US20190241627A1 - Light-activated chimeric opsins and methods of using the same - Google Patents
Light-activated chimeric opsins and methods of using the same Download PDFInfo
- Publication number
- US20190241627A1 US20190241627A1 US16/211,083 US201816211083A US2019241627A1 US 20190241627 A1 US20190241627 A1 US 20190241627A1 US 201816211083 A US201816211083 A US 201816211083A US 2019241627 A1 US2019241627 A1 US 2019241627A1
- Authority
- US
- United States
- Prior art keywords
- light
- amino acid
- acid sequence
- cell
- activated
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 238000000034 method Methods 0.000 title claims abstract description 48
- 108050001704 Opsin Proteins 0.000 title description 56
- 102000010175 Opsin Human genes 0.000 title description 48
- 210000002569 neuron Anatomy 0.000 claims abstract description 188
- 230000002401 inhibitory effect Effects 0.000 claims abstract description 74
- 230000002964 excitative effect Effects 0.000 claims abstract description 71
- 210000000170 cell membrane Anatomy 0.000 claims abstract description 40
- 210000004027 cell Anatomy 0.000 claims description 162
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 128
- 230000002999 depolarising effect Effects 0.000 claims description 36
- 230000032258 transport Effects 0.000 claims description 35
- 229920001184 polypeptide Polymers 0.000 claims description 29
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 29
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 29
- 210000002442 prefrontal cortex Anatomy 0.000 claims description 24
- 210000001176 projection neuron Anatomy 0.000 claims description 23
- 108091033319 polynucleotide Proteins 0.000 claims description 21
- 102000040430 polynucleotide Human genes 0.000 claims description 21
- 239000002157 polynucleotide Substances 0.000 claims description 21
- 102000001675 Parvalbumin Human genes 0.000 claims description 14
- 108060005874 Parvalbumin Proteins 0.000 claims description 14
- 210000004962 mammalian cell Anatomy 0.000 claims description 14
- 210000004899 c-terminal region Anatomy 0.000 claims description 8
- 239000002773 nucleotide Substances 0.000 claims description 7
- 125000003729 nucleotide group Chemical group 0.000 claims description 7
- 210000000663 muscle cell Anatomy 0.000 claims description 6
- 210000000130 stem cell Anatomy 0.000 claims description 6
- 102000037865 fusion proteins Human genes 0.000 abstract description 85
- 108020001507 fusion proteins Proteins 0.000 abstract description 85
- 239000000203 mixture Substances 0.000 abstract description 8
- 108090000623 proteins and genes Proteins 0.000 description 201
- 102000004169 proteins and genes Human genes 0.000 description 189
- 235000018102 proteins Nutrition 0.000 description 187
- 108010035848 Channelrhodopsins Proteins 0.000 description 105
- 230000035772 mutation Effects 0.000 description 51
- 235000001014 amino acid Nutrition 0.000 description 49
- 230000004913 activation Effects 0.000 description 47
- 210000004102 animal cell Anatomy 0.000 description 47
- 239000001654 beetroot red Substances 0.000 description 37
- 230000004044 response Effects 0.000 description 37
- 239000013598 vector Substances 0.000 description 35
- 239000004176 azorubin Substances 0.000 description 34
- 150000001413 amino acids Chemical class 0.000 description 31
- 229940024606 amino acid Drugs 0.000 description 28
- 230000000694 effects Effects 0.000 description 25
- 230000000875 corresponding effect Effects 0.000 description 23
- 230000014509 gene expression Effects 0.000 description 23
- 238000006467 substitution reaction Methods 0.000 description 23
- 230000001965 increasing effect Effects 0.000 description 21
- 210000004556 brain Anatomy 0.000 description 19
- 230000000401 corticothalamic effect Effects 0.000 description 19
- 241000702421 Dependoparvovirus Species 0.000 description 17
- 230000001537 neural effect Effects 0.000 description 17
- 241000699670 Mus sp. Species 0.000 description 16
- 241000700605 Viruses Species 0.000 description 16
- 230000001054 cortical effect Effects 0.000 description 16
- 239000012528 membrane Substances 0.000 description 16
- 241001465754 Metazoa Species 0.000 description 15
- 125000000539 amino acid group Chemical group 0.000 description 15
- 230000000638 stimulation Effects 0.000 description 15
- 208000002267 Anti-neutrophil cytoplasmic antibody-associated vasculitis Diseases 0.000 description 14
- 108091005462 Cation channels Proteins 0.000 description 14
- 108091006146 Channels Proteins 0.000 description 14
- 238000001228 spectrum Methods 0.000 description 14
- 230000009849 deactivation Effects 0.000 description 13
- 238000002347 injection Methods 0.000 description 13
- 239000007924 injection Substances 0.000 description 13
- 150000007523 nucleic acids Chemical class 0.000 description 13
- 238000002360 preparation method Methods 0.000 description 13
- 230000028161 membrane depolarization Effects 0.000 description 12
- 238000001720 action spectrum Methods 0.000 description 11
- 150000001875 compounds Chemical class 0.000 description 11
- 238000002474 experimental method Methods 0.000 description 11
- 239000013607 AAV vector Substances 0.000 description 10
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 10
- 108091006047 fluorescent proteins Proteins 0.000 description 10
- 102000034287 fluorescent proteins Human genes 0.000 description 10
- 210000004295 hippocampal neuron Anatomy 0.000 description 10
- 230000003834 intracellular effect Effects 0.000 description 10
- 102000039446 nucleic acids Human genes 0.000 description 10
- 108020004707 nucleic acids Proteins 0.000 description 10
- 102000034573 Channels Human genes 0.000 description 9
- 108010076504 Protein Sorting Signals Proteins 0.000 description 9
- 238000012421 spiking Methods 0.000 description 9
- 230000002123 temporal effect Effects 0.000 description 9
- 241000195585 Chlamydomonas Species 0.000 description 8
- 241000124008 Mammalia Species 0.000 description 8
- 241000195614 Volvox carteri Species 0.000 description 8
- 230000036982 action potential Effects 0.000 description 8
- 230000001154 acute effect Effects 0.000 description 8
- 230000000763 evoking effect Effects 0.000 description 8
- 230000036749 excitatory postsynaptic potential Effects 0.000 description 8
- 230000004048 modification Effects 0.000 description 8
- 238000012986 modification Methods 0.000 description 8
- 108091005957 yellow fluorescent proteins Proteins 0.000 description 8
- 101000944277 Homo sapiens Inward rectifier potassium channel 2 Proteins 0.000 description 7
- 210000003050 axon Anatomy 0.000 description 7
- 230000001413 cellular effect Effects 0.000 description 7
- 201000010099 disease Diseases 0.000 description 7
- 238000010304 firing Methods 0.000 description 7
- 230000006870 function Effects 0.000 description 7
- 230000002779 inactivation Effects 0.000 description 7
- 230000003287 optical effect Effects 0.000 description 7
- 210000002763 pyramidal cell Anatomy 0.000 description 7
- 239000000243 solution Substances 0.000 description 7
- 230000000946 synaptic effect Effects 0.000 description 7
- 238000012360 testing method Methods 0.000 description 7
- 210000001519 tissue Anatomy 0.000 description 7
- NCYCYZXNIZJOKI-UHFFFAOYSA-N vitamin A aldehyde Natural products O=CC=C(C)C=CC=C(C)C=CC1=C(C)CCCC1(C)C NCYCYZXNIZJOKI-UHFFFAOYSA-N 0.000 description 7
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 6
- 206010003805 Autism Diseases 0.000 description 6
- 208000020706 Autistic disease Diseases 0.000 description 6
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 6
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 6
- 239000004473 Threonine Substances 0.000 description 6
- 238000010521 absorption reaction Methods 0.000 description 6
- 230000008859 change Effects 0.000 description 6
- 108010082025 cyan fluorescent protein Proteins 0.000 description 6
- 238000000586 desensitisation Methods 0.000 description 6
- 230000005284 excitation Effects 0.000 description 6
- 239000000835 fiber Substances 0.000 description 6
- 239000005090 green fluorescent protein Substances 0.000 description 6
- 230000002102 hyperpolarization Effects 0.000 description 6
- 238000001727 in vivo Methods 0.000 description 6
- 230000010354 integration Effects 0.000 description 6
- 239000000463 material Substances 0.000 description 6
- 230000008172 membrane trafficking Effects 0.000 description 6
- 230000001242 postsynaptic effect Effects 0.000 description 6
- 108010054624 red fluorescent protein Proteins 0.000 description 6
- 230000002829 reductive effect Effects 0.000 description 6
- 235000020945 retinal Nutrition 0.000 description 6
- 239000011604 retinal Substances 0.000 description 6
- 230000035945 sensitivity Effects 0.000 description 6
- 238000000926 separation method Methods 0.000 description 6
- 230000008685 targeting Effects 0.000 description 6
- 230000000542 thalamic effect Effects 0.000 description 6
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 5
- 239000007995 HEPES buffer Substances 0.000 description 5
- 208000012902 Nervous system disease Diseases 0.000 description 5
- 230000002068 genetic effect Effects 0.000 description 5
- 230000010355 oscillation Effects 0.000 description 5
- 230000010287 polarization Effects 0.000 description 5
- 230000002207 retinal effect Effects 0.000 description 5
- 230000003595 spectral effect Effects 0.000 description 5
- 241001634120 Adeno-associated virus - 5 Species 0.000 description 4
- 102100033093 Calcium/calmodulin-dependent protein kinase type II subunit alpha Human genes 0.000 description 4
- 101000944249 Homo sapiens Calcium/calmodulin-dependent protein kinase type II subunit alpha Proteins 0.000 description 4
- 229930006000 Sucrose Natural products 0.000 description 4
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 4
- 241000195615 Volvox Species 0.000 description 4
- 230000001976 improved effect Effects 0.000 description 4
- 230000006872 improvement Effects 0.000 description 4
- 238000000338 in vitro Methods 0.000 description 4
- 238000011835 investigation Methods 0.000 description 4
- 239000002245 particle Substances 0.000 description 4
- 230000037361 pathway Effects 0.000 description 4
- 239000013612 plasmid Substances 0.000 description 4
- 230000002360 prefrontal effect Effects 0.000 description 4
- 201000000980 schizophrenia Diseases 0.000 description 4
- 238000010561 standard procedure Methods 0.000 description 4
- 239000005720 sucrose Substances 0.000 description 4
- 230000003461 thalamocortical effect Effects 0.000 description 4
- 210000001103 thalamus Anatomy 0.000 description 4
- NCYCYZXNIZJOKI-IOUUIBBYSA-N 11-cis-retinal Chemical group O=C/C=C(\C)/C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C NCYCYZXNIZJOKI-IOUUIBBYSA-N 0.000 description 3
- 241000972680 Adeno-associated virus - 6 Species 0.000 description 3
- 241000195597 Chlamydomonas reinhardtii Species 0.000 description 3
- 102000004310 Ion Channels Human genes 0.000 description 3
- 108090000862 Ion Channels Proteins 0.000 description 3
- 241000699666 Mus <mouse, genus> Species 0.000 description 3
- 108091028043 Nucleic acid sequence Proteins 0.000 description 3
- 102000002508 Peptide Elongation Factors Human genes 0.000 description 3
- 108010068204 Peptide Elongation Factors Proteins 0.000 description 3
- 241000125945 Protoparvovirus Species 0.000 description 3
- 102000004330 Rhodopsin Human genes 0.000 description 3
- 108090000820 Rhodopsin Proteins 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- 230000003376 axonal effect Effects 0.000 description 3
- 210000005056 cell body Anatomy 0.000 description 3
- 210000000349 chromosome Anatomy 0.000 description 3
- 230000007278 cognition impairment Effects 0.000 description 3
- 210000004748 cultured cell Anatomy 0.000 description 3
- 230000001934 delay Effects 0.000 description 3
- 238000010586 diagram Methods 0.000 description 3
- 208000035475 disorder Diseases 0.000 description 3
- DEFVIWRASFVYLL-UHFFFAOYSA-N ethylene glycol bis(2-aminoethyl)tetraacetic acid Chemical compound OC(=O)CN(CC(O)=O)CCOCCOCCN(CC(O)=O)CC(O)=O DEFVIWRASFVYLL-UHFFFAOYSA-N 0.000 description 3
- 230000004907 flux Effects 0.000 description 3
- 238000001476 gene delivery Methods 0.000 description 3
- 125000000291 glutamic acid group Chemical group N[C@@H](CCC(O)=O)C(=O)* 0.000 description 3
- 238000005286 illumination Methods 0.000 description 3
- 230000000813 microbial effect Effects 0.000 description 3
- 238000012544 monitoring process Methods 0.000 description 3
- 210000003061 neural cell Anatomy 0.000 description 3
- 230000003389 potentiating effect Effects 0.000 description 3
- 230000002441 reversible effect Effects 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- 208000024891 symptom Diseases 0.000 description 3
- 238000011282 treatment Methods 0.000 description 3
- 230000001960 triggered effect Effects 0.000 description 3
- 238000009827 uniform distribution Methods 0.000 description 3
- 239000013603 viral vector Substances 0.000 description 3
- 241001655883 Adeno-associated virus - 1 Species 0.000 description 2
- 241000702423 Adeno-associated virus - 2 Species 0.000 description 2
- 241000202702 Adeno-associated virus - 3 Species 0.000 description 2
- 241000580270 Adeno-associated virus - 4 Species 0.000 description 2
- 241001164823 Adeno-associated virus - 7 Species 0.000 description 2
- 241001164825 Adeno-associated virus - 8 Species 0.000 description 2
- 241000649045 Adeno-associated virus 10 Species 0.000 description 2
- 241000649046 Adeno-associated virus 11 Species 0.000 description 2
- 241000649047 Adeno-associated virus 12 Species 0.000 description 2
- 241000300529 Adeno-associated virus 13 Species 0.000 description 2
- PLXMOAALOJOTIY-FPTXNFDTSA-N Aesculin Natural products OC[C@@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@H](O)[C@H]1Oc2cc3C=CC(=O)Oc3cc2O PLXMOAALOJOTIY-FPTXNFDTSA-N 0.000 description 2
- 101000768857 Arabidopsis thaliana 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic Proteins 0.000 description 2
- 108010003721 Calcium-Calmodulin-Dependent Protein Kinase Type 2 Proteins 0.000 description 2
- 102000004657 Calcium-Calmodulin-Dependent Protein Kinase Type 2 Human genes 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- 108020004414 DNA Proteins 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 108010051001 Kir2.1 channel Proteins 0.000 description 2
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 2
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- 241000713666 Lentivirus Species 0.000 description 2
- 241000699660 Mus musculus Species 0.000 description 2
- NCYCYZXNIZJOKI-OVSJKPMPSA-N Retinaldehyde Chemical compound O=C\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C NCYCYZXNIZJOKI-OVSJKPMPSA-N 0.000 description 2
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 108700005077 Viral Genes Proteins 0.000 description 2
- 239000000853 adhesive Substances 0.000 description 2
- 230000001070 adhesive effect Effects 0.000 description 2
- 125000003118 aryl group Chemical group 0.000 description 2
- 230000003542 behavioural effect Effects 0.000 description 2
- HUCVOHYBFXVBRW-UHFFFAOYSA-M caesium hydroxide Chemical compound [OH-].[Cs+] HUCVOHYBFXVBRW-UHFFFAOYSA-M 0.000 description 2
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 2
- 230000001684 chronic effect Effects 0.000 description 2
- 238000012937 correction Methods 0.000 description 2
- 238000005520 cutting process Methods 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 210000002472 endoplasmic reticulum Anatomy 0.000 description 2
- 230000001747 exhibiting effect Effects 0.000 description 2
- 239000013604 expression vector Substances 0.000 description 2
- 239000011521 glass Substances 0.000 description 2
- 230000000848 glutamatergic effect Effects 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- 230000000971 hippocampal effect Effects 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 210000001153 interneuron Anatomy 0.000 description 2
- 150000002500 ions Chemical class 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- 230000031700 light absorption Effects 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 230000007935 neutral effect Effects 0.000 description 2
- 210000004940 nucleus Anatomy 0.000 description 2
- 238000007427 paired t-test Methods 0.000 description 2
- 230000001991 pathophysiological effect Effects 0.000 description 2
- 230000000149 penetrating effect Effects 0.000 description 2
- WEXRUCMBJFQVBZ-UHFFFAOYSA-N pentobarbital Chemical compound CCCC(C)C1(CC)C(=O)NC(=O)NC1=O WEXRUCMBJFQVBZ-UHFFFAOYSA-N 0.000 description 2
- 230000010412 perfusion Effects 0.000 description 2
- 230000000144 pharmacologic effect Effects 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- 230000035479 physiological effects, processes and functions Effects 0.000 description 2
- 230000002035 prolonged effect Effects 0.000 description 2
- 208000020016 psychiatric disease Diseases 0.000 description 2
- 238000011002 quantification Methods 0.000 description 2
- 230000010076 replication Effects 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- 238000002741 site-directed mutagenesis Methods 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 230000002459 sustained effect Effects 0.000 description 2
- 238000011830 transgenic mouse model Methods 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 241000701161 unidentified adenovirus Species 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 230000003612 virological effect Effects 0.000 description 2
- 238000001429 visible spectrum Methods 0.000 description 2
- 229910052724 xenon Inorganic materials 0.000 description 2
- FHNFHKCVQCLJFQ-UHFFFAOYSA-N xenon atom Chemical compound [Xe] FHNFHKCVQCLJFQ-UHFFFAOYSA-N 0.000 description 2
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- 206010002091 Anaesthesia Diseases 0.000 description 1
- 108010079442 Anion Transport Proteins Proteins 0.000 description 1
- 102000012739 Anion Transport Proteins Human genes 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 101150044789 Cap gene Proteins 0.000 description 1
- 108090000565 Capsid Proteins Proteins 0.000 description 1
- 101710132601 Capsid protein Proteins 0.000 description 1
- 102000053642 Catalytic RNA Human genes 0.000 description 1
- 108090000994 Catalytic RNA Proteins 0.000 description 1
- 102100023321 Ceruloplasmin Human genes 0.000 description 1
- 101710094648 Coat protein Proteins 0.000 description 1
- 206010010904 Convulsion Diseases 0.000 description 1
- 229920001651 Cyanoacrylate Polymers 0.000 description 1
- 241000450599 DNA viruses Species 0.000 description 1
- 239000012983 Dulbecco’s minimal essential medium Substances 0.000 description 1
- 201000011001 Ebola Hemorrhagic Fever Diseases 0.000 description 1
- 101710091045 Envelope protein Proteins 0.000 description 1
- 241000713730 Equine infectious anemia virus Species 0.000 description 1
- 102000027484 GABAA receptors Human genes 0.000 description 1
- 108091008681 GABAA receptors Proteins 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 102100021181 Golgi phosphoprotein 3 Human genes 0.000 description 1
- 208000031886 HIV Infections Diseases 0.000 description 1
- 108010050754 Halorhodopsins Proteins 0.000 description 1
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 1
- 241000713340 Human immunodeficiency virus 2 Species 0.000 description 1
- 206010021033 Hypomenorrhoea Diseases 0.000 description 1
- 102100033114 Inward rectifier potassium channel 2 Human genes 0.000 description 1
- 108010083687 Ion Pumps Proteins 0.000 description 1
- 102000006391 Ion Pumps Human genes 0.000 description 1
- PIWKPBJCKXDKJR-UHFFFAOYSA-N Isoflurane Chemical compound FC(F)OC(Cl)C(F)(F)F PIWKPBJCKXDKJR-UHFFFAOYSA-N 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 101710125418 Major capsid protein Proteins 0.000 description 1
- 101000903581 Natronomonas pharaonis Halorhodopsin Proteins 0.000 description 1
- 206010029240 Neuritis Diseases 0.000 description 1
- 208000025966 Neurological disease Diseases 0.000 description 1
- 101710141454 Nucleoprotein Proteins 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 208000012868 Overgrowth Diseases 0.000 description 1
- 208000018737 Parkinson disease Diseases 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- 102000010292 Peptide Elongation Factor 1 Human genes 0.000 description 1
- 108010077524 Peptide Elongation Factor 1 Proteins 0.000 description 1
- 206010034960 Photophobia Diseases 0.000 description 1
- LHNKBXRFNPMIBR-UHFFFAOYSA-N Picrotoxin Natural products CC(C)(O)C1(O)C2OC(=O)C1C3(O)C4OC4C5C(=O)OC2C35C LHNKBXRFNPMIBR-UHFFFAOYSA-N 0.000 description 1
- 241000083879 Polyommatus icarus Species 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 101710083689 Probable capsid protein Proteins 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 101710188315 Protein X Proteins 0.000 description 1
- 108010083204 Proton Pumps Proteins 0.000 description 1
- 102000006270 Proton Pumps Human genes 0.000 description 1
- 108091030071 RNAI Proteins 0.000 description 1
- 206010037742 Rabies Diseases 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 241000220317 Rosa Species 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 108020004459 Small interfering RNA Proteins 0.000 description 1
- 238000000692 Student's t-test Methods 0.000 description 1
- 102100021696 Syncytin-1 Human genes 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 241001492404 Woodchuck hepatitis virus Species 0.000 description 1
- 230000005856 abnormality Effects 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 210000003626 afferent pathway Anatomy 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 230000037005 anaesthesia Effects 0.000 description 1
- 230000000202 analgesic effect Effects 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 230000006399 behavior Effects 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 230000005540 biological transmission Effects 0.000 description 1
- 210000005013 brain tissue Anatomy 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 230000000747 cardiac effect Effects 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 239000004568 cement Substances 0.000 description 1
- 210000003710 cerebral cortex Anatomy 0.000 description 1
- 230000002490 cerebral effect Effects 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 230000006690 co-activation Effects 0.000 description 1
- 230000036992 cognitive tasks Effects 0.000 description 1
- 230000007748 combinatorial effect Effects 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 210000003618 cortical neuron Anatomy 0.000 description 1
- 210000005257 cortical tissue Anatomy 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 238000007428 craniotomy Methods 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 230000004064 dysfunction Effects 0.000 description 1
- 230000007831 electrophysiology Effects 0.000 description 1
- 238000002001 electrophysiology Methods 0.000 description 1
- 230000003028 elevating effect Effects 0.000 description 1
- JJJFUHOGVZWXNQ-UHFFFAOYSA-N enbucrilate Chemical compound CCCCOC(=O)C(=C)C#N JJJFUHOGVZWXNQ-UHFFFAOYSA-N 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 239000012091 fetal bovine serum Substances 0.000 description 1
- ODKNJVUHOIMIIZ-RRKCRQDMSA-N floxuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ODKNJVUHOIMIIZ-RRKCRQDMSA-N 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 230000009368 gene silencing by RNA Effects 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 229940050410 gluconate Drugs 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 210000002064 heart cell Anatomy 0.000 description 1
- 210000005003 heart tissue Anatomy 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000010365 information processing Effects 0.000 description 1
- 210000001926 inhibitory interneuron Anatomy 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 230000010189 intracellular transport Effects 0.000 description 1
- 229960002725 isoflurane Drugs 0.000 description 1
- 230000000366 juvenile effect Effects 0.000 description 1
- 230000004298 light response Effects 0.000 description 1
- 208000013469 light sensitivity Diseases 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 210000005171 mammalian brain Anatomy 0.000 description 1
- 108010082117 matrigel Proteins 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- CVRPVRHBAOPDIG-UHFFFAOYSA-N methyl 2-methylprop-2-enoate;2-(2-methylprop-2-enoyloxy)ethyl 1,3-dioxo-2-benzofuran-5-carboxylate Chemical compound COC(=O)C(C)=C.CC(=C)C(=O)OCCOC(=O)C1=CC=C2C(=O)OC(=O)C2=C1 CVRPVRHBAOPDIG-UHFFFAOYSA-N 0.000 description 1
- 108091070501 miRNA Proteins 0.000 description 1
- 239000002679 microRNA Substances 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 230000001423 neocortical effect Effects 0.000 description 1
- 238000007857 nested PCR Methods 0.000 description 1
- 230000003767 neural control Effects 0.000 description 1
- 210000000118 neural pathway Anatomy 0.000 description 1
- 230000010004 neural pathway Effects 0.000 description 1
- 230000008904 neural response Effects 0.000 description 1
- 210000002241 neurite Anatomy 0.000 description 1
- 210000004498 neuroglial cell Anatomy 0.000 description 1
- 230000000926 neurological effect Effects 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 229960001412 pentobarbital Drugs 0.000 description 1
- 230000002085 persistent effect Effects 0.000 description 1
- VJKUPQSHOVKBCO-AHMKVGDJSA-N picrotoxin Chemical compound O=C([C@@]12O[C@@H]1C[C@]1(O)[C@@]32C)O[C@@H]3[C@H]2[C@@H](C(=C)C)[C@@H]1C(=O)O2.O=C([C@@]12O[C@@H]1C[C@]1(O)[C@@]32C)O[C@@H]3[C@H]2[C@@H](C(C)(O)C)[C@@H]1C(=O)O2 VJKUPQSHOVKBCO-AHMKVGDJSA-N 0.000 description 1
- 238000003752 polymerase chain reaction Methods 0.000 description 1
- 230000001124 posttranscriptional effect Effects 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 230000003518 presynaptic effect Effects 0.000 description 1
- 239000002464 receptor antagonist Substances 0.000 description 1
- 229940044551 receptor antagonist Drugs 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 101150066583 rep gene Proteins 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000004043 responsiveness Effects 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 230000001020 rhythmical effect Effects 0.000 description 1
- 108091092562 ribozyme Proteins 0.000 description 1
- 210000004761 scalp Anatomy 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 210000003625 skull Anatomy 0.000 description 1
- 230000011273 social behavior Effects 0.000 description 1
- 230000000392 somatic effect Effects 0.000 description 1
- 238000012453 sprague-dawley rat model Methods 0.000 description 1
- 230000010473 stable expression Effects 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 230000004960 subcellular localization Effects 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000008093 supporting effect Effects 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 230000009782 synaptic response Effects 0.000 description 1
- 230000001360 synchronised effect Effects 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 238000012353 t test Methods 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 238000003146 transient transfection Methods 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 238000011870 unpaired t-test Methods 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- 230000029812 viral genome replication Effects 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/405—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from algae
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K67/00—Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
- A01K67/027—New or modified breeds of vertebrates
- A01K67/0275—Genetically modified vertebrates, e.g. transgenic
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61N—ELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
- A61N5/00—Radiation therapy
- A61N5/06—Radiation therapy using light
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/18—Antipsychotics, i.e. neuroleptics; Drugs for mania or schizophrenia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N13/00—Treatment of microorganisms or enzymes with electrical or wave energy, e.g. magnetism, sonic waves
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
- G01N33/5044—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics involving specific cell types
- G01N33/5058—Neurological cells
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2217/00—Genetically modified animals
- A01K2217/05—Animals comprising random inserted nucleic acids (transgenic)
- A01K2217/052—Animals comprising random inserted nucleic acids (transgenic) inducing gain of function
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2227/00—Animals characterised by species
- A01K2227/10—Mammal
- A01K2227/105—Murine
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2267/00—Animals characterised by purpose
- A01K2267/03—Animal model, e.g. for test or diseases
- A01K2267/0393—Animal model comprising a reporter system for screening tests
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61N—ELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
- A61N5/00—Radiation therapy
- A61N5/06—Radiation therapy using light
- A61N2005/0658—Radiation therapy using light characterised by the wavelength of light used
- A61N2005/0662—Visible light
- A61N2005/0663—Coloured light
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/60—Fusion polypeptide containing spectroscopic/fluorescent detection, e.g. green fluorescent protein [GFP]
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2500/00—Screening for compounds of potential therapeutic value
- G01N2500/10—Screening for compounds of potential therapeutic value involving cells
Definitions
- compositions comprising animal cells expressing light-activated chimeric proteins on their plasma membranes and methods of using the same to selectively depolarize excitatory or inhibitory neurons residing in the same microcircuit in the pre-frontal cortex.
- Optogenetics is the combination of genetic and optical methods used to control specific events in targeted cells of living tissue, even within freely moving mammals and other animals, with the temporal precision (millisecond-timescale) needed to keep pace with functioning intact biological systems.
- the hallmark of optogenetics is the introduction of fast light-activated channel proteins to the plasma membranes of target neuronal cells that allow temporally precise manipulation of neuronal membrane potential while maintaining cell-type resolution through the use of specific targeting mechanisms.
- microbial opsins which can be used to investigate the function of neural systems are the channelrhodopsins (ChR2, ChR1, VChR1, and SFOs) used to promote depolarization in response to light.
- compositions comprising chimeric light-activated protein cation channels which are capable of mediating a depolarizing current in the cell when the cell is illuminated with light.
- animal cells comprising a light-activated protein expressed on the cell membrane, wherein the protein is (a) a chimeric protein derived from VChR1 from Volvox carteri and ChR1 from Chlamydomonas reinhardti, wherein the protein comprises the amino acid sequence of VChR1 having at least the first and second transmembrane helices replaced by the first and second transmembrane helices of ChR1; (b) is responsive to light; and (c) is capable of mediating a depolarizing current in the cell when the cell is illuminated with light.
- the cells are isolated or in a cell culture medium.
- polynucleotide comprising a nucleotide sequence encoding a light activated protein expressed on the cell membrane
- the protein is a chimeric protein derived from VChR1 from Volvox carteri and ChR1 from Chlamydomonas reinhardti, wherein the protein comprises the amino acid sequence of VChR1 having at least the first and second transmembrane helices replaced by the first and second transmembrane helices of ChR1; is responsive to light; and is capable of mediating a depolarizing current in the cell when the cell is illuminated with light.
- Vectors (such as expressing vectors) comprising the polynucleotides are also provided.
- the expression vector is a viral vector (e.g., an AAV vector, a retroviral vector, an adenoviral vector, a HSV vector, or a lentiviral vector).
- the first or the second light activated protein is a chimeric protein derived from VChR1 from Volvox carteri and ChR1 from Chlamydomonas reinhardti, wherein the protein comprises the amino acid sequence of VChR1 having at least the first and second transmembrane helices replaced by the first and second transmembrane helices of ChR1.
- the first light-activated protein comprises an amino acid sequence at least 95% identical to the sequence shown in SEQ ID NO: 1, 3, 5, or 7
- the second light-activated protein comprises an amino acid sequence at least 95% identical to the sequence shown in SEQ ID NO:11, 12, 13, or 14.
- a method of selectively depolarizing excitatory or inhibitory neurons residing in the same microcircuit comprising: expressing a first light-activated protein in an excitatory neuron; and expressing a second light activated protein in an inhibitory neuron, wherein the first light activated protein is independently depolarized when exposed to light having a first wavelength and wherein the second light activated protein is independently depolarized when exposed to light having a second wavelength.
- the first or the second light activated protein is a chimeric protein derived from VChR1 from Volvox carteri and ChR1 from Chlamydomonas reinhardti, wherein the protein comprises the amino acid sequence of VChR1 having at least the first and second transmembrane helices replaced by the first and second transmembrane helices of ChR1.
- the first light-activated protein comprises an amino acid sequence at least 95% identical to the sequence shown in SEQ ID NO: 1, 3, 5, or 7, and wherein the second light-activated protein comprises an amino acid sequence at least 95% identical to the sequence shown in SEQ ID NO:11, 12, 13, or 14.
- the first or the second light activated protein is a chimeric protein derived from VChR1 from Volvox carteri and ChR1 from Chlamydomonas reinhardti, wherein the protein comprises the amino acid sequence of VChR1 having at least the first and second transmembrane helices replaced by the first and second transmembrane helices of ChR1.
- the first light-activated protein comprises an amino acid sequence at least 95% identical to the sequence shown in SEQ ID NO: 1, 3, 5, or 7, and wherein the second light-activated protein comprises an amino acid sequence at least 95% identical to the sequence shown in SEQ ID NO:11, 12, 13, or 14.
- FIG. 1 depicts engineering of an improved red-shifted channelrhodopsin for combinatorial optogenetics.
- Putative transmembrane helices 1-7 are indicated with bars (TM1-7); mutated amino acids indicated in grey.
- FIG. 2 depicts testing an improved red-shifted channelrhodopsin for combinatorial optogenetics.
- FIG. 3 depicts photocurrents from acute slice recordings in prefrontal pyramidal neurons.
- Peak photocurrents show consistent correlation with integrated fluorescence intensity.
- Voltage clamp traces show responses in a neuron expressing C1V1(E122T) to 630 nm light pulses. Pulse lengths are indicated above traces. ⁇ on . calculated from the 150 ms trace is 67 ms.
- FIG. 4 depicts independent activation of excitatory pyramidal neurons and inhibitory parvalbumin-expressing cells.
- (a) Current clamp recordings from cultured hippocampal neurons expressing C1V1(E1 22T/E162T) or ChR2(H134R) in response to 2 ms light pulses at 560 nm or 405 nm (5 Hz; 7.6 mW/mm 2 at both wavelengths).
- (b) Recording configuration in double-injected animals expressing C1V1 in cortical pyramidal neurons and ChR2 (H134R) in inhibitory parvalbumin-positive interneurons.
- PV::Cre mice were injected with a two-virus mix containing Lenti-Ca.MKII ⁇ -C1V1(E122T/E162T) and AAV5-EF la-DIO-Ch R2 (H 134R).
- FIG. 5 depicts combinatorial optogenetic excitation in distinct intact-system preparations.
- (a) Combinatorial projection control with C1V1-E122T/E 162T and ChR2-H134R in vitro. Experimental paradigm showing expression of C1V1 and ChR2 in cortico-thalamic (CT) and ventrobasal (VB) thalamo-cortical cells (TC), respectively.
- CT cortico-thalamic
- VB ventrobasal thalamo-cortical cells
- TC thalamo-cortical cells
- FIG. 6 depicts spectrotemporal separation and combinatorial control: circuit modulation and emergent patterns in altered E/I states under ongoing synaptic activity.
- SSFO and C1V1 are activated by a blue light pulse (2) and IPSC frequency is increased by sustained SSFO activity (3; compare upper and lower traces in inset for pre- and post-activation IPSC activity).
- a sustained yellow light pulse deactivates SSFO and activates C1V1 and transiently increases IPSC frequency (4).
- Population power spectra. (right) show gamma frequency activity during optical excitatory neuron activation (590 am pulse) that is increased during coactivation of excitatory and PV neurons (470 nm pulse). Diagrams below traces show predicted activity of C1V1 and SSFO during the experiment. (c) The observed gamma frequency peak was not dependent on prior 1W neuron stimulation via SSFO.
- compositions comprising animal cells expressing light-activated chimeric proteins on their plasma membranes and methods of using the same to selectively depolarize excitatory or inhibitory neurons residing in the same microcircuit in the pre-frontal cortex.
- the inventors have developed chimeric proteins possessing unique physiochemical properties which for the first time permit experimental manipulation of cortical E/I elevations and the ability to monitor gamma oscillations in cortical slices.
- These unique light-sensitive chimeric proteins can be expressed in either excitatory or inhibitory neural circuits in the prefrontal cortex of nonhuman animals which can then be depolarized in response to light having particular wavelengths.
- brain slices from non-human animals containing cortical excitatory or inhibitory neurons expressing the chimeric light-sensitive proteins disclosed herein can be used to search for chemical compounds which can selectively inhibit the depolarization of either excitatory or inhibitory neurons residing within the same neural circuit.
- an “animal” can be a vertebrate, such as any common laboratory model organism, or a mammal. Mammals include, but are not limited to, humans, farm animals, sport animals, pets, primates, mice, rats, and other rodents.
- amino acid substitution or “mutation” as used herein means that at least one amino acid component of a defined amino acid sequence is altered or substituted with another amino acid leading to the protein encoded by that amino acid sequence having altered activity or expression levels within a cell.
- a “chimeric protein” is a protein comprising one or more portions derived from one or more different proteins. Chimeric proteins may be produced by culturing a recombinant cell transfected with a nucleic acid that encodes the chimeric protein.
- the animal cells disclosed herein comprise a chimeric light-sensitive protein, known as “C1V1,” which is derived from the VChR1 cation channel from Volvox carteri and the ChR1 cation channel from Chlamydomonas Reinhardti.
- the protein may be comprised of the amino acid sequence of VChR1, but additionally can have at least the first and second transmembrane helices of the VChR1 polypeptide replaced by the corresponding first and second transmembrane helices of ChR1.
- C1V1 chimeric opsin proteins are assembled from pieces of other opsin proteins that do not express well alone in neurons and which are potent, redshifted, and stable channelrhodopsins.
- the animal cell may express a second light-activated protein on the plasma membrane of the cell.
- the second light-activated protein can be capable of mediating a hyperpolarization of the cell plasma membrane in response to activation by light. Examples of light-activated proteins capable of mediating a hyperpolarization of the cell plasma membrane can be found, for example, in International Patent Application No: PCT/US2011/028893, the disclosure of which is incorporated by reference herein in its entirety.
- Embodiments of the present disclosure may also be directed toward modified or mutated versions of C1V1. These proteins can be used alone or in combination with a variety of other opsins to assert optical control over neurons. In particular, the use of modified C1V1, in connection with other opsins, is believed to be useful for optical control over nervous system disorders. Specific uses of C1V1 relate to optogenetic systems or methods that correlate temporal, spatial and/or cell type-specific control over a neural circuit with measurable metrics.
- the light-activated protein is a chimeric protein derived from VChR1 from Volvox carteri and ChR1 from Chlamydomonas reinhardti.
- the chimeric protein comprises the amino acid sequence of VChR1 having at least the first and second transmembrane helices replaced by the corresponding first and second transmembrane helices of ChR1.
- the chimeric protein comprises the amino acid sequence of VChR1 having the first and second transmembrane helices replaced by the corresponding first and second transmembrane helices of ChR1 and further comprises at least a portion of the intracellular loop domain located between the second and third transmembrane helices replaced by the corresponding portion from ChR1.
- the entire intracellular loop domain between the second and third transmembrane helices of the chimeric light-activated protein can be replaced with the corresponding intracellular loop domain from ChR1.
- the portion of the intercellular loop domain located between the second and third transmembrane helices that is replaced with the corresponding portion of ChR1 can extend to A145 of SEQ ID NO:1.
- the chimeric protein comprises the amino acid sequence of VChR1 having the first and second transmembrane helices and the intracellular loop domain replaced by the corresponding first and second transmembrane helices and intracellular loop domain of ChR1 and further comprises at least a portion of the third transmembrane helix replaced by the corresponding portion of ChR1.
- the portion of the third transmembrane helix replaced by the corresponding portion from ChR1 can extend to W163 of SEQ ID NO:1.
- the light-activated chimeric protein comprises the amino acids 1-145 of ChR1 and amino acids 102-316 of VChR1.
- the light-activated chimeric protein comprises the amino acids 1-162 of ChR1 and amino acids 119-316 of VChR1.
- the light-activated chimeric protein can comprise an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 1 without the signal peptide sequence.
- the light-activated chimeric protein can comprise an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 1
- the light activated chimeric protein is capable of mediating a depolarizing current in the cell when the cell is illuminated with light.
- the light can be green light.
- the light can have a wavelength of between about 540 nm to about 560 nm.
- the light can have a wavelength of about 542 nm.
- the chimeric protein may not be capable of mediating a depolarizing current in the cell when the cell is illuminated with violet light.
- the chimeric protein may not be capable of mediating a depolarizing current in the cell when the cell is illuminated with light having a wavelength of 405 nm.
- the protein can further comprise a C-terminal fluorescent protein.
- the C-terminal fluorescent protein can be enhanced yellow fluorescent protein (EYFP), green fluorescent protein (GFP), cyan fluorescent protein (CFP), or red fluorescent protein (RFP).
- EYFP enhanced yellow fluorescent protein
- GFP green fluorescent protein
- CFP cyan fluorescent protein
- RFP red fluorescent protein
- the light-activated chimeric protein is modified by the addition of a trafficking signal (ts) which enhances transport of the protein to the cell plasma membrane.
- the trafficking signal is derived from the amino acid sequence of the human inward rectifier potassium channel Kir2.1.
- the trafficking signal comprises the amino acid sequence KSRITSEGEYIPLDQIDINV.
- the signal peptide sequence in the protein may be replaced with a different signal peptide sequence.
- the animal cell can be a neuronal cell, a muscle cell, or a stem cell. In one embodiment, the animal cell is a neuronal cell. In some embodiments the neuronal cell can be an excitatory neuron located in the pre-frontal cortex of a non-human animal. In other embodiments, the excitatory neuron can be a pyramidal neuron. In still other embodiments, the inhibitory neuron can be a parvalbumin neuron. In some embodiments the neuronal cell can be an inhibitory neuron located in the pre-frontal cortex of a non-human animal. In some embodiments the neuronal cell can be an inhibitory neuron located in the pre-frontal cortex of a non-human animal.
- the animal cells can further comprise a second light-activated protein expressed on the cells' plasma membrane.
- the second light-activated protein can be capable of mediating a hyperpolarizing current in the cell when the cell is illuminated with light.
- the second light-activated protein can be NpHr, eNpHr2.0, eNpHr3.0, eNpHr3.1 or GtR3. Additional information regarding other light-activated cation channels, anion pumps, and proton pumps can be found in U.S. Patent Application Publication Nos: 2009/0093403; and International Patent Application No: PCT/US2011/028893, the disclosures of which are hereby incorporated by reference herein in their entirety.
- the light-activated chimeric protein can have enhanced photocurrents in neural cells exposed to light relative to cells expressing other light-activated cation channel proteins.
- the enhancement in photocurrent provided by the light-activated chimeric protein can be any of 1 fold, 2 fold, 3 fold, 4 fold, 5 fold, 6 fold, 7 fold, 8 fold, 9 fold, 10 fold, 11 fold, 12 fold, 13 fold, 14 fold, or 15 fold, greater than cells expressing other light-activated cation channel proteins, inclusive.
- the trafficking signal may be fused to the C-terminus of the core amino acid sequence or may be fused to the N-terminus of the core amino acid sequence.
- the trafficking signal can be linked to the core amino acid sequence by a linker.
- the linker can comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length.
- the linker may further comprise a fluorescent protein, for example, but not limited to, an enhanced yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein.
- the trafficking signal can be derived from the amino acid sequence of the human inward rectifier potassium channel Kir2.1.
- the trafficking signal can comprise the amino acid sequence KSRITSEGEYIPIDQIDINV.
- the invention includes polypeptides comprising substituted or mutated amino acid sequences, wherein the mutant polypeptide retains the characteristic light-activatable nature of the precursor C1V1 chimeric polypeptide but may also possess altered properties in some specific aspects.
- the mutant light-activated chimeric proteins described herein may exhibit an increased level of expression both within an animal cell or on the animal cell plasma membrane; an altered responsiveness when exposed to different wavelengths of light, particularly red light; and/or a combination of traits whereby the chimeric C1V1 polypeptide possess the properties of low desensitization, fast deactivation, low violet-light activation for minimal cross-activation with other light-activated cation channels, and/or strong expression in animal cells.
- Light-activated chimeric proteins comprising amino acid substitutions or mutations include those in which one or more amino acid residues have undergone an amino acid substitution while retaining the ability to respond to light and the ability to control the polarization state of a plasma membrane.
- light-activated proteins comprising amino acid substitutions or mutations can be made by substituting one or more amino acids into the amino acid sequence corresponding to SEQ ID NO:1.
- the invention includes proteins comprising altered amino acid sequences in comparison with the amino acid sequence in SEQ ID NO:1, wherein the altered light-activated chimeric protein retains the characteristic light-activated nature and/or the ability to regulate ion flow across plasma membranes of the protein with the amino acid sequence represented in SEQ ID NO:1 but may have altered properties in some specific aspects.
- Amino acid substitutions in a native protein sequence may be conservative or non-conservative and such substituted amino acid residues may or may not be one encoded by the genetic code.
- the standard twenty amino acid “alphabet” is divided into chemical families based on chemical properties of their side chains These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and side chains having aromatic groups (e.g., tyros
- a “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a chemically similar side chain (i.e., replacing an amino acid possessing a basic side chain with another amino acid with a basic side chain).
- a “non-conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a chemically different side chain (i.e., replacing an amino acid having a basic side chain with an amino acid having an aromatic side chain).
- the amino acid substitutions may be conservative or non-conservative. Additionally, the amino acid substitutions may be located in the C1V1 retinal binding pocket, in one or more of the C1V1 intracellular loop domains, and/or in both the retinal binding pocket or the intracellular loop domains.
- C1V1 chimeric light-activated proteins that may have specific amino acid substitutions at key positions throughout the retinal binding pocket of the VChR1 portion of the chimeric polypeptide.
- the C1V1 protein can have a mutation at amino acid residue E122 of SEQ ID NO:1.
- the C1V1 protein can have a mutation at amino acid residue E162 of SEQ ID NO:1.
- the C1V1 protein can have a mutation at both amino acid residues E162 and E122 of SEQ ID NO:1.
- each of the disclosed mutant C1V1 chimeric proteins can have specific properties and characteristics for use in depolarizing the membrane of an animal cell in response to light.
- the light-activated C1V1 chimeric proteins disclosed herein expressed on an animal cell plasma membrane wherein one or more amino acid residues have undergone an amino acid substitution while retaining C1V1 activity (i.e., the ability to catalyze the depolarization of an animal cell in response to light activation), and Wherein the mutation can be at a glutamic acid residue corresponding to E122 of SEQ ID NO:1 (C1V1-E122).
- the C1V1-E122 mutant chimeric light-activated protein comprises substitutions introduced into the amino acid sequence shown in SEQ ID NO:1 at amino acid E122 that can result in the chimeric protein having increased sensitivity to light, increased sensitivity to particular wavelengths of light, and/or increased ability to regulate the polarization state of the plasma membrane of the cell relative to C 1V1 chimeric light-activated proteins that do not have a mutation at E122.
- the mutation can be a conservative amino acid substitution.
- the mutation can be a non-conservative amino acid substitution.
- the mutation at amino acid residue E122 can be to threonine (C1V1-E122T).
- the light-activated chimeric protein can comprise an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 3 without the signal peptide sequence.
- the light-activated chimeric protein can comprise an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 3.
- the C1V1-E122 mutant chimeric light-activated protein may be fused to a C-terminal trafficking signal.
- the trafficking signal can be linked S to the C1V1-E122 mutant chimeric light-activated protein by a linker.
- the linker can comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length.
- the linker may further comprise a fluorescent protein, for example, but not limited to, an enhanced yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein.
- the trafficking signal can be derived from the amino acid sequence of the human inward rectifier potassium channel Kir2.1.
- the trafficking signal can comprise the amino acid sequence KSRITSEGEYIPLDQIDINV.
- the C1V1-E122 chimeric protein is capable of mediating a depolarizing current in the cell when the cell is illuminated with light.
- the light can be green light.
- the light can have a wavelength of between about 540 nm to about 560 nm.
- the light can have a wavelength of about 546 nm.
- the C1V1-E122 chimeric protein can mediate a depolarizing current in the cell when the cell is illuminated with red light.
- the red light can have a wavelength of about 630 nm.
- the C1V1-E122 chimeric protein may not be capable of mediating a depolarizing current in the cell when the cell is illuminated with violet light. In some embodiments, the chimeric protein may not be capable of mediating a depolarizing current in the cell when the cell is illuminated with light having a wavelength of 405 nm.
- the animal cell can be a neuronal cell, a muscle cell, or a stern cell. In one embodiment, the animal cell can be a neuronal cell. In some embodiments the neuronal cell can be an excitatory neuron located in the pre-frontal cortex of a non-human animal. In other embodiments, the excitatory neuron can be a pyramidal neuron.
- the neuronal cell can be an inhibitory neuron located in the pre-frontal cortex of a non-human animal.
- the excitatory neuron can be a pyramidal neuron.
- the inhibitory neuron can be a parvalbumin neuron.
- the animal cells can farther comprise a second light-activated protein expressed on the cells' plasma membrane.
- the second light-activated protein can be capable of mediating a hyperpolarizing current in the cell when the cell is illuminated with light.
- the second light-activated protein can be NpHr, eNpHr2.0, eNpHr3.0, eNpHr3.1 or GtR3.
- the light-activated C1V1 chimeric proteins disclosed herein expressed on an animal cell plasma membrane wherein one or more amino acid residues have undergone an amino acid substitution while retaining C1V1 activity (i.e., the ability to catalyze the depolarization of an animal cell in response to light activation), wherein the mutation can be at a glutamic acid residue corresponding to E162 of SEQ ID NO:1 (C1V1-E162).
- the C1V1-E162 mutant chimeric light-activated protein comprises substitutions introduced into the amino acid sequence shown in SEQ ID NO:1 at amino acid E162 that can result in the chimeric protein having increased sensitivity to light, increased sensitivity to particular wavelengths of light, and/or increased ability to regulate the polarization state of the plasma membrane of the cell relative to C1V1 chimeric light-activated proteins that do not have a mutation at E162.
- the mutation can be a conservative amino acid substitution.
- the mutation can be a non-conservative amino acid substitution.
- the mutation at amino acid residue E162 can be to threonine (C1V1-E162T).
- the light-activated chimeric protein can comprise an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 5 without the signal peptide sequence.
- the light-activated chimeric protein can comprise an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 5.
- the C1V1-E162 mutant chimeric light-activated protein may be fused to a C-terminal trafficking signal.
- the trafficking signal can be linked to the C1V1-E162 mutant chimeric light-activated protein by a linker.
- the linker can comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length.
- the linker may further comprise a fluorescent protein, for example, but not limited to, an enhanced yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein.
- the trafficking signal can be derived from the amino acid sequence of the human inward rectifier potassium channel Kir2.1.
- the trafficking signal can comprise the amino acid sequence KSRITSEGEVIPLDQIDINV.
- the C1V1-E162 chimeric protein is capable of mediating a depolarizing current in the cell when the cell is illuminated with light.
- the light can be green light.
- the light can have a wavelength of between about 540 nm to about 535 nm.
- the light can have a wavelength of about 542 nm.
- the light can have a wavelength of about 530 nm.
- the C1V1-E162 chimeric protein may not be capable of mediating a depolarizing current in the cell when the cell is illuminated with violet light.
- the chimeric protein may not be capable of mediating a depolarizing current in the cell when the cell is illuminated with light having a wavelength of 405 nm.
- the C1V1-E162 chimeric protein can further comprise a C-terminal fluorescent protein.
- the animal cell can be a neuronal cell, a muscle cell, or a stem cell.
- the animal cell can be a neuronal cell.
- the neuronal cell can be an excitatory neuron located in the pre-frontal cortex of a non-human animal. In other embodiments, the excitatory neuron can be a pyramidal neuron.
- the neuronal cell can be an inhibitory neuron located in the pre-frontal cortex of a non-human animal.
- the excitatory neuron can be a pyramidal neuron.
- the inhibitory neuron can be a parvalbumin neuron.
- the animal cells can further comprise a second light-activated protein expressed on the cells' plasma membrane.
- the second light-activated protein can be capable of mediating a hyperpolarizing current in the cell when the cell is illuminated with light.
- the second light-activated protein can be NpHr, eNpHr2.0, eNpHr3.0, eNpHr3.1 or GtR3.
- the C1V1-E162 light-activated chimeric protein can have an accelerated photocycle relative C1V1 proteins lacking mutations at E162 or relative to other light-activated cation channel proteins. In some embodiments, the C1V1-E162 light-activated chimeric protein can have a photocycle more than 1 fold, 1.5 fold, 2 fold, 2.5 fold, 3 fold, 3.5 fold, 4 fold, 4.5 fold, or 5 fold faster than C1V1 proteins lacking mutations at E162 or relative to other light-activated cation channel proteins, inclusive.
- the light-activated C1V1 chimeric proteins disclosed herein expressed on an animal cell plasma membrane wherein one or more amino acid residues have undergone an amino acid substitution while retaining C1V1 activity (i.e., the ability to catalyze the depolarization of an animal cell in response to light activation), wherein the mutations can be at glutamic acid residues corresponding to E122 and E162 of SEQ ID NO:1 (C1V1-E122/E162).
- the C1V1-E122/E162 mutant chimeric light-activated protein can comprise substitutions introduced into the amino acid sequence shown in SEQ NO:1 at amino acid E122 and E162 that can result in the chimeric protein having increased sensitivity to light, increased sensitivity to particular wavelengths of light, and/or increased ability to regulate the polarization state of the plasma membrane of the cell relative to C1V1 chimeric light-activated proteins that do not have a mutation at E122 and E162.
- the mutations can be conservative amino acid substitutions.
- the mutations can be non-conservative amino acid substitutions.
- the mutations can be both conservative and non-conservative amino acid substitutions.
- the mutation at amino acid residue E122 and at E162 can both be to threonine (C1V1-E122T/E162T).
- the light-activated chimeric protein can comprise an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 7 without the signal peptide sequence.
- the light-activated chimeric protein can comprise an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 7.
- the C1V1-E122/E162 mutant chimeric light-activated protein may be fused to a C-terminal trafficking signal.
- the trafficking signal can be linked to the C1V1-E122/E162 mutant chimeric light-activated protein by a linker.
- the linker can comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length.
- the linker may further comprise a fluorescent protein, for example, but not limited to, an enhanced yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein.
- the trafficking signal can be derived from the amino acid sequence of the human inward rectifier potassium channel Kir2.1.
- the trafficking signal can comprise the amino acid sequence KSRITSEGEYIPLDQIDINV.
- the C1V1-E122/E162 chimeric protein is capable of mediating a depolarizing current in the cell when the cell is illuminated with light.
- the light can be green light.
- the light can have a wavelength of between about 540 nm to about 560 nm.
- the light can have a wavelength of about 546 nm.
- the C1V1-E122/E162 chimeric protein may not be capable of mediating a depolarizing current in the cell when the cell is illuminated with violet light.
- the chimeric protein may not be capable of mediating a depolarizing current in the cell when the cell is illuminated with light having a wavelength of 405 nm.
- the C1V1-E122/E162 chimeric protein can exhibit less activation when exposed to violet light relative to C1V1 proteins lacking mutations at E122/E162 or relative to other light-activated cation channel proteins.
- the animal cell can be a neuronal cell, a muscle cell, or a stem cell. In one embodiment, the animal cell can be a neuronal cell. In some embodiments the neuronal cell can be an excitatory neuron located in the pre-frontal cortex of a non-human animal.
- the excitatory neuron can be a pyramidal neuron.
- the neuronal cell can be an inhibitory neuron located in the pre-frontal cortex of a non-human animal.
- the inhibitory neuron can be a parvalbumin neuron.
- the animal cells can further comprise a second light-activated protein expressed on the cells' plasma membrane.
- the second light-activated protein can be capable of mediating a hyperpolarizing current in the cell when the cell is illuminated with light.
- the second light-activated protein can be NpHr, eNpnr2.0, eNpHr3.0, eNpHr3.1 or GtR3.
- the C1V1-E122/E162 mutant light-activated chimeric, protein can have decreased inactivation relative to C1V1 proteins lacking mutations at E 122/E162 or relative to other light-activated cation channel proteins.
- the C1V1-E122/E162 mutant light-activated chimeric protein can inactivate by any of about 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, or 30% compared to C1V1 proteins lacking mutations at E122/E162 or relative to other light-activated cation channel proteins, inclusive.
- the C1V1-E122/E162 light-activated chimeric protein can have a photocycle more than 1 fold, 1.5 fold, 2 fold, 2.5 fold, 3 fold, 3.5 fold, 4 fold, 4.5 fold, 5 fold. 5.5 fold, 6 fold, 6.5 fold, 7 fold, 7.5 fold, 8 fold, 8.5 fold, 9 fold, 9.5 fold, or 10 fold faster than C1V1 proteins lacking mutations at E 122/E162 or relative to other light-activated cation channel proteins, inclusive.
- the present disclosure provides for the modification of light-activated chimeric proteins expressed in a cell by the addition of one or more amino acid sequence motifs which enhance transport to the plasma membranes of mammalian cells.
- Light-activated chimeric proteins having components derived from evolutionarily simpler organisms may not be expressed or tolerated by mammalian cells or may exhibit impaired subcellular localization when expressed at high levels in mammalian cells. Consequently, in some embodiments, the chimeric light-activated. protein expressed in a cell is fused to one or more amino acid sequence motifs selected from the group consisting of a signal peptide, an endoplasmic reticulum (ER) export signal, a membrane trafficking signal, and an N-terminal golgi export signal.
- ER endoplasmic reticulum
- the one or more amino acid sequence motifs which enhance light-activated chimeric protein transport to the plasma membranes of mammalian cells can be fused to the N-terminus, the C-terminus, or to both the N- and C-terminal ends of the light-activated protein.
- the light-activated protein and the one or more amino acid sequence motifs may be separated by a linker.
- the light-activated chimeric protein is modified by the addition of a trafficking signal (ts) which enhances transport of the protein to the cell plasma membrane.
- the trafficking signal is derived from the amino acid sequence of the human inward rectifier potassium channel Kir2.1.
- the trafficking signal comprises the amino acid sequence KSRITSEGEYIPLDQIDINV. Additional protein motifs which can enhance light-activated protein transport to the plasma membrane of a cell are described in U.S. patent application Ser. No. 12/041,628, which is incorporated herein by reference in its entirety.
- the signal peptide sequence in the chimeric protein is deleted or substituted with a signal peptide sequence from a different protein.
- the cells are animal cells.
- the animal cells comprise the C1V1 protein corresponding to SEQ ID NO:1.
- the animal cells comprise the mutant C1V1-E122T protein corresponding to SEQ ID NO:3.
- the animal cells comprise the mutant C1V1-E162T protein corresponding to SEQ ID NO:5.
- the animal cells comprise the mutant C1V1-E122T/E162T protein corresponding to SEQ ID NO7.
- the animal cell can be a neuronal cell, a muscle cell, or a stem cell. In one embodiment, the animal cell can be a neuronal cell.
- the neuronal cell can be an excitatory neuron located in the pre-frontal cortex of a non-human animal in other embodiments, the excitatory neuron can be a pyramidal neuron. In some embodiments the neuronal cell can be an inhibitory neuron located in the pre-frontal cortex of a non-human animal. In still other embodiments, the inhibitory neuron can be a parvalbumin neuron.
- non-human animals comprising the light activated chimeric proteins disclosed herein expressed on the cell membrane of the cells in the animals.
- the animal cells comprise the C1V1 protein corresponding to SEQ ID NO:1.
- the animal cells comprise the mutant C1V1-E122T protein corresponding to SEQ ID NO:3.
- the animal cells comprise the mutant C1V1-E162T protein corresponding to SEQ ID NO:5.
- the animal cells comprise the mutant C1V1-E122T/E162T protein corresponding to SEQ ID NO7.
- the animals comprising the light-activated chimeric proteins described herein are transgenically expressing said light-activated chimeric proteins.
- the animals comprising the light-activated chimeric proteins described herein have been virally transfected with a vector carrying the light-activated protein such as, but not limited to, an adenoviral vector.
- living brain slices from a non-human animal comprising the light-activated chimeric proteins described herein expressed on the cell membrane of the cells in the slices.
- the brain slices are from non-human animals transgenically expressing the light-activated chimeric proteins described herein.
- the brain slices are from non-human animals that have been virally transfected with a vector carrying said light-activated protein such as, but not limited to, an adenoviral vector.
- the brain slices are coronal brain slices.
- the brain slices are any of about 100 ⁇ m, about 150 ⁇ m, about 200 ⁇ m, about 250 ⁇ m, about 300 ⁇ m, about 350 ⁇ m, about 400 ⁇ m, about 450 ⁇ m, or about 500 ⁇ m thick, inclusive, including any thicknesses in between these numbers.
- isolated C1V1 polynucleotides that encode any chimeric polypeptides described herein that, for example, have at least one activity of a C1V1 polypeptide.
- the disclosure provides isolated, synthetic, or recombinant polynucleotides comprising a nucleic acid sequence having at least about 70%, e.g., at least about 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%; 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%, or complete (100%) sequence identity to the nucleic acid of SEQ ID NO:2, 4, 6 or 8 over a region of at least about 10, e.g., at least about 15, 20, 25, 30, 35, 40, 45, 50, 75, 100, 150, 200, 250, 300, 350, 400, 450,
- the disclosure specifically provides a nucleic acid encoding C1V1 and/or a mutant variant thereof.
- the disclosure provides an isolated nucleic acid molecule, wherein the nucleic acid molecule encodes: (1) a polypeptide comprising an amino acid sequence with at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO:1; (2) a polypeptide comprising an amino acid sequence with at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ NO:3, (3) a polypeptide comprising an amino acid sequence with at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO:5; or (4) a polypeptide comprising an amino acid sequence with at least 90%, 91%, 92%
- the disclosure also provides expression cassettes and/or vectors comprising the above-described nucleic acids.
- the nucleic acid encoding a chimeric protein of the disclosure is operably linked to a promoter
- Promoters are well known in the art. Any promoter that functions in the host cell can be used for expression of C1V1 and/or any variant thereof of the present disclosure. Initiation control regions or promoters, which are useful to drive expression of a C1V1 chimeric protein or variant thereof in a specific animal cell are numerous and familiar to those skilled in the art. Virtually any promoter capable of driving these nucleic acids can be used.
- a human calmodulin-dependent protein kinase II alpha (CaMKII ⁇ ) promoter may be used.
- an elongation factor 1a (EF-1a) promoter in conjunction with a Cre-inducible recombinant AAV vector can be used with parvalbumin-Cre transgenic mice to target expression C1V1 chimeric proteins to inhibitory neurons.
- vectors comprising the polynucleotides disclosed herein encoding a C1V1 chimeric polypeptide or any variant thereof.
- the vectors that can be administered according to the present invention also include vectors comprising a polynucleotide which encodes an RNA (e.g., RNAi, ribozymes, miRNA, siRNA) that when transcribed from the polynucleotides of the vector will result in the accumulation of light-activated chimeric proteins on the plasma membranes of target animal cells.
- RNAi e.g., RNAi, ribozymes, miRNA, siRNA
- Vectors which may be used include, without limitation, lenkitiiral, HSV, and adenoviral vectors.
- Lentiviruses include, but are not limited to HIV-1, HIV-2, SIV, FIV and EIAV. Lentiviruses may be pseudotyped with the envelope proteins of other viruses, including, but not limited to VSV, rabies, Mo-MLV, baculovirus and Ebola. Such vectors may be prepared using standard methods in the art.
- the vector is a recombinant AAV vector.
- AAV vectors are DNA viruses of relatively small size that can integrate, in a stable and sitespecific manner, into the genome of the cells that they infect. They are able to infect a wide spectrum of cells without inducing any effects on cellular growth, morphology or differentiation, and they do not appear to be involved in human pathologies.
- the AAV genome has been cloned, sequenced and characterized. It encompasses approximately 4700 bases and contains an inverted terminal repeat (ITR) region of approximately 145 bases at each end, which serves as an origin of replication for the virus.
- ITR inverted terminal repeat
- the remainder of the genome is divided into two essential regions that carry the encapsidation functions: the left-hand part of the genome, that contains the rep gene involved in viral replication and expression of the viral genes; and the right-hand part of the genome, that contains the cap gene encoding the capsid proteins of the virus.
- AAV as a vector for gene therapy has been rapidly developed in recent years. Wild-type AAV could infect, with a comparatively high titer, dividing or non-dividing cells, or tissues of mammal, including human, and also can integrate into in human cells at specific site (on the long arm of chromosome 19) (Kotin, R. M., et al, Proc. Natl. Acad. Sci. USA 87: 2211-2215, 1990) (Samulski, R. J, et al, EMBO J. 10: 3941-3950, 1991 the disclosures of which are hereby incorporated by reference herein in their entireties).
- AAV vector without the rep and cap genes loses specificity of site-specific integration, but may still mediate long-term stable expression of exogenous genes.
- AAV vector exists in cells in two forms, wherein one is episomic outside of the chromosome; another is integrated into the chromosome, with the former as the major form.
- AAV has not hitherto been found to be associated with any human disease, nor any change of biological characteristics arising from the integration has been observed.
- AAV vectors may be prepared using standard methods in the art.
- Adeno-associated viruses of any serotype are suitable (See, e.g., Blacklow, pp. 165-174 of “ Parvoviruses and Human Disease ” J. R. Pattison, ed. (1988); Rose, Comprehensive Virology 3:1, 1974; P.
- the replication defective recombinant AAVs according to the invention can be prepared by co-transfecting a plasmid containing the nucleic acid sequence of interest flanked by two AAV inverted terminal repeat (ITR) regions, and a plasmid carrying the AAV encapsidation genes (rep and cap genes), into a cell line that is infected with a human helper virus (for example an adenovirus).
- ITR inverted terminal repeat
- rep and cap genes AAV encapsidation genes
- the vector(s) for use in the methods of the invention are encapsidated into a virus particle (e.g. AAV virus particle including, but not limited to, AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, AAV13, AAV14, AAV15, and AAV16).
- a virus particle e.g. AAV virus particle including, but not limited to, AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, AAV13, AAV14, AAV15, and AAV16.
- the invention includes a recombinant virus particle (recombinant because it contains a recombinant polynucleotide) comprising any of the vectors described herein. Methods of producing such particles are known in the art and are described in U.S. Pat. No. 6,596,53
- one or more vectors may be administered to neural cells, heart cells, or stem cells. If more than one vector is used, it is understood that they may be administered at the same or at different times to the animal cell.
- a first light-activated protein such as those disclosed herein, can be expressed in an excitatory neuron while a second light-activated protein can be expressed in an inhibitory neuron.
- the first light-activated protein expressed in the excitatory neuron can be activated by a different wavelength of light than the second light-activated protein expressed in the inhibitory neuron.
- the first and second light-activated proteins can be expressed in a living non-human animal or in a living brain slice from a non-human animal.
- a method for identifying a chemical compound that selectively inhibits the depolarization of excitatory or inhibitory neurons residing in the same neural circuit by expressing in those neurons the light-activated chimeric proteins described herein.
- a first light-activated protein can be expressed in an excitatory neuron while a second light-activated protein can be expressed in an inhibitory neuron.
- the first light-activated protein expressed in the excitatory neuron can be activated by a different wavelength of light than the second light-activated protein expressed in the inhibitory neuron.
- the first and second light-activated proteins can be expressed in a living non-human animal or in a living brain slice from a non-human animal.
- a method for selectively depolarizing excitatory or inhibitory neurons residing in the same microcircuit comprising: selectively depolarizing an excitatory neuron comprising a first light-activated protein, wherein the first light-activated protein is depolarized when exposed to light having a first wavelength or selectively depolarizing an inhibitory neuron comprising a second light-activated protein, wherein the second light-activated protein is depolarized when exposed to light having a second wavelength.
- the first light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO: 1.
- the first light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO: 3.
- the first light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO: 5.
- the second light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO:11.
- the second light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO:12. In some embodiments, the second light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO: 13. In some embodiments, the second light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO: 14.
- a method for selectively depolarizing excitatory or inhibitory neurons residing in the same microcircuit comprising: expressing a first light-activated protein in an excitatory neuron; and expressing a second light-activated protein in an inhibitory neuron, wherein the first light-activated protein is independently depolarized when exposed to light having a first wavelength and wherein the second light-activated protein is independently depolarized when exposed to light having a second wavelength.
- the first light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO: 1.
- the first light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO: 3.
- the first light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO: 5.
- the second light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO:11.
- the second light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO:12. In some embodiments, the second light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO:13. In some embodiments, the second light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO:14.
- the first light-activated protein can be activated by green light. In one embodiment, the first light-activated protein can be activated by light having a wavelength of about 560 nm. In one embodiment, the first light-activated protein can be activated by red light. In another embodiment, the first light-activated protein can be activated by light having a wavelength of about 630 nm. In other embodiments, the second light-activated protein can be activated by violet light. In one embodiment, the second light-activated protein can be activated by light having a wavelength of about 405 nm. In other embodiments, the second light activated protein can be activated by green light.
- the light-activated proteins are activated by light pulses that can have a duration for any of about 1 millisecond (ms), about 2 ms, about 3, ms, about 4, ms, about 5 ms, about 6 ms, about 7 ms, about 8 ms, about 9 ms, about 10 ms, about 15 ms, about 20 ms, about 25 ms, about 30 ms, about 35 ms, about 40 ms, about 45 ms, about 50 ms, about 60 ms, about 70 ms, about 80 ms, about 90 ms, about 100 ms, about 200 ms, about 300 ms, about 400 ms, about 500 ms, about 600 ms, about 700 ms, about 800 ms, about 900 ms, about 1 sec, about 1.25 see, about 1.5 sec, or about 2 sec, inclusive, including any times in between these numbers.
- ms millisecond
- the light-activated proteins are activated by light pulses that can have a light power density of any of about 0.05 mW mm ⁇ 2 , about 0.1 mW mm ⁇ 2 , about 0.25 mW mm ⁇ 2 , about 0.5 mW mm ⁇ 2 , about 0.75 mW mm ⁇ 2 , about 1 mW mm ⁇ 2 , about 2 mW mm ⁇ 2 , about 3 mW mm ⁇ 2 , about 4 mW mm ⁇ 2 , about 5 mW mm ⁇ 2 , about 6 mW mm ⁇ 2 , about 7 mW mm ⁇ 2 , about 8 mW mm ⁇ 2 , about 9 mW mm ⁇ 2 , about 10 mW mm ⁇ 2 , about 11 mW mm ⁇ 2 , about 12 mW mm ⁇ 2 , about 13 mW mm ⁇ 2 , about 14 mW
- the neuronal cell can be an excitatory neuron located in the pre-frontal cortex of a non-human animal.
- the excitatory neuron can be a pyramidal neuron.
- the neuronal cell can be an inhibitory neuron located in the pre-frontal cortex of a non-human animal.
- the inhibitory neuron can be a parvalbumin neuron.
- the inhibitory and excitatory neurons can be in a living non-human animal. In other embodiments, the inhibitory and excitatory neurons can be in a brain slice from a non-human animal.
- a method for identifying a chemical compound that selectively inhibits the depolarization of excitatory or inhibitory neurons residing in the same microcircuit comprising: (a) selectively depolarizing an excitatory neuron comprising a first light-activated protein with light having a first wavelength or selectively depolarizing an inhibitory neuron comprising a second light-activated protein with light having a second wavelength; (b) measuring an excitatory post synaptic potential (EPSP) in response to selectively depolarizing the excitatory neuron comprising a first light-activated protein or measuring an inhibitory post synaptic current (IPSC) in response to selectively depolarizing an inhibitory neuron comprising a second light-activated protein; (c) contacting the excitatory neuron or the inhibitory neuron with a chemical compound; (d) measuring the excitatory post synaptic potential (EPSP) or measuring the inhibitory post synaptic current (IPSC) to determine if contacting either the excitatory neuron or
- the first light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO: 1.
- the first light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO: 3.
- the first light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO: 5.
- the second light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence showm in SEQ ID NO:11.
- the second light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO:12.
- the second light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO:13.
- the second light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO:14.
- the chemical compound can be a member of a combinatorial chemical library.
- the method farther comprises assaying the chemical compound to determine if it adversely affects the function of cardiac tissue or the cardiac action potential in mammals.
- the first light-activated protein can be activated by green light. In one embodiment, the first light-activated protein can be activated by light having a wavelength of about 560 nm. In one embodiment, the first light-activated protein can be activated by red light. In another embodiment, the first light-activated protein can be activated by light having a wavelength of about 630 nm. In other embodiments, the second light-activated protein can be activated by violet light. In one embodiment, the second light-activated protein can be activated by light having a wavelength of about 405 nm.
- the light-activated proteins can be activated by light pulses that can have a duration for any of about 1 millisecond (ms), about 2 ms, about 3, ms, about 4, ms, about 5 ms, about 6 ms, about 7 ms, about 8 ms, about 9 ms, about 10 ms, about 15 ms, about 20 ms, about 25 ms, about 30 ms, about 35 ms, about 40 ms, about 45 ms, about 50 ms, about 60 ms, about 70 ms, about 80 ms, about 90 ms, about 100 ms, about 200 ms, about 300 ms, about 400 ms, about 500 ms, about 600 ms, about 700 ms, about 800 ms, about 900 ms, about 1 sec, about 1.25 sec, about 1.5 sec, or about 2 sec, inclusive, including any times in between these numbers.
- ms millisecond
- the light-activated proteins can be activated by light pulses that can have a light power density of any of about 0.05 mW mm ⁇ 2 , about 0.1 mW mm ⁇ 2 , about 0.25 mW mm ⁇ 2 , about 0.5 mW mm ⁇ 2 , about 0.75 mW mmm ⁇ 2 , about 1 mW mm ⁇ 2 , about 2 mW mm ⁇ 2 , about 3 mW mm ⁇ 2 , about 4 mW min ⁇ 2 , about 5 mW mm ⁇ 2 , about 6 mW mm ⁇ 2 , about 7 mW mm ⁇ 2 , about 8 mW mm ⁇ 2 , about 9 mW mm ⁇ 2 , about 10 mW mm ⁇ 2 , about 11 mW mm ⁇ 2 , about 12 mW mm ⁇ 2 , about 13 mW mm ⁇ 2 , about 14 m
- the neuronal cell can be an excitatory neuron located in the pre-frontal cortex of a non-human animal.
- the excitatory neuron can be a pyramidal neuron.
- the neuronal cell can be an inhibitory neuron located in the pre-frontal cortex of a non-human animal.
- the inhibitory neuron can be a parvalbumin neuron.
- the inhibitory and excitatory neurons can be in a living non-human animal. In other embodiments, the inhibitory and excitatory neurons can be in a brain slice from a non-human animal.
- the present disclosure relates to a light-activated chimera opsin that modifies a membrane voltage when expressed therein. While the present disclosure is not necessarily limited in these contexts, various aspects of the disclosure may be appreciated through a discussion of examples using these and other contexts.
- opsin modified for expression in cell membranes including mammalian cells.
- the opsin is derived from a combination of two different opsins, Volvox channelrhodopsin (VChR1) and Chlamydomonas reinhardtii channelrhodopsin (ChR1).
- VhR1 Volvox channelrhodopsin
- ChR1 Chlamydomonas reinhardtii channelrhodopsin
- the opsin can be useful for expressing at levels of a higher rate than either of the individual opsins from which it is derived.
- the genetic sequence of ChR1/VChR1 chimera (C1V1) is primarily VChR1. Portions of the VChR1 sequence associated with trafficking arc replaced with homologous sequences from ChR1.
- Various embodiments relate to modification directed toward the addition of a trafficking signal to improve expression in mammalian cells.
- Certain aspects of the present disclosure are directed to further modified versions of C1V1.
- certain embodiments include a mutation E162T to C1V1, which experiments suggest provides an accelerated photocycle (e.g., almost 3-fold).
- Various embodiments of the present disclosure relate to an optogenetic system or method that correlates temporal, spatial and/or cell-type-specific control over a neural circuit with measurable metrics.
- the optogenetic system uses a variety of opsins, including C1V1 and/or C1V1 variants, to assert control over portions of neural circuits. For instance, various metrics or symptoms might be associated with a neurological disorder.
- the optogenetic system targets a neural circuit within a patient for selective control thereof.
- the optogenetic system involves monitoring the patient for the metrics or symptoms associated with the neurological disorder. In this manner, the optogenetic system can provide detailed information about the neural circuit, its function and/or the neurological disorder.
- particular embodiments relate to studying and probing disorders using a variety of opsins.
- Other embodiments relate to the identification and/or study of phenotypes and endophenotypes.
- Still other embodiments relate to the identification of treatment targets.
- aspects of the present disclosure are directed toward the artificial inducement of disorder/disease states on a fast-temporal time scale.
- the use of an opsin such as C1V1 can be particularly useful based on characteristics regarding an accelerated photocycle.
- certain embodiments allow for reversible disease states, which can be particularly useful for establishing baseline/control points for testing and/or for testing the effects of a treatment on the same animal when exhibiting the disease state and when not exhibiting the disease state.
- the use of opsins such as C1V1 allows for the control of a cell using a light source.
- the C1V1 reacts to light, causing a change in the membrane potential of the cell.
- the removal of the light and the subsequent cessation of the activation of C1V1 allows for the cell to return to its baseline state.
- Various aspects of the present disclosure are directed to an E122T mutation of a C1V1 opsin.
- the E122T mutation shifts maximum absorption of C1V1 or its variants toward the red light spectrum with respect to the un-mutated opsin.
- opsin modified for expression in mammalian cells and shifted, with respect to ChR2, for maximum absorption in the green light spectrum.
- the C1V1 opsin is derived from a combination of opsins and expresses at a higher rate than either of the opsins from which it is derived.
- the opsin, C1V1 is derived from Volvox channelrhodopsin (VChR1) and Chlamydomonas reinhardtii channelrhodopsin (ChR1).
- VhR1 Volvox channelrhodopsin
- ChR1 Chlamydomonas reinhardtii channelrhodopsin
- the resulting opsin, C1V1 and its variants have a maximum absorption at wavelengths between 530 nm and 546 nm.
- Certain aspects of the present disclosure are directed to further modified versions of C1V1.
- certain embodiments include a mutation E122T, which shifts the maximum absorption of C1V1 towards the red light spectrum.
- Other modifications can include an additional mutation E162T, which experiments suggest provides an accelerated photocycle in addition to the red shift provided by the E122T mutation.
- transmembrane molecule derived from VChR1 and having the traffic sequences replaced with homologous sequences from ChR1.
- the molecule further includes a mutation E122T.
- the molecule further includes mutations at E162T and E122T.
- the molecule activates an ion channel in response to green light.
- the molecule has a maximum light absorption of approximately 546 nm. In another embodiment, the molecule has a maximum light absorption of approximately 535 nm.
- an animal cell comprising: an integrated exogenous molecule which expresses an ion channel that is responsive to red light; the exogenous molecule derived from VChR1 and including transmembrane traffic sequences thereof replaced by homologous sequences from aim.
- the exogenous molecule further includes E122T.
- the cell has a neural. firing ratio of about 14% to 94% in response to light having wavelengths of 405 nm and 560 nm, respectively.
- the cell has a neural firing ratio of about 11% to 72% in response to light having wavelengths of 405 nm and 560 nm, respectively.
- Additional example embodiments of the present disclosure relate to the use of a hybrid ChR1/VChR1 chimera that contains no ChR2 sequence at all, is derived from two opsins genes that do not express well individually, and is herein referred to as C1V1.
- Embodiments of the present disclosure also relate to improvements of the membrane targeting of VChR1 through the addition of a membrane trafficking signal derived from the K ir 2.1 channel. Confocal images from cultured neurons expressing VChR1-EYFP revealed a large proportion of intracellular protein compared with ChR2; therefore, membrane trafficking signal (ts) derived from the K ir 2.1 channel was used to improve the membrane targeting of VChR1.
- VChR1-ts-EYFP Membrane targeting of this VChR1-ts-EYFP was slightly enhanced compared with VChR1-EYFP; however, mean photocurrents recorded from cultured hippocampal neurons expressing VCER1-ts-EYFP were only slightly larger than those of VChR1-EYFP. Accordingly, embodiments of the present disclosure relate to VChR1, which has been modified by exchanging helices with corresponding helices from other ChRs. For example, robust improvement has been discovered in two chimeras where helices 1 and 2 were replaced with the homologous segments from ChR1.
- ChR1 is only weakly expressed and poorly integrated into membranes of most mammalian host cells.
- ChR2 is a rhodopsin derived from the unicellular green algae Chlamydomonas reinhardtii.
- rhodopsin as used herein is a protein that comprises at least two building blocks, an opsin protein, and a covalently bound cofactor, usually retinal (retinaldehyde).
- the rhodopsin ChR2 is derived from the opsin Channelopsin-2 (Chop2), originally named Chlamyopsin-4 (Cop4) in the Chlamydomonas genome.
- Chop2 opsin Channelopsin-2
- Cop4 Chlamyopsin-4
- the temporal properties of one depolarizing channelrhodopsin, ChR2 include fast kinetics of activation and deactivation, affording generation of precisely timed action potential trains.
- the normally fast off-kinetics of the channelrhodopsins can be slowed.
- certain implementations of channelrhodopsins apply 1 mW/mm ⁇ 2 light for virtually the entire time in which depolarization is desired, which can be less than desirable.
- VChR1 Volvox channelrhodopsin
- VChR1 Volvox channelrhodopsin
- modifications/mutations can be made to ChR2 or VChR1 variants.
- the modified variants can be used in combination with light-activated ion pumps.
- Embodiments of the present disclosure include relatively minor amino acid variants of the naturally occurring sequences.
- the variants are greater than about 75% homologous to the protein sequence of the naturally occurring sequences.
- the homology is greater than about 80%.
- Yet other variants have homology greater than about 85%, greater than 90%, or even as high as about 93% to about 95% or about 98%.
- Homology in this context means sequence similarity or identity, with identity being preferred. This homology can be determined using standard techniques known in sequence analysis.
- compositions of embodiments of the present disclosure include the protein and nucleic acid sequences provided herein, including variants which are more than about 50% homologous to the provided sequence, more than about 55% homologous to the provided sequence, more than about 60% homologous to the provided sequence, more than about 65% homologous to the provided sequence, more than about 70% homologous to the provided sequence, more than about 75% homologous to the provided sequence, more than about 80% homologous to the provided sequence, more than about 85% homologous to the provided sequence, more than about 90% homologous to the provided sequence, or more than about 95% homologous to the provided sequence.
- stimulation of a target cell is generally used to describe modification of the properties of the cell.
- the stimulus of a target cell may result in a change in the properties of the cell membrane that can lead to the depolarization or polarization of the target cell.
- the target cell is a neuron and the stimulus affects the transmission of impulses by facilitating or inhibiting the generation of impulses (action potentials) by the neuron.
- Chimeric channelrhodopsin variant C1V1 was generated by fusing either a wild-type or human codon-optimized channelrhodopsin-1 with a human codon-adapted VChR1 (GenBankTM accession number ACD70142.1) by overlap extension PCR.
- C1V1 splice variants were generated by overlap PCR.
- Variant one contained the first 145 amino acids of ChR1 and amino acids 102 to 316 of VChR1.
- Variant two contained the first 162 amino acids of ChR1 and amino acids 119 to 316 of VChR1.
- the resultant chimeric PCR fragments were cloned into pECFP-N1 (Clonetech, Mountain View, Calif.) and into lentiviral expression vectors under the CaMKII ⁇ promoter.
- the membrane trafficking signal was derived from the Kir2.1 channel. Mutations were confirmed by sequencing the coding sequence and splice sites.
- opsin-EYFP fusions along with the CaMKII ⁇ promoter were subcloned into a modified version of the pAAV2-MCS vector.
- Cre-dependent opsin expression was achieved by cloning the opsin-EYFP cassette in the reverse orientation between pairs of incompatible lox sites (loxP and lox2722) to generate a double foxed inverted open reading frame (D10) under the control of the elongation factor 1a (EF-1 ⁇ ) promoter. All constructs are available from the Deisseroth Lab (www.optogenetics.org).
- HEK293 cells were cultured in Dulbecco's minimal essential medium supplemented with 10% fetal bovine serum, 2 mM glutamine (Biochrome, Berlin, Germany), and 1% (w/w) penicillin/streptomycin. Cells were seeded onto coverslips at a concentration of 0.175 ⁇ 106 cells/ml and supplemented with 1 ⁇ M all-trans retinal. Transient transfection was performed with Fugene 6 (Roche, Mannheim, Germany) and recordings were done 20-28 hours later. Photocurrents in transiently transfected HEK293 cells were recorded by conventional whole-cell patch-clamp.
- the external solution contained [mM]: 140 NaCl, 2 CaCl 2 , 2MgCl 2 , 2KCl, 10 HEPES (pH 7.2).
- the internal solution contained [mM]: 110 NaCl, 10 EGTA, 2MgCl 2 , 1CaCl 2 , 5KCl, 10 HEPES (pH was adjusted to 7.2 either using CsOH or HCl).
- Patch pipettes were pulled with micropipette puller model P-97 (Sutter Instrument Co., Novato, Calif.) from microhaematocrit-tubes (Hecht-Assistant, Sondheim, Germany) with 1.5-2 M ⁇ resistance.
- HEK cell whole-cell patch-clamping was performed with an EPC 7 (HEKA, Elektronik GmbH, Lambrecht, Germany) amplifier. Analog data was sampled at 20 kHz, digitized with Digidata1440 (Molecular Devices, Foster City, Calif.) and displayed using pClamp10.1 Software (Molecular Devices, Foster City, Calif.). For recording wavelength dependence, a light guide from a Polychrome V unit (TILL Photonics, Planegg, Germany) was mounted on the epiluminescence port of an Olympus IX70 microscope.
- a beam splitter (70% R/30% T) was used resulting in a final photon density of ⁇ 1 ⁇ 10 22 photons m ⁇ 2 s ⁇ 1 at 470 nm on the coverslip.
- the polychrome V Unit was controlled with Tillvision Software (TILL Photonics, Planegg, Germany) synchronized with the pClamp Software.
- FIG. 1C-D Two chimeric ChR1-VChR1 channels for membrane targeting and photocurrent size were tested in cultured HEK293 cells. The first was joined in the second intracellular loop after Ala145 of ChR1, and the second was joined within helix three after Trp163 of ChR1 ( FIG. 1C ). Whereas both variants were nearly equally well expressed in HEK293 cells ( FIG. 1D ), in cultured neurons the second variant expressed more robustly ( FIG.
- the chromophore region was searched using known structural models 22,28 ( FIG. 1H ) for mutations with faster photocycle kinetics, reduced inactivation and reduced blue absorption.
- glutamate-122 was mutated to threonine, based on studies of the glutamate-rich motif in helix 2 showing that this mutation reduces inactivation.
- C1V1 vectors All point mutations in C1V1 vectors were generated in the plasmids by site-directed mutagenesis (Agilent Technologies, Palo Alto, Calif.).
- the membrane trafficking signal was derived from the K ir 2.1 channel. Mutations were confirmed by sequencing the coding sequence and splice sites.
- analogous mutations in ChR2 or other microbial opsins have caused a redshift 28,29
- C1V1 this mutation shifted the action spectrum in the undesired direction, hypsochromic to 530 run ( FIG. 1F ; Table 1).
- C1V1-E122T inactivated only by 26% compared to 46% deactivation of ChR2 ( FIG. 2B , Table 1); in addition, the spectrum was further red-shifted to 546 nm ( FIG.
- lentiviral vectors encoding C1V1-ts-EYFP and the point mutation combinations above were generated. These opsins were then expressed in cultured hippocampal neurons and recorded whole-cell photocurrents under identical stimulation conditions (2 ms pulses, 542 nm light, 5.5 mW mm ⁇ 2 ) to determine whether the improvement in photocurrent amplitude resulted directly from the increased expression of C1V1 compared to VChR1.
- Wild-type or transgenic Parvalbumin::Cre C57/BL6J male mice were group housed three to five to a cage and kept on a reverse 12 hour light/dark cycle with ad libitum food and water. Experimental protocols were approved by Stanford University IACUC and meet guidelines of the National Institutes of Health guide for the Care and Use of Laboratory Animals.
- Electrophysiological recordings from individual neurons identified by fluorescent protein expression were obtained in Tyrode media ([mM] 150 NaCl, 4KCl, 2MgCl2, 2MgCl2, 10 D-glucose, 10 HEPES, pH 7.35 with NaOH) using a standard internal solution ([mM] 130 KGluconate, 10KCl, 10 HEPES, 10 EGTA, 2MgCl2, pH 7.3 with KOH) in 3-5 M ⁇ glass pipettes.
- Cultured cell images were acquired on the same microscope using a Retiga Exi CCD camera (Qimaging, Inc.) at 100 ms exposure with 30 gain. Illumination power density was 12 mW mm ⁇ 2 at 500 nm with a standard EYFP filter set. Quantification of fluorescence was performed with ImageJ software by marking a region containing the soma and proximal neurites and calculating for each cell the total integrated pixel intensity in that region, rather than average fluorescence, since photocurrents are likely to be related to the total number of membrane-bound channels rather than average channel expression per area.
- opsins Both Lentiviral- and AAV-mediated gene delivery were used for heterologous expression of opsins in mice. Indicated opsins were driven by either Human calmodulin-dependent protein kinase II alpha (CaMKII ⁇ ) promoter to target cortical excitatory neurons or Elongation Factor 1a (EF-1a) in conjunction with a Cre-inducible cassette and followed by the Woodchuck hepatitis virus posttranscriptional regulatory element (WPRE). Cre-inducible recombinant AAV vector was produced by the University of North Carolina Vector Core (Chapel Hill, N.C., USA) and used in conjunction with parvalbumin::Cre transgenic mice to target parvalbumin positive interneurons.
- CaMKII ⁇ Human calmodulin-dependent protein kinase II alpha
- EF-1a Elongation Factor 1a
- WPRE Woodchuck hepatitis virus posttranscriptional regulatory element
- AAV constructs were subcloned into a modified version of the pAAV2-MCS, serotyped with AAV5 coat proteins and packaged by the viral vector core at the University of North Carolina.
- the final viral concentration of AAV vectors as 1 ⁇ 10 12 genome copies (gc)/mL.
- Lentiviral constructs were generated as reported. All constructs are available from the Deisseroth Lab (www.optogenetics.org).
- Stereotactic viral injections were carried out under protocols approved by Stanford University. Juvenile (4-6 weeks) mice kept under isoflurane anesthesia were arranged in a stereotactic frame (Kopf Instruments) and leveled using bregma and lambda skull landmarks.
- IL Infralimbic prefrontal cortex
- IL infralimbic prefrontal cortex
- Subjects injected with virus for behavioral studies were additionally implanted with a chronic fiber optic coupling device to facilitate light delivery either with or without an attached penetrating cerebral fiber for local delivery to target cortical region as noted (Doric Lenses, Canada).
- Penetrating fibers were stereotactically inserted to a depth of ⁇ 2.5 mm from the same anterior and lateral coordinates and affixed using adhesive luting cement (C&B MetaBond) prior to adhesive closure of the scalp (Vetbond, 3M). Animals were administered analgesic relief following recovery from surgery.
- adhesive luting cement C&B MetaBond
- C1V1-E122T/E162T would be suitable for optically driving spiking in pyramidal neurons
- adeno-associated viral vectors harboring the C1V1-E122T/E162T-ts-EYFP gene under the CaMKIIa promoter (AAV5-CaMKIIa-C1V1-E122T/E162T-ts-EYFP) were generated and injected the virus into the prefrontal cortex of mice.
- Responses were recorded from expressing neurons in acute slices with 2 ms light pulse trains and compared with responses to trains of current injection (10 ms, 200 pA) at identical frequencies.
- Acute 300 ⁇ m coronal slices isolated from 8-9 week old wild-type C57BL/6J or PV::Cre mice previously injected with virus were obtained in ice-cold sucrose cutting solution ([mM] 11 D-glucose, 234 sucrose, 2.5KCl, 1.25NaH 2 PO 4 , 10MgSO 4 , 0.5CaCl 2 , 26NaHCO 3 ) using a Vibratome (Leica).
- Power spectra were calculated using the wavelet method as described by Sohal et al. 55 Briefly, for each frequency f, the recorded traces were first filtered with a bandpass filter between f ⁇ 5 Hz. The filtered traces were then convolved with the wavelet function:
- Cultured cell images were acquired on the same microscope using a Retiga Exi CCD camera (Qimaging Inc.) at 100 ms exposure with the 30 gain. Illumination power density was 12 mW mm 2 at 500 nm with a standard EYFP filter set. Quantification of fluorescence was done with ImageJ software by marking a region containing the soma and proximal neuritis and calculating for each cell the total integrated pixel intensity in that region, rather than average fluorescence, since photocurrents are likely to be related to the total number of membrane-bound channels rather than average channel expression per area.
- a single pyramidal cell was stimulated with a train of simulated EPSC waveforms.
- Individual sEPSC events had peak current magnitudes of 200 pA and decayed with a time constant of 2 ms.
- Each experiment was divided into 10 sweeps, each 10 seconds long and separated by 5 seconds to minimize rundown.
- Each sweep was divided into 500 ms segments.
- the total number of sEPSCs in each 500 ms segment was randomly chosen from a uniform distribution between 0 and 250.
- the times of the sEPSCs within the 500 ms segment were randomly selected from a uniform distribution extending across the entire segment, simulating excitatory input from a population of unsynchronized neurons.
- these stimulation parameters reliably drove pyramidal neurons at firing rates from 0-30 Hz.
- a 10 sec pulse of 590 nm light was delivered to completely inactivate the opsin before running the sEPSC protocol.
- a 1 sec pulse of 470 nm light preceded the sEPSC protocol.
- the mutual information between each neuron's input sEPSC rate and output spike rate which captures relevant changes in the shape of the I-O curve and in the response variability was computed.
- the joint distribution of sEPSC rate and spike rate by binning in time, sEPSC rate, and spike rate were estimated and the building of a joint histogram.
- Time bins were 125 ms wide, and sEPSC rate was divided into 10 equally spaced bins from 0 to 500 Hz, although the mutual information results were consistent across a wide range of binning parameters.
- Spike rate was binned using the smallest meaningful bin width given the time bin width (e.g. 8 Hz bin width for 125 ms time bins). From this joint histogram, compute mutual information, as previously described was computed equaling the difference between response entropy and noise entropy.
- CT corticothalamic
- TC thalamocortical
- C57BL/6J wild-type postnatal days 90-120 were anesthetized with pentobarbital (100 mg/kg, i.p.) and decapitated.
- pentobarbital 100 mg/kg, i.p.
- the thalamic slice preparation and whole-cell patch-clamp recordings were performed. Recordings were obtained from nRT (reticular thalamic) and TC (relay thalamocortical) neurons visually identified using differential contrast optics with a Zeiss (Oberkochen, Germany), Axioskop microscope, and an infrared video camera.
- the internal solution contained (in mM): 120 K-gluconate, 11KCl, 1MgCl 2 , 1CaCl 2 , 10 Hepes, 1 EGTA. pH was adjusted to 7.4 with KOH (290 mOsm). E Cl ⁇ was estimated ⁇ 60 mV based on the Nernst equation. Potentials were corrected for ⁇ 15 mV liquid junction potential.
- neurons were clamped at ⁇ 80 mV and EPSCs were pharmacologically isolated by bath application of the GABAA receptor antagonist picrotoxin (50 ⁇ M, Tocris). In all recording conditions, access resistance was monitored and cells were included for analysis only if the access resistance was ⁇ 18 M ⁇ and the change of resistance was ⁇ 25% over the course of the experiment.
- rAAV5/CaMKII ⁇ -hChR2(H134R)-EYFP or 900 nL rAAV5-CaMKII ⁇ C1V1(E122T/E162T)-TS-mCherry virus was injected stereotaxically into ventrobasal thalamus (VB) or barrel cortex, respectively, of C57BL/6J wild-type mice in vivo, between post-natal days 30-35.
- Intra-cortical injections were preformed (from bregma) 1.3 mm posterior, 3 mm lateral, 1.15 mm below the cortical surface.
- Intra-thalamic injections were 1.7 mm posterior, 1.5 mm lateral, 3.5 mm below the cortical surface. Mice were sacrificed ⁇ 2-3 months following injections and horizontal brain thalamic slices were made for optical stimulation and in vitro recordings as described above.
- VB thalamus was removed to avoid disynaptic activation of nRT neurons via the CT-TC-nRT pathway. Cutting VB thalamus from slices removed all photosensitive cell bodies from the preparation, enabled direct examination of CTnRT and TC-nRT projections, and did not affect the electrical membrane properties of nRT neurons (not shown).
- Optical activation of ChR2-expressing TC and C1V1-expressing CT axons were performed with 405 nm and 560 nm laser stimuli, respectively (5 ms duration light pulses, 2-3 mW) (OEM Laser Systems, MI) delivered with optic fiber (BFL 37-300, ThorLabs) upstream along the CT and TC pathways projecting to nRT.
- Minimal stimulation intensity was used, defined as the light power that resulted in 50 to 70% failures (30-50% successes), fixed response kinetics and low response amplitude variability.
- Consequent minimal evoked EPSCs presumably resulted from selective optical activation of single CT or TC axons presynaptic to the recorded cell.
- the stimulation light power was slightly increased ( ⁇ 5% above minimal stimulation) until the number of failures became 0.
- CT and TC inputs were (simultaneously) stimulated and minimal evoked EPSCs and EPSPs (each individually subthreshold for action potential firing) were recorded in nRT cells.
- visible-spectrum violet (405 nm) and green (560 nm) lasers were used to achieve separable activation of the two opsins. While 405 nm lasers deliver safe non-UV light, for many applications it may be preferable to use 470 nm laser light for the blue-responsive opsin, since 470 nm light will penetrate tissue more deeply, scatter less, and be more easily and economically delivered from common blue light sources. While this may seem impossible since 470 nm light will partially activate C1V1 ( FIG.
- ChR2-D156A and SSFO were generated by inserting point mutations into the pLenti-CaMKII ⁇ ChR2-EYFP-WPRE vector using site-directed mutagenesis (Quikchange II XL; Stratagene). Viral gene delivery, coronal brain sectioning, and patch clamp recording were performed as above. Double virus injections to express CaMKIIa::C1V1 and DIO-SSFO in the mPFC of PV::Cre mice were performed.
- White handling cells or tissues expressing SSFO care was taken to minimize light exposure to prevent activation by ambient light.
- a 20 s pulse of 590 nm light was applied to convert all of the SSFO channels to the dark state and prevent run-down of photocurrents.
- recordings from cultured neurons were made in voltage clamp mode.
- a 1 s pulse of varying wavelength was applied, followed by a 10 s 590 nm pulse.
- Deactivation spectra were acquired by first applying a 1 s 470 nm pulse to activate SSFO, followed by a 10 s pulse of varying wavelength.
- Net activation or deactivation was calculated by dividing the photocurrent change after the first or second pulse, respectively, by the maximum photocurrent change induced by the peak wavelength for that cell. Negative values in deactivation spectra resulted from traces in which, for example, a 10 s 470 nm pulse led to a slight increase in photocurrent rather than deactivate the channels. This could be the result of the relatively wide (20 nm) band-pass filter width used for these recordings with the Sutter DG-4. intermediate wavelengths (between 470 nm, and 520 nm) are expected to have a mixed effect on the channel population for the same reasons.
- Photon flux calculations for SSFO integration properties were conducted by calculating the photon flux through the microscope objective at each light power, and then dividing to reach the photon flux across the cell surface, based on the diameter of the recorded cells and approximating cell shape as a spheroid.
- SSFO is a novel multiply-engineered channelrhodopsin with a decay constant of 29 minutes that can be effectively deactivated at the same wavelengths that activate C1V1 and permits bistable excitation of neurons over many minutes with enhanced light sensitivity.
- Information regarding SSFOs can be found in International Patent Application Publication No: WO 2010/056970 and U.S. Patent Application Nos. 61/410,704 and 61/410,711, the contents of which are hereby incorporated by reference herein in their entireties.
- Double virus injections to express CaMKIIa::C1V1 and DIO::SSFO in acute slices from the mPFC of PV::Cre mice were performed.
- excitatory pyramidal cells should respond to redshifted light, and inhibitory PV cells to blue light.
- C1V1 is a red-shifted opsin gene assembled, remarkably, from pieces of other opsin genes that do not express well alone in neurons, but which were identified in earlier genomic searches (VChR1 and ChR1).
- C1V1 contains no ChR2 sequence at all, yet its multiply-engineered variants reported here now represent the most potent, most redshifted, and most stable channelrhodopsins known.
- C1V1(E162T) a high-expressing redshifted opsin gene generated as a fast homolog of the ChETA mutation
- C1V1(E122T) which displays the reddest action spectrum shoulder and can even be used to fire action potentials with red light
- C1V1 variants may be selected for different applications based on considerations of current size, deactivation kinetics, and action spectrum (Table 1)—for example, in two-photon work, since 2P activation of ChR2 has been difficult due to current size and rapid kinetics of channel closure, C1V1(E162T) is likely to be of interest.
- the C1V1 variants enabled direct testing of the hypothesis that increasing levels of elevated cellular E/I balance would give rise to increasing intensities of gamma rhythmicity, a phenomenon previously linked to both schizophrenia and autism.
- SEQ ID NO: 1 Humanized C1V1 amino acid sequence
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Biomedical Technology (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Medicinal Chemistry (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Biotechnology (AREA)
- Immunology (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Zoology (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Wood Science & Technology (AREA)
- Microbiology (AREA)
- Cell Biology (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Public Health (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pathology (AREA)
- Gastroenterology & Hepatology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Pharmacology & Pharmacy (AREA)
- General Chemical & Material Sciences (AREA)
- Environmental Sciences (AREA)
- General Engineering & Computer Science (AREA)
- Tropical Medicine & Parasitology (AREA)
- General Physics & Mathematics (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Food Science & Technology (AREA)
Abstract
Provided herein are compositions comprising light-activated chimeric proteins expressed on plasma membranes and methods of using the same to selectively depolarize excitatory or inhibitory neurons.
Description
- This application claims priority to U.S. Provisional Patent Application Nos. 61/410,736 filed on Nov. 5, 2010; 61/410,744 filed on Nov. 5, 2010; and 61/511,912 filed on Jul. 26, 2011, the disclosures of each of which are incorporated herein by reference in their entireties.
- This application pertains to compositions comprising animal cells expressing light-activated chimeric proteins on their plasma membranes and methods of using the same to selectively depolarize excitatory or inhibitory neurons residing in the same microcircuit in the pre-frontal cortex.
- The neurophysiological substrates of most psychiatric disorders are poorly understood, despite rapidly emerging information on genetic factors that are associated with complex behavioral phenotypes such as those observed in autism and schizophrenia (Cichonet al., The American Journal of Psychiatry 166(5):540 (2009); O'Donovan et al., Human Genetics 126(1): 3 (2009)). One remarkable emerging principle is that a very broad range of seemingly unrelated genetic abnormalities can give rise to the same class of psychiatric phenotype (such as social behavior dysfunction; Folstein & Rosen-Sheidley, Nature Reviews 2(12):943 (2001)). This surprising pattern has pointed to the need to identify simplifying circuit-level insights that could unify diverse genetic factors under a common pathophysiological principle.
- One such circuit-level hypothesis is that elevation in the ratio of cortical cellular excitation and inhibition (cellular E/I balance) could give rise to the social and cognitive deficits of autism (Rubenstein, Current Opinion in Neurology 23(2):118; Rubenstein Merzenich, Genes, Brain, and Behavior 2(5):255 (2003)). This hypothesis could potentially unify diverse streams of pathophysiological evidence, including the observation that many autism-related genes are linked to gain-of-function phenotypes in ion channels and synaptic proteins (Bourgeron, Current Opinion in Neurobiology 19 (2), 231 (2009)) and that ˜30% of autistic patients also show clinically apparent seizures (Gillberg & Bilistedt, Acta Psychiatrica Scandinavica, 102(5):321 (2000)). However, it has not been clear if such an imbalance (to be relevant to disease symptoms) would be operative on the chronic (e.g. during development) or the acute timescale. Furthermore, this hypothesis is by no means universally accepted, in part because it has not yet been susceptible to direct testing. Pharmacological and electrical interventions lack the necessary specificity to selectively favor activity (in a manner fundamentally distinct from receptor modulation) of neocortical excitatory cells over inhibitory cells, whether in the clinical setting or in freely behaving experimental mammals during social and cognitive tasks. It is perhaps related to challenges such as this that the social and cognitive deficits of autism and schizophrenia have proven largely unresponsive to conventional psychopharmacology treatments in the clinic.
- Optogenetics is the combination of genetic and optical methods used to control specific events in targeted cells of living tissue, even within freely moving mammals and other animals, with the temporal precision (millisecond-timescale) needed to keep pace with functioning intact biological systems. The hallmark of optogenetics is the introduction of fast light-activated channel proteins to the plasma membranes of target neuronal cells that allow temporally precise manipulation of neuronal membrane potential while maintaining cell-type resolution through the use of specific targeting mechanisms. Among the microbial opsins which can be used to investigate the function of neural systems are the channelrhodopsins (ChR2, ChR1, VChR1, and SFOs) used to promote depolarization in response to light. In just a few short years, the field of optogenetics has furthered the fundamental scientific understanding of how specific cell types contribute to the function of biological tissues such as neural circuits in vivo. Moreover, on the clinical side, optogenetics-driven research has led to insights into Parkinson's disease and other neurological and psychiatric disorders.
- However, there are limitations to existing optogenetic tools for exploring the hypothesis that elevation in the ratio of cortical E/I balance might be associated with the social and cognitive deficits of autism and other disorders such as schizophrenia. Conventional channelrhodopsin photocurrents display significant desensitization which precludes the generation of step-like changes in E/I balance (instead requiring ramping or pulsing, which would not be suitable for investigation of stable changes in cellular E/I balance); moreover, both SFOs and conventional ChRs are driven by blue light, which precludes,within-preparation comparison of the effects of driving different populations of circuit elements (such as excitatory and inhibitory neurons). Therefore, what is needed is a tool that would allow the manipulation of cortical E/I balances and the monitoring of gamma oscillations in cortical slices to permit the investigation of how these manipulations affect downstream neurons residing in the same microcircuit in the pre-frontal cortex.
- Provided herein are compositions comprising chimeric light-activated protein cation channels which are capable of mediating a depolarizing current in the cell when the cell is illuminated with light.
- Provided herein are animal cells comprising a light-activated protein expressed on the cell membrane, wherein the protein is (a) a chimeric protein derived from VChR1 from Volvox carteri and ChR1 from Chlamydomonas reinhardti, wherein the protein comprises the amino acid sequence of VChR1 having at least the first and second transmembrane helices replaced by the first and second transmembrane helices of ChR1; (b) is responsive to light; and (c) is capable of mediating a depolarizing current in the cell when the cell is illuminated with light. In some embodiments, the cells are isolated or in a cell culture medium.
- Also provided herein is a population of cells comprising the cell expressing the chimeric protein described herein on the cell membrane. Also provided herein are non-human animals and brain tissue slices comprising a cell expressing the chimeric protein described herein on the cell membrane.
- Provided herein are polynucleotide comprising a nucleotide sequence encoding a light activated protein expressed on the cell membrane, wherein the protein is a chimeric protein derived from VChR1 from Volvox carteri and ChR1 from Chlamydomonas reinhardti, wherein the protein comprises the amino acid sequence of VChR1 having at least the first and second transmembrane helices replaced by the first and second transmembrane helices of ChR1; is responsive to light; and is capable of mediating a depolarizing current in the cell when the cell is illuminated with light. Vectors (such as expressing vectors) comprising the polynucleotides are also provided. In some embodiments, the expression vector is a viral vector (e.g., an AAV vector, a retroviral vector, an adenoviral vector, a HSV vector, or a lentiviral vector).
- Also provided herein are methods of using the animal cells expressing the chimeric protein described herein on the cell membrane, the methods comprise activating the chimeric protein with light.
- Also provided herein are methods of selectively depolarizing excitatory or inhibitory neurons residing in the same microcircuit, the methods comprising: selectively depolarizing an excitatory neuron comprising a first light-activated protein, wherein the first light activated protein is depolarized when exposed to light having a first wavelength; or selectively depolarizing an inhibitory neuron comprising a second light-activated protein, wherein the second light activated protein is depolarized when exposed to light having a second wavelength. In some embodiments, the first or the second light activated protein is a chimeric protein derived from VChR1 from Volvox carteri and ChR1 from Chlamydomonas reinhardti, wherein the protein comprises the amino acid sequence of VChR1 having at least the first and second transmembrane helices replaced by the first and second transmembrane helices of ChR1. In some embodiments, wherein the first light-activated protein comprises an amino acid sequence at least 95% identical to the sequence shown in SEQ ID NO: 1, 3, 5, or 7, and wherein the second light-activated protein comprises an amino acid sequence at least 95% identical to the sequence shown in SEQ ID NO:11, 12, 13, or 14.
- A method of selectively depolarizing excitatory or inhibitory neurons residing in the same microcircuit, the method comprising: expressing a first light-activated protein in an excitatory neuron; and expressing a second light activated protein in an inhibitory neuron, wherein the first light activated protein is independently depolarized when exposed to light having a first wavelength and wherein the second light activated protein is independently depolarized when exposed to light having a second wavelength. In some embodiments, the first or the second light activated protein is a chimeric protein derived from VChR1 from Volvox carteri and ChR1 from Chlamydomonas reinhardti, wherein the protein comprises the amino acid sequence of VChR1 having at least the first and second transmembrane helices replaced by the first and second transmembrane helices of ChR1. In some embodiments, the first light-activated protein comprises an amino acid sequence at least 95% identical to the sequence shown in SEQ ID NO: 1, 3, 5, or 7, and wherein the second light-activated protein comprises an amino acid sequence at least 95% identical to the sequence shown in SEQ ID NO:11, 12, 13, or 14.
- Also provided herein are methods for identifying a chemical compound that selectively inhibits the depolarization of excitatory or inhibitory neurons residing in the same microcircuit, the method comprising:(a) selectively depolarizing an excitatory neuron comprising a first light-activated protein with light having a first wavelength or selectively depolarizing an inhibitory neuron comprising a second light-activated protein with light having a second wavelength; (b) measuring an excitatory post synaptic potential (EPSP) in response to selectively depolarizing the excitatory neuron comprising a first light-activated protein or measuring an inhibitory post synaptic current (IPSC) in response to selectively depolarizing an inhibitory neuron comprising a second light-activated protein; (c) contacting the excitatory neuron or the inhibitory neuron with a chemical compound; (d) measuring the excitatory post synaptic potential (EPSP) or measuring the inhibitory post synaptic current (IPSC) to determine if contacting either the excitatory neuron or the inhibitory neuron with the chemical compound selectively inhibits the depolarization of either neuron. In some embodiments, the first or the second light activated protein is a chimeric protein derived from VChR1 from Volvox carteri and ChR1 from Chlamydomonas reinhardti, wherein the protein comprises the amino acid sequence of VChR1 having at least the first and second transmembrane helices replaced by the first and second transmembrane helices of ChR1. In some embodiments, the first light-activated protein comprises an amino acid sequence at least 95% identical to the sequence shown in SEQ ID NO: 1, 3, 5, or 7, and wherein the second light-activated protein comprises an amino acid sequence at least 95% identical to the sequence shown in SEQ ID NO:11, 12, 13, or 14.
- It is to be understood that one, some, or all of the properties of the various embodiments described herein may be combined to form other embodiments of the present invention. These and other aspects of the invention will become apparent to one of skill in the art.
-
FIG. 1 depicts engineering of an improved red-shifted channelrhodopsin for combinatorial optogenetics. (a) Confocal images of cultured hippocampal neurons transfected with VChR 1-eYFP or C1V1-eYFP under the control of the CaMKIIa promoter. Box denotes region expanded in the last panel, showing dendritic membrane localization of C1V1-tsYFP. Scale bars: 20 μm (left), 4 μm (right). (b) Peak photocurrents from whole-cell patch clamp recordings in-cultured hippocampal neurons expressing indicated opsins. (c) Sequence alignment of ChR1, ChR2 and VChR1. Splice sites for two C1V1 variants are indicated. Putative transmembrane helices 1-7 are indicated with bars (TM1-7); mutated amino acids indicated in grey. (d) Photocurrent amplitudes recorded in HEK cells expressingC1V1 splice variants C1V1 splice variant 1 as measured by photocurrent magnitude at −40 mV in HEK cells by whole cell patch clamp using cation-isolating external solutions. Data were normalized to the maximum peak Na current. (h) Schematic of the C1V1 chimera with point mutation positions indicated in white. ChR1 sequence indicated with black; VChR1 sequence with grey. -
FIG. 2 depicts testing an improved red-shifted channelrhodopsin for combinatorial optogenetics. (a) Representative traces and summary plot of channel closure time constant (toff) in cultured neurons expressing the indicated opsins; traces are normalized to peak current. (b) C1V1-E122T inactivation compared to deactivation of ChR2. (c) inactivation of current in C1V1 double mutant E122T/E162T versus other C1V1 variants. (d) Mean peak photocurrents recorded in cultured neurons expressing the indicated opsins in response to a 2ms 542 nm light pulse. -
FIG. 3 depicts photocurrents from acute slice recordings in prefrontal pyramidal neurons. (a) Peak photocurrents show consistent correlation with integrated fluorescence intensity. (b) Fluorescence-photocurrent relationship in ChR2(H134R) and C1V1(E122T/E162T). Black lines are linear fits to the data. (c) Acute slice recordings in prefrontal pyramidal neurons stimulated with 560 nm light pulse trains or current injections at the indicated frequencies. Summary graph shows population data (n=6). (d) Fraction of successful spikes to current injections (200 pA, 10 ms pulses; top left) or 2 ms light pulses at the indicated wavelengths and light power densities. All pulse trains consisted of 20×2 ms pulses delivered through the microscope objective using a Sutter DG-4 light source, filtered using 20 nm bandpass filters and additional neutral density filters to attenuate light power (n=6 cells in 2 slices). (e) Voltage-clamp responses to 542 nm and 630 nm light pulses in cells expressing C1V1-E122T or C1V1-E 122T/E 162T (top). Current-clamp recording in a C1V1-E 1221 expressing cell shows spiking in response to a 5 Hz train of 50ms 630 nm light at 3.2 mW mm−2 (bottom). (f) Kinetics of red light response in C1V1(E122T). Activation time constants (τon) of photocurrents recorded from cultured neurons expressing C1V1(E122T) at 540 nm and 630 nm. Note that light powers were 3.2 mW mm−2 at 630 nm and 7.7 mW mm−2 at 540 nm (n=5 cells, p=0.0006 paired t-test). (g) Voltage clamp traces show responses in a neuron expressing C1V1(E122T) to 630 nm light pulses. Pulse lengths are indicated above traces. τon. calculated from the 150 ms trace is 67 ms. (h) Current clamp recording from a neuron expressing C1V1(E122T) showing spikes elicited by 50 ms pulses at 630 nm (power density 3.2 mW mm−2). -
FIG. 4 depicts independent activation of excitatory pyramidal neurons and inhibitory parvalbumin-expressing cells. (a) Current clamp recordings from cultured hippocampal neurons expressing C1V1(E1 22T/E162T) or ChR2(H134R) in response to 2 ms light pulses at 560 nm or 405 nm (5 Hz; 7.6 mW/mm2 at both wavelengths). (b) Recording configuration in double-injected animals expressing C1V1 in cortical pyramidal neurons and ChR2 (H134R) in inhibitory parvalbumin-positive interneurons. To independently express opsins, PV::Cre mice were injected with a two-virus mix containing Lenti-Ca.MKIIα-C1V1(E122T/E162T) and AAV5-EF la-DIO-Ch R2 (H 134R). (c) Voltage clamp recordings from a non-expressing PYR neuron receiving synaptic input from C1V1-expressing PYR-cells and ChR2-expressing PV-cells. Clamped at 0 mV, 405 nm light pulses trigger short-latency IPSCs while 560 nm pulses evoke only small, long-latency inhibitory synaptic responses. (d) Voltage clamp recording from the same cell shown in c. Clamped at −65 mV, 560 nm light pulses trigger EPSCs but 405 nm pulses do not evoke detectable synaptic currents. Gray lines show individual events; black lines show light pulse-triggered averages. (e) mPFC optrode recording in an anesthetized PV::Cre mouse injected with CaMKIIa::C1V1(E162T)-ts-eYFP and Ef1a-DIO::ChR2-eYFP (diagram illustrates experimental setup). Violet (405 nm) light pulses are presented with variable delay (At) relative to green light pulses (example traces). (f) Summary graph shows probability of green light-evoked spikes with violet pulses preceding the green light pulses by the indicated delays. Individual points are from single recordings. Black line shows average for all recordings (>3 recording sites per bin). (g) Optrode recording from a mouse injected with viruses showing one presumed pyramidal unit and one presumed PV unit, firing in response to 561 nm stimulation (right, upper waveform) and 405 nm stimulation (right, lower waveform), respectively. -
FIG. 5 depicts combinatorial optogenetic excitation in distinct intact-system preparations. (a) Combinatorial projection control with C1V1-E122T/E 162T and ChR2-H134R in vitro. Experimental paradigm showing expression of C1V1 and ChR2 in cortico-thalamic (CT) and ventrobasal (VB) thalamo-cortical cells (TC), respectively. (b) Voltage-clamp recording from an nRT cell receiving projections both from CT and. IC cells. Simultaneous stimulation (At=O ms) leads to a linear summation of evoked EPSCs from both projections. (c) Individual subthreshold inputs from TC and CT fibers lead to spiking in an nRT neuron only when inputs are precisely co-incident. (d) Delays between CT and TC inputs are indicated on the left. Horizontal dashed lines indicate truncated spikes. Normalized number of action potentials (from 6 nRT cells) evoked by CT and TC fibers activated with variable latencies (At) indicates that CT and TC inputs lead to effective integration only if coincident within 5 ms. Summary data represent mean±SEM. -
FIG. 6 depicts spectrotemporal separation and combinatorial control: circuit modulation and emergent patterns in altered E/I states under ongoing synaptic activity. (a) Experimental paradigm for SSFO activation of PV neurons and C1V1 activation in pyramidal neurons. (b) Voltage clamp recording at 0 mV from a pyramidal neuron in an acute slice preparation from a PV::Cre mouse expressing CaMKIIa::C1V1(E162T) and DIO-SSFO. SSFO and C1V1 are activated by a blue light pulse (2) and IPSC frequency is increased by sustained SSFO activity (3; compare upper and lower traces in inset for pre- and post-activation IPSC activity). A sustained yellow light pulse deactivates SSFO and activates C1V1 and transiently increases IPSC frequency (4). Population power spectra. (right) show gamma frequency activity during optical excitatory neuron activation (590 am pulse) that is increased during coactivation of excitatory and PV neurons (470 nm pulse). Diagrams below traces show predicted activity of C1V1 and SSFO during the experiment. (c) The observed gamma frequency peak was not dependent on prior 1W neuron stimulation via SSFO. (d) Summary IPSC frequencies from (b) and (c) at baseline and after the initial blue or orange pulse. Diagrams below traces show predicted activity of C1V1 and SSFO during the experiment. - This invention provides, inter alia, compositions comprising animal cells expressing light-activated chimeric proteins on their plasma membranes and methods of using the same to selectively depolarize excitatory or inhibitory neurons residing in the same microcircuit in the pre-frontal cortex. The inventors have developed chimeric proteins possessing unique physiochemical properties which for the first time permit experimental manipulation of cortical E/I elevations and the ability to monitor gamma oscillations in cortical slices. These unique light-sensitive chimeric proteins can be expressed in either excitatory or inhibitory neural circuits in the prefrontal cortex of nonhuman animals which can then be depolarized in response to light having particular wavelengths. Furthermore, brain slices from non-human animals containing cortical excitatory or inhibitory neurons expressing the chimeric light-sensitive proteins disclosed herein can be used to search for chemical compounds which can selectively inhibit the depolarization of either excitatory or inhibitory neurons residing within the same neural circuit.
- General Techniques
- The practice of the present invention will employ, unless otherwise indicated, conventional techniques of molecular biology, microbiology, cell biology, biochemistry, nucleic acid chemistry, and immunology, which are well known to those skilled in the art. Such techniques are explained fully in the literature, such as, Molecular Cloning: A Laboratory Manual, second edition (Sambrook et al., 1989) and Molecular Cloning: A Laboratory Manual, third edition (Sambrook and Russel, 2001), (jointly referred to herein as “Sambrook”); Current Protocols in Molecular Biology (F. M. Ausubel et al., eds., 1987, including supplements through 2001); PCR: The Polymerase Chain Reaction, (Mullis et al., eds., 1994); Harlow and Lane (1988) Antibodies, A Laboratory Manual, Cold Spring Harbor Publications, New York; Harlow and Lane (1999) Using Antibodies: A Laboratory Manual Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (jointly referred to herein as “Harlow and Lane”), Beaucage et al. eds., Current Protocols air Nucleic Acid Chemistry John Wiley & Sons, Inc., New York, 2000), Handbook of Experimental Immunology, 4th edition (D. M. Weir & C. C. Blackwell, eds., Blackwell Science Inc., 1987); and Gene Transfer Vectors for Mammalian Cells (J. M. Miller & M. P. Calos, eds., 1987).
- Definitions
- As used herein, the singular form “a”, “an”, and “the” includes plural references unless indicated otherwise.
- An “animal” can be a vertebrate, such as any common laboratory model organism, or a mammal. Mammals include, but are not limited to, humans, farm animals, sport animals, pets, primates, mice, rats, and other rodents.
- An “amino acid substitution” or “mutation” as used herein means that at least one amino acid component of a defined amino acid sequence is altered or substituted with another amino acid leading to the protein encoded by that amino acid sequence having altered activity or expression levels within a cell.
- A “chimeric protein” is a protein comprising one or more portions derived from one or more different proteins. Chimeric proteins may be produced by culturing a recombinant cell transfected with a nucleic acid that encodes the chimeric protein.
- It is intended that every maximum numerical limitation given throughout this specification includes every lower numerical limitation, as if such lower numerical limitations were expressly written herein. Every minimum numerical limitation given throughout this specification will include every higher numerical limitation, as if such higher numerical limitations were expressly written herein. Every numerical range given throughout this specification will include every narrower numerical range that falls within such broader numerical range, as if such narrower numerical ranges were all expressly written herein.
- V1 C1 Chimeric Proteins and Cells Expressing the Same
- In some aspects, the animal cells disclosed herein comprise a chimeric light-sensitive protein, known as “C1V1,” which is derived from the VChR1 cation channel from Volvox carteri and the ChR1 cation channel from Chlamydomonas Reinhardti. The protein may be comprised of the amino acid sequence of VChR1, but additionally can have at least the first and second transmembrane helices of the VChR1 polypeptide replaced by the corresponding first and second transmembrane helices of ChR1. C1V1 chimeric opsin proteins are assembled from pieces of other opsin proteins that do not express well alone in neurons and which are potent, redshifted, and stable channelrhodopsins. In some embodiments, the animal cell may express a second light-activated protein on the plasma membrane of the cell. The second light-activated protein can be capable of mediating a hyperpolarization of the cell plasma membrane in response to activation by light. Examples of light-activated proteins capable of mediating a hyperpolarization of the cell plasma membrane can be found, for example, in International Patent Application No: PCT/US2011/028893, the disclosure of which is incorporated by reference herein in its entirety.
- Embodiments of the present disclosure may also be directed toward modified or mutated versions of C1V1. These proteins can be used alone or in combination with a variety of other opsins to assert optical control over neurons. In particular, the use of modified C1V1, in connection with other opsins, is believed to be useful for optical control over nervous system disorders. Specific uses of C1V1 relate to optogenetic systems or methods that correlate temporal, spatial and/or cell type-specific control over a neural circuit with measurable metrics.
- V1C1 Chimeric Proteins
- Provided herein are light-activated chimeric proteins expressed on an animal cell plasma membrane. In some aspects the light-activated protein is a chimeric protein derived from VChR1 from Volvox carteri and ChR1 from Chlamydomonas reinhardti. In some embodiments, the chimeric protein comprises the amino acid sequence of VChR1 having at least the first and second transmembrane helices replaced by the corresponding first and second transmembrane helices of ChR1. In other embodiments, the chimeric protein comprises the amino acid sequence of VChR1 having the first and second transmembrane helices replaced by the corresponding first and second transmembrane helices of ChR1 and further comprises at least a portion of the intracellular loop domain located between the second and third transmembrane helices replaced by the corresponding portion from ChR1. In some embodiments, the entire intracellular loop domain between the second and third transmembrane helices of the chimeric light-activated protein can be replaced with the corresponding intracellular loop domain from ChR1. In other embodiments, the portion of the intercellular loop domain located between the second and third transmembrane helices that is replaced with the corresponding portion of ChR1 can extend to A145 of SEQ ID NO:1. In other embodiments, the chimeric protein comprises the amino acid sequence of VChR1 having the first and second transmembrane helices and the intracellular loop domain replaced by the corresponding first and second transmembrane helices and intracellular loop domain of ChR1 and further comprises at least a portion of the third transmembrane helix replaced by the corresponding portion of ChR1. In another embodiment, the portion of the third transmembrane helix replaced by the corresponding portion from ChR1 can extend to W163 of SEQ ID NO:1. In some embodiments, the light-activated chimeric protein comprises the amino acids 1-145 of ChR1 and amino acids 102-316 of VChR1. In some embodiments, the light-activated chimeric protein comprises the amino acids 1-162 of ChR1 and amino acids 119-316 of VChR1. In some embodiments, the light-activated chimeric protein can comprise an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 1 without the signal peptide sequence. In some embodiments, the light-activated chimeric protein can comprise an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 1
- In other embodiments, the light activated chimeric protein is capable of mediating a depolarizing current in the cell when the cell is illuminated with light. In some embodiments the light can be green light. In other embodiments, the light can have a wavelength of between about 540 nm to about 560 nm. In some embodiments, the light can have a wavelength of about 542 nm. In some embodiments, the chimeric protein may not be capable of mediating a depolarizing current in the cell when the cell is illuminated with violet light. In some embodiments, the chimeric protein may not be capable of mediating a depolarizing current in the cell when the cell is illuminated with light having a wavelength of 405 nm.
- In some embodiments, the protein can further comprise a C-terminal fluorescent protein. In some specific embodiments, the C-terminal fluorescent protein can be enhanced yellow fluorescent protein (EYFP), green fluorescent protein (GFP), cyan fluorescent protein (CFP), or red fluorescent protein (RFP). In some embodiments, the light-activated chimeric protein is modified by the addition of a trafficking signal (ts) which enhances transport of the protein to the cell plasma membrane. In some embodiments, the trafficking signal is derived from the amino acid sequence of the human inward rectifier potassium channel Kir2.1. In some embodiments, the trafficking signal comprises the amino acid sequence KSRITSEGEYIPLDQIDINV. In some embodiments, the signal peptide sequence in the protein may be replaced with a different signal peptide sequence.
- In some embodiments, the animal cell can be a neuronal cell, a muscle cell, or a stem cell. In one embodiment, the animal cell is a neuronal cell. In some embodiments the neuronal cell can be an excitatory neuron located in the pre-frontal cortex of a non-human animal. In other embodiments, the excitatory neuron can be a pyramidal neuron. In still other embodiments, the inhibitory neuron can be a parvalbumin neuron. In some embodiments the neuronal cell can be an inhibitory neuron located in the pre-frontal cortex of a non-human animal. In some embodiments the neuronal cell can be an inhibitory neuron located in the pre-frontal cortex of a non-human animal.
- In some embodiments, the animal cells can further comprise a second light-activated protein expressed on the cells' plasma membrane. In some embodiments, the second light-activated protein can be capable of mediating a hyperpolarizing current in the cell when the cell is illuminated with light. In some embodiments the second light-activated protein can be NpHr, eNpHr2.0, eNpHr3.0, eNpHr3.1 or GtR3. Additional information regarding other light-activated cation channels, anion pumps, and proton pumps can be found in U.S. Patent Application Publication Nos: 2009/0093403; and International Patent Application No: PCT/US2011/028893, the disclosures of which are hereby incorporated by reference herein in their entirety. In some embodiments, the light-activated chimeric protein can have enhanced photocurrents in neural cells exposed to light relative to cells expressing other light-activated cation channel proteins. In some embodiments, the enhancement in photocurrent provided by the light-activated chimeric protein can be any of 1 fold, 2 fold, 3 fold, 4 fold, 5 fold, 6 fold, 7 fold, 8 fold, 9 fold, 10 fold, 11 fold, 12 fold, 13 fold, 14 fold, or 15 fold, greater than cells expressing other light-activated cation channel proteins, inclusive.
- Also provided herein is one or more light-activated proteins expressed on an animal cell plasma membrane, wherein said one or more light activated proteins comprises a core amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 1, 3, 5, 7, 9, 11, 12, 13, or 14 and further comprising a trafficking signal (e.g., which enhances transport to the plasma membrane). The trafficking signal may be fused to the C-terminus of the core amino acid sequence or may be fused to the N-terminus of the core amino acid sequence. In some embodiments, the trafficking signal can be linked to the core amino acid sequence by a linker. The linker can comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length. The linker may further comprise a fluorescent protein, for example, but not limited to, an enhanced yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein. In some embodiments, the trafficking signal can be derived from the amino acid sequence of the human inward rectifier potassium channel Kir2.1. In some embodiments, the trafficking signal can comprise the amino acid sequence KSRITSEGEYIPIDQIDINV.
- V1C1 Chimeric Mutant Variants
- In some aspects, the invention includes polypeptides comprising substituted or mutated amino acid sequences, wherein the mutant polypeptide retains the characteristic light-activatable nature of the precursor C1V1 chimeric polypeptide but may also possess altered properties in some specific aspects. For example the mutant light-activated chimeric proteins described herein may exhibit an increased level of expression both within an animal cell or on the animal cell plasma membrane; an altered responsiveness when exposed to different wavelengths of light, particularly red light; and/or a combination of traits whereby the chimeric C1V1 polypeptide possess the properties of low desensitization, fast deactivation, low violet-light activation for minimal cross-activation with other light-activated cation channels, and/or strong expression in animal cells.
- Light-activated chimeric proteins comprising amino acid substitutions or mutations include those in which one or more amino acid residues have undergone an amino acid substitution while retaining the ability to respond to light and the ability to control the polarization state of a plasma membrane. For example, light-activated proteins comprising amino acid substitutions or mutations can be made by substituting one or more amino acids into the amino acid sequence corresponding to SEQ ID NO:1. In some embodiments, the invention includes proteins comprising altered amino acid sequences in comparison with the amino acid sequence in SEQ ID NO:1, wherein the altered light-activated chimeric protein retains the characteristic light-activated nature and/or the ability to regulate ion flow across plasma membranes of the protein with the amino acid sequence represented in SEQ ID NO:1 but may have altered properties in some specific aspects.
- Amino acid substitutions in a native protein sequence may be conservative or non-conservative and such substituted amino acid residues may or may not be one encoded by the genetic code. The standard twenty amino acid “alphabet” is divided into chemical families based on chemical properties of their side chains These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and side chains having aromatic groups (e.g., tyrosine, phenylalanine, tryptophan, histidine). A “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a chemically similar side chain (i.e., replacing an amino acid possessing a basic side chain with another amino acid with a basic side chain). A “non-conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a chemically different side chain (i.e., replacing an amino acid having a basic side chain with an amino acid having an aromatic side chain). The amino acid substitutions may be conservative or non-conservative. Additionally, the amino acid substitutions may be located in the C1V1 retinal binding pocket, in one or more of the C1V1 intracellular loop domains, and/or in both the retinal binding pocket or the intracellular loop domains.
- Accordingly, provided herein are C1V1 chimeric light-activated proteins that may have specific amino acid substitutions at key positions throughout the retinal binding pocket of the VChR1 portion of the chimeric polypeptide. In some embodiments, the C1V1 protein can have a mutation at amino acid residue E122 of SEQ ID NO:1. In some embodiments, the C1V1 protein can have a mutation at amino acid residue E162 of SEQ ID NO:1. In other embodiments, the C1V1 protein can have a mutation at both amino acid residues E162 and E122 of SEQ ID NO:1. In some embodiments, each of the disclosed mutant C1V1 chimeric proteins can have specific properties and characteristics for use in depolarizing the membrane of an animal cell in response to light.
- C1V1-E122 Mutant Polypeptides
- Provided herein are the light-activated C1V1 chimeric proteins disclosed herein expressed on an animal cell plasma membrane, wherein one or more amino acid residues have undergone an amino acid substitution while retaining C1V1 activity (i.e., the ability to catalyze the depolarization of an animal cell in response to light activation), and Wherein the mutation can be at a glutamic acid residue corresponding to E122 of SEQ ID NO:1 (C1V1-E122). In some embodiments, the C1V1-E122 mutant chimeric light-activated protein comprises substitutions introduced into the amino acid sequence shown in SEQ ID NO:1 at amino acid E122 that can result in the chimeric protein having increased sensitivity to light, increased sensitivity to particular wavelengths of light, and/or increased ability to regulate the polarization state of the plasma membrane of the cell relative to C 1V1 chimeric light-activated proteins that do not have a mutation at E122. In some embodiments, the mutation can be a conservative amino acid substitution. In some embodiments, the mutation can be a non-conservative amino acid substitution. In some embodiments, the mutation at amino acid residue E122 can be to threonine (C1V1-E122T). In other embodiments, the light-activated chimeric protein can comprise an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 3 without the signal peptide sequence. In other embodiments, the light-activated chimeric protein can comprise an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 3. In other embodiments, the C1V1-E122 mutant chimeric light-activated protein may be fused to a C-terminal trafficking signal. In some embodiments, the trafficking signal can be linked S to the C1V1-E122 mutant chimeric light-activated protein by a linker. The linker can comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length. The linker may further comprise a fluorescent protein, for example, but not limited to, an enhanced yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein. In some embodiments, the trafficking signal can be derived from the amino acid sequence of the human inward rectifier potassium channel Kir2.1. In some embodiments, the trafficking signal can comprise the amino acid sequence KSRITSEGEYIPLDQIDINV.
- In other embodiments, the C1V1-E122 chimeric protein is capable of mediating a depolarizing current in the cell when the cell is illuminated with light. In some embodiments the light can be green light. In other embodiments, the light can have a wavelength of between about 540 nm to about 560 nm. In some embodiments, the light can have a wavelength of about 546 nm. In other embodiments, the C1V1-E122 chimeric protein can mediate a depolarizing current in the cell when the cell is illuminated with red light. In some embodiments, the red light can have a wavelength of about 630 nm. In some embodiments, the C1V1-E122 chimeric protein may not be capable of mediating a depolarizing current in the cell when the cell is illuminated with violet light. In some embodiments, the chimeric protein may not be capable of mediating a depolarizing current in the cell when the cell is illuminated with light having a wavelength of 405 nm. In some embodiments, the animal cell can be a neuronal cell, a muscle cell, or a stern cell. In one embodiment, the animal cell can be a neuronal cell. In some embodiments the neuronal cell can be an excitatory neuron located in the pre-frontal cortex of a non-human animal. In other embodiments, the excitatory neuron can be a pyramidal neuron. In some embodiments the neuronal cell can be an inhibitory neuron located in the pre-frontal cortex of a non-human animal. In other embodiments, the excitatory neuron can be a pyramidal neuron. In still other embodiments, the inhibitory neuron can be a parvalbumin neuron. In some embodiments, the animal cells can farther comprise a second light-activated protein expressed on the cells' plasma membrane. In some embodiments, the second light-activated protein can be capable of mediating a hyperpolarizing current in the cell when the cell is illuminated with light. In some embodiments the second light-activated protein can be NpHr, eNpHr2.0, eNpHr3.0, eNpHr3.1 or GtR3.
- C1V1-E162 Mutant Polypeptides
- Provided herein are the light-activated C1V1 chimeric proteins disclosed herein expressed on an animal cell plasma membrane, wherein one or more amino acid residues have undergone an amino acid substitution while retaining C1V1 activity (i.e., the ability to catalyze the depolarization of an animal cell in response to light activation), wherein the mutation can be at a glutamic acid residue corresponding to E162 of SEQ ID NO:1 (C1V1-E162). In some embodiments, the C1V1-E162 mutant chimeric light-activated protein comprises substitutions introduced into the amino acid sequence shown in SEQ ID NO:1 at amino acid E162 that can result in the chimeric protein having increased sensitivity to light, increased sensitivity to particular wavelengths of light, and/or increased ability to regulate the polarization state of the plasma membrane of the cell relative to C1V1 chimeric light-activated proteins that do not have a mutation at E162. In some embodiments, the mutation can be a conservative amino acid substitution. In some embodiments, the mutation can be a non-conservative amino acid substitution. In some embodiments, the mutation at amino acid residue E162 can be to threonine (C1V1-E162T). In other embodiments, the light-activated chimeric protein can comprise an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 5 without the signal peptide sequence. In other embodiments, the light-activated chimeric protein can comprise an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 5. In other embodiments, the C1V1-E162 mutant chimeric light-activated protein may be fused to a C-terminal trafficking signal. In some embodiments, the trafficking signal can be linked to the C1V1-E162 mutant chimeric light-activated protein by a linker. The linker can comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length. The linker may further comprise a fluorescent protein, for example, but not limited to, an enhanced yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein. In some embodiments, the trafficking signal can be derived from the amino acid sequence of the human inward rectifier potassium channel Kir2.1. In some embodiments, the trafficking signal can comprise the amino acid sequence KSRITSEGEVIPLDQIDINV.
- In other embodiments, the C1V1-E162 chimeric protein is capable of mediating a depolarizing current in the cell when the cell is illuminated with light. In some embodiments the light can be green light. In other embodiments, the light can have a wavelength of between about 540 nm to about 535 nm. In some embodiments, the light can have a wavelength of about 542 nm. In other embodiments, the light can have a wavelength of about 530 nm. In some embodiments, the C1V1-E162 chimeric protein may not be capable of mediating a depolarizing current in the cell when the cell is illuminated with violet light. In some embodiments, the chimeric protein may not be capable of mediating a depolarizing current in the cell when the cell is illuminated with light having a wavelength of 405 nm. In some embodiments, the C1V1-E162 chimeric protein can further comprise a C-terminal fluorescent protein. In some embodiments, the animal cell can be a neuronal cell, a muscle cell, or a stem cell. In one embodiment, the animal cell can be a neuronal cell. In some embodiments the neuronal cell can be an excitatory neuron located in the pre-frontal cortex of a non-human animal. In other embodiments, the excitatory neuron can be a pyramidal neuron. In some embodiments the neuronal cell can be an inhibitory neuron located in the pre-frontal cortex of a non-human animal. In other embodiments, the excitatory neuron can be a pyramidal neuron. In still other embodiments, the inhibitory neuron can be a parvalbumin neuron. In some embodiments, the animal cells can further comprise a second light-activated protein expressed on the cells' plasma membrane. In some embodiments, the second light-activated protein can be capable of mediating a hyperpolarizing current in the cell when the cell is illuminated with light. In some embodiments the second light-activated protein can be NpHr, eNpHr2.0, eNpHr3.0, eNpHr3.1 or GtR3. In some embodiments, the C1V1-E162 light-activated chimeric protein can have an accelerated photocycle relative C1V1 proteins lacking mutations at E162 or relative to other light-activated cation channel proteins. In some embodiments, the C1V1-E162 light-activated chimeric protein can have a photocycle more than 1 fold, 1.5 fold, 2 fold, 2.5 fold, 3 fold, 3.5 fold, 4 fold, 4.5 fold, or 5 fold faster than C1V1 proteins lacking mutations at E162 or relative to other light-activated cation channel proteins, inclusive.
- C1V1-E122/E162 Double Mutant Polypeptides
- Provided herein are the light-activated C1V1 chimeric proteins disclosed herein expressed on an animal cell plasma membrane, wherein one or more amino acid residues have undergone an amino acid substitution while retaining C1V1 activity (i.e., the ability to catalyze the depolarization of an animal cell in response to light activation), wherein the mutations can be at glutamic acid residues corresponding to E122 and E162 of SEQ ID NO:1 (C1V1-E122/E162). In some embodiments, the C1V1-E122/E162 mutant chimeric light-activated protein can comprise substitutions introduced into the amino acid sequence shown in SEQ NO:1 at amino acid E122 and E162 that can result in the chimeric protein having increased sensitivity to light, increased sensitivity to particular wavelengths of light, and/or increased ability to regulate the polarization state of the plasma membrane of the cell relative to C1V1 chimeric light-activated proteins that do not have a mutation at E122 and E162. In some embodiments, the mutations can be conservative amino acid substitutions. In some embodiments, the mutations can be non-conservative amino acid substitutions. In some embodiments, the mutations can be both conservative and non-conservative amino acid substitutions. In some embodiments, the mutation at amino acid residue E122 and at E162 can both be to threonine (C1V1-E122T/E162T). In other embodiments, the light-activated chimeric protein can comprise an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 7 without the signal peptide sequence. In other embodiments, the light-activated chimeric protein can comprise an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 7. In other embodiments, the C1V1-E122/E162 mutant chimeric light-activated protein may be fused to a C-terminal trafficking signal. In some embodiments, the trafficking signal can be linked to the C1V1-E122/E162 mutant chimeric light-activated protein by a linker. The linker can comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length. The linker may further comprise a fluorescent protein, for example, but not limited to, an enhanced yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein. In some embodiments, the trafficking signal can be derived from the amino acid sequence of the human inward rectifier potassium channel Kir2.1. In some embodiments, the trafficking signal can comprise the amino acid sequence KSRITSEGEYIPLDQIDINV.
- In other embodiments, the C1V1-E122/E162 chimeric protein is capable of mediating a depolarizing current in the cell when the cell is illuminated with light. In some embodiments the light can be green light. In other embodiments, the light can have a wavelength of between about 540 nm to about 560 nm. In some embodiments, the light can have a wavelength of about 546 nm. In some embodiments, the C1V1-E122/E162 chimeric protein may not be capable of mediating a depolarizing current in the cell when the cell is illuminated with violet light. In some embodiments, the chimeric protein may not be capable of mediating a depolarizing current in the cell when the cell is illuminated with light having a wavelength of 405 nm. In some embodiments, the C1V1-E122/E162 chimeric protein can exhibit less activation when exposed to violet light relative to C1V1 proteins lacking mutations at E122/E162 or relative to other light-activated cation channel proteins. In some embodiments, the animal cell can be a neuronal cell, a muscle cell, or a stem cell. In one embodiment, the animal cell can be a neuronal cell. In some embodiments the neuronal cell can be an excitatory neuron located in the pre-frontal cortex of a non-human animal. In other embodiments, the excitatory neuron can be a pyramidal neuron. In some embodiments the neuronal cell can be an inhibitory neuron located in the pre-frontal cortex of a non-human animal. In still other embodiments, the inhibitory neuron can be a parvalbumin neuron. In some embodiments, the animal cells can further comprise a second light-activated protein expressed on the cells' plasma membrane. In some embodiments, the second light-activated protein can be capable of mediating a hyperpolarizing current in the cell when the cell is illuminated with light. In some embodiments the second light-activated protein can be NpHr, eNpnr2.0, eNpHr3.0, eNpHr3.1 or GtR3. In some embodiments, the C1V1-E122/E162 mutant light-activated chimeric, protein can have decreased inactivation relative to C1V1 proteins lacking mutations at E 122/E162 or relative to other light-activated cation channel proteins. In some embodiments, the C1V1-E122/E162 mutant light-activated chimeric protein can inactivate by any of about 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, or 30% compared to C1V1 proteins lacking mutations at E122/E162 or relative to other light-activated cation channel proteins, inclusive. In some embodiments, the C1V1-E122/E162 light-activated chimeric protein can have a photocycle more than 1 fold, 1.5 fold, 2 fold, 2.5 fold, 3 fold, 3.5 fold, 4 fold, 4.5 fold, 5 fold. 5.5 fold, 6 fold, 6.5 fold, 7 fold, 7.5 fold, 8 fold, 8.5 fold, 9 fold, 9.5 fold, or 10 fold faster than C1V1 proteins lacking mutations at E 122/E162 or relative to other light-activated cation channel proteins, inclusive.
- Enhanced Intracellular Transport Amino Acid Motifs
- The present disclosure provides for the modification of light-activated chimeric proteins expressed in a cell by the addition of one or more amino acid sequence motifs which enhance transport to the plasma membranes of mammalian cells. Light-activated chimeric proteins having components derived from evolutionarily simpler organisms may not be expressed or tolerated by mammalian cells or may exhibit impaired subcellular localization when expressed at high levels in mammalian cells. Consequently, in some embodiments, the chimeric light-activated. protein expressed in a cell is fused to one or more amino acid sequence motifs selected from the group consisting of a signal peptide, an endoplasmic reticulum (ER) export signal, a membrane trafficking signal, and an N-terminal golgi export signal. The one or more amino acid sequence motifs which enhance light-activated chimeric protein transport to the plasma membranes of mammalian cells can be fused to the N-terminus, the C-terminus, or to both the N- and C-terminal ends of the light-activated protein. Optionally, the light-activated protein and the one or more amino acid sequence motifs may be separated by a linker. In some embodiments, the light-activated chimeric protein is modified by the addition of a trafficking signal (ts) which enhances transport of the protein to the cell plasma membrane. In some embodiments, the trafficking signal is derived from the amino acid sequence of the human inward rectifier potassium channel Kir2.1. In some embodiments, the trafficking signal comprises the amino acid sequence KSRITSEGEYIPLDQIDINV. Additional protein motifs which can enhance light-activated protein transport to the plasma membrane of a cell are described in U.S. patent application Ser. No. 12/041,628, which is incorporated herein by reference in its entirety. In some embodiments, the signal peptide sequence in the chimeric protein is deleted or substituted with a signal peptide sequence from a different protein.
- Animal Cells, Non-Human Animals, and Brain Slices
- Provided herein are cells comprising the light activated chimeric proteins disclosed herein. In some embodiments, the cells are animal cells. In some embodiments, the animal cells comprise the C1V1 protein corresponding to SEQ ID NO:1. In other embodiments, the animal cells comprise the mutant C1V1-E122T protein corresponding to SEQ ID NO:3. In other embodiments, the animal cells comprise the mutant C1V1-E162T protein corresponding to SEQ ID NO:5. In other embodiments, the animal cells comprise the mutant C1V1-E122T/E162T protein corresponding to SEQ ID NO7. In some embodiments, the animal cell can be a neuronal cell, a muscle cell, or a stem cell. In one embodiment, the animal cell can be a neuronal cell. In some embodiments the neuronal cell can be an excitatory neuron located in the pre-frontal cortex of a non-human animal in other embodiments, the excitatory neuron can be a pyramidal neuron. In some embodiments the neuronal cell can be an inhibitory neuron located in the pre-frontal cortex of a non-human animal. In still other embodiments, the inhibitory neuron can be a parvalbumin neuron.
- Also provided herein, are non-human animals comprising the light activated chimeric proteins disclosed herein expressed on the cell membrane of the cells in the animals. In some embodiments, the animal cells comprise the C1V1 protein corresponding to SEQ ID NO:1. In other embodiments, the animal cells comprise the mutant C1V1-E122T protein corresponding to SEQ ID NO:3. In other embodiments, the animal cells comprise the mutant C1V1-E162T protein corresponding to SEQ ID NO:5. In other embodiments, the animal cells comprise the mutant C1V1-E122T/E162T protein corresponding to SEQ ID NO7. In some embodiments, the animals comprising the light-activated chimeric proteins described herein are transgenically expressing said light-activated chimeric proteins. In other embodiments, the animals comprising the light-activated chimeric proteins described herein have been virally transfected with a vector carrying the light-activated protein such as, but not limited to, an adenoviral vector.
- Provided herein are living brain slices from a non-human animal comprising the light-activated chimeric proteins described herein expressed on the cell membrane of the cells in the slices. In some embodiments, the brain slices are from non-human animals transgenically expressing the light-activated chimeric proteins described herein. In other embodiments, the brain slices are from non-human animals that have been virally transfected with a vector carrying said light-activated protein such as, but not limited to, an adenoviral vector. In some embodiments, the brain slices are coronal brain slices. In some embodiments, the brain slices are any of about 100 μm, about 150 μm, about 200 μm, about 250 μm, about 300 μm, about 350 μm, about 400 μm, about 450 μm, or about 500 μm thick, inclusive, including any thicknesses in between these numbers.
- Isolated Polynucleotides
- Provided herein are isolated C1V1 polynucleotides that encode any chimeric polypeptides described herein that, for example, have at least one activity of a C1V1 polypeptide. The disclosure provides isolated, synthetic, or recombinant polynucleotides comprising a nucleic acid sequence having at least about 70%, e.g., at least about 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%; 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%, or complete (100%) sequence identity to the nucleic acid of SEQ ID NO:2, 4, 6 or 8 over a region of at least about 10, e.g., at least about 15, 20, 25, 30, 35, 40, 45, 50, 75, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, or 1000 nucleotid.es.
- The disclosure specifically provides a nucleic acid encoding C1V1 and/or a mutant variant thereof. For example, the disclosure provides an isolated nucleic acid molecule, wherein the nucleic acid molecule encodes: (1) a polypeptide comprising an amino acid sequence with at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO:1; (2) a polypeptide comprising an amino acid sequence with at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ NO:3, (3) a polypeptide comprising an amino acid sequence with at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO:5; or (4) a polypeptide comprising an amino acid sequence with at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99©% or 100% sequence identity to the amino acid sequence represented by SEQ ID NO:7.
- Promoters and Vectors
- The disclosure also provides expression cassettes and/or vectors comprising the above-described nucleic acids. Suitably, the nucleic acid encoding a chimeric protein of the disclosure is operably linked to a promoter, Promoters are well known in the art. Any promoter that functions in the host cell can be used for expression of C1V1 and/or any variant thereof of the present disclosure. Initiation control regions or promoters, which are useful to drive expression of a C1V1 chimeric protein or variant thereof in a specific animal cell are numerous and familiar to those skilled in the art. Virtually any promoter capable of driving these nucleic acids can be used.
- Specifically, where recombinant expression of C1V1 chimeric proteins in an excitatory neural cell is desired, a human calmodulin-dependent protein kinase II alpha (CaMKIIα) promoter may be used. In other embodiments, an elongation factor 1a (EF-1a) promoter in conjunction with a Cre-inducible recombinant AAV vector can be used with parvalbumin-Cre transgenic mice to target expression C1V1 chimeric proteins to inhibitory neurons.
- Also provided herein are vectors comprising the polynucleotides disclosed herein encoding a C1V1 chimeric polypeptide or any variant thereof. The vectors that can be administered according to the present invention also include vectors comprising a polynucleotide which encodes an RNA (e.g., RNAi, ribozymes, miRNA, siRNA) that when transcribed from the polynucleotides of the vector will result in the accumulation of light-activated chimeric proteins on the plasma membranes of target animal cells. Vectors which may be used, include, without limitation, lenkitiiral, HSV, and adenoviral vectors. Lentiviruses include, but are not limited to HIV-1, HIV-2, SIV, FIV and EIAV. Lentiviruses may be pseudotyped with the envelope proteins of other viruses, including, but not limited to VSV, rabies, Mo-MLV, baculovirus and Ebola. Such vectors may be prepared using standard methods in the art.
- In some embodiments, the vector is a recombinant AAV vector. AAV vectors are DNA viruses of relatively small size that can integrate, in a stable and sitespecific manner, into the genome of the cells that they infect. They are able to infect a wide spectrum of cells without inducing any effects on cellular growth, morphology or differentiation, and they do not appear to be involved in human pathologies. The AAV genome has been cloned, sequenced and characterized. It encompasses approximately 4700 bases and contains an inverted terminal repeat (ITR) region of approximately 145 bases at each end, which serves as an origin of replication for the virus. The remainder of the genome is divided into two essential regions that carry the encapsidation functions: the left-hand part of the genome, that contains the rep gene involved in viral replication and expression of the viral genes; and the right-hand part of the genome, that contains the cap gene encoding the capsid proteins of the virus.
- The application of AAV as a vector for gene therapy has been rapidly developed in recent years. Wild-type AAV could infect, with a comparatively high titer, dividing or non-dividing cells, or tissues of mammal, including human, and also can integrate into in human cells at specific site (on the long arm of chromosome 19) (Kotin, R. M., et al, Proc. Natl. Acad. Sci. USA 87: 2211-2215, 1990) (Samulski, R. J, et al, EMBO J. 10: 3941-3950, 1991 the disclosures of which are hereby incorporated by reference herein in their entireties). AAV vector without the rep and cap genes loses specificity of site-specific integration, but may still mediate long-term stable expression of exogenous genes. AAV vector exists in cells in two forms, wherein one is episomic outside of the chromosome; another is integrated into the chromosome, with the former as the major form. Moreover, AAV has not hitherto been found to be associated with any human disease, nor any change of biological characteristics arising from the integration has been observed. There are sixteen serotypes of AAV reported in literature, respectively named. AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, AAV13, AAV14, AAV15, and AAV16, wherein AAV5 is originally isolated from humans (Bantel-Schaal, and H. zur Hausen. 1984. Virology 134: 52-63), while AAV1-4 and AAV6 are all found in the study of adenovirus (Ursula Bantel-Schaal, Hajo Delius and Harald zur Hausen. J. Virol. 1999, 73: 939-947).
- AAV vectors may be prepared using standard methods in the art. Adeno-associated viruses of any serotype are suitable (See, e.g., Blacklow, pp. 165-174 of “Parvoviruses and Human Disease” J. R. Pattison, ed. (1988); Rose, Comprehensive Virology 3:1, 1974; P. Tattersall “The Evolution of Parvovirus Taxonomy” In Parvoviruses (J R Kerr, S F Cotmore, M E, Bloom, R M Linden, C R Parrish, Eds.) p5-14, Hudder Arnold, London, UK (2006); and D E Bowles, J E Rabinowitz, R J Samulski “The Genus Dependovirus” (J R Kerr, S F Cotmore, M E Bloom, R M Linden, C R Parrish, Eds.) p15-23, Hudder Arnold, London, UK (2006), the disclosures of which are hereby incorporated by reference herein in their entireties). Methods for purifying for vectors may be found in, for example, U.S. Pat. Nos. 6,566,118, 6,989,264, and 6,995,006 and WO/1999/011764 titled “Methods for Generating High Titer Helper-free Preparation of Recombinant AAV Vectors”, the disclosures of which are herein incorporated by reference in their entirety. Preparation of hybrid vectors is described in, for example, PCT Application No. PCT/US2005/027091, the disclosure of which is herein incorporated by reference in its entirety. The use of vectors derived from the AAVs for transferring genes in vitro and in vivo has been described (See e.g., International Patent Application Publication Nos: 91/18088 and WO 93/09239; U.S. Pat. Nos: 4,797,368, 6,596,535, and 5,139,941; and European Patent No: 0488528, all of which are herein incorporated by reference in their entirety). These publications describe various AAV-derived constructs in which the rep and/or cap genes are deleted and replaced by a gene of interest, and the use of these constructs for transferring the gene of interest in vitro (into cultured cells) or in vivo (directly into an organism). The replication defective recombinant AAVs according to the invention can be prepared by co-transfecting a plasmid containing the nucleic acid sequence of interest flanked by two AAV inverted terminal repeat (ITR) regions, and a plasmid carrying the AAV encapsidation genes (rep and cap genes), into a cell line that is infected with a human helper virus (for example an adenovirus). The AAV recombinants that are produced are then purified by standard techniques.
- In some embodiments, the vector(s) for use in the methods of the invention are encapsidated into a virus particle (e.g. AAV virus particle including, but not limited to, AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, AAV13, AAV14, AAV15, and AAV16). Accordingly, the invention includes a recombinant virus particle (recombinant because it contains a recombinant polynucleotide) comprising any of the vectors described herein. Methods of producing such particles are known in the art and are described in U.S. Pat. No. 6,596,535.
- For the animal cells described herein, it is understood that one or more vectors may be administered to neural cells, heart cells, or stem cells. If more than one vector is used, it is understood that they may be administered at the same or at different times to the animal cell.
- Methods of the Invention
- Provided herein are methods for selectively depolarizing excitatory or inhibitory neurons residing in the same microcircuit by expressing in those neurons the light-activated chimeric proteins described herein. In some embodiments, a first light-activated protein, such as those disclosed herein, can be expressed in an excitatory neuron while a second light-activated protein can be expressed in an inhibitory neuron. In some embodiments, the first light-activated protein expressed in the excitatory neuron can be activated by a different wavelength of light than the second light-activated protein expressed in the inhibitory neuron. In some embodiments, the first and second light-activated proteins can be expressed in a living non-human animal or in a living brain slice from a non-human animal.
- In other embodiments, a method is provided for identifying a chemical compound that selectively inhibits the depolarization of excitatory or inhibitory neurons residing in the same neural circuit by expressing in those neurons the light-activated chimeric proteins described herein. In some embodiments, a first light-activated protein can be expressed in an excitatory neuron while a second light-activated protein can be expressed in an inhibitory neuron. In some embodiments, the first light-activated protein expressed in the excitatory neuron can be activated by a different wavelength of light than the second light-activated protein expressed in the inhibitory neuron. In some embodiments, the first and second light-activated proteins can be expressed in a living non-human animal or in a living brain slice from a non-human animal.
- Methods for Selectively Altering the E/I Balance in Neurons Residing in the Same Microcircuit
- In some aspects, there is provided a method for selectively depolarizing excitatory or inhibitory neurons residing in the same microcircuit, the method comprising: selectively depolarizing an excitatory neuron comprising a first light-activated protein, wherein the first light-activated protein is depolarized when exposed to light having a first wavelength or selectively depolarizing an inhibitory neuron comprising a second light-activated protein, wherein the second light-activated protein is depolarized when exposed to light having a second wavelength. In some embodiments, the first light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO: 1. In other embodiments, the first light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO: 3. In some embodiments, the first light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO: 5. In some embodiments, the second light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO:11. In some embodiments, the second light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO:12. In some embodiments, the second light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO: 13. In some embodiments, the second light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO: 14. More information regarding the disclosure of other light-activated cation channels can be found in U.S. Patent Application Publication No: 2007/0054319; U.S. Patent Application No. 61/410,704; and International Patent Application Publication No: WO 2010/056970, the disclosures of each of which are hereby incorporated by reference in their entireties.
- In other aspects, there is provided a method for selectively depolarizing excitatory or inhibitory neurons residing in the same microcircuit, the method comprising: expressing a first light-activated protein in an excitatory neuron; and expressing a second light-activated protein in an inhibitory neuron, wherein the first light-activated protein is independently depolarized when exposed to light having a first wavelength and wherein the second light-activated protein is independently depolarized when exposed to light having a second wavelength. In some embodiments, the first light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO: 1. In other embodiments, the first light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO: 3. In some embodiments, the first light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO: 5. In some embodiments, the second light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO:11. In some embodiments, the second light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO:12. In some embodiments, the second light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO:13. In some embodiments, the second light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO:14.
- In some embodiments, the first light-activated protein can be activated by green light. In one embodiment, the first light-activated protein can be activated by light having a wavelength of about 560 nm. In one embodiment, the first light-activated protein can be activated by red light. In another embodiment, the first light-activated protein can be activated by light having a wavelength of about 630 nm. In other embodiments, the second light-activated protein can be activated by violet light. In one embodiment, the second light-activated protein can be activated by light having a wavelength of about 405 nm. In other embodiments, the second light activated protein can be activated by green light. In some embodiments, the light-activated proteins are activated by light pulses that can have a duration for any of about 1 millisecond (ms), about 2 ms, about 3, ms, about 4, ms, about 5 ms, about 6 ms, about 7 ms, about 8 ms, about 9 ms, about 10 ms, about 15 ms, about 20 ms, about 25 ms, about 30 ms, about 35 ms, about 40 ms, about 45 ms, about 50 ms, about 60 ms, about 70 ms, about 80 ms, about 90 ms, about 100 ms, about 200 ms, about 300 ms, about 400 ms, about 500 ms, about 600 ms, about 700 ms, about 800 ms, about 900 ms, about 1 sec, about 1.25 see, about 1.5 sec, or about 2 sec, inclusive, including any times in between these numbers. In some embodiments, the light-activated proteins are activated by light pulses that can have a light power density of any of about 0.05 mW mm−2, about 0.1 mW mm−2, about 0.25 mW mm−2, about 0.5 mW mm−2, about 0.75 mW mm−2, about 1 mW mm−2, about 2 mW mm−2, about 3 mW mm−2, about 4 mW mm−2, about 5 mW mm−2, about 6 mW mm−2, about 7 mW mm−2, about 8 mW mm−2, about 9 mW mm−2, about 10 mW mm−2, about 11 mW mm−2, about 12 mW mm−2, about 13 mW mm−2, about 14 mW mm−2, about mW mm−2, about 16 mW mm−2, about 17 mW mm−2, about 18 mW mm−2, about 19 mW mm−2, about 20 mW mm−2, about 21 mW mm−2, about 22 mW mm−2, about 23 mW mm−2, about 24 mW mm−2, or about 25 mW mm−2, inclusive, including any values between these numbers. In some embodiments the neuronal cell can be an excitatory neuron located in the pre-frontal cortex of a non-human animal. In other embodiments, the excitatory neuron can be a pyramidal neuron. In some embodiments the neuronal cell can be an inhibitory neuron located in the pre-frontal cortex of a non-human animal. In still other embodiments, the inhibitory neuron can be a parvalbumin neuron. In some embodiments, the inhibitory and excitatory neurons can be in a living non-human animal. In other embodiments, the inhibitory and excitatory neurons can be in a brain slice from a non-human animal.
- Methods for Identifying a Chemical Compound that Selectively Alters the E/I Balance in Neurons Residing in the Same Microcircuit
- In some aspects, there is provided a method for identifying a chemical compound that selectively inhibits the depolarization of excitatory or inhibitory neurons residing in the same microcircuit, the method comprising: (a) selectively depolarizing an excitatory neuron comprising a first light-activated protein with light having a first wavelength or selectively depolarizing an inhibitory neuron comprising a second light-activated protein with light having a second wavelength; (b) measuring an excitatory post synaptic potential (EPSP) in response to selectively depolarizing the excitatory neuron comprising a first light-activated protein or measuring an inhibitory post synaptic current (IPSC) in response to selectively depolarizing an inhibitory neuron comprising a second light-activated protein; (c) contacting the excitatory neuron or the inhibitory neuron with a chemical compound; (d) measuring the excitatory post synaptic potential (EPSP) or measuring the inhibitory post synaptic current (IPSC) to determine if contacting either the excitatory neuron or the inhibitory neuron with the chemical compound selectively inhibits the depolarization of either neuron. In some embodiments, the first light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO: 1. In other embodiments, the first light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO: 3. In some embodiments, the first light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO: 5. In some aspects, the second light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence showm in SEQ ID NO:11. In some embodiments, the second light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO:12. In some embodiments, the second light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO:13. In some embodiments, the second light-activated protein can comprise a protein at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence shown in SEQ ID NO:14. In some embodiments, the chemical compound can be a member of a combinatorial chemical library. In other embodiments, the method farther comprises assaying the chemical compound to determine if it adversely affects the function of cardiac tissue or the cardiac action potential in mammals.
- In some embodiments, the first light-activated protein can be activated by green light. In one embodiment, the first light-activated protein can be activated by light having a wavelength of about 560 nm. In one embodiment, the first light-activated protein can be activated by red light. In another embodiment, the first light-activated protein can be activated by light having a wavelength of about 630 nm. In other embodiments, the second light-activated protein can be activated by violet light. In one embodiment, the second light-activated protein can be activated by light having a wavelength of about 405 nm. In some embodiments, the light-activated proteins can be activated by light pulses that can have a duration for any of about 1 millisecond (ms), about 2 ms, about 3, ms, about 4, ms, about 5 ms, about 6 ms, about 7 ms, about 8 ms, about 9 ms, about 10 ms, about 15 ms, about 20 ms, about 25 ms, about 30 ms, about 35 ms, about 40 ms, about 45 ms, about 50 ms, about 60 ms, about 70 ms, about 80 ms, about 90 ms, about 100 ms, about 200 ms, about 300 ms, about 400 ms, about 500 ms, about 600 ms, about 700 ms, about 800 ms, about 900 ms, about 1 sec, about 1.25 sec, about 1.5 sec, or about 2 sec, inclusive, including any times in between these numbers. In some embodiments, the light-activated proteins can be activated by light pulses that can have a light power density of any of about 0.05 mW mm−2, about 0.1 mW mm−2, about 0.25 mW mm−2, about 0.5 mW mm−2, about 0.75 mW mmm−2, about 1 mW mm−2, about 2 mW mm−2, about 3 mW mm−2, about 4 mW min−2, about 5 mW mm−2, about 6 mW mm−2, about 7 mW mm−2, about 8 mW mm−2, about 9 mW mm−2, about 10 mW mm−2, about 11 mW mm−2, about 12 mW mm−2, about 13 mW mm−2, about 14 mW mm−2, about mW mm−2, about 16 mW mm−2, about 17 mW mm−2, about 18 mW mm−2, about 19 mW mm−2, about 20 mW mm−2, about 21 mW mm−2, about 22 mW mm−2, about 23 mW mm−2, about 24 mW mm−2, or about 25 mW mm−2, inclusive, including any values between these numbers. In some embodiments the neuronal cell can be an excitatory neuron located in the pre-frontal cortex of a non-human animal. In other embodiments, the excitatory neuron can be a pyramidal neuron. In some embodiments the neuronal cell can be an inhibitory neuron located in the pre-frontal cortex of a non-human animal. In still other embodiments, the inhibitory neuron can be a parvalbumin neuron. In some embodiments, the inhibitory and excitatory neurons can be in a living non-human animal. In other embodiments, the inhibitory and excitatory neurons can be in a brain slice from a non-human animal.
- The present disclosure relates to a light-activated chimera opsin that modifies a membrane voltage when expressed therein. While the present disclosure is not necessarily limited in these contexts, various aspects of the disclosure may be appreciated through a discussion of examples using these and other contexts.
- Various embodiments of the present disclosure relate to a light-activated opsin modified for expression in cell membranes including mammalian cells. The opsin is derived from a combination of two different opsins, Volvox channelrhodopsin (VChR1) and Chlamydomonas reinhardtii channelrhodopsin (ChR1). The opsin can be useful for expressing at levels of a higher rate than either of the individual opsins from which it is derived.
- In certain more specific embodiments, the genetic sequence of ChR1/VChR1 chimera (C1V1) is primarily VChR1. Portions of the VChR1 sequence associated with trafficking arc replaced with homologous sequences from ChR1.
- Various embodiments relate to modification directed toward the addition of a trafficking signal to improve expression in mammalian cells.
- Certain aspects of the present disclosure are directed to further modified versions of C1V1. For example, certain embodiments include a mutation E162T to C1V1, which experiments suggest provides an accelerated photocycle (e.g., almost 3-fold).
- Various embodiments of the present disclosure relate to an optogenetic system or method that correlates temporal, spatial and/or cell-type-specific control over a neural circuit with measurable metrics. The optogenetic system uses a variety of opsins, including C1V1 and/or C1V1 variants, to assert control over portions of neural circuits. For instance, various metrics or symptoms might be associated with a neurological disorder. The optogenetic system targets a neural circuit within a patient for selective control thereof. The optogenetic system involves monitoring the patient for the metrics or symptoms associated with the neurological disorder. In this manner, the optogenetic system can provide detailed information about the neural circuit, its function and/or the neurological disorder.
- Consistent with the embodiments discussed herein, particular embodiments relate to studying and probing disorders using a variety of opsins. Other embodiments relate to the identification and/or study of phenotypes and endophenotypes. Still other embodiments relate to the identification of treatment targets.
- Aspects of the present disclosure are directed toward the artificial inducement of disorder/disease states on a fast-temporal time scale. The use of an opsin such as C1V1 can be particularly useful based on characteristics regarding an accelerated photocycle. Moreover, certain embodiments allow for reversible disease states, which can be particularly useful for establishing baseline/control points for testing and/or for testing the effects of a treatment on the same animal when exhibiting the disease state and when not exhibiting the disease state. The use of opsins such as C1V1 allows for the control of a cell using a light source. The C1V1 reacts to light, causing a change in the membrane potential of the cell. The removal of the light and the subsequent cessation of the activation of C1V1 allows for the cell to return to its baseline state. Various other possibilities exist, some of which are discussed in more detail herein.
- Various aspects of the present disclosure are directed to an E122T mutation of a C1V1 opsin. In certain embodiments of the present disclosure, the E122T mutation shifts maximum absorption of C1V1 or its variants toward the red light spectrum with respect to the un-mutated opsin.
- Various embodiments of the present disclosure relate to an opsin modified for expression in mammalian cells and shifted, with respect to ChR2, for maximum absorption in the green light spectrum. The C1V1 opsin is derived from a combination of opsins and expresses at a higher rate than either of the opsins from which it is derived. The opsin, C1V1, is derived from Volvox channelrhodopsin (VChR1) and Chlamydomonas reinhardtii channelrhodopsin (ChR1). The resulting opsin, C1V1 and its variants, have a maximum absorption at wavelengths between 530 nm and 546 nm.
- Certain aspects of the present disclosure are directed to further modified versions of C1V1. For example, certain embodiments include a mutation E122T, which shifts the maximum absorption of C1V1 towards the red light spectrum. Other modifications can include an additional mutation E162T, which experiments suggest provides an accelerated photocycle in addition to the red shift provided by the E122T mutation.
- In some embodiments, there is provided a transmembrane molecule derived from VChR1 and having the traffic sequences replaced with homologous sequences from ChR1. In some embodiments, the molecule further includes a mutation E122T. In other embodiments, the molecule further includes mutations at E162T and E122T. In certain embodiments, the molecule activates an ion channel in response to green light. In one embodiment, the molecule has a maximum light absorption of approximately 546 nm. In another embodiment, the molecule has a maximum light absorption of approximately 535 nm.
- In some embodiments, there is provided an animal cell comprising: an integrated exogenous molecule which expresses an ion channel that is responsive to red light; the exogenous molecule derived from VChR1 and including transmembrane traffic sequences thereof replaced by homologous sequences from aim. In some embodiments, the exogenous molecule further includes E122T. In other embodiments, the cell has a neural. firing ratio of about 14% to 94% in response to light having wavelengths of 405 nm and 560 nm, respectively. In other embodiments, the cell has a neural firing ratio of about 11% to 72% in response to light having wavelengths of 405 nm and 560 nm, respectively.
- Additional example embodiments of the present disclosure relate to the use of a hybrid ChR1/VChR1 chimera that contains no ChR2 sequence at all, is derived from two opsins genes that do not express well individually, and is herein referred to as C1V1. Embodiments of the present disclosure also relate to improvements of the membrane targeting of VChR1 through the addition of a membrane trafficking signal derived from the Kir2.1 channel. Confocal images from cultured neurons expressing VChR1-EYFP revealed a large proportion of intracellular protein compared with ChR2; therefore, membrane trafficking signal (ts) derived from the Kir2.1 channel was used to improve the membrane targeting of VChR1. Membrane targeting of this VChR1-ts-EYFP was slightly enhanced compared with VChR1-EYFP; however, mean photocurrents recorded from cultured hippocampal neurons expressing VCER1-ts-EYFP were only slightly larger than those of VChR1-EYFP. Accordingly, embodiments of the present disclosure relate to VChR1, which has been modified by exchanging helices with corresponding helices from other ChRs. For example, robust improvement has been discovered in two chimeras where
helices helices 2 and 3 (at ChR1 residue Ala145) or within helix 3 (at ChR1 residue Trp163), the resulting chimeras were both robustly expressed and showed similarly enhanced photocurrent and spectral properties. This result was unexpected as ChR1 is only weakly expressed and poorly integrated into membranes of most mammalian host cells. - Specific aspects of the present disclosure relate to microbial opsin genes adapted for neuroscience, allowing transduction of light pulse trains into millisecond-timescale membrane potential changes in specific cell types within the intact mammalian brain channelrhodopsin (ChR2), Volvox channelrhodopsin (VChR1) and halorhodopsin (NpHR)). ChR2 is a rhodopsin derived from the unicellular green algae Chlamydomonas reinhardtii. The term “rhodopsin” as used herein is a protein that comprises at least two building blocks, an opsin protein, and a covalently bound cofactor, usually retinal (retinaldehyde). The rhodopsin ChR2 is derived from the opsin Channelopsin-2 (Chop2), originally named Chlamyopsin-4 (Cop4) in the Chlamydomonas genome. The temporal properties of one depolarizing channelrhodopsin, ChR2, include fast kinetics of activation and deactivation, affording generation of precisely timed action potential trains. For applications seeking long timescale activation, it has been discovered that the normally fast off-kinetics of the channelrhodopsins can be slowed. For example, certain implementations of channelrhodopsins apply 1 mW/mm−2 light for virtually the entire time in which depolarization is desired, which can be less than desirable.
- Much of the discussion herein is directed to ChR2. Unless otherwise stated, the disclosure includes a number of similar variants. Examples include, but are not limited to, Chop2, ChR2-310, Chop2-310, and Volvox channelrhodopsin (VChR1). For further details on VChR1, reference can be made to “Red-shifted optogenetic excitation: a tool for fast neural control derived from Volvox carteri,” Nat Neurosci. June 2008, 11(6):631-3. Epub 2008 Apr. 23, the disclosure of which is fully incorporated herein by reference in its entirety. In other implementations, similar modifications can be made to other opsin molecules. For instance, modifications/mutations can be made to ChR2 or VChR1 variants. Moreover the modified variants can be used in combination with light-activated ion pumps.
- Embodiments of the present disclosure include relatively minor amino acid variants of the naturally occurring sequences. In one instance, the variants are greater than about 75% homologous to the protein sequence of the naturally occurring sequences. In other variants, the homology is greater than about 80%. Yet other variants have homology greater than about 85%, greater than 90%, or even as high as about 93% to about 95% or about 98%. Homology in this context means sequence similarity or identity, with identity being preferred. This homology can be determined using standard techniques known in sequence analysis. The compositions of embodiments of the present disclosure include the protein and nucleic acid sequences provided herein, including variants which are more than about 50% homologous to the provided sequence, more than about 55% homologous to the provided sequence, more than about 60% homologous to the provided sequence, more than about 65% homologous to the provided sequence, more than about 70% homologous to the provided sequence, more than about 75% homologous to the provided sequence, more than about 80% homologous to the provided sequence, more than about 85% homologous to the provided sequence, more than about 90% homologous to the provided sequence, or more than about 95% homologous to the provided sequence.
- As used herein, “stimulation of a target cell” is generally used to describe modification of the properties of the cell. For instance, the stimulus of a target cell may result in a change in the properties of the cell membrane that can lead to the depolarization or polarization of the target cell. In a particular instance, the target cell is a neuron and the stimulus affects the transmission of impulses by facilitating or inhibiting the generation of impulses (action potentials) by the neuron.
- For further details on light-activated opsins, reference can be made to PCT publication No. WO 2010/056970, entitled “Optically-Based Stimulation of Target Cells and Modifications Thereto,” to Deisseroth et al., which is fully incorporated herein by reference in its entirety
- In this example, a tool that would permit the driving of cortical E/I elevations and the monitoring of gamma oscillations in cortical slices, as well as in vivo in live animal experiments, was sought, with three key properties: 1) much higher potency to enable dose-response investigation; 2) low desensitization to allow for step-like changes in E/I balance; and 3) redshifted excitation to allow comparative drive of different populations within the same preparation.
- These experiments were initially attempted with VChR1, which displays both a redshift and reduced desensitization14, but previous investigation suggested that photocurrents in cells expressing VChR1 were small (−100-150 pA14), and did not elicit robust synaptic activity in downstream cells (not shown). Indeed, when first attempting to express VChR1 in cells, only small photocurrents were observed, (
FIG. 1A ) consistent with previous findings. Adding a membrane trafficking signal derived from the Kir2.1 channel to generate VchR1-is-EYFP delivered only a modest trend toward enhanced photocurrents compared with VChR1-EYFP (FIG. 1B ). However, noting that in ChR2, replacing transmembrane segments with the homologous region from ChR1 increased membrane targeting and enhanced photocurrents, it was hypothesized that a similar systematic exchange between the helices of VChR1 with the corresponding helices from other ChRs, might similarly result in enhanced membrane expression in HEK cells. - Materials and Methods
- Chimeric channelrhodopsin variant C1V1 was generated by fusing either a wild-type or human codon-optimized channelrhodopsin-1 with a human codon-adapted VChR1 (GenBank™ accession number ACD70142.1) by overlap extension PCR. C1V1 splice variants were generated by overlap PCR. Variant one contained the first 145 amino acids of ChR1 and amino acids 102 to 316 of VChR1. Variant two contained the first 162 amino acids of ChR1 and amino acids 119 to 316 of VChR1. The resultant chimeric PCR fragments were cloned into pECFP-N1 (Clonetech, Mountain View, Calif.) and into lentiviral expression vectors under the CaMKIIα promoter. The membrane trafficking signal was derived from the Kir2.1 channel. Mutations were confirmed by sequencing the coding sequence and splice sites. For AAV-mediated gene delivery, opsin-EYFP fusions along with the CaMKIIα promoter were subcloned into a modified version of the pAAV2-MCS vector. Cre-dependent opsin expression was achieved by cloning the opsin-EYFP cassette in the reverse orientation between pairs of incompatible lox sites (loxP and lox2722) to generate a double foxed inverted open reading frame (D10) under the control of the elongation factor 1a (EF-1α) promoter. All constructs are available from the Deisseroth Lab (www.optogenetics.org).
- HEK293 cells were cultured in Dulbecco's minimal essential medium supplemented with 10% fetal bovine serum, 2 mM glutamine (Biochrome, Berlin, Germany), and 1% (w/w) penicillin/streptomycin. Cells were seeded onto coverslips at a concentration of 0.175×106 cells/ml and supplemented with 1 μM all-trans retinal. Transient transfection was performed with Fugene 6 (Roche, Mannheim, Germany) and recordings were done 20-28 hours later. Photocurrents in transiently transfected HEK293 cells were recorded by conventional whole-cell patch-clamp. The external solution contained [mM]: 140 NaCl, 2 CaCl2, 2MgCl2, 2KCl, 10 HEPES (pH 7.2). The internal solution contained [mM]: 110 NaCl, 10 EGTA, 2MgCl2, 1CaCl2, 5KCl, 10 HEPES (pH was adjusted to 7.2 either using CsOH or HCl). Patch pipettes were pulled with micropipette puller model P-97 (Sutter Instrument Co., Novato, Calif.) from microhaematocrit-tubes (Hecht-Assistant, Sondheim, Germany) with 1.5-2 MΩ resistance. HEK cell whole-cell patch-clamping was performed with an EPC 7 (HEKA, Elektronik GmbH, Lambrecht, Germany) amplifier. Analog data was sampled at 20 kHz, digitized with Digidata1440 (Molecular Devices, Foster City, Calif.) and displayed using pClamp10.1 Software (Molecular Devices, Foster City, Calif.). For recording wavelength dependence, a light guide from a Polychrome V unit (TILL Photonics, Planegg, Germany) was mounted on the epiluminescence port of an Olympus IX70 microscope. For reflecting light into the objective a beam splitter (70% R/30% T) was used resulting in a final photon density of ˜1×1022 photons m−2 s−1 at 470 nm on the coverslip. For recording the action spectra only 50% of the light intensity was used. The polychrome V Unit was controlled with Tillvision Software (TILL Photonics, Planegg, Germany) synchronized with the pClamp Software.
- Results
- Interestingly, the most robust improvement in chimeras was found where
helix FIG. 1C-D ). Two chimeric ChR1-VChR1 channels for membrane targeting and photocurrent size were tested in cultured HEK293 cells. The first was joined in the second intracellular loop after Ala145 of ChR1, and the second was joined within helix three after Trp163 of ChR1 (FIG. 1C ). Whereas both variants were nearly equally well expressed in HEK293 cells (FIG. 1D ), in cultured neurons the second variant expressed more robustly (FIG. 1E ) and showed greatly enhanced peak photocurrents (888±128 pA, n=11 cells; p<0.0005) compared with VChR1-EYFP (FIG. 1B ). The action spectrum peak remained robustly redshifted relative to ChR2 (Table 1;FIG. 1F ), and the ionic selectivity of the chimera was similar to that previously reported for ChR2 and VChR1 (FIG. 1G ) Adding the Kir2.1 trafficking sequence to this hybrid trended to further increased photocurrents (1104±123 pA, n=12 cells; p<0.0005 compared with VChR1-EYFP, p=0.23 compared with C1V1-EYFP;FIG. 1B ; Tables 1-2). The resulting hybrid ChR1/VChR1 chimera contains no ChR2 sequence at all, is remarkably derived from two opsin genes that do not express well alone, and is here referred to as C1V1 (FIGS. 1A , H). - Fast deactivation properties28 of this redshifted opsin would be required for maximal temporal as well as spectral separation from other opsins that are activated by wavelengths located towards the blue end of the visible spectrum. However, it was found that the photocurrents displayed by C1V1-ts-EYFP exhibited >10-fold slower decay than ChR2, and even slower decay than the original VChR1 (
FIG. 2A ; Toff 156±12 ms and 132±12 ms for C1V1 -ts-EYFP (n=4) and VChR1-EYFP (n=5), respectively; Table 1), potentially precluding the use of C1V1 for applications requiring rapid firing rates. To correct the photocurrent kinetics of C1V1, the chromophore region was searched using known structural models22,28 (FIG. 1H ) for mutations with faster photocycle kinetics, reduced inactivation and reduced blue absorption. Next, glutamate-122 was mutated to threonine, based on studies of the glutamate-rich motif inhelix 2 showing that this mutation reduces inactivation.3 - Materials and Methods
- All point mutations in C1V1 vectors were generated in the plasmids by site-directed mutagenesis (Agilent Technologies, Palo Alto, Calif.). The membrane trafficking signal was derived from the Kir2.1 channel. Mutations were confirmed by sequencing the coding sequence and splice sites.
- Results
- The ChETA-homologous mutation E162T28 markedly accelerated the photocycle almost 3-fold Toff 58±4.7 ms, n=7 cells;
FIG. 2A , Table 1). Surprisingly, whereas analogous mutations in ChR2 or other microbial opsins have caused a redshift28,29, in C1V1 this mutation shifted the action spectrum in the undesired direction, hypsochromic to 530 run (FIG. 1F ; Table 1). C1V1-E122T inactivated only by 26% compared to 46% deactivation of ChR2 (FIG. 2B , Table 1); in addition, the spectrum was further red-shifted to 546 nm (FIG. 1F , Table 1) and showed a striking loss of the problematic blue shoulder of the C1V1 action spectrum. Finally, in the double mutant E122T/E162T, inactivation of the current was even lower than in the E122T mutant and the photocycle was still faster compared to E162T Toff 34±4.9 ms, n=7 cells;FIG. 2A ,FIG. 2C , Table 1), while preserving the redshift and absence of the blue shoulder of the action spectrum. Moreover, While the E122 mutant severely reduced photocurrent amplitude (FIG. 2D , the double mutant restored the very high currents characteristic of the original C1V1-ts. Thus, multiple surprising and useful properties of the individual mutations were conserved in the double mutant, trafficking-enhanced C1V1 chimera. -
TABLE 1 Spectral/kinetic properties of ChR2, VChR1 and C1V1 variants. Peak activation wavelength was recorded in HEK cells using 2 ms light pulses at the peak activation wavelength. Deactivation kinetics (τoff) and peak photocurrents were recorded in cultured hippocampal neurons using 2 ms light pulses at the maximal activation wavelength. To identify the optimal variants for combinatorial activation with ChR2, the percent response at 405 nm and 560 nm was recorded in HEK cells. Desensitization of the photocurrent was recorded using 300 ms light pulses, quantifying the decay of the peak photocurrent (Imax) to the steady state. Absorption Toff Kinetics Peak current (pA) Ratio Desensitation maximum (nm) pH 7.2 (ms) at −60 Mv* 405/560 % ChR2 460 ± 6 (N = 5) 10 ± 1 (N = 5) 816 ± 181 (N = 5) 60%:8% 65 ± 8 (N = 5) (N = 7) VChR1 543 ± 7 (N = 7) 85 ± 11 (N = 6) 284 ± 54 (N = 5) 9%:82% 53 ± 10 (N = 18) (N = 7) C1V1 539 ± 4 (N = 10) 60 ± 6 (N = 6) 1035 ± 158 (N = 6) 28%:86% 46 ± 12 (N = 14) (N = 10) C1V1(E162T) 530 ± 4 (N = 6) 23 ± 5 (N = 4) 1183 ± 53 (N = 6) 20%:71% 41 ± 12 (N = 7) (N = 6) C1V1(E122T) 546 ± 5 (N = 4) 55 ± 8 (N = 5) 572 ± 21 (N = 5) 14%:94% 26 ± 6 (N 4) (N = 4) C1V1(E122T, 535 ± 5 (N = 7) 12 ± 1 (N = 5) 1072 ± 89 (N = 9) 11%:72% 11 ± 9 (N = 9) E162T) (N = 7) -
TABLE 2 Summary of p-values from unpaired t-test comparisons for peak photocurrent amplitude across all opsins shown in Table 1. Photocurrents were recorded in cultured neurons using a 2 ms light pulse at 540 nm (VChR1 and C1V1 variants) or 470 nm (ChR2(H134R)). C1V1 C1V1 VchR1- VChR1-ts- C1V1- C1V1-ts- (E162T)- (E162T/E122T)- ChR2(H134R)- YFP YFP YFP YEP ts-Y ts-YFP YFP 1.0000 0.5770 0.0188 0.0029 6.5E−06 1.1E−05 0.0448 VChr1-YFP 1.0000 0.266 0.0039 1.1E−06 0.0015 0.0579 VChR1-ts-YFP 1.0000 0.3372 0.0399 0.0788 0.8175 C1V1-YFP 1.0000 0.4099 0.8442 0.4222 C1V1-ts-YFP 1.0000 0.3254 0.1490 C1V1(E162T)-ts-Y 1.0000 0.3001 C1V1(E162T/E122T)- ts-YFP 1.0000 ChR2(H134R)-YFP - Thus, multiple useful properties of the individual mutations were conserved together in the double mutant.
- To test these novel C1V1 opsin genes in neurons, lentiviral vectors encoding C1V1-ts-EYFP and the point mutation combinations above were generated. These opsins were then expressed in cultured hippocampal neurons and recorded whole-cell photocurrents under identical stimulation conditions (2 ms pulses, 542 nm light, 5.5 mW mm−2) to determine whether the improvement in photocurrent amplitude resulted directly from the increased expression of C1V1 compared to VChR1.
- Materials and Methods
- Animals
- Wild-type or transgenic Parvalbumin::Cre C57/BL6J male mice were group housed three to five to a cage and kept on a reverse 12 hour light/dark cycle with ad libitum food and water. Experimental protocols were approved by Stanford University IACUC and meet guidelines of the National Institutes of Health guide for the Care and Use of Laboratory Animals.
- Whole Cell Patch-Clamp Electrophysiology in Hippocampal and Cortical Neurons
- Primary hippocampal cultures were isolated from PO Sprague-Dawley rats, plated on Matrigel (Invitrogen)-coated glass coverslips and treated with FUDR to inhibit glia overgrowth. Endotoxin-free plasmid DNA was transfected in cultured neurons using a HEPES buffered Saline/CaPO4 mix. Electrophysiological recordings from individual neurons identified by fluorescent protein expression were obtained in Tyrode media ([mM] 150 NaCl, 4KCl, 2MgCl2, 2MgCl2, 10 D-glucose, 10 HEPES, pH 7.35 with NaOH) using a standard internal solution ([mM] 130 KGluconate, 10KCl, 10 HEPES, 10 EGTA, 2MgCl2, pH 7.3 with KOH) in 3-5 MΩ glass pipettes. For cortical slice physiology, acute 300 gm coronal slices from 8-9 week old wild-type C57BL/6J or PV::Cre mice previously injected with virus were obtained in ice-cold sucrose cutting solution ([mM] 11 D-glucose, 234 sucrose, 2.5KCl, 1.25NaH2PO4, 10MgSO4, 0.5CaCl2, 26NaHCO3) using a Vibratonte (Leica). Slices were recovered in oxygenated Artificial Cerebrospinal Fluid (ACSF; [mM] 124NaCl, 3KCl, 1.3MgCl2, 2.4CaCl2, 1.25NaH2PO4, 26NaHCO3, 10 D-glucose) at 32° C. for one hour. Individual neuron patches were obtained after identifying fluorescent protein expression from indicated prefrontal cortical layer under constant ACSF perfusion. Filtered light from a broad-wavelength xenon lamp source (Sutter Instruments DG-4) was coupled to the fluorescence port of the microscope (Leica DM-LFSA). Band pass filters (Semrock) had 20 nm bandwidth, and were adjusted with additional neutral density filters (ThorLabs) to equalize light power output across the spectrum.
- Cultured cell images were acquired on the same microscope using a Retiga Exi CCD camera (Qimaging, Inc.) at 100 ms exposure with 30 gain. Illumination power density was 12 mW mm−2 at 500 nm with a standard EYFP filter set. Quantification of fluorescence was performed with ImageJ software by marking a region containing the soma and proximal neurites and calculating for each cell the total integrated pixel intensity in that region, rather than average fluorescence, since photocurrents are likely to be related to the total number of membrane-bound channels rather than average channel expression per area.
- Virus Preparation and Injection
- Both Lentiviral- and AAV-mediated gene delivery were used for heterologous expression of opsins in mice. Indicated opsins were driven by either Human calmodulin-dependent protein kinase II alpha (CaMKIIα) promoter to target cortical excitatory neurons or Elongation Factor 1a (EF-1a) in conjunction with a Cre-inducible cassette and followed by the Woodchuck hepatitis virus posttranscriptional regulatory element (WPRE). Cre-inducible recombinant AAV vector was produced by the University of North Carolina Vector Core (Chapel Hill, N.C., USA) and used in conjunction with parvalbumin::Cre transgenic mice to target parvalbumin positive interneurons. Briefly, AAV constructs were subcloned into a modified version of the pAAV2-MCS, serotyped with AAV5 coat proteins and packaged by the viral vector core at the University of North Carolina. The final viral concentration of AAV vectors as 1×1012 genome copies (gc)/mL. Lentiviral constructs were generated as reported. All constructs are available from the Deisseroth Lab (www.optogenetics.org). Stereotactic viral injections were carried out under protocols approved by Stanford University. Juvenile (4-6 weeks) mice kept under isoflurane anesthesia were arranged in a stereotactic frame (Kopf Instruments) and leveled using bregma and lambda skull landmarks. Craniotomies were preformed so as to cause minimal damage to cortical tissue. Infralimbic prefrontal cortex (IL; from bregma: 1.8 mm anterior, 0.35 mm lateral, −2.85 mm ventral) was targeted using a 10 uL syringe and 35 g beveled needle (Word Precision Instruments). Virus was infused at a rate of 0.1 μL/min. Subjects injected with virus for behavioral studies were additionally implanted with a chronic fiber optic coupling device to facilitate light delivery either with or without an attached penetrating cerebral fiber for local delivery to target cortical region as noted (Doric Lenses, Canada). Penetrating fibers were stereotactically inserted to a depth of −2.5 mm from the same anterior and lateral coordinates and affixed using adhesive luting cement (C&B MetaBond) prior to adhesive closure of the scalp (Vetbond, 3M). Animals were administered analgesic relief following recovery from surgery.
- Results
- Recordings from cultured hippocampal neurons expressing individual constructs and an integrated fluorescence reading were obtained from each individual cell. In individual cells, fluorescence levels closely correlated with the measured photocurrent amplitudes across constructs (
FIG. 3A ). It was therefore concluded that the potently increased photocurrent of C1V1 resulted chiefly from improved expression in neurons. Since the double mutant C1V1-E122T/E162T showed superior performance along all dimensions tested (photocurrent size, inactivation kinetics, and action spectrum), performance to ChR2(H134R) was also directly compared by measuring integrated somatic YFP fluorescence and peak photocurrents. Surprisingly, C1V1-E122T/E162T cells showed stronger photocurrents than ChR2-H134R cells at equivalent fluorescence levels (FIG. 3B ), potentially suggestive of increased unitary conductance. - To examine whether C1V1-E122T/E162T would be suitable for optically driving spiking in pyramidal neurons, adeno-associated viral vectors harboring the C1V1-E122T/E162T-ts-EYFP gene under the CaMKIIa promoter (AAV5-CaMKIIa-C1V1-E122T/E162T-ts-EYFP) were generated and injected the virus into the prefrontal cortex of mice. Responses were recorded from expressing neurons in acute slices with 2 ms light pulse trains and compared with responses to trains of current injection (10 ms, 200 pA) at identical frequencies. It was found that the frequency response of neurons to 560 nm pulse trains was indistinguishable from the response to current injections at the same frequencies (
FIG. 3C ; n=6 cells in 2 slices), suggesting that intrinsic properties of the cell and not C1V1 kinetics limit spiking performance at high rates. Similar performance properties were seen across a range of green, yellow, and amber illumination conditions, with strong performance at the moderate light intensities (<10 mW/mm2) suitable for in viva applications in mammals (FIG. 3D ). Indeed, responses at 540 nm and 590 nm were similarly effective at evoking precisely timed action potentials, with lower fidelity at lower light powers as expected (FIG. 3D ). - With the prominently red-shifted action spectrum, the possibility that C1V1 might even be used to drive spiking with red light, not previously reported with any opsin and potentially important for allowing improved spectral separation as well as control of neurons in deeper tissue, was considered. Whether any C1V1 variants could be used to drive spikes using far-red light was therefore examined. Although the kinetics of C1V1-E122T were slower than those of C1V1-E122T/E162T, its action spectrum was the most red-shifted of all variants (
FIG. 1F ), and indeed it was sound that cells expressing C1V1-E122T responded more strongly to red light (630 nm) than cells expressing the double mutant (FIG. 3E , top). Although on-kinetics of the E122T mutant at 630 nm were slower than at 545 nm (FIG. 3F ), photocurrents were recruited using longer pulses of 630 nm light at moderate intensity (FIG. 3G ) that sufficed to elicit defined spike trains (FIG. 3H ;FIG. 3E , bottom). - The study sought to determine whether inhibitory and excitatory neurons residing within the same microcircuit could be targeted with the introduction of C1V1 variants. Independent activation of two neuronal populations within living brain slices was explored; in this case CaMKIIα-C1V1-E122T/E162Tts eYFP and EF1a-DIO-ChR2-H134R-EYFP were expressed in mPFC of PV::Cre mice.
- Materials and Methods
-
Acute 300 μm coronal slices isolated from 8-9 week old wild-type C57BL/6J or PV::Cre mice previously injected with virus were obtained in ice-cold sucrose cutting solution ([mM] 11 D-glucose, 234 sucrose, 2.5KCl, 1.25NaH2PO4, 10MgSO4, 0.5CaCl2, 26NaHCO3) using a Vibratome (Leica). Slices were recovered in oxygenated Artificial Cerebrospinal Fluid (ACSF; [mM] 124NaCl, 3KCl, 1.3MgCl2, 2.4CaCl2, 1.25NaH2PO4, 26NaHCO3, 10 D-glucose) at 32° C. for one hour. Individual neuron patches were obtained after identifying fluorescent protein expression from indicated prefrontal cortical layer under constant ACSF perfusion. Filtered light from a broad-wavelength xenon lamp source (Sutter Instruments DG-4) was coupled to the fluorescence port of the microscope (Leica DM-LFSA). Slice physiology data were imported into Matlab and analyzed using custom-written software. Power spectra were calculated using the wavelet method as described by Sohal et al.55 Briefly, for each frequency f, the recorded traces were first filtered with a bandpass filter between f±5 Hz. The filtered traces were then convolved with the wavelet function: -
W(f,t)=s(t)*g(f,t) -
G(f,t)=e (−t2 )(2σ2 s−πft )−1 - where * denotes convolution, σ=5/(6f). The squared amplitude of W(f,t) over a 500 msec window was then used to measure the power at various frequencies. All power spectra from slice recordings were normalized to 1/f.
- Cultured cell images were acquired on the same microscope using a Retiga Exi CCD camera (Qimaging Inc.) at 100 ms exposure with the 30 gain. Illumination power density was 12 mW mm2 at 500 nm with a standard EYFP filter set. Quantification of fluorescence was done with ImageJ software by marking a region containing the soma and proximal neuritis and calculating for each cell the total integrated pixel intensity in that region, rather than average fluorescence, since photocurrents are likely to be related to the total number of membrane-bound channels rather than average channel expression per area.
- Using current clamp, a single pyramidal cell was stimulated with a train of simulated EPSC waveforms. Individual sEPSC events had peak current magnitudes of 200 pA and decayed with a time constant of 2 ms. Each experiment was divided into 10 sweeps, each 10 seconds long and separated by 5 seconds to minimize rundown. Each sweep was divided into 500 ms segments. The total number of sEPSCs in each 500 ms segment was randomly chosen from a uniform distribution between 0 and 250. Then, the times of the sEPSCs within the 500 ms segment were randomly selected from a uniform distribution extending across the entire segment, simulating excitatory input from a population of unsynchronized neurons. Empirically, these stimulation parameters reliably drove pyramidal neurons at firing rates from 0-30 Hz. In conditions marked as baseline, a 10 sec pulse of 590 nm light was delivered to completely inactivate the opsin before running the sEPSC protocol. In conditions where the opsin was activated, a 1 sec pulse of 470 nm light preceded the sEPSC protocol.
- To understand the net effect of altered E/I balance on information processing, the mutual information between each neuron's input sEPSC rate and output spike rate, which captures relevant changes in the shape of the I-O curve and in the response variability was computed. First, the joint distribution of sEPSC rate and spike rate by binning in time, sEPSC rate, and spike rate were estimated and the building of a joint histogram. Time bins were 125 ms wide, and sEPSC rate was divided into 10 equally spaced bins from 0 to 500 Hz, although the mutual information results were consistent across a wide range of binning parameters. Spike rate was binned using the smallest meaningful bin width given the time bin width (e.g. 8 Hz bin width for 125 ms time bins). From this joint histogram, compute mutual information, as previously described was computed equaling the difference between response entropy and noise entropy.
- Response entropy quantifies the total amount of uncertainty in the output spike rate of the neuron. Noise entropy quantifies the uncertainty that remains in the output spike rate given the input rate. Note that the maximum information that neural responses can transmit about the input stimulus is the entropy of the stimulus set. For 10 equally spaced input sEPSC rate bins and a uniform distribution of input rate over these bins, the entropy of the input rate is log2(10)=3.322 bits.
- Mutual information calculated from undersampled probability distributions can be biased upwards. Consequently, all reported values of mutual information, response entropy and noise entropy were corrected for bias due to undersampling. This correction is done by computing values from smaller fractions (from one-half to one-eighth) of the full data and extrapolating to the limit of infinite data. Using 125 ms time windows, the correction factors were always less than 0.07 bits.
- Vectors were created and injections were performed as above.
- Results
- Using this array of multiply engineered opsin genes, the possibilities for combinatorial control of cells and projections within intact mammalian systems was explored. First, it was asked whether excitatory and inhibitory neurons residing within the same microcircuit could be separably targeted by the respective introduction of C1V1 variants and conventional ChRs into these two cell populations. It was found that cultured hippocampal neurons expressing C1V1-E122T/E162T spiked in response to 2 ms green light pulses (560 nm) but not violet light pulses. In contrast, cells expressing ChR2-H134R spiked in response to 2
ms 405 nm light pulses, but not in response to 2ms 561 nm light pulses (FIG. 4A ). This principle was therefore tested within living brain slices; in this case AAV5-CaMKIIa::C1V1-E122T/E 162T-ts-mCherry along with AAV5-EFla-DIO::ChR2-H134R-EYFP in was expressed in mPFC of PV::Cre mice (FIG. 4B ). In pyramidal neurons not expressing any opsin, 405 nm light pulses triggered robust and fast inhibitory postsynaptic currents due to direct activation of PV cells (FIG. 4C ), while 561 nm light pulses triggered both short-latency EPSCs (FIG. 4D ) and the expected long-latency polysynaptic IPSCs arising from C1V1-expressing pyramidal cell drive of local inhibitory neurons (FIG. 4C ). - Excitation of these independent cellular elements in vivo with optrode recordings was then explored (
FIG. 4E , left). To examine the inhibitory effect of PV cell activity on pyramidal neuron spiking, an experimental protocol in which 5 Hz violet light pulses (to activate ChR2 in PV cells) preceded 5 Hz green light pulses (to activate C1V1 in excitatory pyramidal neurons) with varying inter-pulse intervals was designed. When violet and green light pulses were separated by 100 ms (FIG. 4E , top trace), responses to green light pulses were not affected by the violet pulses. However, as delays between violet and green pulses were reduced, green light-induced events became more readily inhibited and were completely abolished when light pulses were presented with sufficient synchrony (FIG. 4E , bottom trace; summary data inFIG. 4F ). These data demonstrate combinatorial optogenetic activation within an intact mammal (driving one population alone or in precise temporal combination with another), capitalizing on the speed of the opsins and the properties of the delivered light pulses. - To validate the combinatorial control property for axonal projections instead of direct cellular somata stimulation, the effect of independent activation of corticothalamic (CT) and thalamocortical (TC) glutamatergic axons impinging upon neurons of the reticular thalamic nucleus (nRT) (
FIG. 5A ) was examined in thalamic slices. - Materials and Methods
- C57BL/6J wild-type (postnatal days 90-120) were anesthetized with pentobarbital (100 mg/kg, i.p.) and decapitated. The thalamic slice preparation and whole-cell patch-clamp recordings were performed. Recordings were obtained from nRT (reticular thalamic) and TC (relay thalamocortical) neurons visually identified using differential contrast optics with a Zeiss (Oberkochen, Germany), Axioskop microscope, and an infrared video camera. For EPSCs and current-clamp recordings, the internal solution contained (in mM): 120 K-gluconate, 11KCl, 1MgCl2, 1CaCl2, 10 Hepes, 1 EGTA. pH was adjusted to 7.4 with KOH (290 mOsm). ECl − was estimated ˜−60 mV based on the Nernst equation. Potentials were corrected for −15 mV liquid junction potential. For voltage-clamp experiments neurons were clamped at −80 mV and EPSCs were pharmacologically isolated by bath application of the GABAA receptor antagonist picrotoxin (50 μM, Tocris). In all recording conditions, access resistance was monitored and cells were included for analysis only if the access resistance was <18 MΩ and the change of resistance was <25% over the course of the experiment.
- 600 nL rAAV5/CaMKIIα-hChR2(H134R)-EYFP or 900 nL rAAV5-CaMKIIαC1V1(E122T/E162T)-TS-mCherry virus was injected stereotaxically into ventrobasal thalamus (VB) or barrel cortex, respectively, of C57BL/6J wild-type mice in vivo, between post-natal days 30-35. Intra-cortical and intra-thalamic (VB) injections were performed in the same mice (n=6). Intra-cortical injections were preformed (from bregma) 1.3 mm posterior, 3 mm lateral, 1.15 mm below the cortical surface. Intra-thalamic injections were 1.7 mm posterior, 1.5 mm lateral, 3.5 mm below the cortical surface. Mice were sacrificed ˜2-3 months following injections and horizontal brain thalamic slices were made for optical stimulation and in vitro recordings as described above. VB thalamus was removed to avoid disynaptic activation of nRT neurons via the CT-TC-nRT pathway. Cutting VB thalamus from slices removed all photosensitive cell bodies from the preparation, enabled direct examination of CTnRT and TC-nRT projections, and did not affect the electrical membrane properties of nRT neurons (not shown). Optical activation of ChR2-expressing TC and C1V1-expressing CT axons were performed with 405 nm and 560 nm laser stimuli, respectively (5 ms duration light pulses, 2-3 mW) (OEM Laser Systems, MI) delivered with optic fiber (BFL 37-300, ThorLabs) upstream along the CT and TC pathways projecting to nRT. Minimal stimulation intensity was used, defined as the light power that resulted in 50 to 70% failures (30-50% successes), fixed response kinetics and low response amplitude variability. Consequent minimal evoked EPSCs presumably resulted from selective optical activation of single CT or TC axons presynaptic to the recorded cell. The stimulation light power was slightly increased (˜5% above minimal stimulation) until the number of failures became 0. CT and TC inputs were (simultaneously) stimulated and minimal evoked EPSCs and EPSPs (each individually subthreshold for action potential firing) were recorded in nRT cells.
- Statistical significance was calculated using paired or unpaired two-tailed t-tests, as applicable. Data were analyzed using Matlab Statistics toolbox or Microsoft Excel
- Results
- Minimal stimulation of TC axons evoked large and fast excitatory post-synaptic currents (EPSCs) in nRT neurons, whereas minimal stimulation of CT axons evoked small and slow EPSCs in nRT neurons (
FIG. 5B ), both typical for these pathways. - Next the synaptic integration of CT and TC inputs under variable delay conditions between these two inputs was examined. Subthreshold EPSPs from each pathway became suprathreshold for action potential firing only when coincident within 5 ms (
FIG. 5C-D ). The temporal precision of C1V1 and ChR2 activation allowed a reliable control of the delay between the TC and CT inputs and thus allowed determination of a narrow window of effective synaptic integration in nRT cells, not previously observable with existing electrical, pharmacological, or optogenetic techniques due to the reciprocal connectivity of cortex and thalamus as well as the close approximation of CT and TC axons. These results demonstrate for the first time, in the same intact preparation, independent activation of distinct axonal projections to examine their combinatorial effects on the same target cell. - In both of the above two preparations, visible-spectrum violet (405 nm) and green (560 nm) lasers were used to achieve separable activation of the two opsins. While 405 nm lasers deliver safe non-UV light, for many applications it may be preferable to use 470 nm laser light for the blue-responsive opsin, since 470 nm light will penetrate tissue more deeply, scatter less, and be more easily and economically delivered from common blue light sources. While this may seem impossible since 470 nm light will partially activate C1V1 (
FIG. 1G ) as well as ChR2, combinatorial control could be achievable even with 470 nm light, capitalizing on both the temporal properties of SSFO and the redshifted nature of C1V1 to achieve “spectrotemporal separation” within intact mammalian tissue. To test this possibility, it was decided to directly compare, within the same preparation, the effects on rhythmic activity of stably potentiating either excitatory or inhibitory cells (FIG. 6A ) - Materials and Methods
- ChR2-D156A and SSFO were generated by inserting point mutations into the pLenti-CaMKIIα¬ChR2-EYFP-WPRE vector using site-directed mutagenesis (Quikchange II XL; Stratagene). Viral gene delivery, coronal brain sectioning, and patch clamp recording were performed as above. Double virus injections to express CaMKIIa::C1V1 and DIO-SSFO in the mPFC of PV::Cre mice were performed.
- White handling cells or tissues expressing SSFO, care was taken to minimize light exposure to prevent activation by ambient light. Before each experiment, a 20 s pulse of 590 nm light was applied to convert all of the SSFO channels to the dark state and prevent run-down of photocurrents. For acquisition of SSFO activation and deactivation spectra, recordings from cultured neurons were made in voltage clamp mode. For recording activation spectra, a 1 s pulse of varying wavelength was applied, followed by a 10 s 590 nm pulse. Deactivation spectra were acquired by first applying a 1 s 470 nm pulse to activate SSFO, followed by a 10 s pulse of varying wavelength. Net activation or deactivation was calculated by dividing the photocurrent change after the first or second pulse, respectively, by the maximum photocurrent change induced by the peak wavelength for that cell. Negative values in deactivation spectra resulted from traces in which, for example, a 10 s 470 nm pulse led to a slight increase in photocurrent rather than deactivate the channels. This could be the result of the relatively wide (20 nm) band-pass filter width used for these recordings with the Sutter DG-4. intermediate wavelengths (between 470 nm, and 520 nm) are expected to have a mixed effect on the channel population for the same reasons.
- Photon flux calculations for SSFO integration properties were conducted by calculating the photon flux through the microscope objective at each light power, and then dividing to reach the photon flux across the cell surface, based on the diameter of the recorded cells and approximating cell shape as a spheroid.
- Results
- SSFO is a novel multiply-engineered channelrhodopsin with a decay constant of 29 minutes that can be effectively deactivated at the same wavelengths that activate C1V1 and permits bistable excitation of neurons over many minutes with enhanced light sensitivity. Information regarding SSFOs can be found in International Patent Application Publication No: WO 2010/056970 and U.S. Patent Application Nos. 61/410,704 and 61/410,711, the contents of which are hereby incorporated by reference herein in their entireties. Double virus injections to express CaMKIIa::C1V1 and DIO::SSFO in acute slices from the mPFC of PV::Cre mice were performed. Under these conditions, excitatory pyramidal cells should respond to redshifted light, and inhibitory PV cells to blue light. Indeed, in response to a 1 s 470 nm light pulse to activate SSFO in the PV cells, the rate of ongoing IPSCs was stably increased from 8.5±1.2 Hz at baseline (
period 3,FIG. 6B ) to 16.8±2.1 Hz after the blue light pulse (period 2; n=4 recordings, p<0.005, paired t-test;FIG. 6C ), showing persistent activation of the SSFO-expressing inhibitory cells. Even though 470 nm light will also transiently activate C 1V1, this activation can only occur during the light pulse itself due to the very fast deactivation of C1V1 after light-off; the prolonged, post-light period is characterized by SSFO activity only (FIG. 6B ), illustrating temporal separation of optogenetic control modes. Interestingly, during this prolonged period of elevated PV neuron activity, no significantly elevated peak in the IPSC power spectrum was elicited, suggesting that direct activation of PV neurons alone in this reduced preparation is insufficient to elicit gamma synchrony in the network. However, in marked contrast, during the 470 nm light pulse itself when the same level of PV neuron activation but also partial activation of C 1V 1-expressing pyramidal cells is also expected, a pronounced gamma peak was consistently observed (peak frequency 39.2±3.5 Hz; n=4 recordings;) that extended into the high-gamma range (>60 Hz). - Moreover, in the same experiments (indeed, later in the same recorded sweeps), direct activation in this case of C1V1-pyramidal cells alone with 590 nm light(which simultaneously activates C1V1 in PY cells and deactivates the SSFO in PV cells) led to robust gamma synchrony, with a lower frequency peak (26.6±2. 1 Hz, n=6 recordings). Demonstrating that any residual PV neuron activity linked to the prior history of SSFO activation in PV cells was not necessary for this effect, otherwise-identical sweeps with only a history of C1V1 activation in the pyramidal cells and no prior history of elevated IPSC rate elicited the same result). These results illustrate the integrated principle of spectrotemporal combinatorial control, and also suggest that elevating activity in pyramidal neurons can give rise through network properties to gamma oscillations31. Interestingly, during the 470 nm light pulse, when activation of both PV and pyramidal cells was expected, gamma synchrony was consistently observed at higher frequencies than when only excitatory neurons were activated, supporting and extending information on the coordinated importance of both PV and pyramidal cells in eliciting gamma oscillations.31-33
- In the course of this work, a family of new tools was generated that are referred to as C1V1 variants. C1V1 is a red-shifted opsin gene assembled, remarkably, from pieces of other opsin genes that do not express well alone in neurons, but which were identified in earlier genomic searches (VChR1 and ChR1). C1V1 contains no ChR2 sequence at all, yet its multiply-engineered variants reported here now represent the most potent, most redshifted, and most stable channelrhodopsins known. Mutagenesis in key amino acid positions throughout the retinal binding pocket led to the generation of (1) C1V1(E162T), a high-expressing redshifted opsin gene generated as a fast homolog of the ChETA mutation; (2) C1V1(E122T) which displays the reddest action spectrum shoulder and can even be used to fire action potentials with red light (3) C1V1(E122T/E162T)—a combination mutant with the lowest desensitization, fastest deactivation, least violet-light activation for minimal cross-activation with ChR2, and strong expression. Indeed, C1V1 variants may be selected for different applications based on considerations of current size, deactivation kinetics, and action spectrum (Table 1)—for example, in two-photon work, since 2P activation of ChR2 has been difficult due to current size and rapid kinetics of channel closure, C1V1(E162T) is likely to be of interest. The C1V1 variants enabled direct testing of the hypothesis that increasing levels of elevated cellular E/I balance would give rise to increasing intensities of gamma rhythmicity, a phenomenon previously linked to both schizophrenia and autism. Of course, the different tools are also synergistic; using C1V1 variants together with ChR2 permitted reliable and separate driving of spiking in the two distinct neuronal populations addressed in this study—the excitatory pyramidal neurons and the fast-spiking, parvalbumin-expressing inhibitory interneurons, and confirm that steady elevated cellular E/I balance was effective at generating gamma-band circuit activity, capitalizing on both kinetic and spectral differences in the optogenetic tools. This type of combinatorial activation can be extended beyond multiple cell types to multiple neural pathway types—for example, the separable activation of spiking, within a single brain region, in two converging axonal afferent pathways arising from distinct locations—a long-sought goal of systems neuroscience.
- The examples, which are intended to be purely exemplary of the invention and should therefore not be considered to limit the invention in any way, also describe and detail aspects and embodiments of the invention discussed above. The foregoing examples and detailed description are offered by way of illustration and not by way of limitation. All publications, patent applications, and patents cited in this specification are herein incorporated by reference as if each individual publication, patent application, or patent were specifically and individually indicated to be incorporated by reference. Various embodiments described above, and discussed in the attached Appendices may be implemented together and/or in other manners. One or more of the aspects in the present disclosure and in the Appendices can also be implemented in a more separated or integrated manner, as should be apparent and is useful in accordance with particular target applications. In particular, all publications and appendices cited herein are expressly incorporated herein by reference for the purpose of describing and disclosing compositions and methodologies which might be used in connection with the invention. Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, it will be readily apparent to those of ordinary skill in the art in light of the teachings of this invention that certain changes and modifications may be made thereto without departing from the spirit or scope of the appended claims.
- Deisseroth, K. Optogenetics.
Nat Methods 8, 26-29 (2011). - Boyden, E. S., Zhang, F., Bamberg, E., Nagel. G. & Deisseroth, K. Millisecond-timescale, genetically targeted optical control of neural activity.
Nat Neurosci 8, 1263-1268 (2005). - Nagel, G. et al. Light activation of channelrhodopsin-2 in excitable cells of Caenorhabditis elegans triggers rapid behavioral responses. Curr Biol 15, 2279-2284 (2005).
- Li, X. et al. Fast noninvasive activation and inhibition of neural and network activity by vertebrate rhodopsin and green algae channelrhodopsin. Proc Natl Acad Sci USA 102, 17816-17821 (2005).
- Bi, A. et al. Ectopic expression of a microbial-type rhodopsin restores visual responses in mice with photoreceptor degeneration.
Neuron 50, 23-33 (2006). - Schroll, C. et al. Light-induced activation of distinct modulatory neurons triggers appetitive or aversive learning in Drosophila larvae. Curr Biol 16, 1741-1747 (2006).
- Zhang, F. et al. Multimodal fast optical interrogation of neural circuitry. Nature 446, 633-639 (2007).
- Douglass, A. D., Knaves, S., Deisseroth, K., Schier, A. F. & Engert, F, Escape behavior elicited by single, channelrhodopsin-2-evoked spikes in zebrafish somatosensory neurons. Curr Biol 18, 1133-1137 (2008).
- Hagglund, M., Borgius, L, Dougherty, K. J. & Kiehn, O. Activation of groups of excitatory neurons in the mammalian spinal cord or hindbrain evokes locomotion. Nature neuroscience 13, 246-252, doi:10.1038/nn.2482 (2010).
- Huber, D. et al. Sparse optical microstimulation in barrel cortex drives learned behaviour in freely moving mice. Nature 451, 61-64 (2008).
- Hira, R. et al. Transcranial optogenetic stimulation for functional mapping of the motor cortex. J Neurosci Methods 179, 258-263 (2009).
- Higley, M. J. & Sabatini, B. L. Competitive regulation of synaptic Ca2+ influx by D2 dopamine and A2A adenosine receptors. Nature neuroscience 13, 958-966, doi:10.1038/nn.2592 (2010).
- Petreanu, L., Huber, D., Sobczyk, A. & Svoboda, K. Channelrhodopsin-2-assisted circuit mapping of long-range callosal projections.
Nat Neurosci 10, 663-668 (2007). - Ishizuka, T., Kakuda, M., Araki, R. & Yawo, H. Kinetic evaluation of photosensitivity in genetically engineered neurons expressing green algae light-gated channels. Neurosci Res 54, 85-94 (2006).
- Nagel, G. et al. Channelrhodopsin-2, a directly light-gated cation-selective membrane channel. Proc Natl
Acad Sci USA 100, 13940-13945 (2003). - Rickgauer, J. P. & Tank, D. W. Two-photon excitation of channelrhodopsin-2 at saturation. Proc Natl
Acad Sci USA 106, 15025-15030 (2009). - Yonehara, K. et al. Spatially asymmetric reorganization of inhibition establishes a motion-sensitive circuit. Nature 469, 407-410, doi:10.1038/nature09711 (2011).
- Yaroslavsky, A. N. et al. Optical properties of selected native and coagulated human brain tissues in vitro in the visible and near infrared spectral range. Phys Med Biol 47, 2059-2073 (2002).
- Wang, H. et al. Molecular determinants differentiating photocurrent properties of two channelrhodopsins from chlamydomonas. J Biol Chem 284, 5685-5596 (2009).
- Wen, L. et al. Opto-current-clamp actuation of cortical neurons using a strategically designed channelrhodopsin. PLoS One 5, e12893 (2010).
- Zhang, F. et al. Red-shifted optogenetic excitation: a tool for fast neural control derived from Volvox carteri.
Nat Neurosci 11, 631-633 (2008). - Berndt, A., Yizhar, O., Gunaydin, L. A., Hegemann, P. &. Deisseroth, K. Bi-stable neural state switches.
Nat Neurosci 12, 229-234 (2009). - Barnann, C., Gueta, R., Kleinlogel, S., Nagel, G. & Bamberg, E. Structural guidance of the photocycle of channelrhodopsin-2 by an interhelical hydrogen bond. Biochemistry 49, 267-278 (2010).
- Schoenenberger, P., Gerosa, D. & Oertner, T. G. Temporal control immediate early gene induction by light. PLoS One 4, e8185 (2009).
- Stehfest, K., Ritter, E., Berndt, A., Bard, F. & Hegernann, P. The branched photocycle of the slow-cycling channelrhodopsin-2 mutant C128T. J Mol Biol 398, 690-702 (2010).
- Sohal, V. S., Zhang, F., Yizhar, O. & Deisseroth, K. Parvalbumin neurons and gamma rhythms enhance cortical circuit performance. Nature 459, 698-702 (2009).
- Lin, J. Y., Lin, M. Z., Steinbach, P. & Tsien, R. Y. Characterization of engineered ehannehhodopsin variants with improved properties and kinetics. Biophys J 96, 1803-1814 (2009),
- Gunaydin, L. A. et al. Ultrafast optogenetic control. Nat Neurosci 13, 387-392 (2010).
- Tittor, J., Schweiger, U., Oesterhelt, D. & Bamberg, E. Inversion of proton translocation in bacteriorhodopsin mutants D85N, D85T, and D85,96N. Biophys J 67, 1682-1690 (1994).
- Sugiyania, Y. et al. Photocurrent attenuation by a single polar-to-nonpolar point mutation of channelrhodopsin-2.
Photochem Photobiol Sci 8, 328-336 (2009). - Adesnik, H. & Scanziani, M. Lateral competition for cortical space by layer-specific horizontal circuits. Nature 464, 1155-1160 (2010).
- Colgin, L. L. et al. Frequency of gamma oscillations routes flow of information in the hippocampus. Nature 462, 353-357 (2009).
- Cardin, J. A. et al. Driving fast-spiking cells induces gamma rhythm and controls sensory responses. Nature 459, 663-667 (2009).
- Bamann, C., Kirsch, T., Nagel, G. & Bamberg, E. Spectral characteristics of the photocycle of channelrhodopsin-2 and its implication for channel function. J Mol Biol 375, 686-694 (2008).
-
SEQUENCES SEQ ID NO: 1 (Humanized C1V1 amino acid sequence) MSRRPWLLALALAVALAAGSAGASTGSDATVPVATQDGPDYVFHRAHERMLFQTSYTLENNGSVI CIPNNGQCFCLAWLKSNGTNAEKLAANILQWITFALSALCLMFYGYQTWKSTCGWEEIYVATIEMI KFIIEYFHEFDEPAVIYSSNGNKTVWLRYAEWLLTCPVLLIHLSNLTGLKDDYSKRTMGLLVSDVGC IVWGATSAMCTGWTKILFFLISLSYGMYTYFHAAKVYIEAFHTVPKGICRELVRVMAWTFFVAWG MFPVLFLLGTEGFGHISPYGSAIGHSILDLIAKNMWGVLGNYLRVKIHEHILLYGDIRKKQKITIAGQ EMEVETLVAEEED SEQ ID NO: 2 (Humanized C1V1 nucleotide sequence) atgtcgcgacgcccgtggctccttgctctcgcattggcggtggcgcngcagcgggatcggcaggagcgtcaaccggaagcg atgcgaccgtccccgtggctacgcaagacggaccagattacgtgttccacagagcccacgagcggatgttgtttcagacat catacacacttgaaaacaatggtagcgtcatttgcatccctaacaatgggcagtgtttttgcctggcctggttgaaatcga acggtacgaacgccgagaagctggcggcgaacattctgcagtggatcacattcgcactctcggcgctctgccttatgttct atggctaccagacttggaaatccacgtgtggttgggaagagatctacgtagcaaccattgaaatgatcaagtttatcattg agtatttccatgagtttgacgaaccggccgtaatctactcatcgaatgggaataagacagtctggttgaggtatgcggagt ggctcctcacctgcccggtccttctgatccatctgagcaacctcacaggcctgaaggacgattatagcaaaaggactatgg gcctgttggtttctgatgtgggatgcatcgtgtggggcgcaaccagcgccatgtgtacggggtggacgaagatcctgttct tcctcatctcattgagctatggtatgtatacctattttcatgctgctaaagtttatatcgaagcattccacacagttccaa aagggatttgtcgagaactggtccgagtgatggcctggacattctttgtggcttggggaatgtttccagtcctgtttctgc tgggcacggaaggattcggtcatatcagcccttatggatctgccattgggcactccatcctcgacctgattgcaaagaaca tgtggggtgtgctggggaattacctgcgcgtcaaaatccacgagcacatcctgttgtatggcgacatcagaaagaagcaga aaattacgatcgccggccaagagatggaggttgagacactggtggctgaagaggaggactaa SEQ ID NO: 3 (Humanized C1V1 E122T amino acid sequence) MSRRPWLLALALAVALAAGSAGASTGSDATVPVATQDGPDYVFHRAHERMLFQTSYTLENNGSVICIPNNGQCFC LAWLKSNGTNAEKLAANILQWIFFFALSALCLMFYGYQTWKSTCGWETIYVATIEMIKFIIEYFHEFDEPAVIYSSNGNKTV WLRYAEWLLTCPVLLIHLSNLTGLKDDYSKRTMGLLVSDVGCIVWGATSAMCTGWTKILFFLISLSYGMTYFHAAK VYIEAFHTVPKGICRELVRVMAWTFFVAWGMFPVLFLLGTEGFGHISPYGSAIGHSILDLIAKNMWGVLGNYLRV KIHEHILLYGDIRKKQKITIAGQEMEVETLVAEEED SEQ ID NO: 4 (Humanized C1V1 E122T nucleotide sequence) atgtcgcgacgcccgtggctccttgctctcgcattggcggtggcgcttgcagcgggatcggcaggagcgtcaaccggaagc gatgcgaccgtccccgtggctacgcaagacggaccagattacgtgttccacagagcccacgagcggatgttgtttcagaca tcatacacacttgaaaacaatggtagcgtcatttgcatccctaacaatgggcagtgtttttgcctggcctggttgaaatcg aacggtacgaacgccgagaagctggcggcgaacattctgcagtggatcacattcgcactctcggcgctctgccttatgttc tatggctaccagacttggaaatccacgtgtggttgggaaaccatctacgtagcaaccattgaaatgatcaagtttatcatt gagtatttccatgagtttgacgaaccggccgtaatctactcatcgaatgggaataagacagtctggttgaggtatgcggag tggctcctcacctgcccggtccttctgatccatctgagcaacctcacaggcctgaaggacgattatagcaaaaggactatg ggcctgttggtttctgatgtgggatgcatcgtgtggggcgcaaccagcgccatgtgtacggggtggacgaagatcctgttc ttcctcatctcattgagctatggtatgtatacctattttcatgctgctaaagtttatatcgaagcattccacacagttcca aaagggatttgtcgagaactggtccgagtgatggcctggacattctttgtggcttggggaatgtttccagtcctgtttctg ctgggcacggaaggattcggtcatatcagcccttatggatctgccattgggcactccatcctcgacctgattgcaaagaac atgtggggtgtgctggggaattacctgcgcgtcaaaatccacgagcacatcctgrtgtatggcgacatcagaaagaagcag aaaattacgatcgccggccaagagatggaggttgagacactggtggctgaagaggaggactaa SEQ ID NO: 5 (Humanized C1V1 E162T amino acid sequence) MSRRPWLLALALAVALAAGSAGASTGSDATVPVATQDGPDYVFHRAHERMLFQTSYTLENNGSVI CIPNNGQCFCLAWLKSNGTNAEKLAANILQWITFALSALCLMFYGYQTWKSTCGWEEIYVATIEMI KFIIEYFHEFDEPAVIYSSNGNKTVWLRYATWLLTCPVLLIHLSNLTGLKDDYSKRTMGLLVSDVGC IVWGATSAMCTGWTKILFFLISLSYGMYTYFHAAKVYIEAFHTVPKGICRELVRVMAWTFFVAWG MFPVLFLLGTEGFGHISPYGSAIGHSILDLIAKNMWGVLGNYLRVKIHEHILLYGDIRKKQKITIAGQ EMEVETLVAEEED SEQ ID NO: 6 (Humanized C1V1 E162T nucleotide sequence) atgtcgcgacgcccgtggctccttgctctcgcattggcggtggcgcttgcagcgggatcggcaggagcgtcaaccggaagc gatgcgaccgtccccgtggctacgcaagacggaccagattacgtgttccacagagcccacgagcggatgttgtttcagaca tcatacacacttgaaaacaatggtagcgtcatttgcatccctaacaatgggcagtgtttttgcctggcctggttgaaatcg aacggtacgaacgccgagaagctggcggcgaacattctgcagtggatcacattcgcactctcggcgctctgccttatgttc tatggctaccagacttggaaatccacgtgtggttgggaagagatctacgtagcaaccattgaaatgatcaagtttatcatt gagtatttccatgagtttgacgaaccggccgtaatctactcatcgaatgggaataagacagtctggttgaggtatgcgacg tggctcctcacctgcccggtccttctgatccatctgagcaacctcacaggcctgaaggacgattatagcaaaaggactatg ggcctgttggtttetgatgtgggatgcatcgtgtggggcgcaaccagcgccatgtgtacggggtggacgaagatcctgttc ttcctcatctcattgagctatggtatgtatacctattttcatgctgctaaagtttatatcgaagcattccacacagttcca aaagggatttgtcgagaactggtccgagtgatggcctggacattctttgtggcttggggaatgtttccagtcctgtttctg ctgggcacggaaggattcggtcatatcagcccttatggatctgccattgggcactccatcctcgacctgattgcaaagaac atgtggggtgtgctggggaattacctgcgcgtcaaaatccacgagcacatcctgttgtatggcgacatcagaaagaagcag aaaattacgatcgccggccaagagatggaggttgagacactggtggctgaagaggaggactaa SEQ ID NO: 7 (Humanized C1V1 E122T/E162T amino acid sequence) MSRRPWLLALALAVALAAGSAGASTGSDATVPVATQDGPDYVFHRAHERMLFQTSYTLENNGSVI CIPNNGQCFCLAWLKSNGTNAEKLAANILQWITFALSALCLMFYGYQTWKSTCGWETIYVATIEMI KFIIEYFHEFDEPAVIYSSNGNKTVWLRYATWLLTCPVLLIHLSNLTGLKDDYSKRTMGLLVSDVGC IVWGATSAMCTGWTKILFFLISLSYGMYTYFHAAKVYIEAFHTVPKGICRELVRVMAWTFFVAWG MFPVLFLLGTEGFGHISPYGSAIGHSTLDLTAKNMWGVLGNYLRVKIHEHILLYGDIRKKQKITIAGQ EMEVETLVAEEED SEQ ID NO: 8 (Humanized C1V1 E122T/E162T nucleotide sequence) atgtcgcgacgcccgtggctccttgctctcgcattggcggtggcgcttgcagcgggatcggcaggagcgtcaaccggaagc gatgcgaccgtccccgtggctacgcaagacggaccagattacgtgttccacagagcccacgagcggatgttgtttcagaca tcatacacacttgaaaacaatggtagcgtcatttgcatccctaacaatgggcagtgtttttgcctggcctggttgaaatcg aacggtacgaacgccgagaagctggcggcgaacattctgcagtggatcacattcgcactctcggcgctctgccttatgttc tatggctaccagacttggaaatccacgtgtggttgggaaaccatctacgtagcaaccattgaaatgatcaagtttatcatt gagtatttccatgagtttgacgaaccggccgtaatctactcatcgaatgggaataagacagtctggttgaggtatgcgac gtggctcctcacctgcccggtccttctgatccatctgagcaacctcacaggcctgaaggacgattatagcaaaaggactat gggcctgttggtttctgatgtgggatgcatcgtgtggggcgcaaccagcgccatgtgtacggggtggacgaagatcctgtt cttcctcatctcattgagctatggtatgtatacctattttcatgctgctaaagtttatatcgaagcattccacacagttcc aaaagggatttgtcgagaactggtccgagtgatggcctggacattctttgtggcttggggaatgtttccagtcctgtttct gctgggcacggaaggattcggtcatatcagcccttatggatctgccattgggcactccatcctcgacctgattgcaaagaa catgtggggtgtgctggggaattacctgcgcgtcaaaatccacgagcacatcctgttgtatggcgacatcagaaagaagca gaaaattacgatcgccggccaagagatggaggttgagacactggtggctgaagaggaggactaa SEQ ID NO: 9 (Alternative Humanized C1V1 amino acid sequence (C1V1_25) MSRRPWLLALALAVALAAGSAGASTGSDATVPVATQDGPDYVFHRAHERMLFQTSYTLENNGSVICIPNNGQCF CLAWLKSNGTNAEKLAANILQWITFALSALCLMFYGYQTWKSTCGWEEIYVATIEMIKFIIEYFHEFDEPATLWLS SGNGVVWMRYGEWLLTCPVLLIHLSNLTGLKDDYSKRTMGLLVSDVGCIVWGATSAMCTGWTKILFFLISLSYG MYTYFHAAKVYIEAFHTVPKGICRELVRVMAWTFFVAWGMFPVLFLLGTEGFGHISPYGSAIGHSILDLIAKNM WGVLGNYLRVKIHILLYGDIRKKQKITIAGQEMEVETLVAEEED SEQ ID NO: 10 (Alternative Humanized C1V1 nucleotide sequence (C1V1_25)) Atgagcagacggccctggctgctggccctggctctcgctgtggccctggccgccggcagcgccggagccagcaccggcagc gacgccaccgtgcccgttgccacacaggacggccccgactacgtgttccaccgggcccacgagcggatgctgttccagacc agctacacccttgaaaacaacggcagcgtgatctgcatccccaacaacggccagtgcttctgcctggcctggctgaagtcc aacggcaccaacgccgagaagctggccgccaacatcctgcagtggatcaccttcgccctgtctgccctgtgcctgatgttc tacggctaccagacctggaagtccacctgcggctgggaggaaatctacgtggccaccatcgagatgatcaagttcatcatc gagtacttccacgagttcgacgagcccgccaccctgtggctgtccagcggaaacggcgtggtgtggatgagatacggcgag tggctgctgacctgccctgtgctgctgatccacctgagcaacctgaccggactgaaggatgactacagcaagagaaccatg ggactgctggtgtccgatgtgggatgcatcgtgtggggagccacctccgccatgtgcaccggatggaccaagatcctgttc ttcctgatcagcctgagctacggaatgtacacctacttccacgccgccaaggtgtacattgaggcctttcacaccgtgcct aagggaatctgcagagaactggtcagagtgatggcctggaccttcttcgtggcctggggaatgttccctgtgctgttcctg ctgggaaccgagggattcggacacatcagcccttacggaagcgccatcggacacagcatcctggatctgatcgccaagaac atgtggggagtgctgggaaactacctgagagtgaagatccacgagcacatcctgctgtacggcgacatcagaaagaagcag aagatcaccatcgccggacaggaaatggaagtcgagaccctggtggccgaggaagaggat SEQ ID NO: 11 ChR2 amino acid sequence MDYGGALSAVGRELLFVTNPVVVNGSVLVPEDQCYCAGWIESRGTNGAQTASNVLQWLAA GFSILLLMFYAYQTWKSTCGWEEIYVCAIEMVKVILEFFFEFKNPSMLYLATGHRVQWLR YAEWLLTCPVILIHLSNLTGLSNDYSRRTMGLLVSDIGTIVWGATSAMATGYVKVIFFCL GLCYGANTFFHAAKAYIEGYHTVPKGRCRQVVTGMAWLFFVSWGMFPILFILGPEGFGVL SVYGSTVGHTIIDLMSKNCWGLLGHYLRVLIHEHILIHGDIRKTTKLNIGGTEIEVETLV EDEAEAGAVP SEQ ID NO: 12 ChR2 (H134R) MDYGGALSAVGRELLFVTNPWVNGSVLVPEDQCYCAGWIESRGTNGAQTASNVLQWLAA GFSILLLMFYAYQTWKSTCGWEEIYVCAIEMVKVILEFFFEFKNPSMLYLATGHRVQWLR YAEWLLTCPVILIRLSNLTGLSNDYSRRTMGLLVSDIGTIVWGATSAMATGYVKVTFFCL GLCYGANTFFHAAKAYTEGYHTVPKGRCRQWTGMAWLFFVSWGMFPILFILGPEGFGVL SVYGSTVGHTITDLMSKNCWGLLGHYLRVLIHEHILIHGDIRKTTKLNIGGTEIEVETLV EDEAEAGAVP SEQ ID NO: 13 SFO MDYGGALSAVGRELLFVTNPVWNGSVLVPEDQCYCAGWIESRGTNGAQTASNVLQWLAAGFSILL LMFYAYQTWKSTCGWEEIYVCABEMVKVILEFFFEFKNPSMLYLATGHRVQWLRYAEWLLTSPVELI HLSNLTGLSNDYSRRTMGLLVSDIGTIVWGATSAMATGYVKVIFFCLGLCYGANTFFHAAKAYIEGY HTVPKGRCRQWTGMAWLFFVSWGMFPILFILGPEGFGVLSVYGSTVGHTIIDLMSKNCWGLLGHYL RVLIHEHILIHGDIRKTTKLNIGGTEIEVETLVEDEAEAGAVP SEQ ID NO: 14 (SSFO) MDYGGALSAVGRELLFVTNPVVVNGSVLVPEDQCYCAGWIESRGTNGAQTASNVLQWLAAGFSILL LMFYAYQTWKSTCGWEEITYVCAIEMVKVILEFFFEFKNPSMLYLATGHRVQWLRYAEWLLTSPVILI HLSNLTGLSNDYSRRTMGLLVSAIGTIVWGATSAMATGYVKVIFFCLGLCYGANTFFHAAKAYIEGY HTVPKGRCRQWTGMAWLFFVSWGMFPILFILGPEGFGVLSVYGSTVGHTIIDLMSKNCWGLLGHYL RVLIHEHILIHGDIRKTTKLNTGGTEIEVETLVRDEAEAGAVP
Claims (21)
1.-51. (canceled)
52. A polynucleotide comprising a nucleotide sequence encoding a light-responsive chimeric polypeptide comprising an amino acid sequence having at least 90% amino acid sequence identity to the amino acid sequence set forth in SEQ ID NO:7.
53. The polynucleotide of claim 52 , wherein the light-responsive chimeric polypeptide comprises a C-terminal trafficking signal.
54. The polynucleotide of claim 53 , wherein the trafficking signal comprises the amino acid sequence KSRITSEGEYIPLDQIDINV (SEQ ID NO:15).
55. The polynucleotide of claim 52 , wherein the nucleotide sequence is operably linked to a promoter.
56. The polynucleotide of claim 52 , wherein the polynucleotide further comprises a nucleotide sequence encoding a second light-activated polypeptide.
57. The polynucleotide of claim 56 , wherein the second light-activated polypeptide comprises an amino acid sequence having at least 85% amino acid sequence identity to the amino acid sequence set forth in SEQ ID NOs:11, 12, 13, or 14.
58. A method of depolarizing an excitatory or an inhibitory neuron, the method
comprising exposing the neuron to light of a wavelength between about 540 nm to about 560 nm,
wherein the neuron expresses in its cell membrane a light-responsive chimeric polypeptide comprising an amino acid sequence having at least 90% amino acid sequence identity to the amino acid sequence set forth in SEQ ID NO:7.
59. The method of claim 58 , wherein the neuron is an excitatory neuron present in a microcircuit, and where the method further comprises expressing a second light-activated polypeptide in an inhibitory neuron, wherein the second light-activated polypeptide comprises an amino acid sequence having at least 85% amino acid sequence identity to the amino acid sequence set forth in SEQ ID NOs:11, 12, 13, or 14, and wherein the inhibitory neuron is exposed to light of a second wavelength.
60. The method of claim 58 , wherein the excitatory neuron comprises a pyramidal neuron and the inhibitory neuron comprises a parvalbumin neuron.
61. The method of claim 58 , wherein the inhibitory neuron or the excitatory neuron is present in the prefrontal cortex.
62. A mammalian cell comprising a polynucleotide of claim 52 .
63. The mammalian cell of claim 62 , wherein the cell further comprises a second light-activated polypeptide present in the cell membrane, wherein the second light-activated polypeptide comprises an amino acid sequence having at least 85% amino acid sequence identity to the amino acid sequence set forth in SEQ ID NOs:11, 12, 13, or 14.
64. The mammalian cell of claim 62 , wherein the cell is a muscle cell.
65. The mammalian cell of claim 62 , wherein the cell is a stem cell.
66. The mammalian cell of claim 62 , wherein the cell is an excitatory neuronal cell.
67. The mammalian cell of claim 62 , wherein the cell is an inhibitory neuronal cell.
68. A polynucleotide comprising a nucleotide sequence encoding a light-responsive chimeric polypeptide comprising an amino acid sequence having at least 85% amino acid sequence identity to the amino acid sequence set forth in SEQ ID NOs:11, 12, 13, or 14.
69. The polynucleotide of claim 68 , wherein the light-responsive chimeric polypeptide comprises an amino acid sequence having at least 90% amino acid sequence identity to the amino acid sequence set forth in SEQ ID NOs:11, 12, 13, or 14.
70. The polynucleotide of claim 68 , wherein the light-responsive chimeric polypeptide comprises an amino acid sequence having at least 95% amino acid sequence identity to the amino acid sequence set forth in SEQ ID NOs:11, 12, 13, or 14.
71. The polynucleotide of claim 68 , wherein the light-responsive chimeric polypeptide has at least 95% sequence identity to the amino acid sequence set forth in SEQ ID NO:11 and is activated at a wavelength of 405 nm, 461 nm, or 470 nm.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US16/211,083 US20190241627A1 (en) | 2010-11-05 | 2018-12-05 | Light-activated chimeric opsins and methods of using the same |
Applications Claiming Priority (9)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US41073610P | 2010-11-05 | 2010-11-05 | |
US41074410P | 2010-11-05 | 2010-11-05 | |
US201161511912P | 2011-07-26 | 2011-07-26 | |
PCT/US2011/059276 WO2012061679A2 (en) | 2010-11-05 | 2011-11-04 | Light-activated chimeric opsins and methods of using the same |
US13/875,966 US9175095B2 (en) | 2010-11-05 | 2013-05-02 | Light-activated chimeric opsins and methods of using the same |
US14/862,926 US9340589B2 (en) | 2010-11-05 | 2015-09-23 | Light-activated chimeric opsins and methods of using the same |
US15/147,772 US9850290B2 (en) | 2010-11-05 | 2016-05-05 | Light-activated chimeric opsins and methods of using the same |
US15/803,472 US10196431B2 (en) | 2010-11-05 | 2017-11-03 | Light-activated chimeric opsins and methods of using the same |
US16/211,083 US20190241627A1 (en) | 2010-11-05 | 2018-12-05 | Light-activated chimeric opsins and methods of using the same |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/803,472 Continuation US10196431B2 (en) | 2010-11-05 | 2017-11-03 | Light-activated chimeric opsins and methods of using the same |
Publications (1)
Publication Number | Publication Date |
---|---|
US20190241627A1 true US20190241627A1 (en) | 2019-08-08 |
Family
ID=46024835
Family Applications (5)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US13/875,966 Active US9175095B2 (en) | 2010-11-05 | 2013-05-02 | Light-activated chimeric opsins and methods of using the same |
US14/862,926 Expired - Fee Related US9340589B2 (en) | 2010-11-05 | 2015-09-23 | Light-activated chimeric opsins and methods of using the same |
US15/147,772 Active US9850290B2 (en) | 2010-11-05 | 2016-05-05 | Light-activated chimeric opsins and methods of using the same |
US15/803,472 Active US10196431B2 (en) | 2010-11-05 | 2017-11-03 | Light-activated chimeric opsins and methods of using the same |
US16/211,083 Abandoned US20190241627A1 (en) | 2010-11-05 | 2018-12-05 | Light-activated chimeric opsins and methods of using the same |
Family Applications Before (4)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US13/875,966 Active US9175095B2 (en) | 2010-11-05 | 2013-05-02 | Light-activated chimeric opsins and methods of using the same |
US14/862,926 Expired - Fee Related US9340589B2 (en) | 2010-11-05 | 2015-09-23 | Light-activated chimeric opsins and methods of using the same |
US15/147,772 Active US9850290B2 (en) | 2010-11-05 | 2016-05-05 | Light-activated chimeric opsins and methods of using the same |
US15/803,472 Active US10196431B2 (en) | 2010-11-05 | 2017-11-03 | Light-activated chimeric opsins and methods of using the same |
Country Status (8)
Country | Link |
---|---|
US (5) | US9175095B2 (en) |
EP (2) | EP2635108B1 (en) |
JP (3) | JP6276591B2 (en) |
CN (2) | CN103492564B (en) |
AU (1) | AU2011323226B2 (en) |
CA (1) | CA2816971A1 (en) |
ES (1) | ES2716819T3 (en) |
WO (2) | WO2012061679A2 (en) |
Families Citing this family (64)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US9238150B2 (en) | 2005-07-22 | 2016-01-19 | The Board Of Trustees Of The Leland Stanford Junior University | Optical tissue interface method and apparatus for stimulating cells |
US20070053996A1 (en) | 2005-07-22 | 2007-03-08 | Boyden Edward S | Light-activated cation channel and uses thereof |
US8926959B2 (en) | 2005-07-22 | 2015-01-06 | The Board Of Trustees Of The Leland Stanford Junior University | System for optical stimulation of target cells |
US10052497B2 (en) | 2005-07-22 | 2018-08-21 | The Board Of Trustees Of The Leland Stanford Junior University | System for optical stimulation of target cells |
US9274099B2 (en) | 2005-07-22 | 2016-03-01 | The Board Of Trustees Of The Leland Stanford Junior University | Screening test drugs to identify their effects on cell membrane voltage-gated ion channel |
US8398692B2 (en) | 2007-01-10 | 2013-03-19 | The Board Of Trustees Of The Leland Stanford Junior University | System for optical stimulation of target cells |
US8401609B2 (en) | 2007-02-14 | 2013-03-19 | The Board Of Trustees Of The Leland Stanford Junior University | System, method and applications involving identification of biological circuits such as neurological characteristics |
WO2008106694A2 (en) | 2007-03-01 | 2008-09-04 | The Board Of Trustees Of The Leland Stanford Junior University | Systems, methods and compositions for optical stimulation of target cells |
US10035027B2 (en) | 2007-10-31 | 2018-07-31 | The Board Of Trustees Of The Leland Stanford Junior University | Device and method for ultrasonic neuromodulation via stereotactic frame based technique |
US10434327B2 (en) | 2007-10-31 | 2019-10-08 | The Board Of Trustees Of The Leland Stanford Junior University | Implantable optical stimulators |
RU2010147661A (en) | 2008-04-23 | 2012-05-27 | Дзе Борд Оф Трастиз Оф Дзе Лелэнд Стэнфорд Джуниор Юниверсити (Us) | SYSTEMS, METHODS AND COMPOSITIONS FOR THE OPTICAL STIMULATION OF TARGET CELLS |
EP2610350B1 (en) | 2008-05-29 | 2014-12-17 | The Board Of Trustees Of The Leland Stanford Junior University | Cell line, system and method for optical control of secondary messengers |
AU2009260029B2 (en) | 2008-06-17 | 2016-03-17 | The Board Of Trustees Of The Leland Stanford Junior University | Methods, systems and devices for optical stimulation of target cells using an optical transmission element |
US10711242B2 (en) | 2008-06-17 | 2020-07-14 | The Board Of Trustees Of The Leland Stanford Junior University | Apparatus and methods for controlling cellular development |
WO2010006049A1 (en) | 2008-07-08 | 2010-01-14 | The Board Of Trustees Of The Leland Stanford Junior University | Materials and approaches for optical stimulation of the peripheral nervous system |
NZ602416A (en) | 2008-11-14 | 2014-08-29 | Univ Leland Stanford Junior | Optically-based stimulation of target cells and modifications thereto |
AU2011227131B2 (en) | 2010-03-17 | 2014-11-13 | The Board Of Trustees Of The Leland Stanford Junior University | Light-sensitive ion-passing molecules |
CA2816968C (en) | 2010-11-05 | 2019-11-26 | The Board Of Trustees Of The Leland Stanford Junior University | Optically-controlled cns dysfunction |
EP2635346B1 (en) | 2010-11-05 | 2017-03-29 | The Board of Trustees of the Leland Stanford Junior University | Optogenetic control of reward-related behaviors |
CN110215614A (en) | 2010-11-05 | 2019-09-10 | 斯坦福大学托管董事会 | The upper conversion of light for light genetic method |
CN105941328B (en) | 2010-11-05 | 2019-04-09 | 斯坦福大学托管董事会 | It is a kind of to identify the system for inhibiting the compound of depolarising of excitability or inhibitory neuron in prefrontal cortex |
EP2635108B1 (en) | 2010-11-05 | 2019-01-23 | The Board of Trustees of the Leland Stanford Junior University | Light-activated chimeric opsins and methods of using the same |
JP6328424B6 (en) | 2010-11-05 | 2018-07-11 | ザ ボード オブ トラスティーズ オブ ザ レランド スタンフォード ジュニア ユニバーシティー | Control and characterization of memory functions |
EP2635110B1 (en) * | 2010-11-05 | 2018-05-09 | The Board of Trustees of the Leland Stanford Junior University | Control and characterization of psychotic states |
US8696722B2 (en) | 2010-11-22 | 2014-04-15 | The Board Of Trustees Of The Leland Stanford Junior University | Optogenetic magnetic resonance imaging |
US9782091B2 (en) | 2011-07-25 | 2017-10-10 | Neuronexus Technologies, Inc. | Opto-electrical device for artifact reduction |
US10493297B2 (en) | 2011-07-25 | 2019-12-03 | Neuronexus Technologies, Inc. | Neuromodulation transfection system with passive fluid delivery |
US9700736B2 (en) | 2011-07-25 | 2017-07-11 | Neuronexus Technologies, Inc. | Neuromodulation transfection system with active fluid delivery |
US8759492B2 (en) * | 2011-08-17 | 2014-06-24 | The Regents Of The University Of California | Engineered red-shifted channelrhodopsin variants |
DK2776455T3 (en) | 2011-11-12 | 2018-02-26 | Massachusetts Inst Technology | CHANNEL RHODOPSINES FOR OPTICAL CELL CONTROL |
CN104093833B (en) | 2011-12-16 | 2017-11-07 | 斯坦福大学托管董事会 | Opsin polypeptide and its application method |
EP2817068B1 (en) | 2012-02-21 | 2017-04-12 | The Board of Trustees of the Leland Stanford Junior University | Compositions for treating neurogenic disorders of the pelvic floor |
US9636380B2 (en) | 2013-03-15 | 2017-05-02 | The Board Of Trustees Of The Leland Stanford Junior University | Optogenetic control of inputs to the ventral tegmental area |
EP2968997B1 (en) | 2013-03-15 | 2019-06-26 | The Board of Trustees of the Leland Stanford Junior University | Optogenetic control of behavioral state |
WO2014179331A2 (en) | 2013-04-29 | 2014-11-06 | The Board Of Trustees Of The Leland Stanford Junior University | Devices, systems and methods for optogenetic modulation of action potentials in target cells |
AU2014306679A1 (en) | 2013-08-14 | 2016-03-10 | Circuit Therapeutics, Inc. | Compositions and methods for controlling pain |
JP6118239B2 (en) * | 2013-11-29 | 2017-04-19 | 雅敏 堀 | Pest control method and control device |
US10039934B2 (en) * | 2013-12-30 | 2018-08-07 | PhotonEdge Inc. | Multi-wavelength interleaved optical stimulation |
WO2015167639A1 (en) | 2014-02-07 | 2015-11-05 | Massachusetts Institute Of Technology | Blue light-activated ion channel molecules and uses thereof |
AU2015237265A1 (en) | 2014-03-28 | 2016-10-13 | The Board Of Trustees Of The Leland Stanford Junior University | Engineered light-activated anion channel proteins and methods of use thereof |
US10882892B2 (en) | 2014-08-05 | 2021-01-05 | Massachusetts Institute Of Technology | Channelrhodopsin variants and uses thereof |
US10542961B2 (en) | 2015-06-15 | 2020-01-28 | The Research Foundation For The State University Of New York | System and method for infrasonic cardiac monitoring |
WO2016209654A1 (en) | 2015-06-22 | 2016-12-29 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and devices for imaging and/or optogenetic control of light-responsive neurons |
WO2017048808A1 (en) * | 2015-09-15 | 2017-03-23 | The Board Of Trustees Of The Leland Stanford Junior University | Light-responsive polypeptides and methods of use thereof |
US10324080B2 (en) * | 2015-11-17 | 2019-06-18 | Purdue Research Foundation | Systems and methods for automated image-guided patch-clamp electrophysiology in vitro |
IL283779B (en) * | 2015-11-24 | 2022-09-01 | Massachusetts Inst Technology | Systems and methods for preventing, mitigating, and/or treating dementia |
JP7071332B2 (en) | 2016-07-29 | 2022-05-18 | ザ リージェンツ オブ ザ ユニバーシティ オブ カリフォルニア | Adeno-associated virus virions with mutant capsids and how to use them |
CN117701604A (en) | 2016-09-02 | 2024-03-15 | 学校法人庆应义塾 | Visual function regenerating agent or visual function decreasing preventive agent |
AU2017372351B2 (en) * | 2016-11-06 | 2019-12-12 | Nanoscope Technologies Llc | Optogenetic modulation by multi-characteristic opsins for vision restoration and other applications thereof |
US11294165B2 (en) | 2017-03-30 | 2022-04-05 | The Board Of Trustees Of The Leland Stanford Junior University | Modular, electro-optical device for increasing the imaging field of view using time-sequential capture |
CN110475830B (en) | 2017-04-03 | 2022-03-25 | 富士胶片株式会社 | Ink composition, method for producing same, and image forming method |
WO2019060298A1 (en) | 2017-09-19 | 2019-03-28 | Neuroenhancement Lab, LLC | Method and apparatus for neuroenhancement |
EP3694464A4 (en) | 2017-10-10 | 2021-07-07 | Massachusetts Institute of Technology | Systems and methods for preventing, mitigating, and/or treating dementia |
US11717686B2 (en) | 2017-12-04 | 2023-08-08 | Neuroenhancement Lab, LLC | Method and apparatus for neuroenhancement to facilitate learning and performance |
US11318277B2 (en) | 2017-12-31 | 2022-05-03 | Neuroenhancement Lab, LLC | Method and apparatus for neuroenhancement to enhance emotional response |
US11364361B2 (en) | 2018-04-20 | 2022-06-21 | Neuroenhancement Lab, LLC | System and method for inducing sleep by transplanting mental states |
CA3112564A1 (en) | 2018-09-14 | 2020-03-19 | Neuroenhancement Lab, LLC | System and method of improving sleep |
EP3860337A4 (en) * | 2018-10-01 | 2022-07-13 | Cornell University | Kits and methods for performing optical dynamic clamp on excitable cells |
IL265486A (en) | 2019-03-19 | 2020-09-30 | Yeda Res & Dev | Bistable type ii opsins and uses thereof |
US11771741B2 (en) | 2019-09-13 | 2023-10-03 | Restore Vision Inc. | Nucleic acid construct that encodes chimeric rhodopsin |
JPWO2021049634A1 (en) * | 2019-09-13 | 2021-03-18 | ||
WO2021066053A1 (en) * | 2019-09-30 | 2021-04-08 | 国立大学法人筑波大学 | Method for inducing hibernation-like state and device therefor |
JPWO2021193731A1 (en) * | 2020-03-24 | 2021-09-30 | ||
WO2024092248A1 (en) * | 2022-10-28 | 2024-05-02 | The Board Of Trustees Of The Leland Stanford Junior University | Enhanced light gated potassium selective channelrhodopsin |
Family Cites Families (306)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US2968302A (en) | 1956-07-20 | 1961-01-17 | Univ Illinois | Multibeam focusing irradiator |
US3131690A (en) | 1962-10-22 | 1964-05-05 | American Optical Corp | Fiber optics devices |
US3499437A (en) | 1967-03-10 | 1970-03-10 | Ultrasonic Systems | Method and apparatus for treatment of organic structures and systems thereof with ultrasonic energy |
US3567847A (en) | 1969-01-06 | 1971-03-02 | Edgar E Price | Electro-optical display system |
US4162808A (en) | 1978-05-23 | 1979-07-31 | Gulf Oil Corporation | In-situ retorting of carbonaceous deposits |
US4343301A (en) | 1979-10-04 | 1982-08-10 | Robert Indech | Subcutaneous neural stimulation or local tissue destruction |
US4559951A (en) | 1982-11-29 | 1985-12-24 | Cardiac Pacemakers, Inc. | Catheter assembly |
US4616231A (en) | 1984-03-26 | 1986-10-07 | Hughes Aircraft Company | Narrow-band beam steering system |
US4797368A (en) | 1985-03-15 | 1989-01-10 | The United States Of America As Represented By The Department Of Health And Human Services | Adeno-associated virus as eukaryotic expression vector |
FR2580277B1 (en) | 1985-04-15 | 1988-06-10 | Oreal | NOVEL NAPHTHALENIC DERIVATIVES WITH RETINOIC ACTION, THEIR PREPARATION METHOD AND MEDICINAL AND COSMETIC COMPOSITIONS CONTAINING THEM |
US4865042A (en) | 1985-08-16 | 1989-09-12 | Hitachi, Ltd. | Ultrasonic irradiation system |
US5139941A (en) | 1985-10-31 | 1992-08-18 | University Of Florida Research Foundation, Inc. | AAV transduction vectors |
US5041224A (en) | 1988-03-28 | 1991-08-20 | Canon Kabushiki Kaisha | Ion permeable membrane and ion transport method by utilizing said membrane |
US5082670A (en) | 1988-12-15 | 1992-01-21 | The Regents Of The University Of California | Method of grafting genetically modified cells to treat defects, disease or damage or the central nervous system |
JP2882818B2 (en) | 1989-09-08 | 1999-04-12 | 株式会社エス・エル・ティ・ジャパン | Laser irradiation equipment |
CA2028261C (en) | 1989-10-28 | 1995-01-17 | Won Suck Yang | Non-invasive method and apparatus for measuring blood glucose concentration |
US5032123A (en) | 1989-12-28 | 1991-07-16 | Cordis Corporation | Laser catheter with radially divergent treatment beam |
AU7906691A (en) | 1990-05-23 | 1991-12-10 | United States of America, as represented by the Secretary, U.S. Department of Commerce, The | Adeno-associated virus (aav)-based eucaryotic vectors |
US5173414A (en) | 1990-10-30 | 1992-12-22 | Applied Immune Sciences, Inc. | Production of recombinant adeno-associated virus vectors |
EP0785273A1 (en) | 1990-11-26 | 1997-07-23 | Genetics Institute, Inc. | Paired basic amino acid converting enzyme and DNA sequence encoding it |
US5550316A (en) | 1991-01-02 | 1996-08-27 | Fox Chase Cancer Center | Transgenic animal model system for human cutaneous melanoma |
US6497872B1 (en) | 1991-07-08 | 2002-12-24 | Neurospheres Holdings Ltd. | Neural transplantation using proliferated multipotent neural stem cells and their progeny |
US5249575A (en) | 1991-10-21 | 1993-10-05 | Adm Tronics Unlimited, Inc. | Corona discharge beam thermotherapy system |
US5252479A (en) | 1991-11-08 | 1993-10-12 | Research Corporation Technologies, Inc. | Safe vector for gene therapy |
SE9103752D0 (en) | 1991-12-18 | 1991-12-18 | Astra Ab | NEW COMPOUNDS |
US5670113A (en) | 1991-12-20 | 1997-09-23 | Sibia Neurosciences, Inc. | Automated analysis equipment and assay method for detecting cell surface protein and/or cytoplasmic receptor function using same |
US5739273A (en) | 1992-02-12 | 1998-04-14 | Yale University | Transmembrane polypeptide and methods of use |
US5460954A (en) | 1992-04-01 | 1995-10-24 | Cheil Foods & Chemicals, Inc. | Production of human proinsulin using a novel vector system |
US5330515A (en) | 1992-06-17 | 1994-07-19 | Cyberonics, Inc. | Treatment of pain by vagal afferent stimulation |
US5382516A (en) | 1992-09-15 | 1995-01-17 | Schleicher & Schuell, Inc. | Method and devices for delivery of substrate for the detection of enzyme-linked, membrane-based binding assays |
US5527695A (en) | 1993-01-29 | 1996-06-18 | Purdue Research Foundation | Controlled modification of eukaryotic genomes |
JPH08508162A (en) | 1993-03-25 | 1996-09-03 | ザ リージェンツ オブ ザ ユニバーシティ オブ カリフォルニア | Expression of heterologous polypeptides in halobacterium |
JP3128386B2 (en) | 1993-04-07 | 2001-01-29 | 三洋電機株式会社 | Neural model element |
US5411540A (en) | 1993-06-03 | 1995-05-02 | Massachusetts Institute Of Technology | Method and apparatus for preferential neuron stimulation |
GB2278783A (en) | 1993-06-11 | 1994-12-14 | Daniel Shellon Gluck | Method of magnetically stimulating neural cells |
US6346101B1 (en) | 1993-07-19 | 2002-02-12 | Research Foundation Of City College Of New York | Photon-mediated introduction of biological materials into cells and/or cellular components |
US5445608A (en) | 1993-08-16 | 1995-08-29 | James C. Chen | Method and apparatus for providing light-activated therapy |
JPH07171162A (en) | 1993-09-07 | 1995-07-11 | Olympus Optical Co Ltd | Laser probe |
US6251100B1 (en) | 1993-09-24 | 2001-06-26 | Transmedica International, Inc. | Laser assisted topical anesthetic permeation |
US5470307A (en) | 1994-03-16 | 1995-11-28 | Lindall; Arnold W. | Catheter system for controllably releasing a therapeutic agent at a remote tissue site |
EP0755454B1 (en) | 1994-04-13 | 2008-02-13 | The Rockefeller University | Aav-mediated delivery of dna to cells of the nervous system |
US6436908B1 (en) | 1995-05-30 | 2002-08-20 | Duke University | Use of exogenous β-adrenergic receptor and β-adrenergic receptor kinase gene constructs to enhance myocardial function |
US5495541A (en) | 1994-04-19 | 1996-02-27 | Murray; Steven C. | Optical delivery device with high numerical aperture curved waveguide |
US5503737A (en) | 1994-07-25 | 1996-04-02 | Ingersoll-Rand Company | Air inflow restrictor for disc filters |
US5807285A (en) | 1994-08-18 | 1998-09-15 | Ethicon-Endo Surgery, Inc. | Medical applications of ultrasonic energy |
US5520188A (en) | 1994-11-02 | 1996-05-28 | Focus Surgery Inc. | Annular array transducer |
US5795581A (en) | 1995-03-31 | 1998-08-18 | Sandia Corporation | Controlled release of molecular components of dendrimer/bioactive complexes |
US6334846B1 (en) | 1995-03-31 | 2002-01-01 | Kabushiki Kaisha Toshiba | Ultrasound therapeutic apparatus |
WO1996032076A1 (en) | 1995-04-11 | 1996-10-17 | Baxter Internatonal Inc. | Tissue implant systems |
US6342379B1 (en) | 1995-06-07 | 2002-01-29 | The Regents Of The University Of California | Detection of transmembrane potentials by optical methods |
US6480743B1 (en) | 2000-04-05 | 2002-11-12 | Neuropace, Inc. | System and method for adaptive brain stimulation |
US5755750A (en) | 1995-11-13 | 1998-05-26 | University Of Florida | Method and apparatus for selectively inhibiting activity in nerve fibers |
US5722426A (en) | 1996-02-26 | 1998-03-03 | Kolff; Jack | Coronary light probe and method of use |
US5703985A (en) | 1996-04-29 | 1997-12-30 | Eclipse Surgical Technologies, Inc. | Optical fiber device and method for laser surgery procedures |
US5939320A (en) | 1996-05-20 | 1999-08-17 | New York University | G-coupled receptors associated with macrophage-trophic HIV, and diagnostic and therapeutic uses thereof |
US5898058A (en) | 1996-05-20 | 1999-04-27 | Wellman, Inc. | Method of post-polymerization stabilization of high activity catalysts in continuous polyethylene terephthalate production |
US20040076613A1 (en) | 2000-11-03 | 2004-04-22 | Nicholas Mazarakis | Vector system |
US7732129B1 (en) | 1998-12-01 | 2010-06-08 | Crucell Holland B.V. | Method for the production and purification of adenoviral vectors |
US5741316A (en) | 1996-12-02 | 1998-04-21 | Light Sciences Limited Partnership | Electromagnetic coil configurations for power transmission through tissue |
US5756351A (en) | 1997-01-13 | 1998-05-26 | The Regents Of The University Of California | Biomolecular optical sensors |
US5782896A (en) | 1997-01-29 | 1998-07-21 | Light Sciences Limited Partnership | Use of a shape memory alloy to modify the disposition of a device within an implantable medical probe |
US5904659A (en) | 1997-02-14 | 1999-05-18 | Exogen, Inc. | Ultrasonic treatment for wounds |
JP2000514094A (en) | 1997-04-17 | 2000-10-24 | レオネ,パオラ | Delivery system for gene therapy to the brain |
US5816256A (en) | 1997-04-17 | 1998-10-06 | Bioanalytical Systems, Inc. | Movement--responsive system for conducting tests on freely-moving animals |
US7276488B2 (en) | 1997-06-04 | 2007-10-02 | Oxford Biomedica (Uk) Limited | Vector system |
US5984861A (en) | 1997-09-29 | 1999-11-16 | Boston Scientific Corporation | Endofluorescence imaging module for an endoscope |
DK1009808T3 (en) | 1997-09-05 | 2013-01-21 | Genzyme Corp | METHODS FOR GENERATION OF HELP-FREE PREPARATIONS OF HIGH TITER RECOMBINANT AAV VECTORS |
US6989264B2 (en) | 1997-09-05 | 2006-01-24 | Targeted Genetics Corporation | Methods for generating high titer helper-free preparations of released recombinant AAV vectors |
US6566118B1 (en) | 1997-09-05 | 2003-05-20 | Targeted Genetics Corporation | Methods for generating high titer helper-free preparations of released recombinant AAV vectors |
US6016449A (en) | 1997-10-27 | 2000-01-18 | Neuropace, Inc. | System for treatment of neurological disorders |
US6647296B2 (en) | 1997-10-27 | 2003-11-11 | Neuropace, Inc. | Implantable apparatus for treating neurological disorders |
US6597954B1 (en) | 1997-10-27 | 2003-07-22 | Neuropace, Inc. | System and method for controlling epileptic seizures with spatially separated detection and stimulation electrodes |
US6790652B1 (en) | 1998-01-08 | 2004-09-14 | Bioimage A/S | Method and apparatus for high density format screening for bioactive molecules |
US6289229B1 (en) | 1998-01-20 | 2001-09-11 | Scimed Life Systems, Inc. | Readable probe array for in vivo use |
AU3550099A (en) | 1998-04-07 | 1999-10-25 | Windy Hill Technology, Inc. | Methods and devices for the localization of lesions in solid tissue |
US6319241B1 (en) | 1998-04-30 | 2001-11-20 | Medtronic, Inc. | Techniques for positioning therapy delivery elements within a spinal cord or a brain |
US6108081A (en) | 1998-07-20 | 2000-08-22 | Battelle Memorial Institute | Nonlinear vibrational microscopy |
US6632672B2 (en) | 1998-08-19 | 2003-10-14 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and compositions for genomic modification |
US6377842B1 (en) | 1998-09-22 | 2002-04-23 | Aurora Optics, Inc. | Method for quantitative measurement of fluorescent and phosphorescent drugs within tissue utilizing a fiber optic probe |
US6253109B1 (en) | 1998-11-05 | 2001-06-26 | Medtronic Inc. | System for optimized brain stimulation |
AU1344100A (en) | 1998-11-06 | 2000-05-29 | University Of Rochester | A method to improve circulation to ischemic tissue |
US6303362B1 (en) | 1998-11-19 | 2001-10-16 | The Board Of Trustees Of The Leland Stanford Junior University | Adenoviral vector and methods for making and using the same |
US6790657B1 (en) | 1999-01-07 | 2004-09-14 | The United States Of America As Represented By The Department Of Health And Human Services | Lentivirus vector system |
US7507545B2 (en) | 1999-03-31 | 2009-03-24 | Cardiome Pharma Corp. | Ion channel modulating activity method |
US6224566B1 (en) | 1999-05-04 | 2001-05-01 | Cardiodyne, Inc. | Method and devices for creating a trap for confining therapeutic drugs and/or genes in the myocardium |
US6161045A (en) | 1999-06-01 | 2000-12-12 | Neuropace, Inc. | Method for determining stimulation parameters for the treatment of epileptic seizures |
US7655423B2 (en) | 1999-06-14 | 2010-02-02 | Henry Ford Health System | Nitric oxide donors for inducing neurogenesis |
US6662039B2 (en) | 1999-06-18 | 2003-12-09 | The Trustees Of Columbia University In The City Of New York | Optical probing of neuronal connections with fluorescent indicators |
US7674463B1 (en) | 1999-07-15 | 2010-03-09 | Research Development Foundation | Method of inhibiting angiogenesis by administration of a corticotropin releasing factor receptor 2 agonist |
US20040034882A1 (en) | 1999-07-15 | 2004-02-19 | Vale Wylie W. | Corticotropin releasing factor receptor 2 deficient mice and uses thereof |
AU775394B2 (en) | 1999-07-19 | 2004-07-29 | St. Jude Medical, Atrial Fibrillation Division, Inc. | Apparatus and method for ablating tissue |
ES2152900B1 (en) | 1999-07-23 | 2001-08-16 | Palleja Xavier Estivill | TRANSGENIC MOUSES AND OVEREXPRESSION MODEL OF GEN NTRK3 (TRKC) BASED ON THE SAME FOR THE STUDY AND MONITORING OF TREATMENTS OF ANXIETY, DEPRESSION AND RELATED PSYCHIATRIC DISEASES. |
WO2001011612A1 (en) | 1999-08-06 | 2001-02-15 | Mitsubishi Chemical Corporation | Tray for conveying magnetic head for magnetic disk |
JP4827353B2 (en) | 1999-08-09 | 2011-11-30 | ターゲティッド ジェネティクス コーポレイション | Increased expression of single-stranded heterologous nucleotide sequences from recombinant viral vectors by designing sequences to form intrastrand base pairs |
GB9923558D0 (en) | 1999-10-05 | 1999-12-08 | Oxford Biomedica Ltd | Producer cell |
GB9928248D0 (en) | 1999-12-01 | 2000-01-26 | Gill Steven S | An implantable guide tube for neurosurgery |
US6808873B2 (en) | 2000-01-14 | 2004-10-26 | Mitokor, Inc. | Screening assays using intramitochondrial calcium |
US6595934B1 (en) | 2000-01-19 | 2003-07-22 | Medtronic Xomed, Inc. | Methods of skin rejuvenation using high intensity focused ultrasound to form an ablated tissue area containing a plurality of lesions |
US7706882B2 (en) | 2000-01-19 | 2010-04-27 | Medtronic, Inc. | Methods of using high intensity focused ultrasound to form an ablated tissue area |
US6808925B2 (en) | 2000-02-18 | 2004-10-26 | The Board Of Trustees Of The Leland Stanford Junior University | Altered recombinases for genome modification |
US6473639B1 (en) | 2000-03-02 | 2002-10-29 | Neuropace, Inc. | Neurological event detection procedure using processed display channel based algorithms and devices incorporating these procedures |
JP2003531609A (en) | 2000-05-01 | 2003-10-28 | ノバルティス アクチエンゲゼルシャフト | Vectors for transduction of the eye and their uses for gene therapy |
US6599281B1 (en) | 2000-05-03 | 2003-07-29 | Aspect Medical Systems, Inc. | System and method for adaptive drug delivery |
US7250294B2 (en) | 2000-05-17 | 2007-07-31 | Geron Corporation | Screening small molecule drugs using neural cells differentiated from human embryonic stem cells |
US6551346B2 (en) | 2000-05-17 | 2003-04-22 | Kent Crossley | Method and apparatus to prevent infections |
JP2004501113A (en) | 2000-06-01 | 2004-01-15 | ユニヴァーシティ・オヴ・ノース・キャロライナ・アト・チャペル・ヒル | Methods and formulations for controlled release of recombinant parvovirus vectors |
WO2002002639A2 (en) | 2000-07-05 | 2002-01-10 | Pharmacia & Upjohn Company | Human ion channels |
US7312043B2 (en) | 2000-07-10 | 2007-12-25 | Vertex Pharmaceuticals (San Diego) Llc | Ion channel assay methods |
US6921413B2 (en) | 2000-08-16 | 2005-07-26 | Vanderbilt University | Methods and devices for optical stimulation of neural tissues |
US6567690B2 (en) | 2000-10-16 | 2003-05-20 | Cole Giller | Method and apparatus for probe localization in brain matter |
US6584357B1 (en) | 2000-10-17 | 2003-06-24 | Sony Corporation | Method and system for forming an acoustic signal from neural timing difference data |
US6536440B1 (en) | 2000-10-17 | 2003-03-25 | Sony Corporation | Method and system for generating sensory data onto the human neural cortex |
US7350522B2 (en) | 2000-10-17 | 2008-04-01 | Sony Corporation | Scanning method for applying ultrasonic acoustic data to the human neural cortex |
US20020086814A1 (en) | 2000-11-15 | 2002-07-04 | Brian Storrie | B/B-like fragment targeting for the purposes of photodynamic therapy and medical imaging |
US6506154B1 (en) | 2000-11-28 | 2003-01-14 | Insightec-Txsonics, Ltd. | Systems and methods for controlling a phased array focused ultrasound system |
SE525540C2 (en) | 2000-11-30 | 2005-03-08 | Datainnovation I Lund Ab | System and procedure for automatic sampling from a sample object |
US20070196838A1 (en) | 2000-12-08 | 2007-08-23 | Invitrogen Corporation | Methods and compositions for synthesis of nucleic acid molecules using multiple recognition sites |
US6489115B2 (en) | 2000-12-21 | 2002-12-03 | The Board Of Regents Of The University Of Nebraska | Genetic assays for trinucleotide repeat mutations in eukaryotic cells |
US6615080B1 (en) | 2001-03-29 | 2003-09-02 | John Duncan Unsworth | Neuromuscular electrical stimulation of the foot muscles for prevention of deep vein thrombosis and pulmonary embolism |
US7047078B2 (en) | 2001-03-30 | 2006-05-16 | Case Western Reserve University | Methods for stimulating components in, on, or near the pudendal nerve or its branches to achieve selective physiologic responses |
AU2002303283A1 (en) | 2001-04-04 | 2002-10-21 | Irm Llc | Methods for treating drug addiction |
US7107996B2 (en) | 2001-04-10 | 2006-09-19 | Ganz Robert A | Apparatus and method for treating atherosclerotic vascular disease through light sterilization |
US6961045B2 (en) | 2001-06-16 | 2005-11-01 | Che-Chih Tsao | Pattern projection techniques for volumetric 3D displays and 2D displays |
US6810285B2 (en) | 2001-06-28 | 2004-10-26 | Neuropace, Inc. | Seizure sensing and detection using an implantable device |
WO2003016486A2 (en) | 2001-08-16 | 2003-02-27 | Sloan Kettering Institute For Cancer Research | Bio-synthetic photostimulators and methods of use |
DE60219810D1 (en) | 2001-08-23 | 2007-06-06 | Univ California | UNIVERSAL, LIGHT SWITCHABLE GENERIC PROMOTER SYSTEM |
US6974448B2 (en) | 2001-08-30 | 2005-12-13 | Medtronic, Inc. | Method for convection enhanced delivery catheter to treat brain and other tumors |
US7904176B2 (en) | 2006-09-07 | 2011-03-08 | Bio Control Medical (B.C.M.) Ltd. | Techniques for reducing pain associated with nerve stimulation |
WO2003020103A2 (en) | 2001-09-04 | 2003-03-13 | Amit Technology Science & Medicine Ltd. | Method of and device for therapeutic illumination of internal organs and tissues |
US20060057192A1 (en) | 2001-09-28 | 2006-03-16 | Kane Patrick D | Localized non-invasive biological modulation system |
US7175596B2 (en) | 2001-10-29 | 2007-02-13 | Insightec-Txsonics Ltd | System and method for sensing and locating disturbances in an energy path of a focused ultrasound system |
US7303578B2 (en) | 2001-11-01 | 2007-12-04 | Photothera, Inc. | Device and method for providing phototherapy to the brain |
US8308784B2 (en) | 2006-08-24 | 2012-11-13 | Jackson Streeter | Low level light therapy for enhancement of neurologic function of a patient affected by Parkinson's disease |
WO2003040323A2 (en) | 2001-11-08 | 2003-05-15 | Children's Medical Center Corporation | Bacterial ion channel and a method for screening ion channel modulators |
WO2003041496A1 (en) | 2001-11-14 | 2003-05-22 | Yamanouchi Pharmaceutical Co., Ltd. | Transgenic animal |
US20030232430A1 (en) | 2001-11-26 | 2003-12-18 | Advanced Cell Technology | Methods for making and using reprogrammed human somatic cell nuclei and autologous and isogenic human stem cells |
US20030104512A1 (en) | 2001-11-30 | 2003-06-05 | Freeman Alex R. | Biosensors for single cell and multi cell analysis |
US6873868B2 (en) | 2001-12-31 | 2005-03-29 | Infraredx, Inc. | Multi-fiber catheter probe arrangement for tissue analysis or treatment |
US6721603B2 (en) | 2002-01-25 | 2004-04-13 | Cyberonics, Inc. | Nerve stimulation as a treatment for pain |
US6666857B2 (en) | 2002-01-29 | 2003-12-23 | Robert F. Smith | Integrated wavefront-directed topography-controlled photoablation |
AU2003208901A1 (en) | 2002-02-01 | 2003-09-02 | The Cleveland Clinic Foundation | Microinfusion device |
CA2476873A1 (en) | 2002-02-20 | 2003-08-28 | Liposonix, Inc. | Ultrasonic treatment and imaging of adipose tissue |
JP4363843B2 (en) | 2002-03-08 | 2009-11-11 | オリンパス株式会社 | Capsule endoscope |
US20030186249A1 (en) | 2002-04-01 | 2003-10-02 | Zairen Sun | Human TARPP genes and polypeptides |
US20070135875A1 (en) | 2002-04-08 | 2007-06-14 | Ardian, Inc. | Methods and apparatus for thermally-induced renal neuromodulation |
DE10216005A1 (en) | 2002-04-11 | 2003-10-30 | Max Planck Gesellschaft | Use of biological photoreceptors as direct light-controlled ion channels |
US9592409B2 (en) | 2002-04-30 | 2017-03-14 | The Regents Of The University Of California | Methods for modifying electrical currents in neuronal circuits |
US7283861B2 (en) | 2002-04-30 | 2007-10-16 | Alexander Bystritsky | Methods for modifying electrical currents in neuronal circuits |
WO2003096045A1 (en) | 2002-05-13 | 2003-11-20 | Koninklijke Philips Electronics N.V. | Reduction of susceptibility artifacts in subencoded single-shot magnetic resonance imaging |
AU2003239947A1 (en) | 2002-05-31 | 2003-12-19 | Sloan-Kettering Institute For Cancer Research | Heterologous stimulus-gated ion channels and methods of using same |
US7280870B2 (en) | 2002-06-04 | 2007-10-09 | Brown University Research Foundation | Optically-connected implants and related systems and methods of use |
CA2489291A1 (en) | 2002-06-12 | 2003-12-24 | Fraunhofer-Gesellschaft Zur Foerderung Der Angewandten Forschung E.V. | Vegetable protein preparations and use thereof |
US7292890B2 (en) | 2002-06-20 | 2007-11-06 | Advanced Bionics Corporation | Vagus nerve stimulation via unidirectional propagation of action potentials |
US20050020945A1 (en) | 2002-07-02 | 2005-01-27 | Tosaya Carol A. | Acoustically-aided cerebrospinal-fluid manipulation for neurodegenerative disease therapy |
US20040049134A1 (en) | 2002-07-02 | 2004-03-11 | Tosaya Carol A. | System and methods for treatment of alzheimer's and other deposition-related disorders of the brain |
EP1527407A2 (en) | 2002-08-09 | 2005-05-04 | Siemens Aktiengesellschaft | Method and computer program comprising program code means, and computer program product for analysing the activity of a pharmaceutical preparation |
AU2003265509A1 (en) | 2002-08-19 | 2004-03-03 | Arizona Board Regents | Neurostimulator |
US20060014206A1 (en) | 2002-10-10 | 2006-01-19 | Menghang Xia | Assay methods for state-dependent calcium channel agonists/antagonists |
US7355033B2 (en) | 2002-11-18 | 2008-04-08 | Health Research, Inc. | Screening for West Nile Virus antiviral therapy |
CA2507880A1 (en) | 2002-12-16 | 2004-07-22 | Genentech, Inc. | Transgenic mice expressing human cd20 and/or cd16 |
US20040122475A1 (en) | 2002-12-18 | 2004-06-24 | Myrick Andrew J. | Electrochemical neuron systems |
US20040216177A1 (en) | 2003-04-25 | 2004-10-28 | Otsuka Pharmaceutical Co., Ltd. | Congenic rats containing a mutant GPR10 gene |
US7377900B2 (en) | 2003-06-02 | 2008-05-27 | Insightec - Image Guided Treatment Ltd. | Endo-cavity focused ultrasound transducer |
CA2432810A1 (en) | 2003-06-19 | 2004-12-19 | Andres M. Lozano | Method of treating depression, mood disorders and anxiety disorders by brian infusion |
US7091500B2 (en) | 2003-06-20 | 2006-08-15 | Lucent Technologies Inc. | Multi-photon endoscopic imaging system |
WO2005007233A2 (en) | 2003-06-20 | 2005-01-27 | Massachusetts Institute Of Technology | Application of electrical stimulation for functional tissue engineering in vitro and in vivo |
JP2005034073A (en) | 2003-07-16 | 2005-02-10 | Masamitsu Iino | Fluorescent probe for assaying myosin light chain phosphorylation |
US20050153885A1 (en) | 2003-10-08 | 2005-07-14 | Yun Anthony J. | Treatment of conditions through modulation of the autonomic nervous system |
EP1684861B1 (en) | 2003-10-21 | 2014-12-03 | The Regents Of The University Of Michigan | Intracranial neural interface system |
US6952097B2 (en) | 2003-10-22 | 2005-10-04 | Siemens Aktiengesellschaft | Method for slice position planning of tomographic measurements, using statistical images |
US20080119421A1 (en) | 2003-10-31 | 2008-05-22 | Jack Tuszynski | Process for treating a biological organism |
US20060034943A1 (en) | 2003-10-31 | 2006-02-16 | Technology Innovations Llc | Process for treating a biological organism |
CN1997749A (en) | 2003-11-21 | 2007-07-11 | 约翰·霍普金斯大学 | Biomolecule partition motifs and uses thereof |
US20050124897A1 (en) | 2003-12-03 | 2005-06-09 | Scimed Life Systems, Inc. | Apparatus and methods for delivering acoustic energy to body tissue |
US7783349B2 (en) | 2006-04-10 | 2010-08-24 | Cardiac Pacemakers, Inc. | System and method for closed-loop neural stimulation |
CN1236305C (en) | 2004-02-03 | 2006-01-11 | 复旦大学 | Preparation method for biologic photosensitive protein-nanometer semiconductor composite photoelectric electrode |
US7662114B2 (en) | 2004-03-02 | 2010-02-16 | Focus Surgery, Inc. | Ultrasound phased arrays |
US20050215764A1 (en) | 2004-03-24 | 2005-09-29 | Tuszynski Jack A | Biological polymer with differently charged portions |
ITMI20040598A1 (en) | 2004-03-26 | 2004-06-26 | Carlotta Giorgi | METHOD FOR DETECTION OF INTRACELLULAR PARAMETERS WITH LUMINESCENT PROTEIN PROBES FOR THE SCREENING OF MOLECULES ABLE TO ALTER THE SAID PARAMETERS |
US9801527B2 (en) | 2004-04-19 | 2017-10-31 | Gearbox, Llc | Lumen-traveling biological interface device |
WO2005107858A1 (en) | 2004-04-30 | 2005-11-17 | Advanced Neuromodulation Systems, Inc. | Method of treating mood disorders and/or anxiety disorders by brain stimulation |
US7670838B2 (en) | 2004-05-24 | 2010-03-02 | The Board Of Trustees Of The Leland Stanford Junior University | Coupling of excitation and neurogenesis in neural stem/progenitor cells |
US20050279354A1 (en) | 2004-06-21 | 2005-12-22 | Harvey Deutsch | Structures and Methods for the Joint Delivery of Fluids and Light |
US20060057614A1 (en) | 2004-08-04 | 2006-03-16 | Nathaniel Heintz | Tethering neuropeptides and toxins for modulation of ion channels and receptors |
US7699780B2 (en) | 2004-08-11 | 2010-04-20 | Insightec—Image-Guided Treatment Ltd. | Focused ultrasound system with adaptive anatomical aperture shaping |
US8409099B2 (en) | 2004-08-26 | 2013-04-02 | Insightec Ltd. | Focused ultrasound system for surrounding a body tissue mass and treatment method |
WO2006024038A2 (en) | 2004-08-27 | 2006-03-02 | Codman & Shurtleff | Light-based implant for treating alzheimer’s disease |
US7613520B2 (en) | 2004-10-21 | 2009-11-03 | Advanced Neuromodulation Systems, Inc. | Spinal cord stimulation to treat auditory dysfunction |
US7544171B2 (en) | 2004-10-22 | 2009-06-09 | General Patent Llc | Methods for promoting nerve regeneration and neuronal growth and elongation |
WO2007013891A2 (en) | 2004-11-12 | 2007-02-01 | Northwestern University | Apparatus and methods for optical stimulation of the auditory nerve |
AU2005307870A1 (en) | 2004-11-15 | 2006-05-26 | Christopher Decharms | Stimulation of neural tissue with light |
US8109981B2 (en) | 2005-01-25 | 2012-02-07 | Valam Corporation | Optical therapies and devices |
US7686839B2 (en) | 2005-01-26 | 2010-03-30 | Lumitex, Inc. | Phototherapy treatment devices for applying area lighting to a wound |
US7553284B2 (en) | 2005-02-02 | 2009-06-30 | Vaitekunas Jeffrey J | Focused ultrasound for pain reduction |
US9034650B2 (en) | 2005-02-02 | 2015-05-19 | Intrexon Corporation | Site-specific serine recombinases and methods of their use |
JP2006217866A (en) * | 2005-02-10 | 2006-08-24 | Tohoku Univ | Neurocyte to which photosensitivity is newly imparted |
US7548780B2 (en) | 2005-02-22 | 2009-06-16 | Cardiac Pacemakers, Inc. | Cell therapy and neural stimulation for cardiac repair |
US7288108B2 (en) | 2005-03-14 | 2007-10-30 | Codman & Shurtleff, Inc. | Red light implant for treating Parkinson's disease |
US20070059775A1 (en) | 2005-03-29 | 2007-03-15 | The Trustees Of Columbia University In The City Of New York | Synthesis and conjugation of iron oxide nanoparticles to antibodies for targeting specific cells using fluorescence and MR imaging techniques |
ES2668959T3 (en) | 2005-03-31 | 2018-05-23 | Esther Mayer | Probe device for tissue photobiomodulation that covers a body cavity |
JP2006295350A (en) | 2005-04-07 | 2006-10-26 | Sony Corp | Imaging apparatus and method of processing imaging result |
US9445211B2 (en) | 2005-04-11 | 2016-09-13 | St. Jude Medical, Atrial Fibrillation Division, Inc. | Methods for manufacturing high intensity ultrasound transducers |
GB0508254D0 (en) | 2005-04-23 | 2005-06-01 | Smith & Nephew | Ultrasound device |
US7640057B2 (en) | 2005-04-25 | 2009-12-29 | Cardiac Pacemakers, Inc. | Methods of providing neural markers for sensed autonomic nervous system activity |
WO2006113998A1 (en) | 2005-04-26 | 2006-11-02 | University Of Victoria Innovation And Development Corporation | Production of light from sol-gel derived thin films made with lanthanide doped nanoparticles, and preparation thereof |
DK1879623T3 (en) | 2005-05-02 | 2012-12-17 | Genzyme Corp | GENTERAPY FOR BACKGROUND DISEASES |
CN1879906A (en) | 2005-06-15 | 2006-12-20 | 郑云峰 | Magnetic stimulating device for nervous centralis system and its usage method |
US20070027443A1 (en) | 2005-06-29 | 2007-02-01 | Ondine International, Ltd. | Hand piece for the delivery of light and system employing the hand piece |
US9274099B2 (en) | 2005-07-22 | 2016-03-01 | The Board Of Trustees Of The Leland Stanford Junior University | Screening test drugs to identify their effects on cell membrane voltage-gated ion channel |
US10052497B2 (en) | 2005-07-22 | 2018-08-21 | The Board Of Trustees Of The Leland Stanford Junior University | System for optical stimulation of target cells |
US8926959B2 (en) | 2005-07-22 | 2015-01-06 | The Board Of Trustees Of The Leland Stanford Junior University | System for optical stimulation of target cