide comprises a mutation in
residue 1253. In an embodiment, the mutation inresidue 1253 is I253M. In an embodiment, the polypeptide comprises a mutation in residue 5254. In an embodiment, the mutation in residue 5254 is S254H or S254M. In an embodiment, the polypeptide comprises mutations in residues M252 and 5254. In an embodiment, the mutation in residue M252 is M252E. In an embodiment, the mutation in residue 5254 is S254R. In an embodiment, the polypeptide comprises mutations in residues M252, 5254, and R255. In an embodiment, the mutation in residue M252 is M252E. In an embodiment, the mutation in residue 5254 is S254R. In an embodiment, the mutation in residue R255 is R255Y. - In an embodiment, the polypeptide comprises a mutation in at least one (e.g., 2, 3, 4, 5, or more) FcRn non-contact residue. In an embodiment, the polypeptide comprises mutations that are equivalent of T250Q and M34L. In an embodiment, the polypeptide comprises a mutation in one or more (e.g., 2, 3, 4, or all) of residues chosen from D376, K248, E380, M428, or A328. In an embodiment, the polypeptide comprises a mutation in residue D376 and a mutation in a residue chosen from K248, E380, M428, or A328. In an embodiment, the polypeptide comprises a mutation in residue D376 and a mutation in residue K248. In an embodiment, the polypeptide comprises a mutation in residue D376 and a mutation in residue E380. In an embodiment, the polypeptide comprises a mutation in residue D376 and a mutation in residue M428. In an embodiment, the polypeptide comprises a mutation in residue D376 and a mutation in residue A328. In an embodiment, the mutation in residue D376 is D376Q or D376N. In an embodiment, the mutation in residue K248 is K248S. In an embodiment, the mutation in residue E380 is E380A. In an embodiment, the mutation in residue D376 is D376Q. In an embodiment, the mutation in residue M428 is M428L. In an embodiment, the mutation in residue A328 is A328I. In an embodiment, the polypeptide comprises mutation D376Q or D376N, and mutation K248S. In an embodiment, the polypeptide comprises mutation D376Q or D376N, and mutation E380A. In an embodiment, the polypeptide comprises mutations D376Q and M428L. In an embodiment, the polypeptide comprises mutations D376Q and A328I.
- In an embodiment, the polypeptide comprises a mutation in at least one (e.g., 2, 3, 4, 5, or more) FcRn non-contact residue. In an embodiment, the polypeptide comprises a mutation in one or more (e.g., 2 or all) of residues chosen from K246, P247, or D376. In an embodiment, the polypeptide comprises a mutation in residue K246 and a mutation in residue P247, optionally, further comprising a mutation in residue D376. In an embodiment, the mutation in residue K246 is K246N. In an embodiment, the mutation in residue P247 is P247A. In an embodiment, the mutation in residue D376 is D376N. In an embodiment, the polypeptide comprises mutations K246N and P247A, optionally, further comprising mutation D376N.
- In an embodiment, the polypeptide comprises a mutation in one or more (e.g., 2, 3, 4, 5, 6, or all) of residues chosen from T256, T307, N286, A287, P257, Q311, or P247. In an embodiment, the polypeptide comprises mutations in residues T256, T307, N286, and A287. In an embodiment, the polypeptide comprises mutations in residues T256, T307, and P257. In an embodiment, the polypeptide comprises mutations in residues T256, T307, and Q311. In an embodiment, the polypeptide comprises mutations in residues T256, T307, and P247. In an embodiment, mutation in residue T256 is T256D. In an embodiment, the mutation in residue T307 is T307R. In an embodiment, the mutation in residue N286 is N286I. In an embodiment, the mutation in residue A287 is A287S. In an embodiment, the mutation in residue P257 is P257L. In an embodiment, the mutation in residue Q311 is Q311V or Q311L. In an embodiment, the mutation in residue P247 is P247D. In an embodiment, the polypeptide comprises mutations T256D, T307R, N286D, and A287S. In an embodiment, the polypeptide comprises mutations T256D, T307R, and P257L. In an embodiment, the polypeptide comprises mutations T256D, T307R, and Q311V or Q311L. In an embodiment, the polypeptide comprises mutations T256D, T307R, and P247D.
- In an embodiment, the polypeptide comprises a mutation in one or more (e.g., 2, 3, 4, 5, 6, 7, or all) of residues chosen from N286, A287, P247, Q311, V308, P257, N315, or V279. In an embodiment, the polypeptide comprises mutations in residues N286, A287, P247, and Q311. In an embodiment, the mutation in residue N286 is N286D. In an embodiment, the mutation in residue A287 is A287S. In an embodiment, the mutation in residue P247 is P247D. In an embodiment, the mutation in residue Q311 is Q311V. In an embodiment, the polypeptide comprises mutations in residues V308 and P257. In an embodiment, the mutation in residue V308 is V308N. In an embodiment, the mutation in residue P257 is P257M. In an embodiment, the polypeptide comprises mutations in residues Q311, N315, and V279. In an embodiment, the mutation in residue Q311 is Q311L. In an embodiment, the mutation in residue N315 is N315T. In an embodiment, the mutation in residue V279 is V279I.
- In an embodiment, the polypeptide comprises a mutation in one or more (e.g., 2, 3, or all) of residues chosen from G433 or H433, P434 or G434, G434a, or H435. In an embodiment, the polypeptide comprises mutations in residues G433, P434, and H435. In an embodiment, the polypeptide comprises mutations in residues G433, P434, G434a, and H435. In an embodiment, the polypeptide comprises mutations in residues H433, G434, P434a, and H435.
- In an embodiment, the polypeptide comprises one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, or more) mutations, or one or more combination of mutations, as described in Table 1. For example, a combination of mutations can include one or more mutations listed under the name FcMutX and one or more mutations listed under the name FcMutY, where X and Y are three-digit numbers shown in Table 1, and X is not equal to Y.
- In an embodiment, the polypeptide comprises mutation I253M. In an embodiment, the polypeptide comprises mutations L309H, D312A and N315D. In an embodiment, the polypeptide comprises mutation L309N. In an embodiment, the polypeptide comprises mutations M252E and S254R. In an embodiment, the polypeptide comprises mutations M252E, S254R and R255Y. In an embodiment, the polypeptide comprises mutation S254H. In an embodiment, the polypeptide comprises mutation S254M. In an embodiment, the polypeptide comprises mutations T256D and T307R. In an embodiment, the polypeptide comprises mutations T256L, N286I and T3071. In an embodiment, the polypeptide comprises mutations T256I, N286I and T3071. In an embodiment, the polypeptide comprises mutations K248S and D376Q. In an embodiment, the polypeptide comprises mutations K248S and D376N. In an embodiment, the polypeptide comprises mutations D376Q and E380A. In an embodiment, the polypeptide comprises mutations D376N and E380A. In an embodiment, the polypeptide comprises mutations D376Q and M428L. In an embodiment, the polypeptide comprises mutations K248S and A378I. In an embodiment, the polypeptide comprises mutation L314K. In an embodiment, the polypeptide comprises mutation M252W. In an embodiment, the polypeptide comprises mutation V308F. In an embodiment, the polypeptide comprises mutations V308F and N434Y. In an embodiment, the polypeptide comprises mutations T256D, T307R and D376N. In an embodiment, the polypeptide comprises mutations L309R and D312E. In an embodiment, the polypeptide comprises mutations L309R, Q311P and D312E. In an embodiment, the polypeptide comprises mutations K246N and P247A. In an embodiment, the polypeptide comprises mutations K246N, P247A and D376N. In an embodiment, the polypeptide comprises mutations T256E and T307R. In an embodiment, the polypeptide comprises mutations T256R and T307D. In an embodiment, the polypeptide comprises mutations T256R and T307E. In an embodiment, the polypeptide comprises mutation Q311P. In an embodiment, the polypeptide comprises mutation D376Q. In an embodiment, the polypeptide comprises mutations T256D, N286D, A287S and T307R. In an embodiment, the polypeptide comprises mutations T256D, P257L and T307R. In an embodiment, the polypeptide comprises mutations T256D, T307R and Q311V. In an embodiment, the polypeptide comprises mutations P247D, T256D and T307R. In an embodiment, the polypeptide comprises mutations P247D, N286D, A287S and Q311V. In an embodiment, the polypeptide comprises mutations P257M and V308N. In an embodiment, the polypeptide comprises mutations V279I, Q311L and N315T. In an embodiment, the polypeptide comprises mutations H433G and N434P. In an embodiment, the polypeptide comprises mutations T256D, N286D and T307R. In an embodiment, the polypeptide comprises mutations T256D, N286E and T307R. In an embodiment, the polypeptide comprises mutations T256D, N286Q and T307R. In an embodiment, the polypeptide comprises mutations T256D, P257T and T307R. In an embodiment, the polypeptide comprises mutations T256D, P257V and T307R. In an embodiment, the polypeptide comprises mutations T256D, T307R and Q311I. In an embodiment, the polypeptide comprises mutations T256D, T307R and Q311L. In an embodiment, the polypeptide comprises mutations T256D, T307R and Q311M. In an embodiment, the polypeptide comprises mutations T256D, P257L, N286D, T307R and Q311V. In an embodiment, the polypeptide comprises mutations T256D, T307R and M428L
- In an embodiment, the mutation is other than M252Y, S254T, T256E, L309N, T250Q, M428L, N434S, N434A, T307A, E380A, N434A, M252Y, S254T, T256E, or a combination thereof. In an embodiment, the mutation is in a residue other than residue M252, 5254, T256, L309, T250, M428, N434, N434, T307, E380, N434, M252, 5254, T256, or a combination thereof. In an embodiment, the polypeptide does not have one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, or all) of the following mutation or mutations: (i) M252Y, S254T, and T256E; (ii) L309N; (iii) T250Q and M428L; (iv) M428L and N434A; (v) N434A; (vi) T307A, E380A, and N434A; (vii) M252W; (viii) V308F; (ix) V308F and N434Y; or (x) H435A.
- In an embodiment, the polypeptide comprises a first mutation chosen from M252Y, S254T, T256E, L309N, T250Q, M428L, N434S, N434A, T307A, E380A, N434A, M252Y, S254T, or T256E, and a second mutation chosen from a mutation in Table 1 other than M252Y, S254T, T256E, L309N, T250Q, M428L, N434S, N434A, T307A, E380A, N434A, M252Y, S254T, and T256E.
- In an embodiment, the polypeptide comprises a combination of mutations chosen from M252Y, S254T, T256E, L309N, T250Q, M428L, N434S, N434A, T307A, E380A, N434A, M252Y, S254T, or T256E, wherein the combination is other than (i) M252Y, S254T, and T256E; (ii) L309N; (iii) T250Q and M428L; (iv) M428L and N434A; (v) N434A; (vi) T307A, E380A, and N434A; (vii) M252W; (viii) V308F; (ix) V308F and N434Y; or (x) H435A.
- In an embodiment, the polypeptide further comprises a mutation in the Fc region that increases an effector function. In an embodiment, the mutation is in a residue chosen from 5239 (e.g., S239D), A330 (e.g., A330L), 1332 (e.g., 1332E), F243 (e.g., F243L), G236 (e.g., G236A), or a combination thereof, e.g., to increase an effector function.
- In an embodiment, the polypeptide further comprises a mutation in the Fc region that decreases an effector function. In an embodiment, the mutation is in a residue chosen from K322 (e.g., K322A), L234 (e.g., L234A or L234F), L235 (e.g., L235A or L235E), P331 (e.g., P331S), N297, or a combination thereof, e.g., to decrease an effector function.
- In an embodiment, the polypeptide further comprises a mutation in a region other than the Fc region, e.g., in a Fab region.
- In an embodiment, the polypeptide further comprises a plurality of mutations, wherein at least one mutation is a compensating mutation, e.g., a compensating mutation described herein.
- In an embodiment, the polypeptide is an isolated polypeptide. In an embodiment, the polypeptide is a synthetic polypeptide.
- In an aspect, the disclosure features a composition, e.g., pharmaceutical composition, comprising a polypeptide described herein. In an embodiment, the composition further comprises a pharmaceutical acceptable carrier.
- In an aspect, the disclosure features a nucleic acid molecule encoding a polypeptide described herein. In an aspect, the disclosure features a vector comprising a nucleic acid molecule described herein. In an aspect, the disclosure features a cell, e.g., an isolated cell, comprising a nucleic acid molecule described herein or a vector described herein. In an aspect, the disclosure features a kit comprising a polypeptide described herein and instructions to use of the polypeptide. In an aspect, the disclosure features a container comprising a polypeptide described herein.
- In an aspect, the disclosure features a method of producing a polypeptide described herein, the method comprising culturing a cell described herein under conditions that allow production of an antibody molecule, thereby producing the polypeptide. In an embodiment, the method further comprises isolating or purifying the polypeptide.
- In an aspect, the disclosure features a method of treating a disorder (e.g., a disorder described herein), the method comprising administering to a subject in need thereof an effective amount of a polypeptide described herein or a composition described herein, thereby treating the disorder.
- In an aspect, the disclosure features a polypeptide described herein for use in a method of treating a disorder (e.g., a disorder described herein). In another aspect, the disclosure features use of a polypeptide described herein in the manufacture of a medicament in the treatment of a disorder (e.g., a disorder described herein).
- In an aspect, the disclosure features a method of detecting a molecule, the method comprising contacting a cell or a sample from a subject with polypeptide described herein, thereby detecting the molecule.
- The disclosure contemplates all combinations of any one or more of the foregoing aspects and/or embodiments, as well as combinations with any one or more of the embodiments set forth in the detailed description and examples.
- Other features, objects, and advantages of the compositions and methods herein will be apparent from the description and drawings, and from the claims.
-
FIG. 1 depicts the binding between FcRn and IgG1. -
FIG. 2 depicts various binding sites in the Fc region. -
FIG. 3 depicts the structural basis for pH specific engagement of FcRn. -
FIG. 4 depicts mapping of Fc-FcRn interaction interface. CH2 and CH3 domains are indicated and shown by different gray shades. -
FIG. 5 depicts a network view of Fc-FcRn engagement. -
FIG. 6 depicts FcRn binding to anti-CH1 immobilized antibody and pH specific enhancement. -
FIG. 7 depicts the results of a cell-based FcRn binding competition assay. -
FIG. 8 depicts the binding of exemplary antibody molecules to FcγRI and FcγRIIIa. -
FIG. 9 depicts the thermal stability of exemplary antibody molecules. -
FIG. 10 depicts the half-lives of exemplary antibody molecules in Tg32 mice. -
FIG. 11A depicts Kd, kon and koff of exemplary Fc engineered antibodies. Values presented as fold change as compared to IgG containing WT Fc. -
FIG. 11B depicts improved binding to FcRn at pH 6.0 and poor binding to FcRn at pH 7.4 of a representative Fc engineered antibody. -
FIG. 11C depicts the interaction of the CH2 domain of the antibody Fc with the FcRn molecule. -
FIG. 12 depicts biophysical properties of Fc engineered variants. -
FIG. 13A depicts improved in vivo half-life of 3 Motavizumab Fc variants in comparison to WT Motavizumab (Mota-WT). -
FIG. 13B depicts pharmacokinetic properties of 2 Motavizumab Fc variants and WT Motavizumab. -
FIG. 14A depicts improved in vivo half-life of later stage Motavizumab Fc variants in comparison to WT Motavizumab (Mota-WT) administered at a dose of 5 mg/kg. -
FIG. 14B depicts pharmacokinetic properties of later stage Motavizumab Fc variants and WT Motavizumab administered at a dose of 5 mg/kg. -
FIG. 14C depicts improved in vivo half-life of later stage Motavizumab Fc variants in comparison to WT Motavizumab (Mota-WT) administered at a dose of 2 mg/kg. -
FIG. 14D depicts pharmacokinetic properties of later stage Motavizumab Fc variants and WT Motavizumab administered at a dose of 2 mg/kg. -
FIG. 15 depicts longer in vivo half-life of the ZVB Zika antibody. -
FIG. 16 depicts a similar half-life of ZKB-LS (ZVB antibody with LS Fc mutation) and ZKB-156 (ZVB antibody with Visterra 156 Fc mutation). Both of these antibodies had a longer half-life than the parental ZVB antibody (ZKB) and WT Motavizumab. -
FIG. 17A depicts the binding of exemplary Fc variants to FcγRI, FcγRIIA, FcγRIIB, FcγRIIIA, and C1q. -
FIG. 17B depicts the binding of FcMut213 to FcγRIIIA compared to wild-type. -
FIG. 17C depicts the binding of FcMut213 to FcγRIIA compared to wild-type. -
FIG. 17D depicts the binding of FcMut213 to C1q compared to wild-type. -
FIG. 18 depicts the CDC activity of exemplary Fc variants (Rituximab Fab). Calculation is based on concentration that achieves 50% lysis, not the mid-point of the four-parameter fit. -
FIGS. 19A-19B depict the ADCC activity of exemplary Fc variants (Rituximab Fab). -
FIG. 20A depicts the IgG Fc structure and Fc-FcRn interaction. -
FIG. 20B depicts the structures of Fc at two different pHs. -
FIG. 21A depicts the types of residues with potential to mediate Fc-FcRn interaction. -
FIG. 21B depicts the molecular interaction of key residues of exemplary engineered Fc variants. -
FIG. 22 depicts an exemplary Octet sensogram. -
FIG. 23 depicts the SEC profile and Tm of exemplary Fc variants. -
FIG. 24 depicts the binding of Fc variants to FcγRIIIa (ADCC activity) and to C1q (CDC activity). -
FIG. 25A depicts the pharmacokinetic characterization of IgGs with Fc variants. Plot shows change in concentration of IgG over time. -
FIG. 25B depicts the PK characterization of exemplary Fc variants. -
FIG. 26 depicts binding of motavizumab Fab with Fc variants to TRIM21. -
FIG. 27A depicts the structures of the FcRn-Fc complex, Protein A-Fc complex, Trim21-Fc complex, and Fc-Fc hexamer complex. -
FIG. 27B depicts the superposition of crystal structures of Fc domain highlighting Fc domain dynamics. - Disclosed herein are polypeptides (e.g., antibody molecules or fusion proteins) that bind to a target molecule or cell, e.g., a human protein or cell, with high affinity and specificity. Advantageously, several of the polypeptides (e.g., antibody molecules or fusion proteins) describe herein have one or more improved or desired pharmacokinetic properties, such as circulating half-life. Without wishing to be bound theory, it is believed that polypeptides can have a range of circulating half-lives in humans, and circulating half-life can affect, e.g., interaction with serum and cell components, rate of fluid phase pinocytosis, interaction with FcRn, receptor mediated endocytosis, drug doses, and generation of anti-drug antibodies. Nucleic acid molecules encoding the polypeptides (e.g., antibody molecules or fusion proteins), expression vectors, host cells, compositions (e.g., pharmaceutical compositions), kits, containers, and methods for making the polypeptides (e.g., antibody molecules or fusion proteins), are also provided. The polypeptides (e.g., antibody molecules or fusion proteins) and pharmaceutical compositions disclosed herein can be used (alone or in combination with other agents or therapeutic modalities) to treat, prevent, and/or diagnose disorders and conditions, e.g., disorders and conditions associated with a target molecule (e.g., protein) or cell, e.g., a disorder or condition described herein.
- Without wishing to be bound by theory, it is believed that in some embodiments, the long circulating half-life of IgGs is attributed to its ability to minimize its endosomal degradation by associating with the neonatal Fc receptor (FcRn). FcRn plays an important role in placental transfer of IgG molecules from mother to fetus and in serum IgG homeostasis (Leach et al., J Immunol, 1996. 157(8): 3317-22; Simister et al., Eur J Immunol, 1996. 26(7): 1527-31; Kristoffersen, APMIS Suppl, 1996. 64: 5-36; Roopenian et al., J Immunol, 2003. 170(7): 3528-33; Junghans and Anderson, Proc Natl Acad Sci USA, 1996. 93(11): 5512-6). The acidic environment of the early endosome can allow for binding of IgG and albumin to FcRn, which protects the IgG from undergoing degradation and helps trafficking the IgG back to the extracellular environment, where, upon exposure to physiological pH, the molecules are released back into circulation. This pathway can be largely responsible for the prolonged serum half-life of both IgG and albumin (Junghans and Anderson, Proc Natl Acad Sci USA, 1996. 93(11): 5512-6; Chaudhury et al., J Exp Med, 2003. 197(3): 315-22).
- The Fc domain of an antibody is primarily responsible for binding to FcRn to facilitate antibody recycling. In some embodiments, antibodies with identical Fc regions can have different circulating half-lives, at least in part, because a number of factors such as thermal stability, interaction with serum and cell components, presence of anti-drug antibodies, high dose, receptor mediated endocytosis, and fluid phase pinocytosis, can promote antibody degradation and negatively influence its half-life. The interaction of IgG with FcRn can serve to protect the antibody from endosomal degradation and extend the half-life of the antibody. Modification of Fc can be used to promote FcRn interaction and therefore extend the half-life of antibodies (Ghetie et al., Nat Biotechnol, 1997. 15(7): p. 637-40; Dall'Acqua et al., J Biol Chem, 2006. 281(33): 23514-24; Hinton et al., J Biol Chem, 2004. 279(8): 6213-6; Vaccaro et al., Nat Biotechnol, 2005. 23(10): 1283-8; Zalevsky et al., Nat Biotechnol, 2010. 28(2): 157-9; Dall'Acqua et al., J Immunol, 2002. 169(9): 5171-80; Monnet et al., MAbs, 2014. 6(2): 422-36; Monnet et al., Front Immunol, 2015. 6: 39; Shields et al., J Biol Chem, 2001. 276(9): 6591-604; Robbie et al., Antimicrob Agents Chemother, 2013. 57(12): 6147-53).
- The Fc of IgG can also bind to various other receptors such as FcγRI, FcγRIIa, FcγRIIb, FcγRIII, C1q, and TRIM21, and these interactions mediate various effector functions such as antibody dependent cellular cytotoxicity (ADCC), complement dependent cytotoxicity (CDC), antibody dependent cellular phagocytosis (ADCP), and antibody dependent intracellular neutralization (ADIN). Traditional approaches used to identify the Fc variants have largely relied on random mutagenesis and display formats and often compromise certain important attributes of the antibody, be it effector functions or biophysical stability.
- Without wishing to be bound by theory, it is believed that in some embodiment, the engineering of Fc for FcRn binding or half-life extension as disclosed herein is performed in the context of the various effector functions mediated by Fc. For example, a structural and network based framework can be used to interrogate the interaction of Fc with FcRn at neutral and acidic pH. Using this framework, different pathways for improving FcRn binding, e.g., decreasing the koff of interaction, can be identified. The interaction networks of mutations can be mapped and mutations can be combined and assessed for binding to FcRn and other Fc receptors. For example, Fc variants that confer enhancement in half-life and retain and in some cases enhance effector functions such as ADCC and CDC can be identified. With the increasing use of antibodies and fusion proteins as therapeutics for prevention and treatment of different diseases, there have been greater needs to develop antibodies and fusion proteins with long half-life, e.g., to treat or prevent chronic diseases.
- As used herein, the articles “a” and “an” refer to one or to more than one (e.g., to at least one) of the grammatical object of the article.
- The term “or” is used herein to mean, and is used interchangeably with, the term “and/or”, unless context clearly indicates otherwise.
- “About” and “approximately” shall generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Exemplary degrees of error are within 20 percent (%), typically, within 10%, and more typically, within 5% of a given value or range of values.
- The compositions and methods disclosed herein encompass polypeptides and nucleic acids having the sequences specified, or sequences substantially identical or similar thereto, e.g., sequences at least 85%, 90%, 95% identical or higher to the sequence specified.
- In the context of an amino acid sequence, the term “substantially identical” is used herein to refer to a first amino acid that contains a sufficient or minimum number of amino acid residues that are i) identical to, or ii) conservative substitutions of aligned amino acid residues in a second amino acid sequence such that the first and second amino acid sequences can have a common structural domain and/or common functional activity. For example, amino acid sequences that contain a common structural domain having at least about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to a reference sequence, e.g., a sequence provided herein.
- In the context of nucleotide sequence, the term “substantially identical” is used herein to refer to a first nucleic acid sequence that contains a sufficient or minimum number of nucleotides that are identical to aligned nucleotides in a second nucleic acid sequence such that the first and second nucleotide sequences encode a polypeptide having common functional activity, or encode a common structural polypeptide domain or a common functional polypeptide activity. For example, nucleotide sequences having at least about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to a reference sequence, e.g., a sequence provided herein.
- The term “functional variant” refers polypeptides that have a substantially identical amino acid sequence to the naturally-occurring sequence, or are encoded by a substantially identical nucleotide sequence, and are capable of having one or more activities of the naturally-occurring sequence.
- Calculations of homology or sequence identity between sequences (the terms are used interchangeably herein) are performed as follows.
- To determine the percent identity of two amino acid sequences, or of two nucleic acid sequences, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes). In a typical embodiment, the length of a reference sequence aligned for comparison purposes is at least 30%, e.g., at least 40%, 50%, 60%, e.g., at least 70%, 80%, 90%, 100% of the length of the reference sequence. The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position.
- The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
- The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. In some embodiments, the percent identity between two amino acid sequences is determined using the Needleman and Wunsch ((1970) J. Mol. Biol. 48:444-453) algorithm which has been incorporated into the GAP program in the GCG software package (available at gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6. In certain embodiments, the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (available at gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6. One suitable set of parameters (and the one that should be used unless otherwise specified) are a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
- The percent identity between two amino acid or nucleotide sequences can be determined using the algorithm of E. Meyers and W. Miller ((1989) CABIOS, 4:11-17) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- The nucleic acid and protein sequences described herein can be used as a “query sequence” to perform a search against public databases to, for example, identify other family members or related sequences. Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) J. Mol. Biol. 215:403-10. BLAST nucleotide searches can be performed with the NBLAST program, score=100, wordlength=12 to obtain nucleotide sequences homologous to a nucleic acid as described herein. BLAST protein searches can be performed with the XBLAST program, score=50, wordlength=3 to obtain amino acid sequences homologous to protein molecules described herein. To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul et al., (1997) Nucleic Acids Res. 25:3389-3402. When utilizing BLAST and gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and NBLAST) can be used. See ncbi.nlm.nih.gov.
- As used herein, the term “hybridizes under low stringency, medium stringency, high stringency, or very high stringency conditions” describes conditions for hybridization and washing. Guidance for performing hybridization reactions can be found in Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6, which is incorporated by reference. Aqueous and nonaqueous methods are described in that reference and either can be used. Specific hybridization conditions referred to herein are as follows: 1) low stringency hybridization conditions in 6×sodium chloride/sodium citrate (SSC) at about 45° C., followed by two washes in 0.2×SSC, 0.1% SDS at least at 50° C. (the temperature of the washes can be increased to 55° C. for low stringency conditions); 2) medium stringency hybridization conditions in 6×SSC at about 45° C., followed by one or more washes in 0.2×SSC, 0.1% SDS at 60° C.; 3) high stringency hybridization conditions in 6×SSC at about 45° C., followed by one or more washes in 0.2×SSC, 0.1% SDS at 65° C.; and preferably 4) very high stringency hybridization conditions are 0.5M sodium phosphate, 7% SDS at 65° C., followed by one or more washes at 0.2×SSC, 1% SDS at 65° C. Very high stringency conditions 4) are suitable conditions and the ones that should be used unless otherwise specified.
- It is understood that the molecules described herein may have additional conservative or non-essential amino acid substitutions, which do not have a substantial effect on their functions.
- The term “amino acid” is intended to embrace all molecules, whether natural or synthetic, which include both an amino functionality and an acid functionality and capable of being included in a polymer of naturally-occurring amino acids. Exemplary amino acids include naturally-occurring amino acids; analogs, derivatives and congeners thereof; amino acid analogs having variant side chains; and all stereoisomers of any of any of the foregoing. As used herein the term “amino acid” includes both the D- or L-optical isomers and peptidomimetics.
- A “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- The terms “polypeptide,” “peptide” and “protein” (if single chain) are used interchangeably herein to refer to polymers of amino acids of any length. The polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids. The terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component. The polypeptide can be isolated from natural sources, can be a produced by recombinant techniques from a eukaryotic or prokaryotic host, or can be a product of synthetic procedures. In an embodiment, the polypeptide is an antibody molecule. In another embodiment, the polypeptide is a fusion protein.
- The terms “nucleic acid,” “nucleic acid sequence,” “nucleotide sequence,” or “polynucleotide sequence,” and “polynucleotide” are used interchangeably. They refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof. The polynucleotide may be either single-stranded or double-stranded, and if single-stranded may be the coding strand or non-coding (antisense) strand. A polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs. The sequence of nucleotides may be interrupted by non-nucleotide components. A polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component. The nucleic acid may be a recombinant polynucleotide, or a polynucleotide of genomic, cDNA, semisynthetic, or synthetic origin which either does not occur in nature or is linked to another polynucleotide in a non-natural arrangement.
- The term “isolated,” as used herein, refers to material that is removed from its original or native environment (e.g., the natural environment if it is naturally occurring). For example, a naturally-occurring polynucleotide or polypeptide present in a living animal is not isolated, but the same polynucleotide or polypeptide, separated by human intervention from some or all of the co-existing materials in the natural system, is isolated. Such polynucleotides could be part of a vector and/or such polynucleotides or polypeptides could be part of a composition, and still be isolated in that such vector or composition is not part of the environment in which it is found in nature.
- As used herein, the term “treat,” e.g., a disorder described herein, means that a subject (e.g., a human) who has a disorder, e.g., a disorder described herein, and/or experiences a symptom of a disorder, e.g., a disorder described herein, will, in an embodiment, suffer less a severe symptom and/or recover faster when an antibody molecule is administered than if the antibody molecule were never administered. Treatment can, e.g., partially or completely, alleviate, ameliorate, relieve, inhibit, or reduce the severity of, and/or reduce incidence, and optionally, delay onset of, one or more manifestations of the effects or symptoms, features, and/or causes of the disorder. In an embodiment, treatment is of a subject who does not exhibit certain signs of the disorder, and/or of a subject who exhibits only early signs of the disorder. In an embodiment, treatment is of a subject who exhibits one or more established signs of a disorder. In an embodiment, treatment is of a subject diagnosed as suffering from a disorder.
- As used herein, the term “prevent,” a disorder, means that a subject (e.g., a human) is less likely to have the disorder, if the subject receives a polypeptide (e.g., antibody molecule).
- Various aspects of the compositions and methods herein are described in further detail below. Additional definitions are set out throughout the specification.
- Disclosed herein are antibody molecules, e.g., antibody molecules comprising an Fc region, e.g. an Fc region having one or more mutations described herein, and/or having one or more structural or functional properties described herein.
- In an embodiment, the antibody molecule is engineered or derived from an antibody molecule (e.g., a parental antibody molecule) that contains an Fc region. For example, the engineered antibody molecule, or antibody molecule derivative, can have a different Fc region than the parental antibody molecule. In another embodiment, the antibody molecule is engineered or derived from an antibody molecule (e.g., a parental antibody molecule) that does not contain an Fc region. For example, the engineered antibody molecule, or antibody molecule derivative, can have an Fc region, directly or indirectly, fused to the parental antibody molecule or a functional fragment thereof.
- As used herein, the term “antibody molecule” refers to a protein, e.g., an immunoglobulin chain or a fragment thereof, comprising at least one immunoglobulin variable domain sequence. The term “antibody molecule” includes, for example, full-length, mature antibodies and antigen-binding fragments of an antibody. For example, an antibody molecule can include a heavy (H) chain variable domain sequence (abbreviated herein as VH), and a light (L) chain variable domain sequence (abbreviated herein as VL). In another example, an antibody molecule includes two heavy (H) chain variable domain sequences and two light (L) chain variable domain sequence, thereby forming two antigen binding sites, such as Fab, Fab′, F(ab′)2, Fc, Fd, Fd′, Fv, single chain antibodies (scFv for example), single variable domain antibodies, diabodies (Dab) (bivalent and bispecific), and chimeric (e.g., humanized) antibodies, which may be produced by the modification of whole antibodies or those synthesized de novo using recombinant DNA technologies. These functional antibody fragments retain the ability to selectively bind with their respective antigen or receptor. Antibodies and antibody fragments can be from any class of antibodies including, but not limited to, IgG, IgA, IgM, IgD, and IgE, and from any subclass (e.g., IgG1, IgG2, IgG3, and IgG4) of antibodies. The antibody molecules can be monoclonal or polyclonal. The antibody molecule can also be a human, humanized, CDR-grafted, or in vitro generated antibody. The antibody molecule can have a heavy chain constant region chosen from, e.g., IgG1, IgG2, IgG3, or IgG4. The antibody molecule can also have a light chain chosen from, e.g., kappa or lambda. The term “immunoglobulin” (Ig) is used interchangeably with the term “antibody” herein.
- Examples of antigen-binding fragments include: (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab′)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a diabody (dAb) fragment, which consists of a VH domain; (vi) a camelid or camelized variable domain; (vii) a single chain Fv (scFv), see e.g., Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883); (viii) a single domain antibody. These antibody fragments may be obtained using any suitable method, including several conventional techniques known to those with skill in the art, and the fragments can be screened for utility in the same manner as are intact antibodies.
- The term “antibody” includes intact molecules as well as functional fragments thereof. Constant regions of the antibodies can be altered, e.g., mutated, to modify the properties of the antibody (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, or complement function).
- The antibody molecule can be a single chain antibody. A single-chain antibody (scFV) may be engineered (see, for example, Colcher, D. et al. (1999) Ann N Y Acad Sci 880:263-80; and Reiter, Y. (1996) Clin Cancer Res 2:245-52). The single chain antibody can be dimerized or multimerized to generate multivalent antibodies having specificities for different epitopes of the same target protein.
- The antibody molecules disclosed herein can also be single domain antibodies. Single domain antibodies can include antibodies whose complementary determining regions are part of a single domain polypeptide. Examples include, but are not limited to, heavy chain antibodies, antibodies naturally devoid of light chains, single domain antibodies derived from conventional 4-chain antibodies, engineered antibodies and single domain scaffolds other than those derived from antibodies. Single domain antibodies may be any of the art, or any future single domain antibodies. Single domain antibodies may be derived from any species including, but not limited to mouse, human, camel, llama, fish, shark, goat, rabbit, and bovine. According to some aspects, a single domain antibody is a naturally occurring single domain antibody known as heavy chain antibody devoid of light chains. Such single domain antibodies are disclosed in WO 94/04678, for example. For clarity reasons, this variable domain derived from a heavy chain antibody naturally devoid of light chain is known herein as a VHH or nanobody to distinguish it from the conventional VH of four chain immunoglobulins. Such a VHH molecule can be derived from antibodies raised in Camelidae species, for example in camel, llama, dromedary, alpaca and guanaco. Other species besides Camelidae may produce heavy chain antibodies naturally devoid of light chain; such VHHs are also contemplated.
- The VH and VL regions can be subdivided into regions of hypervariability, termed “complementarity determining regions” (CDR), interspersed with regions that are more conserved, termed “framework regions” (FR or FW). The terms “complementarity determining region,” and “CDR,” as used herein refer to the sequences of amino acids within antibody variable regions which confer antigen specificity and binding affinity. As used herein, the terms “framework,” “FW” and “FR” are used interchangeably.
- The extent of the framework region and CDRs has been precisely defined by a number of methods (see, Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242; Chothia, C. et al. (1987) J. Mol. Biol. 196:901-917; and the AbM definition used by Oxford Molecular's AbM antibody modeling software. See, generally, e.g., Protein Sequence and Structure Analysis of Antibody Variable Domains. In: Antibody Engineering Lab Manual (Ed.: Duebel, S. and Kontermann, R., Springer-Verlag, Heidelberg). In an embodiment, the following definitions are used: AbM definition of CDR1 of the heavy chain variable domain and Kabat definitions for the other CDRs. In an embodiment, Kabat definitions are used for all CDRs. In addition, embodiments described with respect to Kabat or AbM CDRs may also be implemented using Chothia hypervariable loops. Each VH and VL typically includes three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4.
- As used herein, an “immunoglobulin variable domain sequence” refers to an amino acid sequence which can form the structure of an immunoglobulin variable domain. For example, the sequence may include all or part of the amino acid sequence of a naturally-occurring variable domain. For example, the sequence may or may not include one, two, or more N- or C-terminal amino acids, or may include other alterations that are compatible with formation of the protein structure.
- The term “antigen-binding region” refers to the part of an antibody molecule that comprises determinants that form an interface that binds to an antigen, or an epitope thereof. With respect to proteins (or protein mimetics), the antigen-binding region typically includes one or more loops (of at least, e.g., four amino acids or amino acid mimics) that form an interface that binds to the antigen. Typically, the antigen-binding region of an antibody molecule includes at least one or two CDRs and/or hypervariable loops, or more typically at least three, four, five or six CDRs and/or hypervariable loops.
- The terms “compete” or “cross-compete” are used interchangeably herein to refer to the ability of an antibody molecule to interfere with binding of another antibody molecule, to a target. The interference with binding can be direct or indirect (e.g., through an allosteric modulation of the antibody molecule or the target). The extent to which an antibody molecule is able to interfere with the binding of another antibody molecule to the target, and therefore whether it can be said to compete, can be determined using a competition binding assay, for example, a FACS assay, an ELISA or BIACORE assay. In an embodiment, a competition binding assay is a quantitative competition assay. In an embodiment, a first antibody molecule is said to compete for binding to the target with a second antibody molecule when the binding of the first antibody molecule to the target is reduced by 10% or more, e.g., 20% or more, 30% or more, 40% or more, 50% or more, 55% or more, 60% or more, 65% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 98% or more, 99% or more in a competition binding assay (e.g., a competition assay described herein).
- The terms “monoclonal antibody” or “monoclonal antibody composition” as used herein refer to a preparation of antibody molecules of single molecular composition. A monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope. A monoclonal antibody can be made by hybridoma technology or by methods that do not use hybridoma technology (e.g., recombinant methods).
- An “effectively human” protein is a protein that does not evoke a neutralizing antibody response, e.g., the human anti-murine antibody (HAMA) response. HAMA can be problematic in a number of circumstances, e.g., if the antibody molecule is administered repeatedly, e.g., in treatment of a chronic or recurrent disease condition. A HAMA response can make repeated antibody administration potentially ineffective because of an increased antibody clearance from the serum (see, e.g., Saleh et al., Cancer Immunol. Immunother. 32:180-190 (1990)) and also because of potential allergic reactions (see, e.g., LoBuglio et al., Hybridoma, 5:5117-5123 (1986)).
- The antibody molecule can be a polyclonal or a monoclonal antibody. In some embodiments, the antibody can be recombinantly produced, e.g., produced by any suitable phage display or combinatorial methods.
- Various phage display and combinatorial methods for generating antibodies are known in the art (as described in, e.g., Ladner et al. U.S. Pat. No. 5,223,409; Kang et al. International Publication No. WO 92/18619; Dower et al. International Publication No. WO 91/17271; Winter et al. International Publication WO 92/20791; Markland et al. International Publication No. WO 92/15679; Breitling et al. International Publication WO 93/01288; McCafferty et al. International Publication No. WO 92/01047; Garrard et al. International Publication No. WO 92/09690; Ladner et al. International Publication No. WO 90/02809; Fuchs et al. (1991) Bio/Technology 9:1370-1372; Hay et al. (1992) Hum Antibod Hybridomas 3:81-85; Huse et al. (1989) Science 246:1275-1281; Griffths et al. (1993) EMBO J 12:725-734; Hawkins et al. (1992) J Mol Biol 226:889-896; Clackson et al. (1991) Nature 352:624-628; Gram et al. (1992) PNAS 89:3576-3580; Garrad et al. (1991) Bio/Technology 9:1373-1377; Hoogenboom et al. (1991) Nuc Acid Res 19:4133-4137; and Barbas et al. (1991) PNAS 88:7978-7982, the contents of all of which are incorporated by reference herein).
- In an embodiment, the antibody molecule is a fully human antibody (e.g., an antibody made in a mouse which has been genetically engineered to produce an antibody from a human immunoglobulin sequence), or a non-human antibody, e.g., a rodent (mouse or rat), goat, primate (e.g., monkey), camel antibody. In an embodiment, the non-human antibody is a rodent (mouse or rat antibody). Methods of producing rodent antibodies are known in the art.
- Human monoclonal antibodies can be generated using transgenic mice carrying the human immunoglobulin genes rather than the mouse system. Splenocytes from these transgenic mice immunized with the antigen of interest are used to produce hybridomas that secrete human mAbs with specific affinities for epitopes from a human protein (see e.g., Wood et al. International Application WO 91/00906, Kucherlapati et al. PCT publication WO 91/10741; Lonberg et al. International Application WO 92/03918; Kay et al. International Application 92/03917; Lonberg et al. 1994 Nature 368:856-859; Green, L. L. et al. 1994 Nature Genet. 7:13-21; Morrison, S. L. et al. 1994 Proc. Natl. Acad. Sci. USA 81:6851-6855; Bruggeman et al. 1993 Year Immunol 7:33-40; Tuaillon et al. 1993 PNAS 90:3720-3724; Bruggeman et al. 1991 Eur J Immunol 21:1323-1326).
- An antibody can be one in which the variable region, or a portion thereof, e.g., the CDRs, are generated in a non-human organism, e.g., a rat or mouse. Chimeric, CDR-grafted, and humanized antibodies are within the invention. Antibodies generated in a non-human organism, e.g., a rat or mouse, and then modified, e.g., in the variable framework or constant region, to decrease antigenicity in a human are within the invention.
- Chimeric antibodies can be produced by any suitable recombinant DNA technique. Several are known in the art (see Robinson et al., International Patent Publication PCT/US86/02269; Akira, et al., European Patent Application 184,187; Taniguchi, M., European Patent Application 171,496; Morrison et al., European Patent Application 173,494; Neuberger et al., International Application WO 86/01533; Cabilly et al. U.S. Pat. No. 4,816,567; Cabilly et al., European Patent Application 125,023; Better et al. (1988 Science 240:1041-1043); Liu et al. (1987) PNAS 84:3439-3443; Liu et al., 1987, J. Immunol. 139:3521-3526; Sun et al. (1987) PNAS 84:214-218; Nishimura et al., 1987, Canc. Res. 47:999-1005; Wood et al. (1985) Nature 314:446-449; and Shaw et al., 1988, J. Natl Cancer Inst. 80:1553-1559).
- A humanized or CDR-grafted antibody will have at least one or two but generally all three recipient CDRs (of heavy and or light immunoglobulin chains) replaced with a donor CDR. The antibody may be replaced with at least a portion of a non-human CDR or only some of the CDRs may be replaced with non-human CDRs. It is only necessary to replace the number of CDRs required for binding of the humanized antibody to lipopolysaccharide. In an embodiment, the donor will be a rodent antibody, e.g., a rat or mouse antibody, and the recipient will be a human framework or a human consensus framework. Typically, the immunoglobulin providing the CDRs is called the “donor” and the immunoglobulin providing the framework is called the “acceptor.” In some embodiments, the donor immunoglobulin is a non-human (e.g., rodent). The acceptor framework is typically a naturally-occurring (e.g., a human) framework or a consensus framework, or a sequence about 85% or higher, e.g., 90%, 95%, 99% or higher identical thereto.
- As used herein, the term “consensus sequence” refers to the sequence formed from the most frequently occurring amino acids (or nucleotides) in a family of related sequences (See e.g., Winnaker, From Genes to Clones (Verlagsgesellschaft, Weinheim, Germany 1987). In a family of proteins, each position in the consensus sequence is occupied by the amino acid occurring most frequently at that position in the family. If two amino acids occur equally frequently, either can be included in the consensus sequence. A “consensus framework” refers to the framework region in the consensus immunoglobulin sequence.
- An antibody can be humanized by any suitable method, and several such methods known in the art (see e.g., Morrison, S. L., 1985, Science 229:1202-1207, by Oi et al., 1986, BioTechniques 4:214, and by Queen et al. U.S. Pat. Nos. 5,585,089, 5,693,761 and 5,693,762, the contents of all of which are hereby incorporated by reference).
- Humanized or CDR-grafted antibodies can be produced by CDR-grafting or CDR substitution, wherein one, two, or all CDRs of an immunoglobulin chain can be replaced. See e.g., U.S. Pat. No. 5,225,539; Jones et al. 1986 Nature 321:552-525; Verhoeyan et al. 1988 Science 239:1534; Beidler et al. 1988 J. Immunol. 141:4053-4060; Winter U.S. Pat. No. 5,225,539, the contents of all of which are hereby expressly incorporated by reference. Winter describes a CDR-grafting method which may be used to prepare humanized antibodies (UK Patent Application GB 2188638A, filed on Mar. 26, 1987; Winter U.S. Pat. No. 5,225,539), the contents of which is expressly incorporated by reference.
- Also provided are humanized antibodies in which specific amino acids have been substituted, deleted or added. Criteria for selecting amino acids from the donor are described in, e.g., U.S. Pat. No. 5,585,089, e.g., columns 12-16 of U.S. Pat. No. 5,585,089, the contents of which are hereby incorporated by reference. Other techniques for humanizing antibodies are described in Padlan et al. EP 519596 A1, published on Dec. 23, 1992.
- In an embodiment, the antibody molecule has a heavy chain constant region chosen from, e.g., the heavy chain constant regions of IgG1, IgG2 (e.g., IgG2a), IgG3, IgG4, IgM, IgA1, IgA2, IgD, and IgE; particularly, chosen from, e.g., the (e.g., human) heavy chain constant regions of IgG1, IgG2, IgG3, and IgG4. In another embodiment, the antibody molecule has a light chain constant region chosen from, e.g., the (e.g., human) light chain constant regions of kappa or lambda. The constant region can be altered, e.g., mutated, to modify the properties of the antibody molecule (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, and/or complement function). In an embodiment, the antibody molecule has effector function and can fix complement. In another embodiment, the antibody molecule does not recruit effector cells or fix complement. In certain embodiments, the antibody molecule has reduced or no ability to bind an Fc receptor. For example, it may be an isotype or subtype, fragment or other mutant, which does not support binding to an Fc receptor, e.g., it has a mutagenized or deleted Fc receptor binding region.
- In an embodiment, a constant region of the antibody molecule is altered. Methods for altering an antibody constant region are known in the art. Antibody molecules s with altered function, e.g. altered affinity for an effector ligand, such as FcR on a cell, or the C1 component of complement can be produced by replacing at least one amino acid residue in the constant portion of the antibody with a different residue (see e.g., EP 388,151 A1, U.S. Pat. Nos. 5,624,821 and 5,648,260, the contents of all of which are hereby incorporated by reference) Amino acid mutations which stabilize antibody structure, such as S228P (EU nomenclature, S241P in Kabat nomenclature) in human IgG4 are also contemplated. Similar type of alterations could be described which if applied to the murine, or other species immunoglobulin would reduce or eliminate these functions.
- In an embodiment, the only amino acids in the antibody molecule are canonical amino acids. In an embodiment, the antibody molecule comprises naturally-occurring amino acids; analogs, derivatives and congeners thereof; amino acid analogs having variant side chains; and/or all stereoisomers of any of any of the foregoing. The antibody molecule may comprise the D- or L-optical isomers of amino acids and peptidomimetics.
- A polypeptide of an antibody molecule described herein may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids. The antibody molecule may also be modified; for example, by disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component. The polypeptide can be isolated from natural sources, can be a produced by recombinant techniques from a eukaryotic or prokaryotic host, or can be a product of synthetic procedures.
- The antibody molecule described herein can be used alone in unconjugated form, or can be bound to a substance, e.g., a toxin or moiety (e.g., a therapeutic drug; a compound emitting radiation; molecules of plant, fungal, or bacterial origin; or a biological protein (e.g., a protein toxin) or particle (e.g., a recombinant viral particle, e.g., via a viral coat protein). For example, the antibody molecule can be coupled to a radioactive isotope such as an α-, β-, or γ-emitter, or a β- and γ-emitter.
- An antibody molecule can be derivatized or linked to another functional molecule (e.g., another peptide or protein). As used herein, a “derivatized” antibody molecule is one that has been modified. Methods of derivatization include but are not limited to the addition of a fluorescent moiety, a radionucleotide, a toxin, an enzyme or an affinity ligand such as biotin. Accordingly, the antibody molecules are intended to include derivatized and otherwise modified forms of the antibodies described herein, including immunoadhesion molecules. For example, an antibody molecule can be functionally linked (by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other molecular entities, such as another antibody (e.g., a bispecific antibody or a diabody), a detectable agent, a toxin, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
- Some types of derivatized antibody molecule are produced by crosslinking two or more antibodies (of the same type or of different types, e.g., to create bispecific antibodies). Suitable crosslinkers include those that are heterobifunctional, having two distinctly reactive groups separated by an appropriate spacer (e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester) or homobifunctional (e.g., disuccinimidyl suberate). Such linkers are available from Pierce Chemical Company, Rockford, Ill.
- Useful detectable agents with which an anti-dengue antibody molecule may be derivatized (or labeled) to include fluorescent compounds, various enzymes, prosthetic groups, luminescent materials, bioluminescent materials, fluorescent emitting metal atoms, e.g., europium (Eu), and other anthanides, and radioactive materials (described below). Exemplary fluorescent detectable agents include fluorescein, fluorescein isothiocyanate, rhodamine, 5dimethylamine-1-napthalenesulfonyl chloride, phycoerythrin and the like. An antibody may also be derivatized with detectable enzymes, such as alkaline phosphatase, horseradish peroxidase, β-galactosidase, acetylcholinesterase, glucose oxidase and the like. When an antibody is derivatized with a detectable enzyme, it is detected by adding additional reagents that the enzyme uses to produce a detectable reaction product. For example, when the detectable agent horseradish peroxidase is present, the addition of hydrogen peroxide and diaminobenzidine leads to a colored reaction product, which is detectable. An antibody molecule may also be derivatized with a prosthetic group (e.g., streptavidin/biotin and avidin/biotin). For example, an antibody may be derivatized with biotin, and detected through indirect measurement of avidin or streptavidin binding. Examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material includes luminol; and examples of bioluminescent materials include luciferase, luciferin, and aequorin.
- Labeled antibody molecules can be used, for example, diagnostically and/or experimentally in a number of contexts, including (i) to isolate a predetermined antigen by standard techniques, such as affinity chromatography or immunoprecipitation; (ii) to detect a predetermined antigen (e.g., in a cellular lysate or cell supernatant) in order to evaluate the abundance and pattern of expression of the protein; (iii) to monitor protein levels in tissue as part of a clinical testing procedure, e.g., to determine the efficacy of a given treatment regimen.
- An antibody molecule may be conjugated to another molecular entity, typically a label or a therapeutic (e.g., antimicrobial (e.g., antibacterial or bactericidal), immunomodulatory, immunostimularoty, cytotoxic, or cytostatic) agent or moiety. Radioactive isotopes can be used in diagnostic or therapeutic applications. Radioactive isotopes that can be coupled to the antibody molecules include, but are not limited to α, β-, or γ-emitters, or β- and γ-emitters. Such radioactive isotopes include, but are not limited to iodine (131I or 125I), yttrium (90Y), lutetium (177Lu), actinium (225Ac), praseodymium, astatine (211At), rhenium (186Re), bismuth (212Bi or 213Bi), indium (111In), technetium (99mTc), phosphorus (32P), rhodium (188Rh), sulfur (35S), carbon (14C), tritium (3H), chromium (51Cr), chlorine (36Cl), cobalt (57Co or 58Co), iron (59Fe), selenium (75Se), or gallium (67Ga). Radioisotopes useful as therapeutic agents include yttrium (90Y), lutetium (177Lu), actinium (225Ac), praseodymium, astatine (211At), At) rhenium (186Re), bismuth (212Bi or 213Bi), and rhodium (188Rh). Radioisotopes useful as labels, e.g., for use in diagnostics, include iodine (131I or 125I), indium (111In), technetium (99mTc), phosphorus (32P), carbon (14C), and tritium (3H), or one or more of the therapeutic isotopes listed above.
- The present disclosure provides radiolabeled antibody molecules and methods of labeling the same. In an embodiment, a method of labeling an antibody molecule is disclosed. The method includes contacting an antibody molecule, with a chelating agent, to thereby produce a conjugated antibody. The conjugated antibody is radiolabeled with a radioisotope, e.g., 111Indium, 90Yttrium and 177Lutetium, to thereby produce a labeled antibody molecule.
- In some aspects, this disclosure provides a method of making an antibody molecule disclosed herein. The method includes: providing an antigen, or a fragment thereof; obtaining an antibody molecule that specifically binds to the antigen; evaluating efficacy of the antibody molecule in modulating activity of the antigen and/or organism expressing the antigen. The method can further include administering the antibody molecule, including a derivative thereof (e.g., a humanized antibody molecule) to a subject, e.g., a human.
- This disclosure provides an isolated nucleic acid molecule encoding the above antibody molecule, vectors and host cells thereof. The nucleic acid molecule includes, but is not limited to, RNA, genomic DNA and cDNA.
- Disclosed herein are fusion proteins, e.g., fusion proteins comprising an Fc region, e.g. an Fc region having one or more mutations described herein, and/or having one or more structural or functional properties described herein.
- In an embodiment, the fusion protein is engineered or derived from a polypeptide (e.g., a fusion protein) that contains an Fc region (e.g., a parental polypeptide). For example, the engineered polypeptide, or derivative, can have a different Fc region than the parental polypeptide. In another embodiment, the fusion protein is engineered or derived from a polypeptide that does not contain an Fc region (e.g., a parental polypeptide). For example, the engineered antibody molecule, or antibody molecule derivative, can have an Fc region, directly or indirectly, fused to the parental polypeptide.
- As used herein, the term “fusion protein” refers to a protein, comprising two or more protein or peptide components. The two or more protein or peptide components can be obtained from different sources or encoded by different genes. A fusion protein is sometimes also referred to as a chimeric protein. An Fc-fusion protein (also known as Fc chimeric fusion protein, Fc-Ig, Ig-based chimeric fusion protein, or Fc-tag protein) can include an Fc region of an immunoglobulin (e.g., an Fc region described herein) linked (e.g., fused) to a protein or peptide. The Fc region can be linked (e.g., fused genetically) to the protein or peptide directly, or indirectly, e.g., through a linker. In an embodiment, the Fc region is derived from the Fc region of IgG, e.g., human IgG, e.g., IgG1, IgG2, IgG3, or IgG4. In an embodiment, the Fc region is derived from the Fc region of IgG1, e.g., human IgG1.
- The Fc-fused binding partner can include a variety of proteins or peptides, or fragments thereof. For example, the Fc region can be fused to a peptide (e.g., a therapeutic peptide), a ligand (e.g., a ligand that activates upon binding with a cell surface receptor), a signaling molecule, the extracellular domain of a receptor, or a bait protein (e.g., used to identify a binding partner, e.g., in a protein microarray).
- In an embodiment, the Fc fusion protein comprises an extracellular domain of a receptor or a soluble receptor, or a ligand binding portion thereof. In an embodiment, the receptor is a growth factor receptor. In an embodiment, the receptor is a cytokine receptor. In an embodiment, the receptor is an immune checkpoint molecule.
- In an embodiment, the fusion protein comprises a vascular endothelia growth factor (VEGF)-binding portion from the extracellular domain of
human VEGF receptors - In another embodiment, the fusion protein comprises a soluble tumor necrosis factor (TNF)
receptor 2 fused to the Fc region of the human IgG1. In an embodiment, the fusion protein is etanercept. In an embodiment, the Fc fusion protein (e.g., etanercept) is used to treat a disorder described herein, e.g., an autoimmune disorder (e.g., rheumatoid arthritis). - In yet another embodiment, the fusion protein comprises ligand-binding domains of the extracellular portions of human interleukin-1 receptor 1 (IL-1R1) and IL-1 receptor accessory protein (IL-1RAcP) fused to the Fc region of human IgG1. In an embodiment, the fusion protein is rilonacept. In an embodiment, the fusion protein (e.g., rilonacept) is used to treat a disorder described herein, e.g., a cryopyrin-associated periodic syndrome (CAPS), e.g., familial cold autoinflammatory syndrome, Muckle-Wells syndrome, or a neonatal onset multisystem inflammatory disease.
- In still another embodiment, the fusion protein comprises the extracellular domain of CTLA-4 fused to the Fc region of human IgG1. In an embodiment, the fusion protein is abatacept or belatacept. In an embodiment, the fusion protein (e.g., abatacept or belatacept) is used to treat a disorder described herein, e.g., an organ rejection, an autoimmune disorder (e.g., rheumatoid arthritis), or a cancer.
- In an embodiment, the Fc fusion protein comprises a peptide, e.g., a therapeutic peptide.
- In an embodiment, the fusion protein comprises a thrombopoietin-binding peptide fused to the Fc region of human IgG1. In an embodiment, the fusion protein is romiplostim. In an embodiment, the fusion protein (e.g., romiplostim) is used to treat a disorder described herein, e.g., chronic idiopathic (immune) thrombocytopenic purpura (ITP).
- In an embodiment, the fusion protein comprises the extracellular CD2-binding portion of the human leukocyte function antigen-3 (LFA-3) fused to the Fc region of human IgG1. In an embodiment, the fusion protein is alefacept. In an embodiment, the fusion protein (e.g., alefacept) is used to treat a disorder described herein, e.g., an autoimmune disorder (e.g., psoriasis) or a cancer (e.g., a cutaneous T-cell lymphoma or a T-cell non-Hodgkin lymphoma).
- In an embodiment, the fusion protein comprises a coagulation factor.
- In an embodiment, the fusion protein comprises Factor IX fused with the Fc region of IgG1. In another embodiment, the fusion protein comprises Factor VIII fused with the Fc region of IgG1. In an embodiment the fusion protein (e.g., the FIX-Fc fusion or FVIII-Fc fusion) is used to treat a disorder described herein, e.g., hemophilia A or hemophilia B.
- In an embodiment, the fusion protein comprises one or more glycosylation sites, or is glycosylated. In another embodiment, the fusion protein does not have a glycosylation site, or is not glycosylated.
- In an embodiment, the only amino acids in the fusion protein are canonical amino acids. In an embodiment, the fusion protein comprises naturally-occurring amino acids; analogs, derivatives and congeners thereof; amino acid analogs having variant side chains; and/or all stereoisomers of any of any of the foregoing. The fusion protein may comprise the D- or L-optical isomers of amino acids and peptidomimetics.
- In an aspect, this disclosure provides a method of making a fusion protein disclosed herein. The fusion proteins described herein can be produced by any suitable recombinant DNA technique. In an embodiment, the method includes culturing a cell containing a nucleic acid encoding the fusion protein under conditions that allow production of the fusion protein. In another embodiment, the method further includes isolating or purifying the fusion protein. In yet another embodiment, the method further includes evaluating efficacy of the fusion protein in a cell-based assay or in an animal model. In still another embodiment, the method further includes administering the fusion protein to a subject, e.g., a human.
- This disclosure provides an isolated nucleic acid molecule encoding the above fusion proteins, vectors and host cells thereof. The nucleic acid molecule includes, but is not limited to, RNA, genomic DNA and cDNA.
- A fragment crystallizable region, or Fc region, refers to a region of an immunoglobulin that is capable of interacting with an Fc receptor. In an embodiment, the Fc region is also capable of interacting with a protein of the complement system. While without wishing to be bound by theory, it is believed that in an embodiment, the interaction between the Fc region with an Fc receptor, allows for activation of the immune system.
- In IgG, IgA and IgD antibody isotypes, the naturally-occurring Fc region generally comprises two identical protein fragments, derived from the second and third constant domains of the antibody's two heavy chains. Naturally-occurring IgM and IgE Fc regions generally comprise three heavy chain constant domains (CH domains 2-4) in each polypeptide chain. The Fc regions of IgGs can contain a highly conserved N-glycosylation site (Stadlmann et al. (2008). Proteomics 8 (14): 2858-2871; Stadlmann (2009) Proteomics 9 (17): 4143-4153). While not wishing to be bound by theory, it is believed that in an embodiment, glycosylation of the Fc fragment contributes to Fc receptor-mediated activities (Peipp et al. (2008) Blood 112 (6): 2390-2399). In an embodiment, the N-glycans attached to this site are predominantly core-fucosylated diantennary structures of the complex type. In another embodiment, small amounts of these N-glycans also contain bisecting GlcNAc and/or α-2,6 linked sialic acid residues.
- An exemplary Fc region amino acid sequence is shown below.
-
(SEQ ID NO: 1) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVL H QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEAL H N H YTQKSLSLSPGK - In SEQ ID NO: 1, the first amino acid residue in this sequence is referred to as position 118 herein. The three Histidines in bold and underlined are positions 310, 433 and 435, respectively.
- A polypeptide (e.g., an antibody molecule or fusion protein) described herein can have one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or more) of mutations or combinations of mutations described in Table 1.
-
TABLE 1 Exemplary Fc mutations Name Mutation FcMut001 I253M FcMut002 L309H_D312A_N315D FcMut003 L309N FcMut004 M252E_S254R FcMut005 M252E_S254R_R255Y FcMut006 S254H FcMut007 S254M FcMut008 T256D_T307R FcMut009 T256L_N286I_T307I FcMut010 T256I_N286I_T307I FcMut011 K248S_D376Q FcMut012 K248S_D376N FcMut013 D376Q_E380A FcMut014 D376N_E380A FcMut015 D376Q_M428L FcMut016 K248S_A378I FcMut017 L314K FcMut018 T250Q_M428L FcMut019 M428L_N434A FcMut020 N434A FcMut021 T307A_E380A_N434A FcMut022 M252W FcMut023 V308F FcMut024 V308F_N434Y FcMut026 T256D_T307R_D376N FcMut027 L309R_D312E FcMut028 L309R_Q311P_D312E FcMut029 K246N_P247A FcMut030 K246N_P247A_D376N FcMut031 T256E_T307R FcMut032 T256R_T307D FcMut033 T256R_T307E FcMut034 Q311P FcMut035 D376Q FcMut036 L234A_L235A FcMut037 L235V_G236A FcMut038 L234P_L235P FcMut039 L235P FcMut040 P329G FcMut041 P329E FcMut042 E233K FcMut043 T256D_N286D_A287S_T307R FcMut044 T256D_P257L_T307R FcMut045 T256D_T307R_Q311V FcMut046 P247D_T256D_T307R FcMut047 P247D_N286D_A287S_Q311V FcMut048 P257M_V308N FcMut049 V279I_Q311L_N315T FcMut050 M428L_N434S FcMut051 N434S FcMut052 H433G_N434P FcMut053 V259I_V308F_M428L FcMut067 T256D_N286D_T307R FcMut068 T256D_N286E_T307R FcMut069 T256D_N286Q_T307R FcMut070 T256D_P257T_T307R FcMut071 T256D_P257V_T307R FcMut072 T256D_T307R_Q311I FcMut073 T256D_T307R_Q311L FcMut074 T256D_T307R_Q311M FcMut075 T256D_P257L_N286D_T307R_Q311V FcMut076 T256D_T307R_M428L FcMut077 M428L FcMut078 M252Y_S254T_T256Q FcMut079 M252Y_S254T_T256E_K288E FcMut080 T256K_K288E FcMut081 T256D_E258T FcMut082 E283Q_H285E FcMut083 R344D_D401R FcMut084 K248E_E380K FcMut085 K248E_E380R FcMut086 K246H FcMut087 K248H FcMut088 T250I FcMut089 T250V FcMut090 L251F FcMut091 L251M FcMut093 P257V FcMut094 N276D FcMut095 H285N FcMut096 H285D FcMut097 K288H FcMut098 K288Q FcMut099 K288E FcMut100 T307E FcMut101 T307Q FcMut102 V308P FcMut103 V308I FcMut104 V308L FcMut105 L309H FcMut106 L309M FcMut107 Q311H FcMut108 L314F FcMut109 Y319H FcMut110 I336T FcMut111 P343D FcMut112 P343V FcMut113 E345Q FcMut114 P346V FcMut115 P374T FcMut116 D376N FcMut117 A378S FcMut118 A431T FcMut119 A431P FcMut120 A431G FcMut121 L432V FcMut122 L432I FcMut123 L432Q FcMut124 N434T FcMut125 H435N FcMut126 Y436H FcMut127 K439Q FcMut128 T256D FcMut129 T307R FcMut130 A378T FcMut131 A378D FcMut132 A378H FcMut133 A378Y FcMut134 A378V FcMut135 D376R FcMut136 D376F FcMut137 D376W FcMut138 L314H FcMut139 L432E_T437Q FcMut140 D376Q_A378T FcMut141 D376Q_I377M_A378T FcMut142 P244Q_D376Q FcMut143 P247T_A378T FcMut144 P247N_A378T FcMut145 T256D_T307R_L309T FcMut146 A339T_S375E_F404Y FcMut147 L235V_G236A_T256D_T307R FcMut148 L235V_G236A_D376Q_M428L FcMut149 L314N FcMut150 N315D FcMut151 A378T FcMut152 T437Q FcMut153 L432E FcMut154 Y436R FcMut155 L314M FcMut156 L234A_L235A_T256D_T307R_Q311V FcMut157 L234A_L235A_T256D_P257V_T307R FcMut158 L234A_L235A_T256D_P257L_N286D_T307R_Q311V FcMut159 L235V_G236A_T256D_T307R_Q311V FcMut160 L235V_G236A_T256D_P257V_T307R FcMut161 L235V_G236A_T256D_P257L_N286D_T307R_Q311V FcMut162 S267T_A327N_A330M FcMut163 S267T_A327N FcMut164 E235V_G236A_S267T_A327N_A330M FcMut165 F235V_G236A_S267T_A327N FcMut166 M252Y_S254T FcMut167 T256E FcMut168 G236A_I332E FcMut169 S239D_I332E FcMut170 G236A_S239D_I332E FcMut171 T256D_N286D_T307R_Q311V FcMut172 T256D_E258T_T307R FcMut173 T256D_E258T_T307R_Q311V FcMut174 T256D_P257V_E258T_T307R FcMut175 T256D_P257L_E258T_N286D_T307R_Q311V FcMut176 T256D_E258T_N286D_T307R_Q311V FcMut177 A378V_M428L FcMut178 A378V_M428I FcMut179 A378V_M428V FcMut180 T256D_N286D FcMut181 T256D_A378V FcMut182 T256D_Q311V FcMut183 T256D_Q311V_A378V FcMut184 T256D_T307R_A378V FcMut185 T256D_N286D_T307R_A378V FcMut186 T256D_T307R_Q311V_A378V FcMut187 H285D_A378V FcMut188 H285D_Q311V FcMut189 T256D_H285D FcMut190 T256D_H285D_Q311V FcMut191 T256D_H285D_T307R FcMut192 T256D_H285D_T307R_A378V FcMut193 H285D_L314M_A378V FcMut194 T256D_E258T_H285D_Q311H FcMut195 T256D_E258T_H285D FcMut196 H285D_N315D FcMut197 H285N_T307Q_N315D FcMut198 H285D_L432E_T437Q FcMut199 T256D_E258T_N315D FcMut200 P257V_H285N FcMut201 H285N_L432F FcMut202 H285N_T437I FcMut203 T256D_E258T_L314M FcMut204 T256D_E258T_T307Q FcMut205 T256D_E258T_A378V FcMut206 V308P_A378V FcMut207 P257V_A378T FcMut208 P257V_V308P_A378V FcMut209 N315D_A378T FcMut210 H285N_L314M FcMut211 L314M_L432E_T437Q FcMut212 T307Q_N315D FcMut213 H285D_T307Q_A378V FcMut214 L314M_N315D FcMut215 T307Q_Q311V_A378V FcMut216 H285D_Q311V_A378V FcMut217 Q311V_N315D_A378V FcMut218 T256D_E258T_Q311V FcMut219 T256D_N315D_A378V FcMut220 T256D_Q311V_N315D FcMut221 T256D_T307Q_A378V FcMut222 T256D_T307Q_Q311V FcMut223 T256D_H285D_A378V FcMut224 T256D_H285D_T307R_Q311V FcMut225 T256D_H285D_N286D_T307R FcMut226 T256D_H285D_N286D_T307R_Q311V FcMut227 T256D_H285D_N286D_T307R_A378V FcMut228 T256D_N286D_T307R_Q311V_A378V FcMut229 T256D_H285D_T307R_Q311V_A378V FcMut230 V308P_Q311V_A378V FcMut231 T256D_V308P_A378V FcMut232 T256D_V308P_Q311V FcMut233 T256D_E258T_V308P FcMut234 H285D_V308P_Q311V FcMut242 E258T FcMut243 N286D FcMut244 Q311V YTE M252Y_S254T_T256E - In an embodiment, the Fc region comprises FcMut001. In an embodiment, the Fc region comprises FcMut002. In an embodiment, the Fc region comprises FcMut003. In an embodiment, the Fc region comprises FcMut004. In an embodiment, the Fc region comprises FcMut005. In an embodiment, the Fc region comprises FcMut006. In an embodiment, the Fc region comprises FcMut007. In an embodiment, the Fc region comprises FcMut008. In an embodiment, the Fc region comprises FcMut009. In an embodiment, the Fc region comprises FcMut010. In an embodiment, the Fc region comprises FcMut011. In an embodiment, the Fc region comprises FcMut012. In an embodiment, the Fc region comprises FcMut013. In an embodiment, the Fc region comprises FcMut014. In an embodiment, the Fc region comprises FcMut015. In an embodiment, the Fc region comprises FcMut016. In an embodiment, the Fc region comprises FcMut017. In an embodiment, the Fc region comprises FcMut018. In an embodiment, the Fc region comprises FcMut019. In an embodiment, the Fc region comprises FcMut020. In an embodiment, the Fc region comprises FcMut021. In an embodiment, the Fc region comprises FcMut022. In an embodiment, the Fc region comprises FcMut023. In an embodiment, the Fc region comprises FcMut024. In an embodiment, the Fc region comprises FcMut026. In an embodiment, the Fc region comprises FcMut027. In an embodiment, the Fc region comprises FcMut028. In an embodiment, the Fc region comprises FcMut029. In an embodiment, the Fc region comprises FcMut030. In an embodiment, the Fc region comprises FcMut031. In an embodiment, the Fc region comprises FcMut032. In an embodiment, the Fc region comprises FcMut033. In an embodiment, the Fc region comprises FcMut034. In an embodiment, the Fc region comprises FcMut035. In an embodiment, the Fc region comprises FcMut036. In an embodiment, the Fc region comprises FcMut037. In an embodiment, the Fc region comprises FcMut038. In an embodiment, the Fc region comprises FcMut039. In an embodiment, the Fc region comprises FcMut040. In an embodiment, the Fc region comprises FcMut041. In an embodiment, the Fc region comprises FcMut042. In an embodiment, the Fc region comprises FcMut043. In an embodiment, the Fc region comprises FcMut044. In an embodiment, the Fc region comprises FcMut045. In an embodiment, the Fc region comprises FcMut046. In an embodiment, the Fc region comprises FcMut047. In an embodiment, the Fc region comprises FcMut048. In an embodiment, the Fc region comprises FcMut049. In an embodiment, the Fc region comprises FcMut050. In an embodiment, the Fc region comprises FcMut051. In an embodiment, the Fc region comprises FcMut052. In an embodiment, the Fc region comprises FcMut053. In an embodiment, the Fc region comprises FcMut067. In an embodiment, the Fc region comprises FcMut068. In an embodiment, the Fc region comprises FcMut069. In an embodiment, the Fc region comprises FcMut070. In an embodiment, the Fc region comprises FcMut071. In an embodiment, the Fc region comprises FcMut072. In an embodiment, the Fc region comprises FcMut073. In an embodiment, the Fc region comprises FcMut074. In an embodiment, the Fc region comprises FcMut075. In an embodiment, the Fc region comprises FcMut076. In an embodiment, the Fc region comprises FcMut077. In an embodiment, the Fc region comprises FcMut078. In an embodiment, the Fc region comprises FcMut079. In an embodiment, the Fc region comprises FcMut080. In an embodiment, the Fc region comprises FcMut081. In an embodiment, the Fc region comprises FcMut082. In an embodiment, the Fc region comprises FcMut083. In an embodiment, the Fc region comprises FcMut084. In an embodiment, the Fc region comprises FcMut085. In an embodiment, the Fc region comprises FcMut086. In an embodiment, the Fc region comprises FcMut087. In an embodiment, the Fc region comprises FcMut088. In an embodiment, the Fc region comprises FcMut089. In an embodiment, the Fc region comprises FcMut090. In an embodiment, the Fc region comprises FcMut091. In an embodiment, the Fc region comprises FcMut093. In an embodiment, the Fc region comprises FcMut094. In an embodiment, the Fc region comprises FcMut095. In an embodiment, the Fc region comprises FcMut096. In an embodiment, the Fc region comprises FcMut097. In an embodiment, the Fc region comprises FcMut098. In an embodiment, the Fc region comprises FcMut099. In an embodiment, the Fc region comprises FcMut100. In an embodiment, the Fc region comprises FcMut101. In an embodiment, the Fc region comprises FcMut102. In an embodiment, the Fc region comprises FcMut103. In an embodiment, the Fc region comprises FcMut104. In an embodiment, the Fc region comprises FcMut105. In an embodiment, the Fc region comprises FcMut106. In an embodiment, the Fc region comprises FcMut107. In an embodiment, the Fc region comprises FcMut108. In an embodiment, the Fc region comprises FcMut109. In an embodiment, the Fc region comprises FcMut110. In an embodiment, the Fc region comprises FcMut111. In an embodiment, the Fc region comprises FcMut112. In an embodiment, the Fc region comprises FcMut113. In an embodiment, the Fc region comprises FcMut114. In an embodiment, the Fc region comprises FcMut115. In an embodiment, the Fc region comprises FcMut116. In an embodiment, the Fc region comprises FcMut117. In an embodiment, the Fc region comprises FcMut118. In an embodiment, the Fc region comprises FcMut119. In an embodiment, the Fc region comprises FcMut120. In an embodiment, the Fc region comprises FcMut121. In an embodiment, the Fc region comprises FcMut122. In an embodiment, the Fc region comprises FcMut123. In an embodiment, the Fc region comprises FcMut124. In an embodiment, the Fc region comprises FcMut125. In an embodiment, the Fc region comprises FcMut126. In an embodiment, the Fc region comprises FcMut127. In an embodiment, the Fc region comprises FcMut128. In an embodiment, the Fc region comprises FcMut129. In an embodiment, the Fc region comprises FcMut130. In an embodiment, the Fc region comprises FcMut131. In an embodiment, the Fc region comprises FcMut132. In an embodiment, the Fc region comprises FcMut133. In an embodiment, the Fc region comprises FcMut134. In an embodiment, the Fc region comprises FcMut135. In an embodiment, the Fc region comprises FcMut136. In an embodiment, the Fc region comprises FcMut137. In an embodiment, the Fc region comprises FcMut138. In an embodiment, the Fc region comprises FcMut139. In an embodiment, the Fc region comprises FcMut140. In an embodiment, the Fc region comprises FcMut141. In an embodiment, the Fc region comprises FcMut142. In an embodiment, the Fc region comprises FcMut143. In an embodiment, the Fc region comprises FcMut144. In an embodiment, the Fc region comprises FcMut145. In an embodiment, the Fc region comprises FcMut146. In an embodiment, the Fc region comprises FcMut147. In an embodiment, the Fc region comprises FcMut148. In an embodiment, the Fc region comprises FcMut149. In an embodiment, the Fc region comprises FcMut150. In an embodiment, the Fc region comprises FcMut151. In an embodiment, the Fc region comprises FcMut152. In an embodiment, the Fc region comprises FcMut153. In an embodiment, the Fc region comprises FcMut154. In an embodiment, the Fc region comprises FcMut155. In an embodiment, the Fc region comprises FcMut156. In an embodiment, the Fc region comprises FcMut157. In an embodiment, the Fc region comprises FcMut158. In an embodiment, the Fc region comprises FcMut159. In an embodiment, the Fc region comprises FcMut160. In an embodiment, the Fc region comprises FcMut161. In an embodiment, the Fc region comprises FcMut162. In an embodiment, the Fc region comprises FcMut163. In an embodiment, the Fc region comprises FcMut164. In an embodiment, the Fc region comprises FcMut165. In an embodiment, the Fc region comprises FcMut166. In an embodiment, the Fc region comprises FcMut167. In an embodiment, the Fc region comprises FcMut168. In an embodiment, the Fc region comprises FcMut169. In an embodiment, the Fc region comprises FcMut170. In an embodiment, the Fc region comprises FcMut171. In an embodiment, the Fc region comprises FcMut172. In an embodiment, the Fc region comprises FcMut173. In an embodiment, the Fc region comprises FcMut174. In an embodiment, the Fc region comprises FcMut175. In an embodiment, the Fc region comprises FcMut176. In an embodiment, the Fc region comprises FcMut177. In an embodiment, the Fc region comprises FcMut178. In an embodiment, the Fc region comprises FcMut179. In an embodiment, the Fc region comprises FcMut180. In an embodiment, the Fc region comprises FcMut181. In an embodiment, the Fc region comprises FcMut182. In an embodiment, the Fc region comprises FcMut183. In an embodiment, the Fc region comprises FcMut184. In an embodiment, the Fc region comprises FcMut185. In an embodiment, the Fc region comprises FcMut186. In an embodiment, the Fc region comprises FcMut187. In an embodiment, the Fc region comprises FcMut188. In an embodiment, the Fc region comprises FcMut189. In an embodiment, the Fc region comprises FcMut190. In an embodiment, the Fc region comprises FcMut191. In an embodiment, the Fc region comprises FcMut192. In an embodiment, the Fc region comprises FcMut193. In an embodiment, the Fc region comprises FcMut194. In an embodiment, the Fc region comprises FcMut195. In an embodiment, the Fc region comprises FcMut196. In an embodiment, the Fc region comprises FcMut197. In an embodiment, the Fc region comprises FcMut198. In an embodiment, the Fc region comprises FcMut199. In an embodiment, the Fc region comprises FcMut200. In an embodiment, the Fc region comprises FcMut201. In an embodiment, the Fc region comprises FcMut202. In an embodiment, the Fc region comprises FcMut203. In an embodiment, the Fc region comprises FcMut204. In an embodiment, the Fc region comprises FcMut205. In an embodiment, the Fc region comprises FcMut206. In an embodiment, the Fc region comprises FcMut207. In an embodiment, the Fc region comprises FcMut208. In an embodiment, the Fc region comprises FcMut209. In an embodiment, the Fc region comprises FcMut210. In an embodiment, the Fc region comprises FcMut211. In an embodiment, the Fc region comprises FcMut212. In an embodiment, the Fc region comprises FcMut213. In an embodiment, the Fc region comprises FcMut214. In an embodiment, the Fc region comprises FcMut215. In an embodiment, the Fc region comprises FcMut216. In an embodiment, the Fc region comprises FcMut217. In an embodiment, the Fc region comprises FcMut218. In an embodiment, the Fc region comprises FcMut219. In an embodiment, the Fc region comprises FcMut220. In an embodiment, the Fc region comprises FcMut221. In an embodiment, the Fc region comprises FcMut222. In an embodiment, the Fc region comprises FcMut223. In an embodiment, the Fc region comprises FcMut224. In an embodiment, the Fc region comprises FcMut225. In an embodiment, the Fc region comprises FcMut226. In an embodiment, the Fc region comprises FcMut227. In an embodiment, the Fc region comprises FcMut228. In an embodiment, the Fc region comprises FcMut229. In an embodiment, the Fc region comprises FcMut230. In an embodiment, the Fc region comprises FcMut231. In an embodiment, the Fc region comprises FcMut232. In an embodiment, the Fc region comprises FcMut233. In an embodiment, the Fc region comprises FcMut234. In an embodiment, the Fc region comprises FcMut242. In an embodiment, the Fc region comprises FcMut243. In an embodiment, the Fc region comprises FcMut244.
- In an embodiment, the Fc region comprises one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, or more) of mutations or combinations of mutations chosen from FcMut045, FcMut171, FcMut183, FcMut186, FcMut190, FcMut197, FcMut213, FcMut215, FcMut216, FcMut219, FcMut222, FcMut223, FcMut224, FcMut226, FcMut227, FcMut228, or FcMut229. In an embodiment, the Fc region comprises one or more (e.g., 2, 3, 4, 5, 6, or all) of mutations or combinations of mutations chosen from FcMut045, FcMut183, FcMut197, FcMut213, FcMut215, FcMut228, or FcMut156. In another embodiment, the Fc region comprises one or more (e.g., 2, 3, 4, 5, or all) of mutations or combinations of mutations chosen from FcMut183, FcMut197, FcMut213, FcMut215, FcMut228, or FcMut229.
- In an embodiment, the Fc region does not comprise one or more (e.g., 2, 3, 4, or all) of mutations or combinations of mutations chosen from FcMut018, FcMut021, FcMut050, FcMut102, or YTE. In an embodiment, the Fc region comprises one or more (e.g., 2, 3, 4, or all) of mutations or combinations of mutations chosen from FcMut018, FcMut021, FcMut050, FcMut102, or YTE, and one or more other mutations or combinations of mutations described in Table 1.
- In an embodiment, the Fc region comprises one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more) of mutations or combinations of mutations described in Table 1 that result in a synergistic effect (e.g., binding affinity or circulating half-life) as described herein.
- In an embodiment, the Fc region comprises one or more (e.g., 2, 3, 4, 5, 6, or 7) mutations in residues chosen from T256, H285, N286, T307, Q311, N315, or A378. In an embodiment, the Fc region comprises one or more (e.g., 2, 3, 4, 5, 6, or 7) mutations chosen from T256D, H285N, N286D, T307Q, Q311V, N315D, or A378V.
- In an embodiment, the Fc region comprises a half-life enhancing mutation, a mutation that is capable of disrupting an Fc effector function, or both. In an embodiment, the Fc region comprises one or more mutations or combinations of mutations described herein, e.g., chosen from M252W, V308F/N434Y, R255Y, P257L/N434Y, V308F, P257N/M252Y, G385N, P257N/V308Y, N434Y, M252Y/S254T/T256E (“YTE”), M428L/N434S (“LS”), or any combination thereof. Alternatively, or additionally, in an embodiment, the Fc region comprises (a) one or more (e.g., 2, 3, 4, 5, or all) combinations of mutations chosen from: T256D/Q311V/A378V, H285N/T307Q/N315D, H285D/T307Q/A378V, T307Q/Q311V/A378V, T256D/N286D/T307R/Q311V/A378V, or T256D/T307R/Q311V; (b) a mutation or a combination of mutations capable of disrupting an Fc effector function, e.g., L234A/L235A (also known as “LALA” mutation), or (c) both (a) and (b).
- In an embodiment, the Fc region comprises mutations T256D/Q311V/A378V and a mutation or a combination of mutations capable of disrupting an Fc effector function, e.g., L234A/L235A. In an embodiment, the Fc region comprises mutations H285N/T307Q/N315D and a mutation or a combination of mutations capable of disrupting an Fc effector function, e.g., L234A/L235A. In an embodiment, the Fc region comprises mutations H285D/T307Q/A378V and a mutation or a combination of mutations capable of disrupting an Fc effector function, e.g., L234A/L235A. In an embodiment, the Fc region comprises mutations T307Q/Q311V/A378V and a mutation or a combination of mutations capable of disrupting an Fc effector function, e.g., L234A/L235A. In an embodiment, the Fc region comprises mutations T256D/N286D/T307R/Q311V/A378V and a mutation or a combination of mutations capable of disrupting an Fc effector function, e.g., L234A/L235A. In an embodiment, the Fc region comprises mutations T256D/T307R/Q311V and a mutation or a combination of mutations capable of disrupting an Fc effector function, e.g., L234A/L235A.
- A reference Fc region amino acid sequence (including the numbering used herein) is provided below (e.g., for identification of the mutation positions described herein). The CH2 domain sequence is underlined; the hinge region sequence is in italics, and the CH3 domain sequence is in bold.
-
(SEQ ID NO: 1) 118 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL 175 QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPA 232 PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN 287 AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQ P 344 REPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS 401 DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK - Any of the half-life extension mutations described herein can be used in combination with any Fc mutation capable of enhancing or disrupting an Fc effector function.
- The Fc region can bind to various cell receptors (e.g., Fc receptors) and complement proteins. The Fc region can also mediate different physiological effects of antibody molecules, e.g., detection of opsonized particles; cell lysis; degranulation of mast cells, basophils, and eosinophils; and other processes.
- There are several different types of Fc receptors (FcR), which can be classified based on the type of antibody that they recognize.
- Fcγ receptors (FcγR) belong to the immunoglobulin superfamily, and are involved, e.g., in inducing phagocytosis of opsonized microbes. This family includes several members, FcγRI (CD64), FcγRIIA (CD32), FcγRIIB (CD32), FcγRIIIA (CD16a), FcγRIIIB (CD16b), which differ in their antibody affinities due to their different molecular structure. For instance, FcγRI can bind to IgG more strongly than FcγRII or FcγRIII does. FcγRI also has an extracellular portion comprising three immunoglobulin (Ig)-like domains, one more domain than FcγRII or FcγRIII has. This property allows FcγRI to bind a sole IgG molecule (or monomer), but Fcγ receptors generally need to bind multiple IgG molecules within an immune complex to be activated.
- The Fcγ receptors differ in their affinity for IgG and the different IgG subclasses can have unique affinities for each of the Fcγ receptors. These interactions can be further tuned by the glycan (oligosaccharide) at certain position of IgG. For example, by creating steric hindrance, fucose containing CH2-84.4 glycans reduce IgG affinity for FcγRIIIA, whereas GO glycans, which lack galactose and terminate instead with GlcNAc moieties, have increased affinity for FcγRIIIA (Maverakis et al. (2015) Journal of Autoimmunity 57 (6): 1-13)
- The neonatal Fc receptor (FcRn) is expressed on multiple cell types and is similar in structure to MHC class I. This receptor also binds IgG and is involved in preservation of this antibody (Zhu et al. (2001). Journal of Immunology 166 (5): 3266-76.). FcRn is also involved in transferring IgG from a mother either via the placenta to her fetus or in milk to her suckling infant. This receptor may also play a role in the homeostasis of IgG serum levels.
- FcαRI (or CD89) belongs to the FcαR subgroup. FcαRI is found on the surface of neutrophils, eosinophils, monocytes, macrophages (including Kupffer cells), and dendritic cells. It comprises two extracellular Ig-like domains, and is a member of both the immunoglobulin superfamily and the multi-chain immune recognition receptor (MIRR) family. It signals by associating with two FcRγ signaling chains.
- Fc-alpha/mu receptor (Fcα/μR) is a type I transmembrane protein. It can bind IgA, although it has higher affinity for IgM (Shibuya and Honda (2006) Springer Seminars in Immunopathology 28 (4): 377-82). With one Ig-like domain in its extracellular portion, this Fc receptor is also a member of the immunoglobulin superfamily.
- There are two known types of FcεR. The high-affinity receptor FcεRI is a member of the immunoglobulin superfamily (it has two Ig-like domains). FcεRI is found on epidermal Langerhans cells, eosinophils, mast cells and basophils. This receptor can play a role in controlling allergic responses. FcεRI is also expressed on antigen-presenting cells, and controls the production of immune mediators, e.g., cytokines that promote inflammation (von Bubnoff et al. (2003) Clinical and Experimental Dermatology 28 (2): 184-7). The low-affinity receptor FcεRII (CD23) is a C-type lectin. FcεRII has multiple functions as a membrane-bound or soluble receptor. It can also control B cell growth and differentiation and blocks IgE-binding of eosinophils, monocytes, and basophils (Kikutani et al. (1989) Ciba Foundation Symposium 147: 23-31).
- In an embodiment, the Fc region can be engineered to contain an antigen-binding site to generate an Fcab fragment (Wozniak-Knopp et al. (2010) Protein Eng Des 23 (4): 289-297). Fcab fragments can be inserted into a full immunoglobulin by swapping the Fc region, thus obtaining a bispecific antibody (with both Fab and Fcab regions containing distinct binding sites).
- The binding and recycling of FcRn can be illustrated below. For example, IgG and albumin are internalized into vascular endothelial cells through pinocytosis. The pH of the endosome is 6.0, facilitating association with membrane-bound FcRn. The contents of endosomes can be processed in one of two ways: either recycling back to the apical cell membrane or transcytosis from the apical to the basolateral side. IgG not associated with FcRn is degraded by lysosomes.
- While not wishing to be bound by theory, it is believed that FcRn interaction with IgG is mediated through Fc. The binding of Fc to FcRn is pH specific, e.g., no significant binding at pH 7.4 and strong binding in acidic environment. Structure of FcRn in complex with Fc domain of IgG1 molecule is known in
FIG. 1 . Each FcRn molecule generally binds to an Fc-monomer. In an embodiment, Fab domains can also influence binding of IgG to FcRn, e.g., have either a negative or no influence on the affinity of the IgG for FcRn. - There can be multiple considerations when an Fc region is engineered to enhance half-life of a polypeptide. For example, prolonging half-life and efficient recirculation of antibody molecules or fusion proteins often requires pH specific affinity enhancement (e.g., only at low pH of the endosome). FcRn binds proximal to the linker region between CH2 and CH3 domains of a Fc region. Modifications to the linker can impact Fc engagement with Fcγ receptors. Modifications on the Fc region can impact thermal stability and aggregation properties of the polypeptide.
- In an embodiment, the polypeptide (e.g., antibody molecule or fusion protein) described herein has the same affinity function, or does not substantially alter (e.g., decrease by more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) an effector function (e.g., an effector function described herein). In an embodiment, the effector function is not associated with the binding between an Fc region and an FcRn.
- The amino acid residues to be mutated can be selected, at least in part, based on the structural or functional properties of one or more binding sites on the Fc region. These binding sites include, but are not limited to, a Protein A binding site, a C1q binding site, an FcγRI binding site, an FcγRIIa binding site, an FcγRIIIa binding site, or an FcRn binding site, e.g., as shown in
FIG. 2 . The binding sites can also include a TRIM21 binding site, e.g., one or more residues chosen from loop 308-316, loop 252-256, or loop 429-436 of an IgG. In an embodiment, the linker region between the CH2 and CH3 domain can influence the dynamics of the CH2 domain which impinges on FcγR binding. - Without wishing to be bound by theory, it is believed that low pH of the endosome leads to protonation of surface histidines on the CH2 and CH3 domains. For example, protonation of residue H310 on CH2 and/or H433 on CH3 can be important for FcRn engagement, e.g., at low pH (e.g., at pH 6.0). Protonation can also lead to change in the conformational dynamics of the region, such as better exposure or shielding of the linker region for solvent or ligand molecule binding. Accordingly, in an embodiment, the polypeptide (e.g., antibody molecule or fusion protein) comprises a mutation in residue H310, a mutation in residue H433, or both. One or more residues adjacent to residues H310 and/or H433 can also be mutated. The polypeptide can also include a compensating or beneficial mutation, e.g., a mutation that compensates, or beneficial, for any of the aforesaid mutations, e.g., to reduce a negative consequence of that mutation (e.g., polar vs. non-polar, charged vs. no charge, positively-charged (basic) vs. negatively charged (acidic), or hydrophobic vs. hydrophilic). For example, P247D can be a compensating or beneficial mutation.
- In an embodiment, protonation of histidine can result in additional conformational changes including, e.g., movement/displacement of the linker/CH2/CH3 interface residues. Crystal structures of Fc fragments have been crystallized at different pHs. As shown in
FIG. 3 , an analysis of two high resolution crystal structures of Fc fragments crystallized and pH 6.5 (cyan) and 5.0 (green) indicated potential differences. - In an embodiment, the polypeptide (e.g., antibody molecule or fusion protein) described herein comprises a mutation that can alter the interaction between an Fc region and an FcRn. In an embodiment, the mutation is selected based, at least in part, on a structural feature of the Fc-FcRn interaction interface.
- In an embodiment, the Fc region of an immunoglobulin monomer can have the structure shown in
FIG. 4 . As shown inFIG. 4 , the black dotted line indicates the Fc-FcRn interaction interface. The structure includes FcRn contact residues and FcRn affinity enhancing Fc residues, e.g., as described herein. Residues H310 and H435, which are located in the CH2 and CH3 domains, respectively, are primarily responsible for the pH dependent Fc-FcRn interactions. In an embodiment, the FcRn binds the Fc region between its CH2 and CH3 domains. In another embodiment, the Fc-FcRn binding site is located across both the CH2 and CH3 domains of the Fc monomer. - In an embodiment, the polypeptide (e.g., antibody molecule or fusion protein) described herein comprises a plurality of mutations that can alter the interaction between an Fc region and an FcRn. In an embodiment, the mutation is selected based, at least in part, on a network view of the Fc-FcRn interaction.
- Without wishing to be bound by theory, it is believed that in an embodiment, residue H310 plays a central role in engagement with the FcRn, e.g., as determined by a network analysis of the Fc-FcRn complex. As shown in
FIG. 5 , residue H310 is highly interconnected to multiple other highly networked residues. In an embodiment, a mutation in the H310 cluster, and neighboring (connected nodes), can strengthen the H310 network. Analysis of sub-networks informs introduction of synergistic mutations for favorable FcRn interaction; with reduced or minimal impact on other Fc residues. - In an embodiment, the polypeptide (e.g., antibody molecule or fusion protein) described herein can be designed for optimizing Fc-FcRn binding.
- In an embodiment, the polypeptide having a mutation in the Fc region has a pH-specific affinity enhancement, compared to a reference polypeptide (e.g., an otherwise identical polypeptide without the mutation). In an embodiment, affinity enhancement is achieved by increasing van der Waal interaction. In an embodiment, affinity enhancement is not achieved by introduction of hydrogen bonds and/or electrostatic interaction. In an embodiment, the mutation does not alter, or has reduced or minimal perturbation to, the conformation of the linker region between the CH2 and CH3 domains. In an embodiment, the polypeptide comprises a plurality of mutations across both domains (four quadrants). In an embodiment, the polypeptide does not contain a large cluster of hydrophobic or aromatic residues on the surface.
- In an embodiment, the polypeptide comprises a mutation that enhances the strength of interaction between an Fc region and FcRn or reduces the dissociation constant (Kd) for FcRn, e.g., at an acidic pH. In an embodiment, the polypeptide comprises a mutation that reduces the rate of dissociation (koff) for FcRn, e.g., at an acidic pH. In an embodiment, the polypeptide comprises a mutation that increases the rate of association (kon) for FcRn, e.g., at an acidic pH. In an embodiment, the polypeptide comprises a mutation that reduces the rate of dissociation (koff) for FcRn, and increases the rate of association (kon) for FcRn, e.g., at an acidic pH. In an embodiment, the polypeptide comprises a mutation that reduces the rate of dissociation (koff) for FcRn, and does not, or does not significantly, affect the rate of association (kon) for FcRn, e.g., at an acidic pH. Without wishing to be bound by theory, it is believed that in an embodiment, the reduction of the dissociation constant Kd for FcRn is primarily resulted from the reduction of the rate of dissociation (koff) for FcRn, rather than the increase of the rate of association (kon).
- The polypeptides (e.g., antibody molecules or fusion proteins) described herein can be evaluated by a number of methods. The pH-specific Fc-FcRn binding (e.g., binding at pH6.0 and pH7.4) can be determined, e.g., by an Octet-based assay, a competition assay (e.g., flow cytometry), or surface plasmon resonance (SPR).
- Biophysical characterization (e.g., thermal stability, aggregation, or expression) can be performed. Thermal stability can be determined, e.g., by SYPRO orange. Aggregation can be measured, e.g., by SEC or RP-HPLC.
- Effector functions, e.g., relating to FcγRI (e.g., by an Octet-based assay), FcγRIIIa, FcγRIIa, FcγRIIb (e.g., by ELISA), C1q, ADCC, or CDC, can be tested.
- Tripartite Motif-Containing Protein 21 (TRIM21) binding can be tested. TRIM21 is a cytosolic receptor that binds with Fc of IgG. TRIM21 plays a role in mediating intracellular recognition and neutralization of Fc bound pathogens such as viruses, bacteria and fungus. For example, TRIM21 plays an important role in the neutralization of non-enveloped viruses (McEwan et al. Nat Immunol. 2013; 14(4):327-36). Its role has been further expanded to include directing of immune complexes for degradation (McEwan et al. Proc Natl Acad Sci USA. 2017; 114(3):574-579). TRIM21 binds to the CH2:CH3 interface of the antibody Fc region, which overlaps with the FcRn binding site. Some Fc mutations that increase FcRn affinity decrease TRIM21 affinity (Foss et al. J Immunol. 2016; 196(8):3452-3459). Key contact residues include, e.g., positions 253, 433, 434, and 435. The LS variant (M428L/N434S) contains a mutation at position 434, and it has been shown that the N434S mutation causes a 10 fold decrease in TRIM21 binding. TRIM21-mediated neutralization is known as antibody dependent intracellular neutralization (ADIN).
- Mucosal uptake can be tested. FcRn transports IgG across different cellular barriers such as the mucosal epithelium lining the intestine and the alveolar surfaces. Modification of FcRn binding provides a mechanism to enhance mucosal localization that confers immune protection.
- The half-life of the polypeptide can be measured, e.g., using transgenic mice (e.g., Tg32 and Tg276 mice from Jackson's lab), or in primates (e.g., cynomolgus monkeys).
- Exemplary assays are described in more detail as follows:
- 1. FcRn Binding Assays
- a. Octet Assay with Immobilization of FcRn to NiNTA Biosensors
- Immobilization of FcRn to a NiNTA biosensor via a 6× histidine tag (SEQ ID NO: 2) allows for subsequent interrogation of binding to IgG molecules under acidic (pH 6.0) and physiological (pH 7.4) conditions. This strategy has been previously described (1) and this method details an adaptation of the referenced protocol. Briefly, recombinant human FcRn at 5 μg/mL is loaded onto a NiNTA biosensor for 180 seconds. After a 60 second baseline step in 1×PBS pH 6.0, the FcRn loaded tip is exposed to IgG at a concentration of 250 nM (37.5 μg/mL) for 60 seconds, followed by dissociation for 60 seconds in PBS pH 6.0, and an additional 30 seconds in PBS pH 7.4. After assay completion, a quantitative assessment of the affinity constant (KD) at pH 6.0 is performed using the ForteBio octet software and a qualitative assessment is performed by plotting the response rate over time, allowing for visualization of the association of IgG to FcRn at pH 6.0 and the subsequent dissociation at pH 6.0 and pH 7.4.
- b. Octet Assay with Immobilization of IgG to Anti-CH1 Biosensors
- Immobilization of IgG to an anti-CH1 biosensor allows for subsequent interrogation of binding to FcRn molecules under acidic (pH 6.0) and physiological (pH 7.4) conditions. This strategy has been previously described (2) and this method details an adaptation of the referenced protocol. Briefly, purified IgG at 5 μg/mL is loaded onto an anti-CH1 biosensor for 180 seconds. After a 60 second baseline step in 1×PBS pH 6.0, the IgG loaded tip is exposed to FcRn at a concentration of 50 μg/mL for 60 seconds, followed by dissociation for 60 seconds in PBS pH 6.0, and an additional 30 seconds in PBS pH 7.4. After assay completion, a quantitative assessment of the affinity constant (KD) at pH 6.0 is performed using the ForteBio octet software and a qualitative assessment is performed by plotting the response rate over time, allowing for visualization of the association of IgG to FcRn at pH 6.0 and the subsequent dissociation at pH 6.0 and pH 7.4.
- c. Cell Based Assay
- Cell-based assays are also used to analyze the interactions between FcRn and IgG (Ref: PMID: 23384837). Expression of membrane-anchored FcRn on the cell surface closely represents the physiological presentation of FcRn, where the plasma membrane and molecular orientations influence interactions between FcRn and IgG. The assay used here is a competition assay in which IgGs of interest are evaluated for their ability to compete with cell binding of a fluorescently-labeled, high affinity Fc competitor reagent (Fc-A488). Expi293 cells expressing the full-length, membrane-bound FcRn heterodimer are incubated with mixtures of a static concentration of Fc-A488 (0.5 ug/ml) and varying concentrations of IgG of interest (0.001-10 μM). Cell-bound fluorescence is detected by flow cytometry. IgGs with improved binding to FcRn will compete off the Fc competitor at lower IgG concentrations. This assay is robust, linear, and specific and can be used to show differences in relative binding of IgG/Fc variants to FcRn.
- 2. Thermal Stability Assay
- The stability of the IgG variants was assessed by Differential Scanning Fluorimetry (DSF) is an assay using SYPRO® Orange dye to monitor protein unfolding under thermal stress. SYPRO® Orange is a fluorescent dye that non-specifically binds to hydrophobic surfaces and its fluorescence is quenched in aqueous environments. Proteins begin to lose their secondary structure and unfold with increasing temperatures thus exposing their hydrophobic core residues, and allowing the dye to fluoresce. Maximum fluorescent signal is attained at complete unfolding, after which the protein begins to aggregate, reducing the exposed hydrophobic residues, and thus reducing the fluorescent signal. At the midpoint between native state and fully unfolded protein is the transition temperature, or melt temperature (Tm), which can be used to directly compare protein constructs or formulation conditions for relative stability.
- In an embodiment, factors other than FcRn binding can also affect the observed half-life of a polypeptide (e.g., an antibody molecule or fusion protein). These factors can include, e.g., aggregation propensity, non-specific binding, stability, or Fab composition.
- In an embodiment, a mutation in a non-Fc region is introduced, e.g., to provide a substantial improvement in half-life in the context of a suboptimal template. For example, polypeptides (e.g., antibody molecules or fusion proteins) with lower starting half-life may indicate the presence of suboptimal properties. Engineering efforts can also focus on mitigating the root cause of lower half-life, e.g., to maintain requisite binding profile (e.g., affinity and/or specificity), or to obtain suitable developability characteristics (e.g., stability, solubility, expression level, or aggregation). In an embodiment, additional engineering is performed for polypeptide (e.g., antibody molecules or fusion proteins) with suboptimal biophysical properties to realize maximal half-life extension.
- The polypeptides (e.g., antibody molecules or fusion proteins) described herein can have one or more desired pharmacokinetic properties, e.g., one or more (e.g., 2, 3, 4, 5, or more) of the pharmacokinetic properties described herein.
- Pharmacokinetics (PK) can be used to determine the fate of substances administered to a living organism. PK studies can be used to analyze drug metabolism and to identify the fate of a drug from the moment that it is administered up to the point at which it is completely eliminated from the body. Pharmacokinetics describes, e.g., how the body affects a specific drug after administration through the mechanisms of absorption and distribution, the chemical changes of the substance in the body (e.g. by metabolic enzymes such as cytochrome P450 or glucuronosyltransferase enzymes), or the effects and routes of excretion of the metabolites of the drug. Pharmacokinetic properties of drugs may be affected by elements such as the site of administration and the dose of administered drug, which may affect the absorption rate. Pharmacokinetics can be analyzed in conjunction with pharmacodynamics (e.g., the study of the biochemical and physiologic effects of drugs).
- A number of different models have been developed for pharmacokinetics. For example, pharmacokinetic modelling can be performed by noncompartmental or compartmental methods.
- Noncompartmental methods estimate the exposure to a drug by estimating the area under the curve of a concentration-time graph. Noncompartmental PK analysis is highly dependent on estimation of total drug exposure. Total drug exposure is often estimated by area under the curve (AUC) methods, with the trapezoidal rule (numerical integration) the most common method. Due to the dependence on the length of ‘x’ in the trapezoidal rule, the area estimation is highly dependent on the blood/plasma sampling schedule. That is, the closer time points are, the closer the trapezoids reflect the actual shape of the concentration-time curve.
- Compartmental methods estimate the concentration-time graph using kinetic models. Compartmental PK analysis uses kinetic models to describe and predict the concentration-time curve. PK compartmental models are often similar to kinetic models used in other scientific disciplines such as chemical kinetics and thermodynamics. The advantage of compartmental over some noncompartmental analyses is the ability to predict the concentration at any time. Compartment-free modelling based on curve stripping does not suffer this limitation. The simplest PK compartmental model is the one-compartmental PK model with IV bolus administration and first-order elimination. The more complex PK models (e.g., PBPK models) rely on the use of physiological information to ease development and validation.
- In a single-compartment model, the graph of the relationship between the various factors involved (e.g., dose, blood plasma concentrations, or elimination) gives a straight line or an approximation to one (i.e., linear pharmacokinetics). For drugs to be effective they need to be able to move rapidly from blood plasma to other body fluids and tissues.
- In multi-compartmental models, the graph for the non-linear relationship between the various factors is represented by a curve, the relationships between the factors can then be found by calculating the dimensions of different areas under the curve. The models used in non-linear pharmacokinetics are largely based on Michaelis-Menten kinetics.
- The various compartments that the model is divided into are commonly referred to as the ADME scheme (also referred to as LADME if liberation is included as a separate step from absorption): liberation (e.g., the process of release of a drug from the pharmaceutical formulation); absorption (e.g., the process of a substance entering the blood circulation); distribution (e.g., the dispersion or dissemination of substances throughout the fluids and tissues of the body); metabolism (or biotransformation, or inactivation) (e.g., the recognition by the organism that a foreign substance is present and the irreversible transformation of parent compounds into daughter metabolites); and excretion (e.g., the removal of the substances from the body). In rare cases, some drugs irreversibly accumulate in body tissue. The two phases of metabolism and excretion can also be grouped together under the title elimination.
- All these parameters can be represented through mathematical formulas that have a corresponding graphical representation. The use of these models allows an understanding of the characteristics of a molecule, as well as how a particular drug will behave given information regarding some of its basic characteristics such as its acid dissociation constant (pKd), bioavailability and solubility, absorption capacity and distribution in the organism.
- The model outputs for a drug can be used in industry (for example, in calculating bioequivalence when designing generic drugs) or in the clinical application of pharmacokinetic concepts. Clinical pharmacokinetics provides a number of performance guidelines for effective and efficient use of drugs for human-health professionals and in veterinary medicine.
- Exemplary pharmacokinetic properties include, but are not limited to, dose (e.g., the amount of drug administered), dosing interval (e.g., the time between drug dose administrations), Cmax (e.g., the peak plasma concentration of a drug after administration), tmax (e.g., the time to reach Cmax), Cmin (e.g., the lowest concentration that a drug reaches before the next dose is administered), volume of distribution (e.g., the apparent volume in which a drug is distributed, e.g., relating drug concentration to drug amount in the body), concentration (e.g., the amount of drug in a given volume of plasma), half-life or elimination half-life (e.g., the time required for the concentration of the drug to reach half of its original value), elimination rate constant (e.g., the rate at which a drug is removed from the body), infusion rate (e.g., the rate of infusion required to balance elimination), area under the curve (e.g., the integral of the concentration-time curve, e.g., after a single dose or in steady state), clearance (e.g., the volume of plasma cleared of the drug per unit time), bioavailability (e.g., the systemically available fraction of a drug), or fluctuation (e.g., the peak trough fluctuation within one dosing interval at steady state).
- Pharmacokinetic properties can be measured by various methods. For example, bioanalytical methods can be used to construct a concentration-time profile. Chemical techniques can be employed to measure the concentration of drugs in biological matrix, e.g., plasma. Proper bioanalytical methods should be selective and sensitive. For example, microscale thermophoresis can be used to quantify how the biological matrix/liquid affects the affinity of a drug to its target (Baaske et al. (2010). Angew. Chem. Int. Ed. 49 (12): 1-5; Wienken et al. (2010). Nature Communications 1 (7): 100).
- Pharmacokinetic properties can also be studied using mass spectrometry, e.g., when there is a need for high sensitivity to observe concentrations after a low dose and a long time period. A common instrumentation used in this application is LC-MS with a triple quadrupole mass spectrometer. Tandem mass spectrometry can be employed for added specificity. Standard curves and internal standards can be used for quantitation of a pharmaceutical in the samples. The samples represent different time points as a pharmaceutical is administered and then metabolized or cleared from the body. Blank samples taken before administration are used in determining background and ensuring data integrity with such complex sample matrices. The standard curve can be linear, or curve fitting can be used with more complex functions such as quadratics since the response of most mass spectrometers is less than linear across large concentration ranges (Hsieh and Korfmacher (2006) Current Drug Metabolism 7 (5): 479-89; Covey et al. (1986) Anal. Chem. 58 (12): 2453-60; Covey et al. (1985). Anal. Chem. 57 (2): 474-81).
- The methods described herein can be used to engineer a variety of antibody molecules, e.g., any antibody molecule containing an Fc region.
- In an embodiment, the antibody molecule is a chimeric antibody molecule, a humanized antibody molecule, or a human antibody molecule.
- In an embodiment, the antibody molecule is a whole monoclonal antibody. In another embodiment, the antibody molecule is an Fc region-containing derivative of an antibody molecule that does not contain an Fc region (e.g., an antigen-binding fragment described herein). Exemplary antigen-binding fragments include, but are not limited to, Fab, F(ab′)2, Fab′, scFv, di-scFv, or sdAb. In another embodiment, the antibody molecule is a bispecific monoclonal antibody, e.g., a trifunctional antibody (3funct) or bi-specific T-cell engager (BiTE).
- In an embodiment, the antibody molecule targets a molecule (e.g., a protein) associated with an infectious disease (e.g., a viral infection, a bacterial infection, or a fungal infection). In another embodiment, the antibody molecule targets a molecule (e.g., a protein) or cell associated with a cancer. In another embodiment, the antibody molecule targets a molecule (e.g., a protein) or cell associated with an immune disorder. In another embodiment, the antibody molecule targets a molecule (e.g., a protein) or cell associated with a cardiovascular disorder. In another embodiment, the antibody molecule targets a molecule (e.g., a protein) or cell associated with a metabolic disorder. In another embodiment, the antibody molecule targets a molecule (e.g., a protein) or cell associated with a neurological disorder.
- Exemplary antibody molecules include, but are not limited to, antibody molecules that target one or more (e.g., 2) of the following molecules or cells: β-amyloid, 4-1BB, SAC, 5T4, ACF9, ACFIX, activin receptor-like kinase 1, ACVR2B, an adenocarcinoma antigen, AGS-22M6, alpha-fetoprotein, angiopoietin 2, angiopoietin 3, a protective antigen of anthrax toxin, AOC3 (VAP-1), B7-H3, bacillus anthracisanthrax, BAFF, B-lymphoma cell, C242 antigen, C5, CA-125 (imitation), calcitonin, canis lupus familiaris IL31, carbonic anhydrase 9 (CA-IX), cardiac myosin, CCL11 (eotaxin-1), CCR2, CCR4, CCR5, CD11, CD18, CD125, CD140a, CD147 (basigin), CD15, CD152, CD154 (CD40L), CD19, CD2, CD20, CD200, CD22, CD221, CD23 (IgE receptor), CD25 (α chain of IL-2 receptor), CD27, CD274, CD276, CD28, CD3, CD3 epsilon, CD30 (TNFRSF8), CD33, CD37, CD38 (cyclic ADP ribose hydrolase), CD4, CD40, CD40 ligand, CD41 (integrin alpha-IIb), CD44 v6, CD5, CD51, CD52, CD56, CD6, CD70, CD74, CD79B, CD80, CEA, a CEA-related antigen, CFD, CGRP, ch4D5, CLDN18.2, Clostridium difficile, clumping factor A, coagulation factor III, CSF1R, CSF2, CTGF, CTLA-4, C-X-C chemokine receptor type 4, cytomegalovirus, cytomegalovirus glycoprotein B, dabigatran, DLL3, DLL4, DPP4, DRS, E. coli shiga toxintype-1, E. coli shiga toxintype-2, EGFL7, EGFR, endoglin, endotoxin, EpCAM, ephrin receptor A3, episialin, ERBB3, Escherichia coli, F protein of respiratory syncytial virus, FAP, fibrin II beta chain, fibronectin extra domain-B, folate hydrolase, folate receptor 1, folate receptor alpha, Frizzled receptor, ganglioside GD2, GCGR, GD2, GD3 ganglioside, GDF-8, glypican 3, GMCSF receptor α-chain, GPNMB, growth differentiation factor8, GUCY2C, hemagglutinin, hepatitis B surface antigen, hepatitis B virus, HER1, HER2/neu, HER3, HGF, HHGFR, histone complex, HIV-1, HLA-DR, HNGF, Hsp90, human scatter factor receptor kinase, human TNF, human beta-amyloid, ICAM-1 (CD54), ICOSL, IFN-α, IFN-γ, IgE, IgE Fc region, IGF-1 receptor, IGF-I, IGHE, IL 20, IL-1, IL-12, IL-13, IL-17, IL-17A, IL-17F, IL-1β, IL2, IL-22, IL-23, IL23A, IL31RA, IL-4, IL-4, IL-5, IL6, IL-6 receptor (IL6R), IL-9, ILGF2, influenza A virus hemagglutinin (HA), insulin-like growth factor I receptor, integrin α4, integrin α4β7, integrin α5β1, integrin α7β7, integrin αIIbβ3, integrin αvβ3, interferon receptor, interferon α/β receptor, interferon gamma-induced protein, ITGA2, ITGB2 (CD18), kallikrein, KIR2D, KLRC1, Lewis-Y antigen, LFA-1 (CD11a), LFA-1 (CD11a), LINGO-1, lipoteichoic acid, LOXL2, L-selectin (CD62L), LTA, MCP-1, mesothelin, MIF, MS4A1, MSLN, MUC1, mucin CanAg, myelin-associated glycoprotein, myostatin, NCA-90 (granulocyte antigen), NCA-90 (granulocyte antigen), neural apoptosis-regulated proteinase 1, neural apoptosis-regulated proteinase 1, NGF, NGF, N-glycolylneuraminic acid, NOGO-A, Notch 1, Notch receptor, NRP1, Oryctolagus cuniculus, OX-40, oxLDL, PCSK9, PD-1, PD-1, PDCD1, PDGF-R α, phosphate-sodium co-transporter, phosphatidylserine, platelet-derived growth factor receptor beta, prostatic carcinoma cells, Pseudomonas aeruginosa, Pseudomonas aeruginosa type III secretion system, rabies virus glycoprotein, rabies virus glycoprotein, RANKL, respiratory syncytial virus, respiratory syncytial virus, RHD, Rhesus factor, Rhesus factor, RON, RTN4, sclerostin, SDC1, selectin P, SLAMF7, SOST, sphingosine-1-phosphate, Staphylococcus aureus, STEAP1, TAG-72, T-cell receptor, TEM1, tenascin C, TFPI, TGF beta 1, TGF beta 2, TGF-β, TNFR superfamily member 4, TNF-α, TRAIL-R1, TRAIL-R2, TSLP, tumor antigen CTAA16.88, tumor specific glycosylation of MUC1, tumor-associated calcium signal transducer 2, TWEAK receptor, TYRP1(glycoprotein 75), VEGFA, VEGFR-1, VEGFR2, vimentin, or VWF.
- Exemplary antibody molecules include, but are not limited to, antibody molecules that target one or more (e.g., 2) of the following pathogens (e.g., bacteria, viruses, or fungi): Actinomyces gerencseriae, Actinomyces israelii, Actinomycetoma species, Alphavirus, Anaplasma phagocytophilum, Anaplasma species, Ancylostoma braziliense, Ancylostoma duodenale, Angiostrongylus, Anisakis, Arcanobacterium haemolyticum, Ascaris lumbricoides, Aspergillus species, Astroviridae family, Babesia species, Bacillus anthracis, Bacillus cereus, bacterial vaginosis microbiota, Bacteroides species, Balantidium coli, Bartonella, Bartonella bacilliformis, Bartonella henselae, Batrachochytrium dendrabatidis, Baylisascaris species, BK virus, Blastocystis species, Blastomyces dermatitidis, Bordetella pertussis, Borrelia afzelii, Borrelia burgdorferi, Borrelia garinii, Borrelia hermsii, Borrelia recurrentis, Borrelia species, Brucella species, Brugia malayi, Bunyaviridae family, Burkholderia cepacia, Burkholderia mallei, Burkholderia pseudomallei, Burkholderia species, Caliciviridae family, Campylobacter species, Candida albicans, Candida species, Capillaria aerophila, Capillaria hepatica, Capillaria philippinensis, Chlamydia trachomatis, Chlamydia trachomatis, Chlamydia trachomatis, Chlamydophila pneumoniae, Chlamydophila psittaci, Clonorchis sinensis, Clostridium botulinum, Clostridium difficile, Clostridium perfringens, Clostridium perfringens, Clostridium tetani, Clostridium species, Coccidioides immitis, Coccidioides immitis, Coccidioides posadasii, Coccidioides posadasii, Colorado tick fever virus (CTFV), coronaviruses, Corynebacterium diphtheriae, Coxiella burnetii, Coxsackie A virus and Enterovirus 71 (EV71), Crimean-Congo hemorrhagic fever virus, Cryptococcus neoformans, Cryptosporidium species, Cyclospora cayetanensis, Cytomegalovirus, Dengue viruses (DEN-1, DEN-2, DEN-3 or DEN-4), Dientamoeba fragilis, Diphyllobothrium, Dracunculus medinensis, Ebolavirus (EBOV), Echinococcus species, Ehrlichia chaffeensis, Ehrlichia ewingii, Ehrlichia species, Entamoeba histolytica, Enterobacteriaceae family, Enterobius vermicularis, Enterococcus species, Enterovirus species, Enteroviruses, Entomophthorales order (Entomophthoramycosis), Epidermophyton floccosum, Epstein-Barr Virus (EBV), Escherichia coli O157:H7, Eumycetoma species, Fasciola hepatica and Fasciola gigantica, Fasciolopsis buski, Filarioidea superfamily, Flavivirus, Fonsecaea pedrosoi, Francisella tularensis, Fusobacterium species, Geotrichum candidum, Giardia lamblia, Gnathostoma hispidum, Gnathostoma spinigerum, Green algae Desmodesmus armatus, Group A Streptococcus, Guanarito virus, Haemophilus ducreyi, Haemophilus influenzae, Heartland virus, Helicobacter pylori, Hepatitis A virus, Hepatitis B virus, Hepatitis C virus, Hepatitis D Virus, Hepatitis E virus, Herpes simplex virus 1 and 2 (HSV-1 and HSV-2), Histoplasma capsulatum, HIV (Human immunodeficiency virus), Hortaea werneckii, Human bocavirus (HBoV), Human herpesvirus 6 (HHV-6) and Human herpesvirus 7 (HHV-7), Human metapneumovirus (hMPV), Human papillomavirus (HPV), Human parainfluenza viruses (HPIV), Hymenolepis diminuta, Hymenolepis nana, Isospora belli, JC virus, Junin virus, Kingella kingae, Klebsiella granulomatis, Lassa virus, Legionella pneumophila, Leishmania species, Leptospira species, Listeria monocytogenes, Lymphocytic choriomeningitis virus (LCMV), Machupo virus, Malassezia species, Marburg virus, Measles virus, Measles virus, Metagonimus yokagawai, Microsporidia phylum, Middle East respiratory syndrome coronavirus, Molluscum contagiosum virus (MCV), Monkeypox virus, Mucorales order (Mucormycosis), Mumps virus, Mycobacterium leprae, Mycobacterium lepromatosis, Mycobacterium tuberculosis, Mycobacterium ulcerans, Mycoplasma pneumoniae, Naegleria fowleri, Necator americanus, Neisseria gonorrhoeae, Neisseria gonorrhoeae, Neisseria meningitidis, Nocardia asteroids, Nocardia species, O111 and O104:H4, Onchocerca volvulus, Opisthorchis felineus, Opisthorchis viverrini, Orthomyxoviridae family, Paracoccidioides brasiliensis, Paragonimus westermani, Paragonimus species, parasitic dipterous fly larvae, Parvovirus B19, Pasteurella species, Pediculus humanus capitis, Pediculus humanus corporis, Phthirus pubis, Piedraia hortae, Plasmodium species, Pneumocystis jirovecii, Poliovirus, Prevotella species, PRNP, Propionibacterium propionicus, Rabies virus, Respiratory syncytial virus (RSV), Rhinosporidium seeberi, Rhinovirus, rhinoviruses, Rickettsia, Rickettsia akari, Rickettsia prowazekii, Rickettsia rickettsii, Rickettsia typhi, Rickettsia species, Rift Valley fever virus, Rotavirus, Rubella virus, Sabia, Salmonella enterica subsp. enterica, Salmonella species, Sarcoptes scabiei, SARS coronavirus, Schistosoma species, serovar typhi, Shigella species, Sin Nombre virus, Sporothrix schenckii, Staphylococcus, Staphylococcus species, Staphylococcus species, Streptococcus agalactiae, Streptococcus pneumoniae, Streptococcus pyogenes, Strongyloides stercoralis, Taenia solium, Taenia species, Toxocara canis, Toxocara cati, Toxoplasma gondii, Treponema pallidum, Trichinella spiralis, Trichomonas vaginalis, Trichophyton mentagrophytes, Trichophyton rubrum, Trichophyton rubrum, Trichophyton tonsurans, Trichophyton species, Trichosporon beigelii, Trichuris trichiura, Trypanosoma brucei, Trypanosoma cruzi, Ureaplasma urealyticum, Varicella zoster virus (VZV), Variola major, Variola minor, Venezuelan equine encephalitis virus, Vibrio cholerae, Vibrio parahaemolyticus, Vibrio vulnificus, West Nile virus, Wuchereria bancrofti, Yellow fever virus, Yersinia enterocolitica, Yersinia pestis, Yersinia pseudotuberculosis, or Zika virus,
- Exemplary antibody molecules include, but are not limited to, 3f8, 8h9, abagovomab, abciximab, abituzumab, abrilumab, actoxumab, adalimumab, adecatumumab, aducanumab, afasevikumab, afelimomab, afutuzumab, alacizumab pegol, a1d518, alemtuzumab, alirocumab, altumomab pentetate, amatuximab, anatumomab mafenatox, anetumab ravtansine, anifrolumab, anrukinzumab (ima-638), apolizumab, arcitumomab, ascrinvacumab, aselizumab, atezolizumab, atinumab, atlizumab (tocilizumab), atorolimumab, avelumab, bapineuzumab, basiliximab, bavituximab, bectumomab, begelomab, belimumab, benralizumab, bertilimumab, besilesomab, bevacizumab, bezlotoxumab, biciromab, bimagrumab, bimekizumab, bivatuzumab mertansine, bleselumab, blinatumomab, blontuvetmab, blosozumab, bococizumab, brazikumab, brentuximab vedotin, briakinumab, brodalumab, brolucizumab, brontictuzumab, cabiralizumab, canakinumab, cantuzumab mertansine, cantuzumab ravtansine, caplacizumab, capromab pendetide, carlumab, carotuximab, catumaxomab, cbr96-doxorubicin immunoconjugate, cedelizumab, cergutuzumab amunaleukin, certolizumab pegol, cetuximab, ch.14.18, citatuzumab bogatox, cixutumumab, clazakizumab, clenoliximab, clivatuzumab tetraxetan, codrituzumab, coltuximab ravtansine, conatumumab, concizumab, crenezumab, crotedumab, cr6261, dacetuzumab, daclizumab, dalotuzumab, dapirolizumab pegol, daratumumab, dectrekumab, demcizumab, denintuzumab mafodotin, denosumab, derlotuximab biotin, detumomab, dinutuximab, diridavumab, domagrozumab, dorlimomab aritox, drozitumab, duligotumab, dupilumab, durvalumab, dusigitumab, ecromeximab, eculizumab, edobacomab, edrecolomab, efalizumab, efungumab, eldelumab, elgemtumab, elotuzumab, elsilimomab, emactuzumab, emibetuzumab, emicizumab, enavatuzumab, enfortumab vedotin, enlimomab pegol, enoblituzumab, enokizumab, enoticumab, ensituximab, epitumomab cituxetan, epratuzumab, erenumab, erlizumab, ertumaxomab, etaracizumab, etrolizumab, evinacumab, evolocumab, exbivirumab, fanolesomab, faralimomab, farletuzumab, fasinumab, fbta05, felvizumab, fezakinumab, fibatuzumab, ficlatuzumab, figitumumab, firivumab, flanvotumab, fletikumab, fontolizumab, foralumab, foravirumab, fresolimumab, fulranumab, futuximab, galcanezumab, galiximab, ganitumab, gantenerumab, gavilimomab, gemtuzumab ozogamicin, gevokizumab, girentuximab, glembatumumab vedotin, golimumab, gomiliximab, guselkumab, ibalizumab, ibritumomab tiuxetan, icrucumab, idarucizumab, igovomab, imab362, imalumab, imciromab, imgatuzumab, inclacumab, indatuximab ravtansine, indusatumab vedotin, inebilizumab, infliximab, intetumumab, inolimomab, inotuzumab ozogamicin, ipilimumab, iratumumab, isatuximab, itolizumab, ixekizumab, keliximab, labetuzumab, lambrolizumab, lampalizumab, lanadelumab, landogrozumab, laprituximab emtansine, lebrikizumab, lemalesomab, lendalizumab, lenzilumab, lerdelimumab, lexatumumab, libivirumab, lifastuzumab vedotin, ligelizumab, lilotomab satetraxetan, lintuzumab, lirilumab, lodelcizumab, lokivetmab, lorvotuzumab mertansine, lucatumumab, lulizumab pegol, lumiliximab, lumretuzumab, mapatumumab, margetuximab, maslimomab, mavrilimumab, matuzumab, mepolizumab, metelimumab, milatuzumab, minretumomab, mirvetuximab soravtansine, mitumomab, mogamulizumab, monalizumab, morolimumab, motavizumab, moxetumomab pasudotox, muromonab-cd3, nacolomab tafenatox, namilumab, naptumomab estafenatox, naratuximab emtansine, narnatumab, natalizumab, navicixizumab, navivumab, nebacumab, necitumumab, nemolizumab, nerelimomab, nesvacumab, nimotuzumab, nivolumab, nofetumomab merpentan, obiltoxaximab, obinutuzumab, ocaratuzumab, ocrelizumab, odulimomab, ofatumumab, olaratumab, olokizumab, omalizumab, onartuzumab, ontuxizumab, opicinumab, oportuzumab monatox, oregovomab, orticumab, otelixizumab, otlertuzumab, oxelumab, ozanezumab, ozoralizumab, pagibaximab, palivizumab, pamrevlumab, panitumumab, pankomab, panobacumab, parsatuzumab, pascolizumab, pasotuxizumab, pateclizumab, patritumab, pembrolizumab, pemtumomab, perakizumab, pertuzumab, pexelizumab, pidilizumab, pinatuzumab vedotin, pintumomab, placulumab, plozalizumab, pogalizumab, polatuzumab vedotin, ponezumab, prezalizumab, priliximab, pritoxaximab, pritumumab, pro 140, quilizumab, racotumomab, radretumab, rafivirumab, ralpancizumab, ramucirumab, ranibizumab, raxibacumab, refanezumab, regavirumab, reslizumab, rilotumumab, rinucumab, risankizumab, rituximab, rivabazumab pegol, robatumumab, roledumab, romosozumab, rontalizumab, rovalpituzumab tesirine, rovelizumab, ruplizumab, sacituzumab govitecan, samalizumab, sapelizumab, sarilumab, satumomab pendetide, secukinumab, seribantumab, setoxaximab, sevirumab, sibrotuzumab, sgn-cd19a, sgn-cd33a, sifalimumab, siltuximab, simtuzumab, siplizumab, sirukumab, sofituzumab vedotin, solanezumab, solitomab, sonepcizumab, sontuzumab, stamulumab, sulesomab, suvizumab, tabalumab, tacatuzumab tetraxetan, tadocizumab, talizumab, tamtuvetmab, tanezumab, taplitumomab paptox, tarextumab, tefibazumab, telimomab aritox, tenatumomab, teneliximab, teplizumab, teprotumumab, tesidolumab, tetulomab, tezepelumab, tgn1412, ticilimumab (tremelimumab), tildrakizumab, tigatuzumab, timolumab, tisotumab vedotin, tnx-650, tocilizumab (atlizumab), toralizumab, tosatoxumab, tositumomab, tovetumab, tralokinumab, trastuzumab, trastuzumab emtansine, trbs07, tregalizumab, tremelimumab, trevogrumab, tucotuzumab celmoleukin, tuvirumab, ublituximab, ulocuplumab, urelumab, urtoxazumab, ustekinumab, utomilumab, vadastuximab talirine, vandortuzumab vedotin, vantictumab, vanucizumab, vapaliximab, varlilumab, vatelizumab, vedolizumab, veltuzumab, vepalimomab, vesencumab, visilizumab, vobarilizumab, volociximab, vorsetuzumab mafodotin, votumumab, xentuzumab, zalutumumab, zanolimumab, zatuximab, ziralimumab, zolimomab aritox, or derivative thereof.
- In an embodiment, the antibody molecule comprises one, two, or three CDRs of the VH region of an antibody molecule described herein, using the Kabat or Chothia definitions of CDRs. In an embodiment, the antibody molecule comprises one, two, or three CDRs of the VL region of an antibody molecule described herein, using the Kabat or Chothia definitions of CDRs. In an embodiment, the antibody molecule comprises one or more (e.g., two or three) CDRs of the VH region and/or one or more (e.g., two or three) CDRs of the VL region of an antibody molecule described herein, using the Kabat or Chothia definitions of CDRs.
- In an embodiment, the antibody molecule comprises one, two, three, or four frameworks of the VH region of an antibody molecule described herein. In an embodiment, the antibody molecule comprises one, two, three, or four frameworks of the VL region of an antibody molecule described herein. In an embodiment, the antibody molecule comprises one or more (e.g., two, three, or four) frameworks of the VH region and/or one or more (e.g., two, three, or four) frameworks of the VL region of an antibody molecule described herein.
- In an embodiment, the antibody molecule comprises a heavy chain variable region of an antibody molecule described herein, or a heavy chain variable region having an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues). In an embodiment, the antibody molecule comprises a light chain variable region of an antibody molecule described herein, or a light chain variable region having an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues). In an embodiment, the antibody molecule comprises a heavy chain variable region, or a heavy chain variable region having an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues), and a light chain variable region of an antibody molecule described herein, or a light chain variable region having an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues).
- In an embodiment, the antibody molecule further comprises a heavy chain constant region, e.g., a heavy chain constant region of an antibody molecule described herein, or a heavy chain constant region having an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues). In an embodiment, the antibody molecule further comprises a light chain constant region, e.g., a light chain constant region of an antibody molecule described herein, or a light chain constant region having an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues). In an embodiment, the antibody molecule further comprises a heavy chain constant region, or a heavy chain constant region having an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues), and a light chain constant region, or a light chain constant region having an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues). In an embodiment, the antibody molecule comprises a heavy chain constant region, a light chain constant region, and heavy and light chain variable regions of an antibody molecule, as described herein.
- The antibody molecules described herein can have several advantageous properties, including, but limited to, a desired (e.g., increased) half-life. For example, the antibody molecules can be used to effectively treat, prevent or diagnose a disorder described herein.
- In an embodiment, the antibody molecule is capable of binding to a target molecule or cell. For example, the engineered antibody molecule is capable of binding to the target molecule or cell, with the same, or substantially the same, binding specificity and/or affinity, as compared to the parental antibody molecule. In an embodiment, the antibody molecule binds to the target molecule or cell with high affinity, e.g., with a dissociation constant (Kd) of less than about 100 nM, typically about 10 nM, and more typically, about 10-0.01 nM, about 5-0.01 nM, about 3-0.05 nM, about 1-0.1 nM, or stronger, e.g., less than about 80, 70, 60, 50, 40, 30, 20, 10, 8, 6, 4, 3, 2, 1, 0.5, 0.2, 0.1, 0.05, or 0.01 nM. In an embodiment, the antibody molecule binds to the target molecule or cell with a Koff slower than 1×10−4, 5×10−5, or 1×10−5 s−1. In an embodiment, the antibody molecule binds to the target molecule or cell with a Kon faster than 1×104, 5×104, 1×105, or 5×105 M−1s−1.
- In an embodiment, the antibody molecule is capable of inhibiting or activating a biological function of a target molecule or cell. For example, the engineered antibody molecule is capable of inhibiting or activating a biological function of the target molecule or cell, with the same, or substantially the same, level of effectiveness, as compared to the parental antibody molecule, e.g., as determined by IC50, EC50, or LD50.
- In an embodiment, the antibody molecule is capable of binding to an epitope on a target molecule or cell. For example, the engineered antibody molecule is capable of binding to the same, or substantially the same, epitope on the target molecule or cell, as compared to the parental antibody molecule.
- The methods described herein can be used to engineer a variety of fusion proteins, e.g., any Fc fusion protein containing an Fc region.
- Exemplary Fc fusion proteins include, but are not limited to, a CTLA-4 Fc fusion protein (e.g., belatacept or abatacept), a vascular endothelial growth factor receptor (VEGFR) Fc fusion protein (e.g., a VEGFR1/VEGFR2 Fc fusion protein, e.g., aflibercept or KH902), an IL-1R Fc fusion protein (e.g., (rilonacept), a thrombopoietin-binding peptide Fc fusion protein (e.g., romiplostim), an LFA-3 Fc fusion protein (e.g., alefacept), an anti-CD40L Fc fusion protein (e.g., a dimeric fusion protein comprising the C-terminus of the domain antibody (dAb) targeting the CD40 ligand (CD40L or CD154) linked to an Fc fragment of IgG1, e.g., BMS-986004 or letolizumab), an TNF receptor (TNFR) Fc fusion protein (e.g., a recombinant TNF receptor 2 (TNFR2) fused to an IgG1 Fc domain, e.g., OPRX-106 or etanercept), a coagulation Factor VIII-Fc fusion protein (e.g., BIIB031, efraloctocog-α, or rFVIIIFc), a coagulation Factor IX-Fc Fusion Protein (e.g., BIIB029 or eftrenonacog-α), a Factor IX Fc fusion protein (e.g., rFIXFc), a granulocyte colony-stimulating factor Fc fusion protein (e.g., F-627), a follicle stimulating hormone (FSH) Fc fusion protein (e.g., KNO15), an activin type 2B receptor Fc fusion protein (e.g., STM 434), an activin receptor-like kinase 1 (ALK-1) inhibitor receptor Fc fusion protein (e.g., dalantercept), an RNase Fc fusion (e.g., RSLV-132), an anti-angiopoietin peptibody (e.g., a peptide with angiopoietin-binding properties that is fused to the Fc region, e.g., AMG 386), a tissue nonspecific alkaline phosphatase (TNSALP) Fc fusion protein (e.g., asfotase alfa or ENB-0040), a CD24 Fc fusion protein, a BAFF-Fc fusion protein (e.g., blisibimod), a GLP1 peptide analog Fc fusion protein (e.g., dulaglutide or LY2189265), an erythropoietin-mimetic peptide Fc fusion protein (e.g., an erythropoietin-mimetic peptide-IgG1 Fc mimetibody (e.g., CNTO 528), or an erythropoietin-mimetic peptide-IgG4 Fc fusion protein mimetibody (e.g., CNTO 530)), or a CD95 Fc fusion (e.g., APG 101 or apocept).
- The polypeptides (e.g., antibody molecules or fusion proteins) described herein can be evaluated in vivo, e.g., using various animal models. For example, an animal model can be used to test the efficacy of a polypeptide (e.g., antibody molecule or fusion proteins) described herein in modulating a biological function of a target molecule or cell. As another example, an animal model can also be used to test the efficacy of a polypeptide (e.g., antibody molecule) described herein in in treating, preventing, or diagnosing a disorder described herein Animal models can also be used, e.g., to investigate for side effects, measure concentrations of antibody molecules in situ, demonstrate correlations between a function of a target molecule or cell and a disorder described herein.
- Exemplary animal models for other disorders described herein are also known in the art. Exemplary types of animals that can be used to evaluate the antibody molecules described herein include, but are not limited to, mice, rats, rabbits, guinea pigs, and monkeys. Non-human primates and transgenic mice expressing human FcRn are typically used as the model of choice for PK analysis (Avery et al. MAbs. 2016; 8(6):1064-78; Fan et al. MAbs. 2016; 8(5):848-53; Tam et al. MAbs. 2013; 5(3):397-405).
- For example, humanized FcRn mice can be established on the C57BL/6J background in a sequential manner, including the creation of a mouse strain carrying a deletion in the mouse FcRn gene, followed by introduction of the human FcRn gene. Exemplary mouse lines include, e.g., Tg276 and Tg32 (The Jackson Laboratory stock number 004919 and 014565). With further backcrossing and sequential alterations, additional lines can be made. Exemplary mouse models that can be used to evaluate the polypeptides described herein include, but are not limited to, FcRn-null mice, humanized Tg276 FcRn mice (e.g., B6.Cg-Fcgrt<tm1Dcr>Tg(CAG-FCGRT)276Dcr/DcrJ with the Jackson Laboratory stock number 004919), humanized Tg32 FcRn mice (e.g., B6.Cg-Fcgrt<tm1Dcr>Tg(FCGRT)32Dcr/DcrJ with the Jackson Laboratory stock number 014565), immunodeficient hFcRn mice (e.g., B6.Cg-Fcgrt<tm1Dcr>Prkdc<scid>Tg(CAG-FCGRT)276Dcr/DcrJ with the Jackson Laboratory stock number 021146), B6.Cg-Fcgrt<tm1Dcr>Prkdc<scid>Tg(FCGRT)32Dcr/DcrJ with the Jackson Laboratory stock number 018441, and B6.Cg-Rag1<tm>Mom<Fcgrt>tm1Dcr[Tg(CAG-FCGRT)276Dcr/DcrJ with the Jackson Laboratory stock number 16919), e.g., as described in Proetzel et al. BioDrugs. 2014; 28(2): 171-180.
- In some aspects, this disclosure provides compositions, e.g., pharmaceutically acceptable compositions, which include a polypeptide (e.g., an antibody molecule or fusion protein) described herein, formulated together with a pharmaceutically acceptable carrier.
- As used herein, “pharmaceutically acceptable carrier” includes any and all solvents, dispersion media, isotonic and absorption delaying agents, and the like that are physiologically compatible. The carrier can be suitable for intravenous, intramuscular, subcutaneous, parenteral, rectal, spinal or epidermal administration (e.g., by injection or infusion). In certain embodiments, less than about 5%, e.g., less than about 4%, 3%, 2%, or 1% of the antibody molecules in the pharmaceutical composition are present as aggregates. In other embodiments, at least about 95%, e.g., at least about 96%, 97%, 98%, 98.5%, 99%, 99.5%, 99.8%, or more of the antibody molecules in the pharmaceutical composition are present as monomers. In some embodiments, the level of aggregates or monomers is determined by chromatography, e.g., high performance liquid chromatography size exclusion chromatography (HPLC-SEC).
- The compositions set out herein may be in a variety of forms. These include, for example, liquid, semi-solid and solid dosage forms, such as liquid solutions (e.g., injectable and infusible solutions), dispersions or suspensions, liposomes, and suppositories. A suitable form depends on the intended mode of administration and therapeutic application. Typical suitable compositions are in the form of injectable or infusible solutions. One suitable mode of administration is parenteral (e.g., intravenous, subcutaneous, intraperitoneal, intramuscular). In an embodiment, the polypeptide (e.g., antibody molecule or fusion proteins) is administered by intravenous infusion or injection. In another embodiment, the polypeptide (e.g., antibody molecule or fusion proteins) is administered by intramuscular or subcutaneous injection.
- The phrases “parenteral administration” and “administered parenterally” as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion.
- Therapeutic compositions typically should be sterile and stable under the conditions of manufacture and storage. The composition can be formulated as a solution, microemulsion, dispersion, liposome, or other ordered structure suitable to high antibody concentration. Sterile injectable solutions can be prepared by incorporating the active compound (i.e., antibody or antibody portion) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof. The proper fluidity of a solution can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Prolonged absorption of injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
- The polypeptides (e.g., antibody molecules or fusion proteins) described herein can be administered by a variety of methods. Several are known in the art, and for many therapeutic, prophylactic, or diagnostic applications, an appropriate route/mode of administration is intravenous injection or infusion. For example, the antibody molecules can be administered by intravenous infusion at a rate of less than 10 mg/min; preferably less than or equal to 5 mg/min to reach a dose of about 1 to 100 mg/m2, preferably about 5 to 50 mg/m2, about 7 to 25 mg/m2 and more preferably, about 10 mg/m2. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results. In certain embodiments, the active compound may be prepared with a carrier that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are patented or generally known to those skilled in the art. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978.
- In certain embodiments, a polypeptide (e.g., an antibody molecule or fusion protein) can be orally administered, for example, with an inert diluent or an assimilable edible carrier. The antibody molecule (and other ingredients, if desired) may also be enclosed in a hard or soft shell gelatin capsule, compressed into tablets, or incorporated directly into the subject's diet. For oral therapeutic administration, the antibody molecule may be incorporated with excipients and used in the form of ingestible tablets, buccal tablets, troches, capsules, elixirs, suspensions, syrups, wafers, and the like. To administer a polypeptide (e.g., an antibody molecule) by other than parenteral administration, it may be necessary to coat the compound with, or co-administer the compound with, a material to prevent its inactivation. Therapeutic, prophylactic, or diagnostic compositions can also be administered with medical devices, and several are known in the art.
- Dosage regimens are adjusted to provide the desired response (e.g., a therapeutic, prophylactic, or diagnostic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms are dictated by and directly dependent on (a) the unique characteristics of the antibody molecule and the particular therapeutic, prophylactic, or diagnostic effect to be achieved, and (b) the limitations inherent in the art of compounding such an antibody molecule for the treatment of sensitivity in individuals.
- An exemplary, non-limiting range for a therapeutically, prophylactically, or diagnostically effective amount of an antibody molecule is about 0.1-50 mg/kg, e.g., about 0.1-30 mg/kg, e.g., about 1-30, 1-15, 1-10, 1-5, 5-10, or 1-3 mg/kg, e.g., about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, or 50 mg/kg. The antibody molecule can be administered by intravenous infusion at a rate of less than 10 mg/min, e.g., less than or equal to 5 mg/min to reach a dose of about 1 to 100 mg/m2, e.g., about 5 to 50 mg/m2, about 7 to 25 mg/m2, e.g., about 10 mg/m2. It is to be noted that dosage values may vary with the type and severity of the condition to be alleviated. It is to be further understood that for any particular subject, specific dosage regimens should be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the compositions, and that dosage ranges set forth herein are exemplary only and are not intended to limit the scope or practice of the claimed compositions.
- The pharmaceutical compositions herein may include a “therapeutically effective amount,” “prophylactically effective amount,” or “diagnostically effectively amount” of a polypeptide (e.g., an antibody molecule) described herein.
- A “therapeutically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic result. A therapeutically effective amount of the polypeptide (e.g., antibody molecule or fusion protein) may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the antibody or antibody portion to elicit a desired response in the individual. A therapeutically effective amount is also one in which any toxic or detrimental effect of the antibody molecule is outweighed by the therapeutically beneficial effects. A “therapeutically effective dosage” typically inhibits a measurable parameter by at least about 20%, e.g., by at least about 40%, by at least about 60%, or by at least about 80% relative to untreated subjects. The measurable parameter may be, e.g., hematuria, colored urine, foamy urine, pain, swelling (edema) in the hands and feet, or high blood pressure. The ability of an antibody molecule to inhibit a measurable parameter can be evaluated in an animal model system predictive of efficacy in treating or preventing a disorder described herein. Alternatively, this property of a composition can be evaluated by examining the ability of the polypeptide (e.g., antibody molecule or fusion proteins) to modulate a biological function of a target molecule or cell, e.g., by an in vitro assay.
- A “prophylactically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.
- A “diagnostically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired diagnostic result. Typically, a diagnostically effective amount is one in which a disorder, e.g., a disorder described herein, can be diagnosed in vitro, ex vivo, or in vivo.
- Also within this disclosure is a kit that comprises a polypeptide (e.g., an antibody molecule or fusion protein), described herein. The kit can include one or more other elements including: instructions for use; other reagents, e.g., a label, a therapeutic agent, or an agent useful for chelating, or otherwise coupling, an antibody molecule to a label or therapeutic agent, or a radioprotective composition; devices or other materials for preparing the polypeptide (e.g., antibody molecule or fusion protein) for administration; pharmaceutically acceptable carriers; and devices or other materials for administration to a subject.
- The present disclosure also features nucleic acids comprising nucleotide sequences that encode polypeptides (e.g., antibody molecules or fusion proteins), e.g., Fc regions of the polypeptides, as described herein.
- For example, the present disclosure features a nucleic acid encoding an Fc region described herein, e.g., an Fc region comprising one or more of the mutations described herein. The Fc region can be engineered from an Fc region of an existing polypeptide (e.g., an antibody molecule or fusion protein) described herein. The nucleic acid can comprise a nucleotide sequence encoding an amino acid sequence of an Fc region of a polypeptide (e.g., antibody molecule or fusion protein) described herein, or a nucleotide sequence substantially identical thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein).
- In an embodiment, the nucleic acid further comprises a nucleotide sequence encoding a heavy chain variable region of a polypeptide (e.g., an antibody molecule or fusion protein) described herein, or having a nucleotide sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein). In another embodiment, the nucleic acid further comprises a nucleotide sequence encoding a light chain variable region of a polypeptide (e.g., an antibody molecule or fusion protein) described herein, or a nucleotide sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein). In yet another embodiment, the nucleic acid further comprises a nucleotide sequence encoding a heavy chain variable region and a light chain variable region of a polypeptide (e.g., an antibody molecule or fusion protein) described herein, or a nucleotide sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein).
- In an embodiment, the nucleic acid further comprises a nucleotide sequence encoding at least one, two, or three CDRs from a heavy chain variable region of a polypeptide (e.g., an antibody molecule or fusion protein) described herein, or a nucleotide sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein). In another embodiment, the nucleic acid further comprises a nucleotide sequence encoding at least one, two, or three CDRs from a light chain variable region of a polypeptide (e.g., an antibody molecule or fusion protein) described herein, or a nucleotide sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein). In yet another embodiment, the nucleic acid comprises a nucleotide sequence encoding at least one, two, three, four, five, or six CDRs from heavy and light chain variable regions of a polypeptide (e.g., an antibody molecule or fusion protein) described herein, or a nucleotide sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein).
- In an embodiment, the nucleic acid comprises a portion of a nucleotide sequence described herein. The portion may encode, for example, an Fc region, a variable region (e.g., VH or VL); one, two, or three or more (e.g., four, five, or six) CDRs; or one, two, three, or four or more framework regions.
- The nucleic acids disclosed herein include deoxyribonucleotides or ribonucleotides, or analogs thereof. The polynucleotide may be either single-stranded or double-stranded, and if single-stranded may be the coding strand or non-coding (antisense) strand. A polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs. The sequence of nucleotides may be interrupted by non-nucleotide components. A polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component. The nucleic acid may be a recombinant polynucleotide, or a polynucleotide of genomic, cDNA, semisynthetic, or synthetic origin which either does not occur in nature or is linked to another polynucleotide in a non-natural arrangement.
- In some aspects, the application features host cells and vectors containing the nucleic acids described herein. The nucleic acids may be present in a single vector or separate vectors present in the same host cell or separate host cell, as described in more detail below.
- The present disclosure features vectors that comprise nucleotide sequences encoding polypeptides (e.g., an antibody molecules or fusion proteins), e.g., Fc regions of the polypeptides, as described herein.
- For example, the present disclosure features a vector comprising a nucleotide sequence encoding an Fc region described herein, e.g., an Fc region comprising one or more of the mutations described herein. The Fc region can be engineered from an Fc region of an existing polypeptide (e.g., an antibody molecule or fusion protein) described herein. The vector can comprise a nucleotide sequence encoding an amino acid sequence of an Fc region of a polypeptide (e.g., antibody molecule or fusion protein) described herein, or a nucleotide sequence substantially identical thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein).
- The vectors include, but are not limited to, a virus, plasmid, cosmid, lambda phage or a yeast artificial chromosome (YAC).
- Numerous vector systems can be employed. For example, one class of vectors utilizes DNA elements which are derived from animal viruses such as, for example, bovine papilloma virus, polyoma virus, adenovirus, vaccinia virus, baculovirus, retroviruses (Rous Sarcoma Virus, MMTV or MOMLV) or SV40 virus. Another class of vectors utilizes RNA elements derived from RNA viruses such as Semliki Forest virus, Eastern Equine Encephalitis virus and Flaviviruses.
- Additionally, cells which have stably integrated the DNA into their chromosomes may be selected by introducing one or more markers which allow for the selection of transfected host cells. The marker may provide, for example, prototropy to an auxotrophic host, biocide resistance (e.g., antibiotics), or resistance to heavy metals such as copper, or the like. The selectable marker gene can be either directly linked to the DNA sequences to be expressed, or introduced into the same cell by cotransformation. Additional elements may also be needed for optimal synthesis of mRNA. These elements may include splice signals, as well as transcriptional promoters, enhancers, and termination signals.
- Once the expression vector or DNA sequence containing the constructs has been prepared for expression, the expression vectors may be transfected or introduced into an appropriate host cell. Various techniques may be employed to achieve this, such as, for example, protoplast fusion, calcium phosphate precipitation, electroporation, retroviral transduction, viral transfection, gene gun, lipid based transfection or other conventional techniques. In the case of protoplast fusion, the cells are grown in media and screened for the appropriate activity.
- Methods and conditions for culturing the resulting transfected cells and for recovering the polypeptide (e.g., antibody molecule) produced are known to those skilled in the art, and may be varied or optimized depending upon the specific expression vector and mammalian host cell employed, based upon the present description.
- The present disclosure also provides host cells comprising a nucleic acid encoding a polypeptide (e.g., an antibody molecule or fusion protein) as described herein. The polypeptide (e.g., antibody molecule or fusion protein) can be engineered in accordance with a method described herein. For example, the host cells may comprise a nucleic acid molecule having a nucleotide sequence of a polypeptide described herein (e.g., an antibody molecule or fusion protein described herein), a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein), or a portion of one of said nucleic acids.
- In some embodiments, the host cells are genetically engineered to comprise nucleic acids encoding the polypeptide (e.g., antibody molecule or fusion protein) described herein.
- In certain embodiments, the host cells are genetically engineered by using an expression cassette. The phrase “expression cassette,” refers to nucleotide sequences, which are capable of affecting expression of a gene in hosts compatible with such sequences. Such cassettes may include a promoter, an open reading frame with or without introns, and a termination signal. Additional factors necessary or helpful in effecting expression may also be used, such as, for example, an inducible promoter.
- The disclosure also provides host cells comprising the vectors described herein.
- The cell can be, but is not limited to, a eukaryotic cell, a bacterial cell, an insect cell, or a human cell. Suitable eukaryotic cells include, but are not limited to, Vero cells, HeLa cells, COS cells, CHO cells, HEK293 cells, BHK cells and MDCKII cells. Suitable insect cells include, but are not limited to, Sf9 cells.
- The polypeptides (e.g., antibody molecules or fusion proteins) disclosed herein, as well as the pharmaceutical compositions disclosed herein, have in vitro, ex vivo, and in vivo therapeutic, prophylactic, and/or diagnostic utilities.
- In an embodiment, the polypeptide (e.g., antibody molecule or fusion protein) modulates (e.g., reduces (e.g., inhibits, blocks, or neutralizes) or increases (e.g., activates, initiates, or enhances)) one or more biological activities of a target molecule (e.g., protein) or cell. For example, these polypeptides (e.g., antibody molecules or fusion proteins) can be administered to cells in culture, in vitro or ex vivo, or to a subject, e.g., a human subject, e.g., in vivo, to modulate one or more biological activities of the target molecule or cell. Accordingly, in an aspect, the disclosure provides a method of treating, preventing, or diagnosing a disorder, e.g., a disorder described herein, in a subject, comprising administering to the subject a polypeptide (e.g., an antibody molecule or fusion protein) described herein, such that the disorder is treated, prevented, or diagnosed. For example, the disclosure provides a method comprising contacting the polypeptide (e.g., antibody molecule or fusion protein) described herein with cells in culture, e.g. in vitro or ex vivo, or administering the polypeptide (e.g., antibody molecule or fusion protein) described herein to a subject, e.g., in vivo, to treat, prevent, or diagnose a disorder, e.g., a disorder associated with a target molecule or cell (e.g., a disorder described herein).
- As used herein, the term “subject” is intended to include human and non-human animals. In some embodiments, the subject is a human subject, e.g., a human patient having a disorder described herein, or at risk of having a disorder described herein. The term “non-human animals” includes mammals and non-mammals, such as non-human primates. In an embodiment, the subject is a human. The methods and compositions described herein are suitable for treating human patients for a disorder described herein. Patients having a disorder described herein include those who have developed a disorder described herein but are (at least temporarily) asymptomatic, patients who have exhibited a symptom of a disorder described herein, or patients having a disorder related to or associated with a disorder described herein.
- The polypeptides (e.g., antibody molecules or fusion proteins) described herein can be used to treat or prevent disorders or conditions. In an embodiment, the polypeptide has an optimal or improved half-life, which can be desirable for treating or preventing the disorder or condition. While not wishing to be bound by theory, it is believed that in an embodiment, the polypeptide described herein (e.g., the polypeptide having an optimal or improved half-life) can provide one or more benefits over another polypeptide having the same or similar binding affinity and/or specificity (e.g., a polypeptide that does not have, or has not been engineered to have, an optimal or improved half-life). These benefits can include, but are not limited to, an increased therapeutic or preventive efficacy, a reduced dosage regimen, or an improved pharmacokinetic property. In an embodiment, the polypeptide includes a mutated Fc region as described herein.
- Exemplary disorders or conditions that can be treated or prevented by the polypeptides described herein include, but are not limited to, a cancer (e.g., a solid tumor or a hematologic cancer), an infectious disease (e.g., a bacterial infection or a viral infection), an immune disorder (e.g., an autoimmune disorder), an inflammatory disorder, a metabolic disorder (e.g., diabetes), a cardiovascular disorder, an organ transplant rejection. In an embodiment, the disorder is a chronic disorder.
- Exemplary cancers that can be treated or prevented by the polypeptides described herein include, but are not limited to, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), adrenocortical carcinoma, Kaposi sarcoma, an AIDS-related lymphoma, primary central nervous system (CNS) lymphoma, anal cancer, appendix cancer, astrocytoma, atypical teratoid/rhabdoid tumor, basal cell carcinoma, bile duct cancer, bladder cancer, bone cancer (e.g., Ewing sarcoma or osteosarcoma and malignant fibrous histiocytoma), brain tumor (e.g., astrocytomas, brain stem glioma, central nervous system atypical teratoid/rhabdoid tumor, central nervous system embryonal tumor, central nervous system germ cell tumor, craniopharyngioma, or ependymoma), breast cancer, bronchial tumor, Burkitt lymphoma, carcinoid tumor (e.g., gastrointestinal carcinoid tumor), cardiac (heart) tumor, embryonal tumor, germ cell tumor, lymphoma, cervical cancer, cholangiocarcinoma, chordoma, chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), chronic myeloproliferative neoplasm, colon cancer, colorectal cancer, craniopharyngioma, cutaneous T-cell lymphoma, ductal carcinoma in situ (DCIS), endometrial cancer, ependymoma, esophageal cancer, esthesioneuroblastoma, Ewing sarcoma, extracranial germ cell tumor, extragonadal germ cell tumor, eye cancer (e.g., intraocular melanoma or retinoblastoma), fallopian tube cancer, fibrous histiocytoma of bone, osteosarcoma, gallbladder cancer, gastric (stomach) cancer, gastrointestinal carcinoid tumor, gastrointestinal stromal tumors (GIST), germ cell tumor (e.g., central nervous system tumor, extracranial tumor, extragonadal tumor, ovarian cancer, or testicular cancer), gestational trophoblastic disease, glioma, hairy cell leukemia, head and neck cancer, hepatocellular (liver) cancer, Hodgkin lymphoma, hypopharyngeal cancer, intraocular melanoma, islet cell tumor, pancreatic neuroendocrine tumor, Kaposi sarcoma, kidney cancer (e.g., renal cell cancer or Wilms tumor), Langerhans cell histiocytosis (LCH), laryngeal cancer, leukemia (e.g., acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), or hairy cell leukemia), lip and oral cavity cancer, liver cancer, lung cancer (e.g., non-small cell lung cancer (NSCLC) or small cell lung cancer), lymphoma (e.g., aids-related, Burkitt lymphoma, cutaneous T-cell lymphoma, Hodgkin lymphoma, non-Hodgkin lymphoma, or primary central nervous system (CNS) lymphoma), Waldenström macroglobulinemia, male breast cancer, malignant fibrous histiocytoma of bone and osteosarcoma, melanoma (e.g., intraocular (eye) melanoma), Merkel cell carcinoma, mesothelioma, metastatic squamous neck cancer, midline tract carcinoma, mouth cancer, multiple endocrine neoplasia syndrome, multiple myeloma/plasma cell neoplasm, mycosis fungoides, myelodysplastic syndrome, myelodysplastic/myeloproliferative neoplasm, chronic myeloproliferative neoplasm, nasal cavity and paranasal sinus cancer, nasopharyngeal cancer, neuroblastoma, oral cancer, lip and oral cavity cancer, oropharyngeal cancer, osteosarcoma and malignant fibrous histiocytoma of bone, ovarian cancer (e.g., epithelial ovarian cancer or germ cell ovarian tumor), pancreatic cancer, pancreatic neuroendocrine tumors (islet cell tumors), papillomatosis, paraganglioma, paranasal sinus and nasal cavity cancer, parathyroid cancer, penile cancer, pharyngeal cancer, pheochromocytoma, pituitary tumor, pleuropulmonary blastoma, peritoneal cancer, prostate cancer, rectal cancer, retinoblastoma, rhabdomyosarcoma, salivary gland cancer, sarcoma (e.g., Ewing sarcoma, Kaposi sarcoma, osteosarcoma, rhabdomyosarcoma, soft tissue sarcoma, or uterine sarcoma), Sezary syndrome, skin cancer (e.g., melanoma, Merkel cell carcinoma, or nonmelanoma skin cancer), small intestine cancer, squamous cell carcinoma, testicular cancer, throat cancer, thymoma and thymic carcinoma, thyroid cancer, transitional cell cancer of the renal pelvis and ureter, urethral cancer, endometrial uterine cancer, vaginal cancer, vulvar cancer, or a metastatic lesion thereof.
- Exemplary infectious diseases that can be treated or prevented by the polypeptides described herein include, but are not limited to, Acinetobacter infections, actinomycosis, African sleeping sickness (African trypanosomiasis), AIDS (acquired immunodeficiency syndrome), amebiasis, anaplasmosis, angiostrongyliasis, anisakiasis, anthrax, arcanobacterium haemolyticum infection, argentine hemorrhagic fever, ascariasis, aspergillosis, astrovirus infection, babesiosis, Bacillus cereus infection, bacterial pneumonia, bacterial vaginosis, bacteroides infection, balantidiasis, bartonellosis, baylisascaris infection, bk virus infection, black piedra, blastocystosis, blastomycosis, bolivian hemorrhagic fever, botulism (and infant botulism), brazilian hemorrhagic fever, brucellosis, bubonic plague, burkholderia infection, buruli ulcer, calicivirus infection (norovirus and sapovirus), campylobacteriosis, candidiasis (moniliasis; thrush), capillariasis, carrion's disease, cat-scratch disease, cellulitis, chagas disease (american trypanosomiasis), chancroid, chickenpox, chikungunya, chlamydia, chlamydophila pneumoniae infection (taiwan acute respiratory agent or twar), cholera, chromoblastomycosis, chytridiomycosis, clonorchiasis, Clostridium difficile colitis, coccidioidomycosis, colorado tick fever (CTF), common cold (Acute viral rhinopharyngitis; Acute coryza), Creutzfeldt-Jakob disease (CJD), Crimean-Congo hemorrhagic fever (CCHF), cryptococcosis, cryptosporidiosis, cutaneous larva migrans (CLM), cyclosporiasis, cysticercosis, cytomegalovirus infection, dengue fever, desmodesmus infection, dientamoebiasis, diphtheria, diphyllobothriasis, dracunculiasis, ebola hemorrhagic fever, echinococcosis, ehrlichiosis, enterobiasis (pinworm infection), enterococcus infection, enterovirus infection, epidemic typhus, erythema infectiosum (fifth disease), exanthem subitum (sixth disease), fasciolasis, fasciolopsiasis, fatal familial insomnia (FFI), filariasis, food poisoning by Clostridium perfringens, free-living amebic infection, fusobacterium infection, gas gangrene (clostridial myonecrosis), geotrichosis, gerstmann-straussler-scheinker syndrome (GSS), giardiasis, glanders, gnathostomiasis, gonorrhea, granuloma inguinale (donovanosis), Group A streptococcal infection, Group B streptococcal infection, Haemophilus influenzae infection, hand, foot and mouth disease (HFMD), Hantavirus Pulmonary Syndrome (HPS), heartland virus disease, Helicobacter pylori infection, hemolytic-uremic syndrome (HUS), hemorrhagic fever with renal syndrome (HFRS), hepatitis A, hepatitis B, hepatitis C, hepatitis D, hepatitis E, herpes simplex, histoplasmosis, hookworm infection, human bocavirus infection, human ewingii ehrlichiosis, human granulocytic anaplasmosis (HGA), human metapneumovirus infection, Human monocytic ehrlichiosis, human papillomavirus (HPV) infection, Human parainfluenza virus infection, Hymenolepiasis, Epstein-Barr Virus Infectious Mononucleosis (Mono), influenza (flu), isosporiasis, kawasaki disease, keratitis, kingella kingae infection, kuru, lassa fever, legionellosis (legionnaires' disease), legionellosis (pontiac fever), leishmaniasis, leprosy, leptospirosis, listeriosis, lyme disease (lyme borreliosis), lymphatic filariasis (Elephantiasis), Lymphocytic choriomeningitis, Malaria, Marburg hemorrhagic fever (MHF), Measles, Middle East respiratory syndrome (MERS), melioidosis (Whitmore's disease), meningitis, meningococcal disease, metagonimiasis, microsporidiosis, molluscum contagiosum (MC), Monkeypox, Mumps, Murine typhus (Endemic typhus), Mycoplasma pneumonia, Mycetoma (disambiguation), Myiasis, Neonatal conjunctivitis (Ophthalmia neonatorum), (New) Variant Creutzfeldt-Jakob disease (vCJD, nvCJD), nocardiosis, onchocerciasis (River blindness), opisthorchiasis, paracoccidioidomycosis (South American blastomycosis), paragonimiasis, pasteurellosis, pediculosis capitis (head lice), pediculosis corporis (body lice), pediculosis pubis (pubic lice, crab lice), pelvic inflammatory disease (PID), pertussis (Whooping cough), plague, pneumococcal infection, pneumocystis pneumonia (PCP), pneumonia, poliomyelitis, prevotella infection, primary amoebic meningoencephalitis (PAM), progressive multifocal leukoencephalopathy, psittacosis, Q fever, rabies, relapsing fever, respiratory syncytial virus infection, rhinosporidiosis, rhinovirus infection, rickettsial infection, rickettsialpox, Rift Valley fever (RVF), Rocky Mountain spotted fever (RMSF), rotavirus infection, rubella, salmonellosis, SARS (Severe Acute Respiratory Syndrome), scabies, schistosomiasis, sepsis, shigellosis (Bacillary dysentery), shingles (Herpes zoster), smallpox (Variola), sporotrichosis, staphylococcal food poisoning, staphylococcal infection, strongyloidiasis, subacute sclerosing panencephalitis, syphilis, Taeniasis, Tetanus (Lockjaw), Tinea barbae (Barber's itch), Tinea capitis (Ringworm of the Scalp), Tinea corporis (Ringworm of the Body), Tinea cruris (Jock itch), Tinea manum (Ringworm of the Hand), Tinea nigra, Tinea pedis (Athlete's foot), Tinea unguium (Onychomycosis), Tinea versicolor (Pityriasis versicolor), Toxocariasis (Ocular Larva Migrans (OLM)), Toxocariasis (Visceral Larva Migrans (VLM)), Trachoma, Toxoplasmosis, Trichinosis, Trichomoniasis, Trichuriasis (Whipworm infection), Tuberculosis, Tularemia, Typhoid fever, Typhus fever, Ureaplasma urealyticum infection, Valley fever, Venezuelan equine encephalitis, Venezuelan hemorrhagic fever, Vibrio vulnificus infection, Vibrio parahaemolyticus enteritis, viral pneumonia, West Nile Fever, white piedra (Tinea blanca), Yersinia pseudotuberculosis infection, yersiniosis, yellow fever, Zika fever, or zygomycosis.
- Exemplary immune disorders or conditions that can be treated or prevented by the polypeptides described herein include, but are not limited to, Addison's disease, agammaglobulinemia, alopecia areata, amyloidosis, ankylosing spondylitis, anti-GBM/anti-TBM nephritis, antiphospholipid syndrome (APS), autoimmune hepatitis, autoimmune inner ear disease (AIED), axonal & neuronal neuropathy (AMAN), Behcet's disease, Bullous pemphigoid, Castleman disease (CD), Celiac disease, Chagas disease, chronic inflammatory demyelinating polyneuropathy (CIDP), chronic recurrent multifocal osteomyelitis (CRMO), Churg-Strauss, Cicatricial pemphigoid/benign mucosal pemphigoid, Cogan's syndrome, Cold agglutinin disease, Congenital heart block, Coxsackie myocarditis, CREST syndrome, Crohn's disease, dermatitis herpetiformis, dermatomyositis, Devic's disease (neuromyelitis optica), Discoid lupus, Dressler's syndrome, endometriosis, eosinophilic esophagitis (EoE), eosinophilic fasciitis, erythema nodosum, essential mixed cryoglobulinemia, Evans syndrome, fibromyalgia, fibrosing alveolitis, giant cell arteritis (temporal arteritis), giant cell myocarditis, Glomerulonephritis, Goodpasture's syndrome, Granulomatosis with Polyangiitis, Graves' disease, Guillain-Barre syndrome, Hashimoto's thyroiditis, hemolytic anemia, Henoch-Schonlein purpura (HSP), herpes gestationis or pemphigoid gestationis (PG), hypogammalglobulinemia, IgA nephropathy, IgG4-related sclerosing disease, inclusion body myositis (IBM), interstitial cystitis (IC), juvenile arthritis, juvenile diabetes (Type 1 diabetes), juvenile myositis (JM), Kawasaki disease, Lambert-Eaton syndrome, leukocytoclastic vasculitis, Lichen planus, Lichen sclerosus, Ligneous conjunctivitis, linear IgA disease (LAD), lupus, Lyme disease chronic, Meniere's disease, microscopic polyangiitis (MPA), mixed connective tissue disease (MCTD), Mooren's ulcer, Mucha-Habermann disease, multiple sclerosis (MS), Myasthenia gravis, Myositis, Narcolepsy, Neuromyelitis optica, neutropenia, ocular cicatricial pemphigoid, optic neuritis, palindromic rheumatism (PR), PANDAS (Pediatric Autoimmune Neuropsychiatric Disorders Associated with Streptococcus), paraneoplastic cerebellar degeneration (PCD), Paroxysmal nocturnal hemoglobinuria (PNH), Parry Romberg syndrome, Pars planitis (peripheral uveitis), Parsonnage-Turner syndrome, Pemphigus, peripheral neuropathy, Perivenous encephalomyelitis, pernicious anemia (PA), POEMS syndrome (polyneuropathy, organomegaly, endocrinopathy, monoclonal gammopathy, skin changes), polyarteritis nodosa, polymyalgia rheumatica, polymyositis, postmyocardial infarction syndrome, postpericardiotomy syndrome, primary biliary cirrhosis, primary sclerosing cholangitis, progesterone dermatitis, psoriasis, psoriatic arthritis, pure red cell aplasia (PRCA), pyoderma gangrenosum, Raynaud's phenomenon, Reactive Arthritis, Reflex sympathetic dystrophy, Reiter's syndrome, relapsing polychondritis, restless legs syndrome (RLS), retroperitoneal fibrosis, rheumatic fever, rheumatoid arthritis (RA), sarcoidosis, Schmidt syndrome, scleritis, scleroderma, Sjogren's syndrome, sperm & testicular autoimmunity, Stiff person syndrome (SPS), subacute bacterial endocarditis (SBE), Susac's syndrome, sympathetic ophthalmia (SO), Takayasu's arteritis, temporal arteritis/Giant cell arteritis, thrombocytopenic purpura (TTP), Tolosa-Hunt syndrome (THS), transverse myelitis, type 1 diabetes, ulcerative colitis (UC), undifferentiated connective tissue disease (UCTD), uveitis, vasculitis, vitiligo, or Wegener's granulomatosis (Granulomatosis with Polyangiitis (GPA)).
- The polypeptides (e.g., antibody molecules or fusion proteins) described herein are typically administered at a frequency that keeps a therapeutically effective level of polypeptides in the patient's system until the patient recovers. For example, the polypeptides may be administered at a frequency that achieves a serum concentration sufficient for at least about 1, 2, 5, 10, 20, 30, or 40 polypeptides to bind each target molecule or cell. In an embodiment, the polypeptides are administered every 1, 2, 3, 4, 5, 6, or 7 days, every 1, 2, 3, 4, 5, or 6 weeks, or every 1, 2, 3, 4, 5, or 6 months.
- Methods of administering various polypeptides (e.g., antibody molecules or fusion proteins) are known in the art and are described below. Suitable dosages of the polypeptides used will depend on the age and weight of the subject and the particular drug used.
- The polypeptides can be used by themselves or conjugated to a second agent, e.g., an bacterial agent, toxin, or protein, e.g., a second polypeptide. This method includes: administering the polypeptide, alone or conjugated to a second agent, to a subject requiring such treatment. The polypeptides can be used to deliver a variety of therapeutic agents, e.g., a toxin, or mixtures thereof.
- The polypeptides (e.g., antibody molecules or fusion proteins) can be used in combination with other therapies. For example, the combination therapy can include a polypeptide co-formulated with, and/or co-administered with, one or more additional therapeutic agents, e.g., one or more additional therapeutic agents described herein. In other embodiments, the polypeptides are administered in combination with other therapeutic treatment modalities, e.g., other therapeutic treatment modalities described herein. Such combination therapies may advantageously utilize lower dosages of the administered therapeutic agents, thus avoiding possible toxicities or complications associated with the various monotherapies.
- Administered “in combination”, as used herein, means that two (or more) different treatments are delivered to the subject before, or during the course of the subject's affliction with a disorder. In an embodiment, two or more treatments are delivered prophylactically, e.g., before the subject has the disorder or is diagnosed with the disorder. In another embodiment, the two or more treatments are delivered after the subject has developed or diagnosed with the disorder. In some embodiments, the delivery of one treatment is still occurring when the delivery of the second begins, so that there is overlap. This is sometimes referred to herein as “simultaneous” or “concurrent delivery.” In other embodiments, the delivery of one treatment ends before the delivery of the other treatment begins. In some embodiments of either case, the treatment is more effective because of combined administration. For example, the second treatment is more effective, e.g., an equivalent effect is seen with less of the second treatment, or the second treatment reduces symptoms to a greater extent, than would be seen if the second treatment were administered in the absence of the first treatment, or the analogous situation is seen with the first treatment. In some embodiments, delivery is such that the reduction in a symptom, or other parameter related to the disorder is greater than what would be observed with one treatment delivered in the absence of the other. The effect of the two treatments can be partially additive, wholly additive, or greater than additive. The delivery can be such that an effect of the first treatment delivered is still detectable when the second is delivered.
- In an embodiment, the polypeptide is administered in combination with a second therapy (e.g., an additional agent) to treat or prevent a disorder described herein. In an embodiment, the additional agent is a second polypeptide (e.g., antibody molecule), e.g., a polypeptide (e.g., an antibody molecule) different from a first polypeptide (e.g., antibody molecule). Exemplary polypeptides (e.g., antibody molecules) that can be used in combination include, but are not limited to, any combination of the polypeptides (e.g., antibody molecules) described herein. In another embodiment, the additional agent is other than a polypeptide (e.g., antibody molecule). For example, the additional agent can be a small molecule or a nucleic acid molecule. In yet another embodiment, the second therapy is chosen from a surgery, a radiation therapy, a cell therapy (e.g., a stem cell therapy), or an organ or tissue transplantation.
- In an embodiment, the second therapy comprises a therapy chosen from one or more of: an androgen replacement therapy, an antihormone therapy, an antiserum therapy, an autologous immune enhancement therapy, a biotherapy, a blood irradiation therapy, a brachytherapy, a cardiac resynchronization therapy, a cell therapy, a cell transfer therapy, a chelation therapy, a chemotherapy, a chrysotherapy, a cobalt therapy, a cold compression therapy, a cryotherapy, an electroconvulsive therapy, an electromagnetic therapy, an electron therapy, an electrotherapy, an enzyme replacement therapy, an epigenetic therapy, an estrogen replacement therapy, an extracorporeal shockwave therapy, a fast neutron therapy, a fluoride therapy, a gene therapy, a heat therapy, a helminthic therapy, a hormone therapy, a hormone replacement therapy, a host modulatory therapy, a hyperbaric oxygen therapy, a hyperthermia therapy, an immunosuppressive therapy, an immunotherapy, an intraoperative electron radiation therapy, an intraoperative radiation therapy, an inversion therapy, a laser therapy, a light therapy, a lithium therapy, a low level laser therapy, a magnet therapy, a magnetic resonance therapy, a medical gas therapy, a medical nutrition therapy, a molecular chaperone therapy, a molecular therapy, a monoclonal antibody therapy, a negative air ionization therapy, a neutron capture therapy, a neutron therapy, an oral rehydration therapy, an osmotherapy, an oxygen therapy, an ozone therapy, a palliative therapy, a particle therapy, a phage therapy, a phonemic neurological hypochromium therapy, a photodynamic therapy, a phototherapy, a photothermal therapy, a physical therapy, a prototherapy, a protein therapy, a proton therapy, a pulsed electromagnetic field therapy, a PUVA therapy, a radiation therapy, a rehydration therapy, a respiratory therapy, salvage therapy, a serotherapy, a stem cell therapy, a stereotactic radiation therapy, a targeted therapy, a thermotherapy, a TK cell therapy, a tolerogenic therapy, a transdermal continuous oxygen therapy, an ultraviolet light therapy, or a virotherapy.
- Exemplary therapies that can be used in combination with a polypeptide or composition described herein to treat or prevent other disorders are also described in the section of “Methods of Treating or Preventing Disorders” herein.
- In some aspects, the present disclosure provides a diagnostic method for detecting the presence of a target molecule (e.g., a protein) or cell in vitro (e.g., in a biological sample, such as a biopsy or body fluid (e.g., blood, urine, or cerebrospinal fluid) sample) or in vivo (e.g., in vivo imaging in a subject). The method includes: (i) contacting the sample with a polypeptide described herein (e.g., an antibody molecule described herein), or administering to the subject, the polypeptide (e.g., antibody molecule); (optionally) (ii) contacting a reference sample, e.g., a control sample (e.g., a control biological sample, such as a biopsy or body fluid (e.g., blood, urine, or cerebrospinal fluid) sample) or a control subject with a polypeptide described herein (e.g., an antibody molecule described herein); and (iii) detecting formation of a complex between the polypeptide (e.g., antibody molecule) and the target molecule or cell in the sample or subject, or the control sample or subject, wherein a change, e.g., a statistically significant change, in the formation of the complex in the sample or subject relative to the control sample or subject is indicative of the presence of the target molecule or cell in the sample. The polypeptide (e.g., antibody molecule) can be directly or indirectly labeled with a detectable substance to facilitate detection of the bound or unbound polypeptide (e.g., antibody molecule). Suitable detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials and radioactive materials, as described herein.
- The term “sample,” as it refers to samples used for detecting bacteria includes, but is not limited to, cells, cell lysates, proteins or membrane extracts of cells, body fluids such as blood, urine, or CSF, or tissue samples such as biopsies.
- Complex formation between the polypeptide (e.g., antibody molecule), and the target molecule or cell, can be detected by measuring or visualizing either the polypeptide (e.g., antibody molecule) bound to the target molecule or cell, or unbound polypeptide (e.g., antibody molecule). Any suitable detection assays can be used, and conventional detection assays include an enzyme-linked immunosorbent assays (ELISA), a radioimmunoassay (RIA) or tissue immunohistochemistry. Alternative to labeling the polypeptide, the presence of the target molecule or cell can be assayed in a sample by a competition immunoassay utilizing standards labeled with a detectable substance and an unlabeled polypeptide. In this assay, the biological sample, the labeled standards and the polypeptide are combined and the amount of labeled standard bound to the unlabeled binding molecule is determined. The amount of the target molecule or cell in the sample is inversely proportional to the amount of labeled standard bound to the polypeptide (e.g., antibody molecule).
- The polypeptides (e.g., antibody molecules) described herein can be used to diagnose disorders that can be treated or prevented by the polypeptides described herein. The detection or diagnostic methods described herein can be used in combination with other methods described herein to treat or prevent disorders described herein.
- The present disclosure also includes any of the following numbered paragraphs:
- 1. A polypeptide comprising an Fc region, wherein the Fc region comprises a mutation, wherein the polypeptide has 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or all of the following properties:
- a) has an increased binding affinity for a neonatal Fc receptor (FcRn) at a pH between 6.0 and 6.5, compared to a reference polypeptide;
- b) has a higher binding affinity for FcRn at a pH between 6.0 and 6.5 than the binding affinity at a pH between 7.0 and 7.4;
- c) binds to an FcRn at a pH between 6.0 and 6.5 with a dissociation constant (Kd) of 300 nM or less;
- d) binds to the FcRn at a pH between 7.0 and 7.4 with a Kd of 50 nM or more;
- e) has the same, substantially the same, or increased binding affinity for an Fcγ receptor, compared to a reference polypeptide;
- f) has the same, or substantially the same, thermal stability, compared to a reference polypeptide;
- g) has the same, substantially the same, or increased binding affinity for C1q, compared to a reference polypeptide;
- h) has the same, substantially the same, or increased binding affinity for TRIM21, compared to a reference polypeptide.
- i) has an effector function that is the same, substantially the same, or increased, compared to a reference polypeptide;
- j) has an increased half-life in vivo, compared to a reference polypeptide;
- k) has a biological function, in vitro, ex vivo, or in vivo, that is the same, substantially the same, or increased, compared to a reference polypeptide;
- l) has a developability characteristic that is the same or substantially the same, compared to a reference polypeptide;
- m) has the same, substantially the same, or increased binding affinity, specificity, or both, for an epitope, compared to a reference polypeptide; or
- n) increases mucosal uptake, compared to a reference polypeptide, and
- wherein the polypeptide has at least properties a), b), and one, two, three, four, or all of properties e), f), g), h), or i).
- 2. The polypeptide of
paragraph 1, which has at least properties a), b), c), d), and one, two, three, four, or all of properties e), f), g), h), or i). - 3. The polypeptide of
paragraph - 4. The polypeptide of any of paragraphs 1-3, which has at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, or 50-fold increase in the binding affinity for the FcRn at pH 6.0, compared to a reference polypeptide, as determined by an octet-based assay or a cell-based assay.
- 5. The polypeptide of any of paragraphs 1-4, which has at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 50-fold higher in the binding affinity for the FcRn at pH 6.0 than that at pH 7.4, as determined by an octet-based assay or a cell-based assay.
- 6. The polypeptide of any of paragraphs 1-5, which binds to the FcRn at pH 6.0 with a dissociation constant (Kd) of 250 nM or less, 200 nM or less, 150 nM or less, 100 nM or less, 50 nM or less, 25 nM or less, 10 nM or less, 5 nM or less, 2 nM or less, 1 nM or less, 0.5 nM or less, 0.2 nM or less, 0.1 nM or less, 0.05 nM or less, 0.02 nM or less, 0.01 nM or less, between 25 nM and 0.1 nM, between 20 nM and 0.5 nM, between 15 nM and 1 nM, between 10 nM and 5 nM, or between 20 nM and 10 nM, as determined by an octet-based assay or a cell-based assay.
- 7. The polypeptide of any of paragraphs 1-6, which binds to the FcRn at pH 7.4 with a Kd of 60 nM or more, 80 nM or more, 100 nM or more, 150 nM or more, 200 nM or more, 500 nM or more, between 50 nM and 500 nM, or between 100 nM and 250 nM, as determined by an octet-based assay or a cell-based assay.
- 8. The polypeptide of any of paragraphs 1-7, which decreases the binding affinity for one, two, or, all of FcγRI, FcγRIIa/b, or FcγRIII by no more than 10%, 20%, 30%, 40%, or 50%, or increases the binding affinity for one, two, or all of FcγRI, FcγRIIa/b, or FcγRIII by at least 1.5, 2, 3, 4, or 5-fold, compared to a reference polypeptide, as determined by an octet-based assay or a cell-based assay.
- 9. The polypeptide of any of paragraphs 1-8, which increases or decreases the melting temperature by no more than 1° C., 2° C., 3° C., 4° C., 5° C., 6° C., 7° C., 8° C., 9° C., or 10° C., compared to a reference polypeptide, as determined by a sypro orange assay.
- 10. The polypeptide of any of paragraphs 1-9, which decreases the binding affinity for C1q by no more than 10%, 20%, 30%, 40%, or 50%, or increases the binding affinity for C1q by at least 1.5, 2, 3, 4, or 5-fold, compared to a reference polypeptide, as determined by ELISA.
- 11. The polypeptide of any of paragraphs 1-10, which decreases the binding affinity for TRIM21 by no more than 10%, 20%, 30%, 40%, or 50%, or increases the binding affinity for TRIM21 by at least 1.5, 2, 3, 4, or 5-fold, compared to a reference polypeptide, as determined by ELISA.
- 12. The polypeptide of any of paragraphs 1-11, which decreases one, two, three, or all of a complement dependent cytotoxicity (CDC), an antibody dependent cell mediated cytotoxicity (ADCC), an antibody dependent cell mediated phagocytosis (ADCP), or an antibody dependent intracellular neutralization (ADIN) by no more than 10%, 20%, 30%, 40%, or 50%, or increases one, two, three, or all of a complement dependent cytotoxicity (CDC), an antibody dependent cell mediated cytotoxicity (ADCC), an antibody dependent cell mediated phagocytosis (ADCP), or an antibody dependent intracellular neutralization (ADIN) by at least 1.5, 2, 3, 4, or 5-fold, compared to a reference polypeptide.
- 13. The polypeptide of any of paragraphs 1-12, which has at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, or 10-fold increase in the half-life in vivo, compared to a reference polypeptide, as determined in an animal model.
- 14. The polypeptide of any of paragraphs 1-13, which decreases the biological function, in vitro, ex vivo, or in vivo by no more than 10%, 20%, 30%, 40%, or 50%, or increases the biological function, in vitro, ex vivo, or in vivo by at least 1.5, 2, 3, 4, or 5-fold, compared to a reference polypeptide.
- 15. The polypeptide of any of paragraphs 1-14, which alters one, two, three, or all of stability, solubility, aggregation, or expression level by no more than 10%, 20%, 30%, 40%, or 50%, compared to a reference polypeptide.
- 16. The polypeptide of any of paragraphs 1-15, which decreases the binding affinity, specificity, or both by no more than 10%, 20%, 30%, 40%, or 50%, or increases the binding affinity, specificity, or both by at least 1.5, 2, 3, 4, or 5-fold, compared to a reference polypeptide.
- 17. The polypeptide of any of paragraphs 1-16, which increases mucosal uptake by at least 1.5, 2, 3, 4, 5, 6, 7, 8, 9, or 10-fold, compared to a reference polypeptide, as determined by a transcytosis assay.
- 18. The polypeptide of any of paragraphs 1-4 or 8-17, wherein the reference polypeptide comprises a wild-type Fc region, an Fc region comprising the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues.
- 19. The polypeptide of any of paragraphs 1-18, wherein the mutation is in a residue in a CH2 domain.
- 20. The polypeptide of any of paragraphs 1-18, wherein the mutation is in a residue in a CH3 domain.
- 21. The polypeptide of any of paragraphs 1-20, comprising at least one mutation in a residue in a CH2 domain and at least one mutation in a residue in a CH3 domain.
- 22. The polypeptide of any of paragraphs 1-21, further comprising a mutation in a residue in a region other than a CH2 domain and/or a CH3 domain.
- 23. The polypeptide of any of paragraphs 1-22, wherein the mutation does not alter, or does not substantially alter, the conformation of the linker region between a CH2 domain and a CH3 domain.
- 24. The polypeptide of any of paragraphs 1-23, wherein the mutation does not introduce 3, 4, 5, 6, 7, 8, 9, 10, or more consecutive hydrophobic or aromatic residues on a surface region.
- 25. The polypeptide of any of paragraphs 1-24, which comprises an antibody molecule.
- 26. The polypeptide of any of paragraphs 1-25, which comprises an IgG.
- 27. The polypeptide of any of paragraphs 1-26, which comprises an IgG1, IgG2, IgG3, or IgG4.
- 28. The polypeptide of any of paragraphs 1-27, which comprises a heavy chain immunoglobulin variable region, a light chain immunoglobulin variable region, or both.
- 29. The polypeptide of any of paragraphs 1-28, which comprises a tetramer of two heavy chain immunoglobulin variable regions and two light chain immunoglobulin variable regions.
- 30. The polypeptide of any of paragraphs 1-29, which comprises a full length antibody molecule.
- 31. The polypeptide of any of paragraphs 1-30, which comprises a fragment of an antibody molecule.
- 32. The polypeptide of any of paragraphs 1-31, which comprises a chimeric antibody molecule or a murine antibody molecule.
- 33. The polypeptide of any of paragraphs 1-32, which comprises a human antibody molecule or a humanized antibody molecule.
- 34. The polypeptide of any of paragraphs 1-24, which comprises a fusion protein.
- 35. The polypeptide of any of paragraphs 1-34, comprising 1, 2, 3, 4, or all of the following:
- (i) a mutation in a residue in a surface region that interacts with FcRn;
- (ii) a mutation in a residue that is a peripheral residue along the Fc-FcRn interface;
- (iii) a mutation is in a residue that is non-contact residue in Fc-FcRn binding;
- (iv) a mutation in a residue which is a helix contact reside that enhances the conformational dynamics of a helix comprising 1, 2, 3, 4, 5, or all of P247, K248, D249, T250, L251, or M252; or
- (v) a mutation, which modulates pK of a histidine or is an introduction of a histidine along the Fc-FcRn interface.
- 36. The polypeptide of any of paragraphs 1-35, comprising a mutation in a residue in a surface region that interacts with FcRn.
- 37. The polypeptide of paragraph 36, wherein the mutation is in a residue chosen from: L251, I253, R255, P257, H285, N286, K288, T307, V308, L309, Q311, L314, H310, H433, N434, H435, or Y436.
- 38. The polypeptide of any of paragraphs 1-37, comprising a plurality of mutations in 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, or all of the residues chosen from L251, I253, R255, P257, H285, N286, K288, T307, V308, L309, Q311, L314, H310, H433, N434, H435, or Y436.
- 39. The polypeptide of any of paragraphs 1-38, comprising a mutation in a residue that is a peripheral residue along the Fc-FcRn interface.
- 40. The polypeptide of paragraph 39, wherein the mutation is in a residue chosen from M252, T256, T307, L309, Q311, H433, N434, Y436, N286, or K288.
- 41. The polypeptide of any of paragraphs 1-40, comprising a plurality of mutations in 2, 3, 4, 5, 6, 7, 8, 9, or all of the residues chosen from M252, T256, T307, L309, Q311, H433, N434, Y436, N286, or K288.
- 42. The polypeptide of any of paragraphs 1-41, comprising a mutation is in a residue that is non-contact residue in Fc-FcRn binding.
- 43. The polypeptide of paragraph 42, wherein the mutation is in a residue chosen from A287, V308, N315, L314, L432, H429, E430, or A431.
- 44. The polypeptide of any of paragraphs 1-43, comprising a plurality of mutations in 2, 3, 4, 5, 6, 7, or all of the residues chosen from A287, V308, N315, L314, L432, H429, E430, or A431.
- 45. The polypeptide of any of paragraphs 1-44, comprising a mutation in a residue which is a helix contact reside that enhances the conformational dynamics of a helix comprising 1, 2, 3, 4, 5, or all of P247, K248, D249, T250, L251, or M252.
- 46. The polypeptide of paragraph 45, wherein the mutation is in a residue chosen from P244, P245, T250, L251, P247, E380, M428, A378, D376, P257, V308, A287, L306, or H427.
- 47. The polypeptide of any of paragraphs 1-46, comprising a plurality of mutations in 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or all of the residues chosen from P244, P245, T250, L251, P247, E380, M428, A378, D376, P257, V308, A287, L306, or H427.
- 48. The polypeptide of any of paragraphs 1-47, comprising a mutation which is the introduction of a histidine along the Fc-FcRn interface.
- 49. The polypeptide of any of paragraphs 1-48, comprising 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more mutations, or one or more combination of mutations, as described in Table 1.
- 50. The polypeptide of any of paragraphs 1-49, wherein the mutation is other than M252Y, S254T, T256E, L309N, T250Q, M428L, N434S, N434A, T307A, E380A, N434A, M252Y, S254T, T256E, or a combination thereof.
- 51. The polypeptide of any of paragraphs 1-50, wherein the mutation is in a residue other than residue M252Y, S254T, T256E, L309N, T250, M428, N434, N434, T307, E380, N434, M252, 5254, T256, or a combination thereof.
- 52. The polypeptide of any of paragraphs 1-51, which does not have 1, 2, 3, 4, 5, 6, 7, 8, 9, or all of the following mutation or mutations: (i) M252Y, S254T, and T256E; (ii) L309N; (iii) T250Q and M428L; (iv) M428L and N434A; (v) N434A; (vi) T307A, E380A, and N434A; (vii) M252W; (viii) V308F; (ix) V308F and N434Y; or (x) H435A.
- 53. The polypeptide of any of paragraphs 1-52, comprising a first mutation chosen from M252Y, S254T, T256E, L309N, T250Q, M428L, N434S, N434A, T307A, E380A, N434A, M252Y, S254T, or T256E, and a second mutation chosen from a mutation in Table 1 other than M252Y, S254T, T256E, L309N, T250Q, M428L, N434S, N434A, T307A, E380A, N434A, M252Y, S254T, and T256E.
- 54. The polypeptide of any of paragraphs 1-53, further comprising a mutation in the Fc region that increases an effector function.
- 55. The polypeptide of paragraph 54, wherein the mutation is in a residue chosen from S239, A330, I332, F243, G236, or a combination thereof.
- 56. The polypeptide of any of paragraphs 1-55, further comprising a mutation in the Fc region that decreases an effector function.
- 57. The polypeptide of paragraph 56, wherein the mutation is in a residue chosen from K322, L234, L235, P331, N297, or a combination thereof.
- 58. The polypeptide of any of paragraphs 1-57, wherein the Fc region comprises:
- (a) 1, 2, 3, 4, 5, or all of the combinations of mutations chosen from: T256D/Q311V/A378V, H285N/T307Q/N315D, H285D/T307Q/A378V, T307Q/Q311V/A378V, T256D/N286D/T307R/Q311V/A378V, or T256D/T307R/Q311V;
- (b) a mutation or a combination of mutations capable of disrupting an Fc effector function, or
- (c) both (a) and (b).
- 59. The polypeptide of any of paragraphs 1-58, which comprises mutations in residues chosen from: (i) T256, Q311, and A378; (ii) H285, T307, and N315; (iii) H285, T307, and A378; (iv) T307, Q311, and A378; (v) T256, N286, T307, Q311, and A378; or (vi) T256, H285, T307, Q311, and A378.
- 60. The polypeptide of any of paragraphs 1-59, which comprises mutations chosen from: (i) T256D, Q311V, and A378V; (ii) H285N, T307Q, and N315D; (iii) H285D, T307Q, and A378V; (iv) T307Q, Q311V, and A378V; (v) T256D, N286D, T307R, Q311V, and A378V; or (vi) T256D, H285D, T307R, Q311V, and A378V.
- 61. The polypeptide of any of paragraphs 1-60, further comprising a mutation in a region other than the Fc region.
- 62. The polypeptide of any of paragraphs 1-61, comprising a plurality of mutations, wherein at least one mutation is a compensating or beneficial mutation.
- 63. The polypeptide of any of paragraphs 1-62, which is an isolated polypeptide.
- 64. The polypeptide of any of paragraphs 1-62, which is a synthetic polypeptide.
- 65. A composition comprising a polypeptide of any of paragraphs 1-64.
- 66. The composition of paragraph 65, further comprising a pharmaceutical acceptable carrier.
- 67. A nucleic acid molecule encoding a polypeptide of any of paragraphs 1-64.
- 68. A vector comprising a nucleic acid molecule of paragraph 67.
- 69. A cell comprising a nucleic acid molecule of paragraph 67 or a vector of paragraph 68.
- 70. A kit comprising a polypeptide of any of paragraphs 1-64 and instructions to use of the polypeptide.
- 71. A container comprising a polypeptide of any of paragraphs 1-64.
- 72. A method of producing a polypeptide, the method comprising culturing a cell of paragraph 69 under conditions that allow production of an antibody molecule, thereby producing the polypeptide.
- 73. The method of paragraph 72, further comprising isolating or purifying the polypeptide.
- 74. A method of treating a disorder, the method comprising administering to a subject in need thereof an effective amount of a polypeptide of any of paragraphs 1-64 or a composition of paragraph 65 or 66, thereby treating the disorder.
- 75. A polypeptide of any of paragraphs 1-64, or a composition of paragraph 65 or 66, for use in treating a disorder in a subject.
- 76. Use of a polypeptide of any of paragraphs 1-64, or a composition of paragraph 65 or 66, in the manufacture of a medicament for the treatment of a disorder in a subject.
- 77. A method of detecting a molecule, the method comprising contacting a cell or a sample from a subject with a polypeptide of any of paragraphs 1-64, thereby detecting the molecule.
- A structure and network based framework was developed to interrogate the engagement of IgG with multiple Fc receptors (e.g., FcRn, C1q, TRIM21, FcγRI, FcγRIIa/b, and FcγRIIIa). Using this framework, features that govern Fc-FcRn interaction and multiple distinct pathways for enhancing FcRn binding in a pH specific manner were identified. Network analysis provided a lens to study the allosteric impact of FcRn optimization mutations on the distal FcγR engagement. Applying these principles, a panel of distinct Fc variants that enhance FcRn binding with robust biophysical properties and wild-type like binding to activating receptors were engineered. Control polypeptides with these Fc variants have shown a half-life improvement of >9 fold and robust effector functions such as ADCC, ADCP, CDC and ADIN mediated by TRIM21.
- A co-crystal structure of the human FcRn protein in complex with the Fc domain of a human IgG1 and human serum albumin was recently reported (Oganesyan et al., J Biol Chem, 2014. 289 (11): 7812-2). Inspection of the structure (
FIG. 20A ) shows that both the alpha and beta subunits of the FcRn molecule participate in binding to the Fc-domain, making contact with both CH2 and CH3 domains of the Fc. The primary interaction is mediated by the alpha-subunit on the FcRn side and CH2 domain on the Fc side. The pH specific nature of binding is driven by the histidine residues at positions 310 and 435 (Kabat numbering) which undergo protonation at acidic pH and make critical contacts with FcRn glutamate at position 115 and aspartate at position 130. Mutation of either of the two histidine residues significantly reduces the binding affinity of Fc with FcRn (Oganesyan et al., J Biol Chem, 2014. 289(43): 29874-80; Raghavan et al., Biochemistry, 1995. 34(45): 14649-57). In addition to the H310 and H435, a number of other Fc residues (L251, 1253, R255, P257, H285, N286, K288, T307, V308, L309, Q311, L314, H433, N434, and Y436) are involved in making molecular contacts with FcRn. - The structure of Fc has been solved at different pHs (Crispin et al., Proc Natl Acad Sci USA, 2013. 110(38): E3544-6; Ahmed et al., J Mol Biol, 2014. 426(18): 3166-79; Chen et al., ACS Chem Biol, 2016. 11(7): 1852-61). Superposition of the crystal structure of Fc at pH 4.0 (pdb id 4BYH) and 6.5 (pdb id 4Q7D) reveals a number of subtle changes, including lateral displacement of the 250-helix and differences in the relative orientation of CH2 (
FIG. 20B ). Given that FcRn binding amino acid residues such as M252 and I253 are located on the 250-helix, the observed displacement of the helix is expected to influence the FcRn binding (Oganesyan et al., J Biol Chem, 2014. 289 (11): 7812-2). Further, the difference in the relative orientation of CH2 with respect to CH3 highlights the conformational flexibility of the CH2 region (FIG. 20B ) (Frank et al., J Mol Biol, 2014. 426(8): 1799-811). Given that the FcRn-Fc interface is found across both the CH2/CH3 domains of the Fc, the conformation dynamics of the CH2 domain is also expected to influence the FcRn binding. Deuterium exchange studies on the Fc residues in the presence and absence of FcRn at acidic and neutral pHs showed that FcRn binding to Fc molecule offers protection to its binding Fc residues; however, in the absence of FcRn molecule the 250-helix residues at acidic pH showed enhanced Deuterium exchange suggesting that pH change induces conformational change for this region (Walters et al., J Biol Chem, 2016. 291(4): 1817-25; Jensen et al., Mol Cell Proteomics, 2017. 16(3): 451-456). - Analysis of the strength of engagement of Fc with FcRn at acidic pH reveals that human FcRn binds to human Fc domain with weak affinity (>600 nM). The kinetic parameters further show that while the rate of association (kon ˜105 M−1s−1) of Fc-FcRn interaction is comparable to a typical antibody-antigen interaction, the lower binding affinity is primarily due to the fast dissociation rate (koff ˜0.1 s−1) of Fc-FcRn interaction (Suzuki et al., J Immunol, 2010. 184(4): 1968-76). The conformational flexibility of the CH2 subdomain is thought to contribute to the poor koff of FcRn binding. Improving the off rate of Fc-FcRn interaction can serve as a key facet for improved half-life (Datta-Mannan et al., J Biol Chem, 2007. 282(3): 1709-17).
- Towards that, four sets of Fc residues, mutations to which could impinge on FcRn interaction and dissociation rate (koff), were identified (
FIG. 21A ). This includes residues that make direct contact with FcRn as well as peripheral and non-surface exposed residues that have the potential to modify the interaction surface and residues that have the potential to influence 250-helix dynamics. Indeed, some of these positions have been previously interrogated and half-life enhancing mutants such as M252Y/S254T/T256E (YTE), M428L/N434S (LS), T307A/E380A/N434A (AAA), T250Q/M428L (QL), V308P, include combinations of mutations at the listed sites. - In the analysis, the role of each residue was first investigated in silico, and the network of interactions mediated by the residue was identified (
FIG. 21B ). Specific set of mutations were designed to enhance hydrophobic interactions in the Fc-FcRn interface and to enhance polar and electrostatic interactions at the periphery of the Fc-FcRn interface. Mutations of non-contacting residues near the interface can enhance the electrostatic charge complementarity and the affinity by reducing the koff rate (Lee and Tidor, Protein Sci, 2001. 10(2): 362-77; Whitehead et al., Nat Biotechnol, 2012. 30(6): 543-8). The FcRn binding site on Fc has overlaps with the binding site of intracellular receptor TRIM21, protein A used for antibody purification and the Fc-Fc interaction interface formed during hexamerization of IgG for CDC activity. Substitution of at each position was assessed for impact on these binding to TRIM21, protein A and Fc. More than 30 distinct positions were chosen for substitutions. Combination of the individual mutations were designed based on the following guiding principles (a) avoiding introduction of large clusters of charge or hydrophobicity to minimize binding to solvent ions and impact on thermal stability of the IgG and (b) incorporate diversity in the types of interaction, not just electrostatic or hydrophobic (c) include mutations across CH2 and CH3 domains. Based on these considerations, more than 150 unique mutant combinations were designed and experimentally evaluated. - IgG1 s incorporating the designed Fc variants on either actoxumab or motavizumab Fab were recombinantly expressed and evaluated for binding to human FcRn by biolayer interferometry using two different protocols: FcRn on NiNTA biosensor with IgG as the analyte, and IgG on an anti-CH1 biosensor with FcRn as the analyte. The assays were used to quantify binding at pH 6.0 followed by dissociation at pH 6.0 and pH 7.4, as well as binding and dissociation at pH 7.4 (
FIG. 11A ). Fc variants incorporating mutations at P257 and V308 had high affinity at pH 6.0 but displayed markedly slower off-rates at pH 7.4 and were not considered for further analyses. More than 10 distinct variants had greater than 5-fold decrease in Kd as compared to IgG with WT Fc. Further, these variants decreased the koff by more than 2.5-fold (FIG. 22 ). - The FcRn binding site on the Fc domain considerably overlaps with the protein A and Trim21 binding sites as determined from their complex crystal structures (
FIG. 27A ). The Fc domain also binds to C1q to mediate CDC, however the C1q binding site does note overlap with FcRn binding site on Fc. C1q is naturally found as hexamer and a homo-hexamer assembly of Fc domains is expected to not only have a better C1q binding and also CDC. The Fc-Fc interface for formation of homo-hexamer overlaps with the FcRn binding site (FIG. 27A ). Superposition of crystal structures of Fc domain shows that the orientation of the CH2 domain in these structures varies with respect to the CH3 domain illustrating the conformational flexibility of the CH2 domain (FIG. 27B ). Since the FcRn binding site is at the interface across both the CH2 and CH3 domains therefore this conformational flexibility may be important for its binding. - The FcRn binding affinity of Fc variants FcMut008 and FcMut015 was assessed by Octet. Antibody was immobilized on the Octet tip by anti-CH1 antibody and FcRn was in solution. As shown in
FIG. 6 , FcMut008 and FcMut015 had increased affinity to FcRn. The binding is pH specific and increased binding at pH 6.0 was observed. - Cell-based competition assay provides a robust, specific, linear assay to show differences in relative binding of Fc variants. FcRn-expressing cells were obtained by transient transfection of FcRn alpha and β2m. Cells were incubated at pH6.0 with dilutions of IgG and fixed concentration of fluorescently-labeled Fc (Fc-A488). Cell-bound fluorescence was read by FACS. The results are shown in
FIG. 7 . FcMut008 and FcMut015 showed improved FcRn binding at pH6.0. - The binding of exemplary mutant antibody molecules to FcγRI and FcγRIIIa was determined. As shown in
FIG. 8 , FcMut008 and FcMut015 retained and in some instance enhanced FcγR engagement. - The thermal stability of exemplary mutant antibody molecules was determined. The thermal stability was measured by SYPRO orange. As shown in
FIG. 9 , FcMut008 and FcMut015 retained high melting temperature. - The impact of incorporating exemplary Fc variants on biophysical attributes was experimentally assessed. IgGs incorporating the Fc variants on motavizumab Fab were tested on SE-HPLC. All samples eluted at similar retention times as wild-type Fc, and displayed clean monomeric profile, and no aggregates were detected (
FIG. 23 ). The IgGs were also assessed for the thermal stability of the CH2 and CH3 domains by Differential Scanning Fluorimetry (DSF). The melting temperature (Tm) of the wild type human CH2 and CH3 domain, as measured differential scanning calorimetry, is approximately 70° C. and 81.5° C., respectively (Ionescu et al., J Pharm Sci, 2008. 97(4): 1414-26). The DSF experimental results in this Example yielded similar results with a CH2 and CH3 TM of 68.8° C. and 80.8° C., respectively. The half-life extending Fc variant YTE has been reported to decrease the TM of the CH2 domain by 6.7° C. (Majumdar et al., MAbs, 2015. 7(1): p. 84-95.). In the experiments described in this Example, the TM of the CH2 domain of YTE was 7.2° C. lower than WT. Additionally, mutations at 247, 257, and 308 significantly impacted the TM of CH2. The exemplary Fc variants (FcMut183, FcMut197, FcMut213, FcMut215, FcMut228, FcMut229) were thermally stable with the TM of the CH2 domain>64° C. (FIG. 23 ). - Tg32 mice were homozygous, 8 week old, males. There were 4 mice per test article group. The test articles included CDA1-WT, CDA1-FcMut008, and CDA1-FcMut015. The mice were dosed at 10 mg/Kg by IV administration. Data were collected at thirteen time points (1 h, 8 h, 1 d, 2 d, 3 d, 4 d, 6 d, 8 d, 10 d, 13 d, 16 d, 19 d, and 22 d). Human IgG was quantified by ELISA using an anti-hIgG polyclonal antibody.
- Tg32 is a human FcRn transgenic mouse model that can be used in drug discovery for early assessment and prediction of human pharmacokinetics of monoclonal antibodies. Monoclonal antibody clearance in Tg32 homozygous mice has the strongest correlation to monoclonal antibody clearance in humans (Avery et al. MAbs. 2016; 8(6):1064-78).
- CDA1 (actoxumab) is known to have a half-life of >25 days in human In vivo evaluation with additional mAbs in Tg32 model was performed. The different constructs can also be evaluated on Tg276 mice which are reported to have increased half-life differences between IgG variants. The results are shown in Table 2 and
FIG. 10 . FcMut015 increased the half-life of CDA1 in Tg32 mice. -
TABLE 2 Half-Lives of Exemplary Antibody Molecules in Tg32 Homozygous Mice t1/2 Cmax Clast AUCinf Group (hr) (ug/ml) (ug/ml) (hr*ug/ml) Rsq WT 261.17 116.03 15.40 24108.03 0.99 FcMut008 231.92 131.33 15.74 25687.39 0.99 FCMut015 436.69 151.82 27.69 42735.9 0.93 - FcRn interaction with IgG is believed to be mediated through Fc. The binding of Fc to FcRn is generally pH specific (typically little or no binding at pH7.4 and strong binding in acidic environment). Structure of FcRn in complex with Fc domain of IgG1 is known and each FcRn molecule binds to an Fc-monomer. Fab domains can also influence binding of IgG to FcRn.
- Network analysis of Fc-FcRn complex highlights the centrality of H310 in engagement with FcRn. H310 is highly interconnected to multiple other highly networked residues. Mutations in the H310 cluster, and neighboring (connected nodes) may strengthen the H310 network. Analysis of sub-networks informs introduction of synergistic mutations for favorable FcRn interaction, with minimal impact on other Fc residues.
- To identify Fc variants with improved binding to FcRn at pH 6.0, various Fc mutations were engineered into IgG1 Motazivumab (WT). All antibodies were assessed for binding to FcRn using biolayer interferometry. Briefly, anti-CH1 biosensors (ForteBio) were loaded with each antibody of interest. Loaded biosensors were exposed to recombinant FcRn protein at pH 6.0 to detect binding. After saturation, biosensors were exposed to buffer alone at pH 6.0 to measure dissociation of the FcRn from each antibody. The result is a response curve representing on rate and off rate of the antibody. These rates were calculated using the ForteBio software and compared to the rate of wild type Motavizumab. The fold increase in on-rate and the fold decrease in off-rate as compared to wild type are listed in the table. Numerous antibody mutations significantly increased and decreased on and off rate, respectively (
FIG. 11A ). Also shown is the binding of a representative Fc variant to FcRn at a pH range of 6.0 to 7.4. It is important that the affinity of the Fc mutant antibodies for FcRn is improved at pH 6.0 but not significantly enhanced at a higher pH such as pH 7.4.FIG. 11B demonstrates that this representative antibody still shows poor binding to FcRn at pH 7.4, a desirable feature. -
FIG. 11C shows the interaction of the CH2 domain of the antibody Fc with the FcRn molecule. The engineering efforts described herein attempted to improve shape complementarity (SC), electrostatic charge complementarity (CC), and hydrophobic complementarity (HC). A few positions on the Fc are noted as important for the interaction. Also noted is the 250 helix. This helix is dynamic and moves depending on the pH of the environment. This is important in the binding of the Fc domain to FcRn at pH 6.0 but not pH 7.4. - Exemplary Fc variants were tested in developability assays, the results of which are summarized in
FIG. 12 . Assays, including Sypro orange, SDS PAGE and SEC-HPLC, were performed. For expression determination, constructs were transfected into Expi293 cells in 96 well culture dishes using ExpiFectamine as described by the manufacturer. After 5-7 days, supernatants were quantified using biolayer interferometry (Octet) equipped with anti-human CH1 biosensors using a motavizumab standard curve. For protein A binding assessment the following was performed. Constructs were transfected into Expi293 cells in 30 mL cultures using ExpiFectamine as described by the manufacturer. After 5-7 days, supernatants were harvested and antibodies purified. Using biolayer interferometry with protein A biosensors, Fc-modified antibody affinity to protein A was measured and compared to antibody containing a wild type Fc domain. - All Fc variants, expressed in the context of the Motavizumab antibody, were separated by SDS-PAGE under reducing and non-reducing conditions. Briefly, 2 μg of antibody in 5 μL of water was mixed with 5 μL of Laemmli Sample Buffer (BioRad Catalog #161-0737), with and of β-mercaptoethanol (BioRad Catalog #161-0710). The samples were boiled at 95° C. for ten minutes and then briefly centrifuged. Samples were then run on a 4-12% Bis-Tris NuPAGE gel (Thermo Scientific # NP0321BOX) in 1×MES running buffer in an XCell SureLock Gel Electrophoresis Cell (Novex Catalog #090403-839) alongside the SeeBlue Plus2 molecular weight standard (Invitrogen Catalog # LC5925). The samples were run at 200V for 35 minutes. The gels were stained with SimplyBlue SafeStain (Novex # LC6065) following manufacturer's protocol and imaged on the BioRad ChemiDoc MP Imaging System.
- HPLC based size exclusion chromatography (HPLC-SEC) is an analytical tool used to determine the apparent size of a protein, monomeric purity, and the apparent level non-specific column adsorption between the protein and the silica based sizing resin. The impact of Fc mutations on the IgG elution profile was assessed on a Phenomenex Biosep 3000s column. Briefly the IgGs with various Fc variants were diluted to 1 mg/ml in PBS pH 7.4 and 20 tit was injected into the column. The elution time and percentage purity was recorded.
- The thermal stability of the mAbs was determined by differential scanning fluorescence (DSF). DSF monitors the conformational stability of a protein as it is exposed to increasing thermal stress. The dye, SYPRO ORANGE®, fluoresces in a hydrophobic environment, such as hydrophobic core residues that are exposed during thermally triggered protein unfolding, or denaturation. By monitoring the fluorescent signal, the unfolding of CH2, CH3 and Fab can be monitored. Various Fc variants with Motavizumab Fab were evaluated in a SYPRO orange assay. Briefly 15 μL of IgG at 0.5 mg/mL was mixed with 15 μL of 1:500 diluted SYPRO Orange dye and assessed by a thermocycler with fluorescent read capabilities using a 1° C. ramp from 40° C. to 99° C. The midpoint between native state and first unfolding event was reported as the transition temperature or melt temperature (Tm).
- All Fc mutations were introduced in IgG1 (m3 allotype) heavy chain gene and cloned into pcDNA3.1(C). The light chain genes were cloned into pcDNA3.1(A). In all cases, the native signal peptide was replaced with an osteonectin signal peptide (GenBank accession # AAA60993). Co-expression of the heavy and light chain vectors was performed by transient transfection in Expi293 cells using the Expi293 transfection kit (Thermo Fisher catalogue # A14524) following the manufacturer's protocol. The heavy and light chain vectors were co-transfected at a 1:2 ratio. Cell culture supernatant was harvested 5 to 7 days post transfection and purified on the
AKTA 10 FPLC system (GE) using HiTrap MabSelect SuRe protein A columns (GE) following manufacturer's instructions. - All antibodies were purified from cell culture supernatant using 1 mL columns packed with mAb select sure protein A resin (GE catalogue #17543801) using the
AKTA purifier 10 FPLC system. Briefly, sterile filtered cell culture supernatant was loaded onto the columns at a flow rate of 2 mL/minute. Columns were washed with 10 column volumes of PBSN (1×PBS with 0.05% sodium azide). Antibodies were eluted with 10 column volumes of elution buffer (100 mM glycine pH 2.5) and neutralized by addition 17.5% v/v of neutralization buffer (1M Tris, 1M NaCl, pH 8.0) and collated in 1 mL fractions. The chromatogram for absorbance at 280 nm was used to identify elution fractions containing the antibody. All antibodies were then dialyzed into 1×PBS using 10,000 dalton molecular weight cut-off cassette (Thermo Fisher catalogue #66380). - Protein A binding was functionally determined by the ability of all antibodies to be purified by FPLC using protein A columns. After purification, protein A binding was further assessed by quantifying a known amount of antibody using the Octet QKe system and protein A biosensors (Pall catalogue #18-5012) following the standard quantitation protocol provided with the Octet data acquisition software.
- Expi293 cells were co-transfected with a plasmid encoding the human α-FcRn with a 6× histidine tag on the C-terminus and a plasmid encoding human 132M. Cell culture supernatant was harvested 4 days post transfection. FcRn was purified from cell culture supernatant using the AKTA pure FPLC system with a HisTrap HP column (GE catalogue #17-5247-01). Post purification the protein was dialyzed into 1×PBS pH 6.0.
- Screening assays were performed using anti-CH1 Fab biosensors on the Octet QKe system. Briefly, purified IgG at 10 μg/mL is loaded onto an anti-CH1 biosensor for 180 seconds. After a 60 second baseline step in 1×PBS pH 6.0, the IgG loaded tip is exposed to FcRn at a concentration of 50 μg/mL for 60 seconds, followed by dissociation for 60 seconds in PBS pH 6.0, and an additional 30 seconds in PBS pH 7.4. In addition, FcRn binding was performed using NiNTA biosensors. Briefly, recombinant human FcRn at 5 μg/mL is loaded onto a NiNTA biosensor for 180 seconds. After a 60 second baseline step in 1×PBS pH 6.0, the FcRn loaded tip is exposed to IgG at a concentration of 250 nM (37.5 μg/mL) for 60 seconds, followed by dissociation for 60 seconds in PBS pH 6.0, and an additional 30 seconds in PBS pH 7.4. After assay completion of each assay, a quantitative assessment of the affinity constant (KD) at pH 6.0 is performed using the ForteBio octet software and a qualitative assessment is performed by plotting the response rate over time, allowing for visualization of the association of IgG to FcRn at pH 6.0 and the subsequent dissociation at pH 6.0 and pH 7.4.
- As shown in
FIG. 12 , all Fc variants performed comparably to the WT antibody in all of these experiments. - Motavizumab wildtype was compared to Motavizumab containing three of Fc engineering mutations in the in vivo assessment of engineered antibody half-life. Antibodies (2-5 mg/kg) were administered to mice transgenic for human FcRn and daily samples of mouse serum were obtained (day 0-day 4). ELISA was performed on serum to quantify the amount of Motazivumab in the serum.
- The amount of human IgG present in mouse serum was determined using a human IgG quantitation ELISA kit (Bethyl Labs catalogue # E80-104) following the manufacturer's protocol. All serum samples were titrated in a twofold serial dilution starting at 1:50 dilution and ending at a 1:6400 dilution. Each ELISA plate included a human reference standard curve provided with the kit in duplicate or triplicate. The standard curve contains the following concentrations: 500.0, 250.0, 125.0, 62.5, 31.3, 15.6, 7.8, and 3.9 ng/mL. The lower limit of detection was considered to be the A450 nm value obtained for the second to last point on the reference standard, which was 7.8 ng/mL. Because the starting dilution of the serum was 1:50, this puts the level of detection the assay at ˜0.4 μg/mL (7.812 ng/mL×50 fold dilution). The following procedures were followed to calculate the IgG levels: (1) perform a four parameter logistic regression (4PL) on the standard curve; (2) set the maximum acceptable A450 nm signal as the reading for the third titration point on the standard curve; (3) set the minimum acceptable A450 nm signal as the reading for the seventh titration point on the standard curve; (4) mask all samples titration points that fall above the maximum acceptable signal and below the minimum acceptable signal; (5) user the reference standard 4PL curve fit to calculate the concentration for each titration point with an acceptable A450 signal and multiply that value by the dilution factor of that titration point; (6) for each sample titration, calculate the mean value for the calculated concentration across titration series.
- ELISA results were converted to percent of antibody remaining based on the
day 0 timepoint representing 100%. As shown inFIGS. 13A-13B , all three antibody variants demonstrated extended half-life in this well-established mouse model of antibody half-life. Motavizumab wild-type has a half-life of 32 hours. FcMut043 and FcMut045 mutants built on FcMut008 show significant half-life improvement. FcMut045 mutant enhanced half-life 5.2 fold (about 166 hours half-life). The half-life as well as the other parameters inFIG. 13B were calculated using the Winonlin software. - Similar experiments were conducted with later stage Fc variants in the context of Motazivumab. When the Motavizumab variants were administered at a dose of 5 mg/kg, next generation variants (FcMut171, FcMut183, FcMut186, and FcMut197) demonstrated further enhanced half-life with more than nine fold increase in half-life observed with FcMut213 (
FIGS. 14A-14B ). One of the early variants (FcMut045) was included to demonstrate the improved half-life seen with the later stage designs as compared to the early stage designs. Similar results were observed when the Motavizumab variants were administered at a dose of 2 mg/kg (FIGS. 14C-14D ). - To evaluate if the enhanced binding of Fc variants to human FcRn translated to increased serum persistence and longer circulating half-life life, a pharmacokinetic study of IgGs containing the different Fc variants was performed in Tg276 transgenic mice. Transgenic mouse models expressing human FcRn have been developed by the Jackson laboratory (JAX) to study PK of human Fc-containing biotherapeutics. The Tg276 mice are null for mouse FcRn alpha chain and express the human FcRn alpha transgene under the control of a constitutive promoter (actin) and use the mouse β2microglobulin. The Tg276 homozygous or hemizygous mice have been widely used to differentiate half-lives of antibody variants.
- For the in vivo study, Tg276hemi FcRn transgenic mice were dosed with 2 or 5 mg/kg of mAb intravenously. Each mAb group had 4 mice/group. Blood was collected at several time points between 1 hour and 21 days, and IgG titers were determined by quantitative ELISA as described herein. PK parameters were determined for each group of mice with a non-compartmental model using Phoenix WinNonlin version 7.0 (Certera).
- The results are shown in
FIGS. 14A-14D . - Two Zika antibodies (ZVA and ZVB) as well as wild type Motavizumab (MVZ) were administered to mice transgenic for human FcRn at a dose of 2-5 mg/kg, and daily samples of mouse serum were obtained (day 0-day 4). ELISA was performed on serum to quantify the amount of Motavizumab. ELISA results were converted to percent of antibody remaining based on the
day 0 timepoint representing 100%. ZVA antibody represents the A series antibody A-3/2. The ZVB antibody represents the A series antibody A-5/1 containing the affinity enhancing light chain modification S92Y. As shown inFIG. 15 , ZVB had a much longer half-life than either Motavizumab or ZVA (both ZVA and ZVB had longer half-life than Motavizumab). These antibodies contained wild-type Fc regions so the extended half-life of the ZVB antibody is a property of the antibody itself, and not any Fc engineering. - In the next experiment, Motavizumab wild type (MVZ WT) was tested against the ZVB antibody (ZB-1/4, ZKB in the graph) and the ZVB antibody containing Fc modification 156 (L234A/L235A (“LALA”) and T256D/T307R/Q311V (half-life extension), ZKB-156 in the graph) as well as the “LS” half-life extension Fc mutation (ZKB-LS). Both LS and Fc modification 156 extended half-life significantly compared to the wild-type ZVB (
FIG. 16 ). These data demonstrate that the Visterra mutation is comparable to the literature derived LS mutation, and also demonstrates that the FC engineering efforts described herein can extend the half-life of an antibody that already has a very long half-life in this transgenic mouse model. “ZVB” is indicated as “ZKB” inFIG. 16 . - Exemplary Fc variants were assessed on multiple assays for FcγRI, FcγRIIA (mediator of opsonophagocytosis), FcγRIIB, FcγRIIIA (mediator of ADCC), and C1q (mediator of CDC).
- Binding to Fcγ receptors I, IIa, IIb, IIIa, and IIIa V176F (R&D Systems catalogue #1257-FC-050, 1330-CD-050, 1875-CD-050, 4325-FC-050, and 8894-FC-050) was measured by ELISA. All Fc variants were tested in the context of the Motavizumab, Rituximab, or Actoxumab antibody. Briefly, Fc receptors were coated on an ELISA plate (VWR catalogue #62409-002) at 1 μg/mL (0.1 μg/well) in PBS and stored at 4° C. overnight. Plates were washed three times with PBST (1×PBS 0.05% Tween20). Antibodies were titrated threefold in PBST-BSA from 100 μg/mL to 0.05 μg/mL and 100 μL was added to each well of the ELISA plate and incubated for 1 hour at room temperature. Plates were washed three times with PBST. Goat anti-human Fc (Jackson catalogue #109-035-098) was diluted 1:5000 in PBST-BSA and 100 μL was added to each well and incubated for 1 hour at 4 C. Plates were washed six times with PBST. Plates were developed using the TMB Microwell Peroxidase Substrate Kit (VWR catalogue #95059-156). The reaction was stopped after 10 minutes by the addition of 1N sulfuric acid and absorbance at 450 nm was measured. The values of antibody concentration (x-axis) and absorbance at 450 nm (y-axis) were fit to a four parameter logistic regression (4PL) curve. The curve fit was then used to determine the EC50 (the midpoint of the 4PL) for each Fc variant.
- Binding to Fcγ receptors IIa and IIb was measured by BioLayer Interferometry using the Octet QKe system. Briefly, FcγIIa and FcγIIb (R&D Systems catalogue #1330-CD-050 and 1875-CD-050) were diluted to 5 μg/mL in PBS. The receptors were immobilized via a C-terminal 6× histidine tag (SEQ ID NO: 2) to Ni-NTA biosensors (Pall catalogue #18-5101) for 180 seconds followed by a 60 second baseline step in PBS. The biosensors were then exposed to the various Fc variants at a concentration of 50 μg/mL in PBS for 120 seconds followed by a dissociation step in PBS for an additional 120 seconds. The max binding response during the association step for each variant was reported and compared to the wild type Fc response.
- Binding to C1q was measured by ELISA. All Fc variants were tested in the context of the Motavizumab antibody. Briefly, antibodies were coated on an ELISA plate (VWR catalogue #62409-002) at 25 μg/mL (2.5 μg/well) in PBS and stored at 4° C. overnight. Plates were washed three times with PBST (1×PBS 0.05% Tween 20). Purified C1q (Quidel Corporation catalogue # A400) was titrated threefold in PBST-BSA (1×PBS 0.05
% Tween20 1% BSA) from 12.5 μg/mL to 0.02 μg/mL and incubated for 90 minutes at room temperature. Liquid was aspirated from wells and polyclonal rabbit anti-human C1q (Agilent catalogue # A013602-1) was diluted in PBST-BSA to a final concentration of 1 μg/mL and 100 μL was added to each well and incubated for 1 hour at room temperature. Plates were washed three times with PBST. Polyclonal swine anti-rabbit-HRP (Agilent catalogue # P021702-2) was diluted to 0.5 μg/mL in PBST-BSA and 100 μL was added to each well and incubated for 1 hour at room temperature. Plates were washed six times with PBST. Plates were developed using the TMB Microwell Peroxidase Substrate Kit (VWR catalogue #95059-156). The reaction was stopped after 10 minutes by the addition of 1N sulfuric acid and absorbance at 450 nm was measured. The values of antibody concentration (x-axis) and absorbance at 450 nm (y-axis) were fit to a four parameter logistic regression (4PL) curve. The curve fit was then used to determine the EC50 (the midpoint of the 4PL) for each Fc variant. - The results are shown in
FIGS. 17A-17D . - Complement dependent cytotoxicity (CDC) activity of exemplary Fc variants (Rituximab Fab) was examined.
- CDC assays were performed using CD20+ Raji cells and low toxicity guinea pig complement (Cedarlane Laboratories Product # CL4051). Complement induced cell lysis was measured using the
CYTOTOX 96® Non-Radioactive Cytotoxicity Assay from Promega (catalogue # G1780) following the manufacturer's protocol. All Fc variants were tested in the context of the anti-CD20 antibody, Rituximab. Briefly, antibody concentrations were titrated fourfold ranging from 20 μg/mL to 0.005 μg/mL and incubated with 20,000 target cells per well at 37° C. for 30 minutes. Complement was then added to the cells and incubated an additional 2 hours at 37° C. Additionally, cell lysis buffer provided with the CYTOTOX kit was added to control wells to measure the maximum cell lysis. A negative control antibody, Motavizumab, was used to measure the background signal of an irrelevant antibody. The background signal and maximum lysis signal were used to calculate the percent of cell lysis for each Fc variant. The values of antibody concentration (x-axis) and percent lysis (y-axis) were fit to a four parameter logistic regression curve. The curve fit was then used to determine the EC50 (concentration needed to obtain 50% lysis) and the maximum lysis for each Fc variant. - The results are shown in
FIG. 18 . - Antibody dependent cellular cytotoxicity (ADCC) activity of exemplary Fc variants (Rituximab Fab) was examined.
- ADCC assays were performed using the ADCC Reporter Bioassay with CD20+ WIL2-S target cells from Promega (catalogue # G7014) following the manufacturer's protocol. All Fc variants were tested in the context of the anti-CD20 antibody, Rituximab. Antibody concentrations were titrated fivefold ranging from 5 μg/mL to 0.0016 μg/mL. The values of antibody concentration (x-axis) and fold induction of the luminescent reporter gene (y-axis) were fit to a four parameter logistic regression (4PL) curve. The curve fit was then used to determine the EC50 (the midpoint of the 4PL) and the maximum induction for each Fc variant.
- The results are shown in
FIGS. 19A-19B . Exemplary Fc variants retain and in some cases enhance ADCC activity. - TRIM21 is a cytosolic receptor that binds with Fc of IgG. TRIM21 plays a role in mediating intracellular recognition and neutralization of Fc bound viruses. TRIM21-mediated neutralization is known as antibody dependent intracellular neutralization (ADIN).
- Binding to TRIM21 was measured by ELISA. All Fc variants were tested in the context of the Motavizumab or Actoxumab antibody. Briefly, antibodies were coated on an ELISA plate (VWR catalogue #62409-002) at 25 μg/mL (2.5 μg/well) in PBS and stored at 4° C. overnight. Plates were washed three times with PBST (1×PBS 0.05% Tween20). TRIM21-GST (Antibodies Online catalogue # ABIN1323621) was titrated threefold in PBST-BSA (1×PBS 0.05
% Tween20 1% BSA) from 12.5 μg/mL to 0.02 μg/mL and incubated for 90 minutes at room temperature. Liquid was aspirated from wells and two rabbit anti-TRIM21 antibodies (AbCam catalogue # ab91423 and ab96800) were mix together in PBST-BSA at a final concentration of 1 μg/mL each and 100 μL was added to each well and incubated for 1 hour at room temperature. Plates were washed three times with PBST. Polyclonal swine anti-rabbit-HRP (Agilent catalogue # P021702-2) was diluted to 0.5 μg/mL in PBST-BSA and 100 μL was added to each well and incubated for 1 hour at room temperature. Plates were washed six times with PBST. Plates were developed using the TMB Microwell Peroxidase Substrate Kit (VWR catalogue #95059-156). The reaction was stopped after 10 minutes by the addition of 1N sulfuric acid and absorbance at 450 nm was measured. The values of antibody concentration (x-axis) and absorbance at 450 nm (y-axis) were fit to a four parameter logistic regression (4PL) curve. The curve fit was then used to determine the EC50 (the midpoint of the 4PL) for each Fc variant. - A TRIM21 binding ELISA was performed to evaluate if the Fc variants impacted binding to TRIM21. The results are shown in
FIG. 26 . Fc variants FcMut045, FcMut183, FcMut197, FcMut213, FcMut215, FcMut228 had TRIM21 binding EC50s that were within 1.5 fold of WT EC50. - FcRn transports IgG across different cellular barriers such as the mucosal epithelium lining the intestine and the alveolar surfaces. Modification of FcRn binding provides a mechanism to enhance mucosal localization that confers immune protection. Exemplary Fc mutants are expected to enhance mucosal uptake in a similar fashion
- The impact of FcRn affinity enhancing mutations on binding of Fc to other receptors was experimentally evaluated. The Fc region of IgG is capable of binding to many different Fc receptors and the mechanism of action for many therapeutic antibodies relies on engagement with Fc receptors. Mutations, even at positions distant from the Fc receptor binding site, can impact engagement of Fc with receptors such as FcγRI, FcγRIIa/b, FcγRIIIa, C1q, TRIM21. While Fc receptor TRIM21 binds to a site that overlaps with FcRn binding site on CH2-CH3, other receptors such Fcγ receptors and C1q engage at the interface formed by dimeric CH2. As such any mutations introduced for enhancing half-life should be assessed for its impact on binding to other receptors. Mutations introduced to enhance half-life can The Fc variants (FcMut183, FcMut197, FcMut213, FcMut215, FcMut228, FcMut229, YTE, LS) were incorporated into rituximab Fab and together with WT rituximab, were evaluated for binding to FcγRI, FcγRIIa, FcγRIIb, FcγRIIIa, C1q and TRIM21. As shown in
FIG. 24 , introduction of Fc variants FcMut183, FcMut197, FcMut213, FcMut215, FcMut228 and FcMut229 did not significantly impact engagement with the tested Fc receptors. - While binding to Fc receptors is necessary for activities such as ADCC (FcγRIIIa), CDC (C1q) and ADIN (TRIM21), it may not be sufficient in mediating these activities. For example, a hexameric assembly of Fc is required to elicit CDC activity. The Fc hexamer assembly involves formation of an Fc-Fc interface, and residues involved in formation of this interface partially overlaps with FcRn binding site. As such, it was important to evaluate the impact of the Fc mutations on not just binding to Fc receptors but also activities such as CDC and ADCC. Rituximab with various Fc variants (FcMut183, FcMut197, FcMut213, FcMut215, FcMut228, FcMut229, YTE, LS, WT) were evaluated for ADCC and CDC activities as described in the methods section. The results confirmed that Fc variants FcMut183, FcMut197, FcMut213, FcMut215, FcMut228 and FcMut229 did not negatively impact ADCC activity and in fact showed a slight enhancement in CDC activity. Rituximab containing YTE had no detectable CDC activity and significantly reduced ADCC activity. Similarly another mutant FcMut197 had reduced ADCC and CDC activity. Inspects of the network map of these mutations provides an insight into the possible reason for loss of ADCC and CDC activity.
- To evaluate whether the enhanced binding of Fc variants to human FcRn translated to increased serum persistence and longer circulating half-life life, a pharmacokinetic study of IgGs containing the different Fc variants was performed in Tg276 transgenic mice. Transgenic mouse models expressing human FcRn can be used to study PK of human Fc-containing biotherapeutics (Roopenian et al., Methods Mol Biol, 2010. 602: 93-104; Petkova et al., Int Immunol, 2006. 18(12): 1759-69). The Tg276 mice are null for mouse FcRn alpha chain and express the human FcRn alpha transgene under the control of a constitutive promoter (actin) and use the mouse β2microglobuli. The Tg276 homozygous and hemizygous mice can be used to differentiate half-lives of antibody variants. For the PK study, Tg276hemi FcRn transgenic mice were intravenously administered with 5 mg/kg of IgG (motavizumab Fab on WT or modified Fc). Retro-orbital blood collection was performed at several time points, and IgG titers were determined by quantitative ELISA. IgGs containing the engineered Fc variants persisted in serum much longer than wild-type Motavizumab (
FIG. 25A ). Pharmacokinetic parameters from non-compartmental analysis indicates Motavizumab with Fc variants have greater than two fold slower clearance rate and significant increases in β-phase elimination half-life and area under the curve (AUC) measurements (FIG. 25B ). - All publications, patents, and Accession numbers mentioned herein are hereby incorporated by reference in their entirety as if each individual publication or patent was specifically and individually indicated to be incorporated by reference.
- While specific embodiments of the subject invention have been discussed, the above specification is illustrative and not restrictive. Many variations of the invention will become apparent to those skilled in the art upon review of this specification and the claims below. The full scope of the invention should be determined by reference to the claims, along with their full scope of equivalents, and the specification, along with such variations.
Claims (26)
1. A polypeptide comprising the CH2 and CH3 domains of an Fc region, wherein the CH2 and CH3 domains of the Fc region comprises mutations from any of (i)-(vi):
(i) T256D, Q311V, and A378V;
(ii) H285N, T307Q, and N315D;
(iii) H285D, T307Q, and A378V;
(iv) T307Q, Q311V, and A378V;
(v) T256D, N286D, T307R, Q311V, and A378V; or
(vi) T256D, H285D, T307R, Q311V, and A378V.
2. The polypeptide of claim 1 , which is an isolated polypeptide or a synthetic polypeptide.
3. The polypeptide of claim 1 , wherein the CH2 and CH3 domains of the Fc region comprises the mutations T256D, Q311V, and A378V.
4. The polypeptide of claim 1 , wherein the CH2 and CH3 domains of the Fc region comprises the mutations H285N, T307Q, and N315D.
5. The polypeptide of claim 1 , wherein the CH2 and CH3 domains of the Fc region comprises the mutations H285D, T307Q, and A378V.
6. The polypeptide of claim 1 , wherein the CH2 and CH3 domains of the Fc region comprises the mutations T307Q, Q311V, and A378V.
7. The polypeptide of claim 1 , wherein the CH2 and CH3 domains of the Fc region comprises the mutations T256D, N286D, T307R, Q311V, and A378V.
8. The polypeptide of claim 1 , wherein the CH2 and CH3 domains of the Fc region comprises the mutations T256D, H285D, T307R, Q311V, and A378V.
9. The polypeptide of claim 1 , which further comprises a hinge region between the CH2 and CH3 domains of the Fc region.
10. The polypeptide of claim 1 , which is an antibody molecule.
11. The polypeptide of claim 10 , wherein the antibody molecule is a chimeric antibody molecule or a murine antibody molecule.
12. The polypeptide of claim 10 , wherein the antibody molecule is a human antibody molecule or a humanized antibody molecule.
13. The polypeptide of claim 1 , which further comprises a heavy chain immunoglobulin variable region, a light chain immunoglobulin variable region, or both.
14. The polypeptide of claim 1 , which is an immunoglobulin chain or a fragment thereof.
15. The polypeptide of claim 1 , which is a fusion protein.
16. A composition comprising the polypeptide of claim 1 .
17. The composition of claim 16 , further comprising a pharmaceutically acceptable carrier.
18. A nucleic acid molecule encoding the polypeptide of claim 1 .
19. A vector comprising the nucleic acid molecule of claim 18 .
20. A cell comprising the nucleic acid molecule of claim 18 .
21. A kit comprising the polypeptide of claim 1 and instructions to use of the polypeptide.
22. A container comprising the polypeptide of claim 1 .
23. A method of producing a polypeptide, the method comprising culturing the cell of claim 20 under conditions that allow production of an antibody molecule, thereby producing the polypeptide.
24. The method of claim 23 , further comprising isolating or purifying the polypeptide.
25. A method of treating a disorder, the method comprising administering to a subject in need thereof an effective amount of the polypeptide of claim 1 , thereby treating the disorder.
26. A method of detecting a molecule, the method comprising contacting a cell or a sample from a subject with the polypeptide of claim 1 , thereby detecting the molecule.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US16/845,894 US20200277358A1 (en) | 2016-08-02 | 2020-04-10 | Engineered polypeptides and uses thereof |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201662370201P | 2016-08-02 | 2016-08-02 | |
US201762485671P | 2017-04-14 | 2017-04-14 | |
US15/667,309 US11858980B2 (en) | 2016-08-02 | 2017-08-02 | Engineered polypeptides and uses thereof |
US16/845,894 US20200277358A1 (en) | 2016-08-02 | 2020-04-10 | Engineered polypeptides and uses thereof |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/667,309 Continuation US11858980B2 (en) | 2016-08-02 | 2017-08-02 | Engineered polypeptides and uses thereof |
Publications (1)
Publication Number | Publication Date |
---|---|
US20200277358A1 true US20200277358A1 (en) | 2020-09-03 |
Family
ID=59656189
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/667,309 Active US11858980B2 (en) | 2016-08-02 | 2017-08-02 | Engineered polypeptides and uses thereof |
US16/845,894 Pending US20200277358A1 (en) | 2016-08-02 | 2020-04-10 | Engineered polypeptides and uses thereof |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/667,309 Active US11858980B2 (en) | 2016-08-02 | 2017-08-02 | Engineered polypeptides and uses thereof |
Country Status (15)
Country | Link |
---|---|
US (2) | US11858980B2 (en) |
EP (1) | EP3494134A1 (en) |
JP (2) | JP7464389B2 (en) |
KR (1) | KR20190038607A (en) |
CN (2) | CN110072887A (en) |
AU (1) | AU2017325654A1 (en) |
BR (1) | BR112019001989A2 (en) |
CA (1) | CA3032820A1 (en) |
CL (2) | CL2019000261A1 (en) |
CO (1) | CO2019000931A2 (en) |
IL (1) | IL264590A (en) |
MX (1) | MX2019001458A (en) |
RU (1) | RU2019104889A (en) |
SG (1) | SG11201900616UA (en) |
WO (1) | WO2018052556A1 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11858980B2 (en) | 2016-08-02 | 2024-01-02 | Visterra, Inc. | Engineered polypeptides and uses thereof |
Families Citing this family (27)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP3412279B1 (en) | 2010-09-24 | 2021-02-17 | The Brigham and Women's Hospital, Inc. | Nanostructured gels capable of controlled release of encapsulated agents |
WO2018031400A1 (en) * | 2016-08-12 | 2018-02-15 | Janssen Biotech, Inc. | Fc engineered anti-tnfr superfamily member antibodies having enhanced agonistic activity and methods of using them |
MA45919A (en) | 2016-08-12 | 2019-06-19 | Janssen Biotech Inc | DESIGN OF MODIFIED ANTIBODIES AND OTHER MOLECULES CONTAINING FC DOMAIN WITH ENHANCED AGONISM AND EFFECTOR FUNCTIONS |
WO2018144991A1 (en) | 2017-02-03 | 2018-08-09 | The Brigham And Women's Hospital, Inc. | Self-assembled gels formed with anti-retroviral drugs, prodrugs thereof, and pharmaceutical uses thereof |
EP3762014A4 (en) * | 2018-03-05 | 2021-08-25 | Oncoimmune, Inc. | Methods of use of soluble cd24 for treating acquired immune deficiency syndrome (hiv/aids) |
WO2019195546A1 (en) | 2018-04-04 | 2019-10-10 | Alivio Therapeutics, Inc. | Self-assembled gels for controlled delivery of biologics and methods of making thereof |
JP7372237B2 (en) * | 2018-06-04 | 2023-10-31 | 中外製薬株式会社 | Antigen-binding molecules with altered half-lives in the cytoplasm |
US20210317479A1 (en) | 2018-09-06 | 2021-10-14 | The Broad Institute, Inc. | Nucleic acid assemblies for use in targeted delivery |
EP3883968A4 (en) * | 2018-11-22 | 2022-08-17 | Agency for Science, Technology and Research | Modified fc region |
AU2020280543A1 (en) * | 2019-05-23 | 2022-01-27 | Xiamen University | Anti-hepatitis B virus antibodies and use thereof |
EP3983442A2 (en) | 2019-06-17 | 2022-04-20 | Visterra, Inc. | Humanized antibody molecules to cd138 and uses thereof |
BR112022001415A2 (en) | 2019-07-26 | 2022-06-07 | Visterra Inc | Interleukin-2 agents and their uses |
EP4025596A4 (en) * | 2019-09-04 | 2023-09-20 | Cedars-Sinai Medical Center | Use of calcineurin inhibitor free ctla4-ig + anti-il6/il6r for long term immunosuppression in solid organ transplant recipients |
EP3819312A1 (en) * | 2019-11-10 | 2021-05-12 | Amgen, Inc | Dosing regimen for anti-dll3 agents |
WO2021119467A1 (en) | 2019-12-11 | 2021-06-17 | Visterra, Inc. | Compositions and methods for treating and preventing influenza |
TW202140553A (en) | 2020-01-13 | 2021-11-01 | 美商威特拉公司 | Antibody molecules to c5ar1 and uses thereof |
CN111254207A (en) * | 2020-01-22 | 2020-06-09 | 郑州大学第一附属医院 | Intestinal microbial marker for distinguishing autoimmune hepatitis from healthy people and application thereof |
MX2022016591A (en) | 2020-06-24 | 2023-04-20 | Visterra Inc | Antibody molecules to april and uses thereof. |
MX2023006599A (en) | 2020-12-04 | 2023-06-19 | Visterra Inc | Methods of using interleukin-2 agents. |
TW202245825A (en) | 2021-01-20 | 2022-12-01 | 美商威特拉公司 | Interleukin-2 agents and uses thereof |
US20230348614A1 (en) | 2021-11-24 | 2023-11-02 | Visterra, Inc. | Engineered antibody molecules to cd138 and uses thereof |
CA3238574A1 (en) | 2021-12-01 | 2023-06-08 | Gregory Babcock | Methods of using interleukin-2 agents |
WO2023154870A1 (en) | 2022-02-11 | 2023-08-17 | Visterra, Inc. | Interleukin-2 muteins for the treatment of autoimmune diseases |
TW202400637A (en) | 2022-04-25 | 2024-01-01 | 美商威特拉公司 | Antibody molecules to april and uses thereof |
WO2024027793A1 (en) * | 2022-08-05 | 2024-02-08 | I-Mab Biopharma (Hangzhou) Co., Ltd. | Bispecific antibodies targeting ifnar1 and blys |
WO2024097938A1 (en) * | 2022-11-04 | 2024-05-10 | Cephalon, LLC | Compositions and methods for increasing transport into the brain |
CN117467025B (en) * | 2023-12-28 | 2024-04-16 | 上海鼎新基因科技有限公司 | anti-VEGF and complement bifunctional fusion protein and application thereof |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5843708A (en) * | 1988-01-05 | 1998-12-01 | Ciba-Geigy Corporation | Chimeric antibodies |
US20140294812A1 (en) * | 2013-03-15 | 2014-10-02 | Xencor, Inc. | Fc variants that improve fcrn binding and/or increase antibody half-life |
Family Cites Families (101)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
JPS6147500A (en) | 1984-08-15 | 1986-03-07 | Res Dev Corp Of Japan | Chimera monoclonal antibody and its preparation |
EP0173494A3 (en) | 1984-08-27 | 1987-11-25 | The Board Of Trustees Of The Leland Stanford Junior University | Chimeric receptors by dna splicing and expression |
GB8422238D0 (en) | 1984-09-03 | 1984-10-10 | Neuberger M S | Chimeric proteins |
JPS61134325A (en) | 1984-12-04 | 1986-06-21 | Teijin Ltd | Expression of hybrid antibody gene |
US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
GB8607679D0 (en) | 1986-03-27 | 1986-04-30 | Winter G P | Recombinant dna product |
DE3883899T3 (en) | 1987-03-18 | 1999-04-22 | Sb2 Inc | CHANGED ANTIBODIES. |
DE68927933T2 (en) | 1988-09-02 | 1997-08-14 | Dyax Corp | PRODUCTION AND SELECTION OF RECOMBINANT PROTEINS WITH DIFFERENT BINDING POINTS |
US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
GB8905669D0 (en) | 1989-03-13 | 1989-04-26 | Celltech Ltd | Modified antibodies |
WO1991000906A1 (en) | 1989-07-12 | 1991-01-24 | Genetics Institute, Inc. | Chimeric and transgenic animals capable of producing human antibodies |
SG48759A1 (en) | 1990-01-12 | 2002-07-23 | Abgenix Inc | Generation of xenogenic antibodies |
US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
GB9015198D0 (en) | 1990-07-10 | 1990-08-29 | Brien Caroline J O | Binding substance |
ATE185601T1 (en) | 1990-07-10 | 1999-10-15 | Cambridge Antibody Tech | METHOD FOR PRODUCING SPECIFIC BONDING PAIRS |
KR100272077B1 (en) | 1990-08-29 | 2000-11-15 | 젠팜인터내셔날,인코포레이티드 | Transgenic non-human animals capable of producing heterologous antibodies |
WO1992003917A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International | Homologous recombination in mammalian cells |
ATE164395T1 (en) | 1990-12-03 | 1998-04-15 | Genentech Inc | METHOD FOR ENRICHMENT OF PROTEIN VARIANTS WITH MODIFIED BINDING PROPERTIES |
EP0575485A1 (en) | 1991-03-01 | 1993-12-29 | Dyax Corp. | Process for the development of binding mini-proteins |
WO1992018619A1 (en) | 1991-04-10 | 1992-10-29 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
DE69233482T2 (en) | 1991-05-17 | 2006-01-12 | Merck & Co., Inc. | Method for reducing the immunogenicity of antibody variable domains |
DE4122599C2 (en) | 1991-07-08 | 1993-11-11 | Deutsches Krebsforsch | Phagemid for screening antibodies |
AU4116793A (en) | 1992-04-24 | 1993-11-29 | Board Of Regents, The University Of Texas System | Recombinant production of immunoglobulin-like domains in prokaryotic cells |
DK1087013T3 (en) | 1992-08-21 | 2009-05-11 | Univ Bruxelles | Immunoglobulins without light chains |
WO1997034631A1 (en) | 1996-03-18 | 1997-09-25 | Board Of Regents, The University Of Texas System | Immunoglobin-like domains with increased half lives |
US6277375B1 (en) * | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
KR101077001B1 (en) | 1999-01-15 | 2011-10-26 | 제넨테크, 인크. | Polypeptide Variants with Altered Effector Function |
US7183387B1 (en) | 1999-01-15 | 2007-02-27 | Genentech, Inc. | Polypeptide variants with altered effector function |
EP1355919B1 (en) | 2000-12-12 | 2010-11-24 | MedImmune, LLC | Molecules with extended half-lives, compositions and uses thereof |
US7658921B2 (en) | 2000-12-12 | 2010-02-09 | Medimmune, Llc | Molecules with extended half-lives, compositions and uses thereof |
KR100988949B1 (en) | 2001-10-25 | 2010-10-20 | 제넨테크, 인크. | Glycoprotein compositions |
US7317091B2 (en) | 2002-03-01 | 2008-01-08 | Xencor, Inc. | Optimized Fc variants |
US20040132101A1 (en) | 2002-09-27 | 2004-07-08 | Xencor | Optimized Fc variants and methods for their generation |
CA2491488A1 (en) | 2002-07-09 | 2004-01-15 | Genentech, Inc. | Compositions and methods for the diagnosis and treatment of tumor |
WO2004063351A2 (en) | 2003-01-09 | 2004-07-29 | Macrogenics, Inc. | IDENTIFICATION AND ENGINEERING OF ANTIBODIES WITH VARIANT Fc REGIONS AND METHODS OF USING SAME |
CA2545603A1 (en) | 2003-11-12 | 2005-05-26 | Biogen Idec Ma Inc. | Neonatal fc receptor (fcrn)-binding polypeptide variants, dimeric fc binding proteins and methods related thereto |
AU2012203476A1 (en) | 2003-11-12 | 2012-07-05 | Biogen Idec Ma Inc. | Neonatal Fc Receptor (FcRn)-Binding Polypeptide Variants, Dimeric Fc Binding Proteins and Methods Related Thereto |
DK1706424T3 (en) | 2004-01-12 | 2009-11-02 | Applied Molecular Evolution | FC region variants |
US7740847B2 (en) | 2004-08-04 | 2010-06-22 | Applied Molecular Evolution, Inc. | Variant Fc regions |
EP1778728A2 (en) * | 2004-08-19 | 2007-05-02 | Genentech, Inc. | Polypeptide variants with altered effector function |
US8802820B2 (en) | 2004-11-12 | 2014-08-12 | Xencor, Inc. | Fc variants with altered binding to FcRn |
US8546543B2 (en) * | 2004-11-12 | 2013-10-01 | Xencor, Inc. | Fc variants that extend antibody half-life |
US8367805B2 (en) | 2004-11-12 | 2013-02-05 | Xencor, Inc. | Fc variants with altered binding to FcRn |
DK2325207T3 (en) | 2004-11-12 | 2017-06-06 | Xencor Inc | Fc variants with altered binding to FcRn |
CA2595169A1 (en) * | 2005-01-12 | 2006-07-20 | Xencor, Inc. | Antibodies and fc fusion proteins with altered immunogenicity |
US20110123440A1 (en) | 2005-03-29 | 2011-05-26 | Genevieve Hansen | Altered Antibody FC Regions and Uses Thereof |
WO2008030564A2 (en) | 2006-09-08 | 2008-03-13 | Verenium Corporation | Aglycosylated antibodies and methods of making and using those antibodies |
EP2083017A4 (en) | 2006-09-14 | 2011-01-12 | Med & Biological Lab Co Ltd | Antibody having enhanced adcc activity and method for production thereof |
US20100184959A1 (en) | 2007-03-19 | 2010-07-22 | Medimmune Limited | Polypeptide Variants |
EP3825329A1 (en) | 2007-12-26 | 2021-05-26 | Xencor, Inc. | Fc variants with altered binding to fcrn |
EP3524620A1 (en) | 2008-10-14 | 2019-08-14 | Genentech, Inc. | Immunoglobulin variants and uses thereof |
WO2010068722A1 (en) | 2008-12-12 | 2010-06-17 | Medimmune, Llc | Crystals and structure of a human igg fc variant with enhanced fcrn binding |
MX2011007833A (en) | 2009-01-23 | 2011-10-06 | Biogen Idec Inc | Stabilized fc polypeptides with reduced effector function and methods of use. |
EP2233500A1 (en) * | 2009-03-20 | 2010-09-29 | LFB Biotechnologies | Optimized Fc variants |
AU2015200990B2 (en) | 2009-03-20 | 2016-07-21 | Laboratoire Français Du Fractionnement Et Des Biotechnologies | Optimized Fc variants |
EP2445520A4 (en) | 2009-06-22 | 2013-03-06 | Medimmune Llc | ENGINEERED Fc REGIONS FOR SITE-SPECIFIC CONJUGATION |
IT1395574B1 (en) | 2009-09-14 | 2012-10-16 | Guala Dispensing Spa | DISTRIBUTION DEVICE |
WO2011057198A1 (en) | 2009-11-09 | 2011-05-12 | Carson Cantwell G | Vaccine testing system |
US20170039314A1 (en) | 2010-03-23 | 2017-02-09 | Iogenetics, Llc | Bioinformatic processes for determination of peptide binding |
EP2550529B1 (en) | 2010-03-23 | 2021-11-17 | Iogenetics, LLC. | Bioinformatic processes for determination of peptide binding |
TWI667346B (en) | 2010-03-30 | 2019-08-01 | 中外製藥股份有限公司 | Antibodies with modified affinity to fcrn that promote antigen clearance |
WO2012032080A1 (en) * | 2010-09-07 | 2012-03-15 | F-Star Biotechnologische Forschungs- Und Entwicklungsges.M.B.H | Stabilised human fc |
EP4231014A3 (en) | 2010-11-30 | 2024-03-20 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule capable of binding to plurality of antigen molecules repeatedly |
EP2654790B1 (en) | 2010-12-22 | 2019-02-06 | Teva Pharmaceuticals Australia Pty Ltd | Modified antibody with improved half-life |
EP2673299B1 (en) | 2011-02-07 | 2017-05-10 | Research Development Foundation | Engineered immunoglobulin fc polypeptides |
WO2012132067A1 (en) | 2011-03-30 | 2012-10-04 | 中外製薬株式会社 | Retention of antigen-binding molecules in blood plasma and method for modifying immunogenicity |
US20140093496A1 (en) | 2011-02-25 | 2014-04-03 | Chugai Seiyaku Kabushiki Kaisha | Fc-gamma-RIIb-SPECIFIC Fc ANTIBODY |
EP3590965A1 (en) | 2011-03-29 | 2020-01-08 | Roche Glycart AG | Antibody fc variants |
AU2012233313C1 (en) | 2011-03-30 | 2017-08-03 | Chugai Seiyaku Kabushiki Kaisha | Method for altering plasma retention and immunogenicity of antigen-binding molecule |
WO2013012733A1 (en) | 2011-07-15 | 2013-01-24 | Biogen Idec Ma Inc. | Heterodimeric fc regions, binding molecules comprising same, and methods relating thereto |
GB201112429D0 (en) | 2011-07-19 | 2011-08-31 | Glaxo Group Ltd | Antigen-binding proteins with increased FcRn binding |
TW201326209A (en) | 2011-09-30 | 2013-07-01 | Chugai Pharmaceutical Co Ltd | Therapeutic antigen-binding molecule with a FcRn-binding domain that promotes antigen clearance |
EP2762493B1 (en) | 2011-09-30 | 2021-06-09 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule promoting disappearance of antigens having plurality of biological activities |
TW201726745A (en) | 2011-09-30 | 2017-08-01 | 中外製藥股份有限公司 | Antigen-binding molecule for promoting loss of antigens |
WO2013047729A1 (en) | 2011-09-30 | 2013-04-04 | 中外製薬株式会社 | Antigen-binding molecule inducing immune response to target antigen |
KR20210074395A (en) | 2011-11-30 | 2021-06-21 | 추가이 세이야쿠 가부시키가이샤 | Drug containing carrier into cell for forming immune complex |
EP2794650B1 (en) | 2011-12-21 | 2019-08-14 | Amgen Inc. | Variant fc-polypeptides with enhanced binding to the neonatal fc receptor |
WO2013093809A1 (en) | 2011-12-23 | 2013-06-27 | Pfizer Inc. | Engineered antibody constant regions for site-specific conjugation and methods and uses therefor |
US20150210763A1 (en) | 2012-02-09 | 2015-07-30 | Chugai Seiyaku Kabushiki Kaisha | MODIFIED Fc REGION OF ANTIBODY |
JP6545959B2 (en) | 2012-02-11 | 2019-07-17 | ジェネンテック, インコーポレイテッド | R-Spondin rearrangement and method of using the same |
MX370668B (en) | 2012-02-24 | 2019-12-19 | Chugai Pharmaceutical Co Ltd | Antigen-binding molecule for promoting disappearance of antigen via fc gamma riib. |
EP2844289B1 (en) | 2012-04-30 | 2019-07-17 | MedImmune, LLC | Molecules with reduced effector function and extended half-lives, compositions, and uses thereof |
WO2013180200A1 (en) | 2012-05-30 | 2013-12-05 | 中外製薬株式会社 | Target-tissue-specific antigen-binding molecule |
EP2857419B1 (en) | 2012-05-30 | 2021-01-13 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule for eliminating aggregated antigens |
CN104736174B (en) | 2012-07-06 | 2019-06-14 | 根马布私人有限公司 | Protein dimer with triple mutant |
JP6280300B2 (en) | 2012-08-24 | 2018-02-14 | 中外製薬株式会社 | Brain disease treatment |
CA2904806C (en) | 2013-04-29 | 2021-11-23 | F. Hoffmann-La Roche Ag | Human fcrn-binding modified antibodies and methods of use |
EP3888690A3 (en) * | 2014-05-16 | 2021-10-20 | MedImmune, LLC | Molecules with altered neonate fc receptor binding having enhanced therapeutic and diagnostic properties |
CA2946430A1 (en) | 2014-06-12 | 2015-12-17 | F. Hoffmann-La Roche Ag | Method for selecting antibodies with modified fcrn interaction |
FR3024453B1 (en) | 2014-08-01 | 2018-06-29 | Lab Francais Du Fractionnement | PROCESS FOR PRODUCING VARIANTS HAVING FC HAVING ENHANCED SIALYLATION |
PL3215528T3 (en) | 2014-11-06 | 2020-01-31 | F.Hoffmann-La Roche Ag | Fc-region variants with modified fcrn-binding and methods of use |
WO2016164480A1 (en) | 2015-04-07 | 2016-10-13 | Genentech, Inc. | Antigen binding complex having agonistic activity and methods of use |
FR3035879A1 (en) | 2015-05-07 | 2016-11-11 | Lab Francais Du Fractionnement | MUTANTS FC WITH MODIFIED FUNCTIONAL ACTIVITY |
EP3423572B1 (en) | 2016-03-02 | 2023-11-29 | Momenta Pharmaceuticals, Inc. | Methods related to engineered fc constructs |
CA3011887A1 (en) | 2016-03-14 | 2017-09-21 | Stian FOSS | Engineered immunoglobulins with altered fcrn binding |
WO2017181098A2 (en) | 2016-04-15 | 2017-10-19 | Visterra, Inc. | Antibody molecules to zika virus and uses thereof |
US11858980B2 (en) | 2016-08-02 | 2024-01-02 | Visterra, Inc. | Engineered polypeptides and uses thereof |
EP3456738A1 (en) | 2017-09-19 | 2019-03-20 | Tillotts Pharma Ag | Antibody variants |
-
2017
- 2017-08-02 US US15/667,309 patent/US11858980B2/en active Active
- 2017-08-02 RU RU2019104889A patent/RU2019104889A/en unknown
- 2017-08-02 EP EP17754535.7A patent/EP3494134A1/en active Pending
- 2017-08-02 CA CA3032820A patent/CA3032820A1/en active Pending
- 2017-08-02 WO PCT/US2017/045126 patent/WO2018052556A1/en active Application Filing
- 2017-08-02 BR BR112019001989A patent/BR112019001989A2/en unknown
- 2017-08-02 JP JP2019505188A patent/JP7464389B2/en active Active
- 2017-08-02 CN CN201780059776.2A patent/CN110072887A/en active Pending
- 2017-08-02 KR KR1020197006298A patent/KR20190038607A/en not_active Application Discontinuation
- 2017-08-02 SG SG11201900616UA patent/SG11201900616UA/en unknown
- 2017-08-02 CN CN202410254572.6A patent/CN118085091A/en active Pending
- 2017-08-02 MX MX2019001458A patent/MX2019001458A/en unknown
- 2017-08-02 AU AU2017325654A patent/AU2017325654A1/en active Pending
-
2019
- 2019-01-30 CO CONC2019/0000931A patent/CO2019000931A2/en unknown
- 2019-01-31 IL IL264590A patent/IL264590A/en unknown
- 2019-01-31 CL CL2019000261A patent/CL2019000261A1/en unknown
-
2020
- 2020-04-10 US US16/845,894 patent/US20200277358A1/en active Pending
-
2022
- 2022-01-06 CL CL2022000036A patent/CL2022000036A1/en unknown
- 2022-06-14 JP JP2022096036A patent/JP2022120132A/en not_active Withdrawn
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5843708A (en) * | 1988-01-05 | 1998-12-01 | Ciba-Geigy Corporation | Chimeric antibodies |
US20140294812A1 (en) * | 2013-03-15 | 2014-10-02 | Xencor, Inc. | Fc variants that improve fcrn binding and/or increase antibody half-life |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11858980B2 (en) | 2016-08-02 | 2024-01-02 | Visterra, Inc. | Engineered polypeptides and uses thereof |
Also Published As
Publication number | Publication date |
---|---|
CN110072887A (en) | 2019-07-30 |
WO2018052556A8 (en) | 2019-03-14 |
KR20190038607A (en) | 2019-04-08 |
CL2022000036A1 (en) | 2022-10-28 |
WO2018052556A1 (en) | 2018-03-22 |
IL264590A (en) | 2019-02-28 |
CL2019000261A1 (en) | 2019-06-28 |
RU2019104889A3 (en) | 2020-09-04 |
CN118085091A (en) | 2024-05-28 |
CO2019000931A2 (en) | 2019-02-08 |
BR112019001989A2 (en) | 2019-08-20 |
JP7464389B2 (en) | 2024-04-09 |
US11858980B2 (en) | 2024-01-02 |
EP3494134A1 (en) | 2019-06-12 |
SG11201900616UA (en) | 2019-02-27 |
JP2022120132A (en) | 2022-08-17 |
AU2017325654A1 (en) | 2019-02-14 |
JP2019531705A (en) | 2019-11-07 |
CA3032820A1 (en) | 2018-03-22 |
RU2019104889A (en) | 2020-09-04 |
MX2019001458A (en) | 2019-07-04 |
US20180037634A1 (en) | 2018-02-08 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20200277358A1 (en) | Engineered polypeptides and uses thereof | |
US11942149B2 (en) | Bispecific binding molecules that are capable of binding CD137 and tumor antigens, and uses thereof | |
US11525007B2 (en) | Antibody fab and Fc variants | |
JP2019514844A (en) | Combination therapy with anti-CD73 antibody | |
TW201625693A (en) | Antibodies against CD73 and uses thereof | |
TW201708255A (en) | Antibodies against OX40 and uses thereof | |
TW202003565A (en) | Antibodies against MICA and/or MICB and uses thereof | |
KR20230008775A (en) | Bispecific antibodies to CD3 and CD20 | |
CA2689680A1 (en) | Fc receptor-binding polypeptides with modified effector functions | |
JP7285936B2 (en) | Antibodies against IL-7R alpha subunit and uses thereof | |
KR20200100147A (en) | Human IgG Fc domain variants with improved effector function | |
Pelletier et al. | Passive monoclonal and polyclonal antibody therapies | |
BR112020011810A2 (en) | cd16 binding molecule x disease antigen, pharmaceutical composition, use of pharmaceutical composition, and method for treating a disease | |
US20220242962A1 (en) | 4-1bb and ox40 binding proteins and related compositions and methods, antibodies against 4-1bb, antibodies against ox40 | |
JP2023531722A (en) | ANTIBODY MOLECULES AGAINST APRIL AND USES THEREOF | |
NZ790823A (en) | Engineered polypeptides and uses thereof | |
NZ790739A (en) | Engineered polypeptides and uses thereof | |
KR20230147072A (en) | Interleukin-2 mutants and uses thereof | |
JP2023551907A (en) | Tumor-associated antigens and CD3 binding proteins, related compositions, and methods | |
KR20230129018A (en) | How to use interleukin-2 agonists |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |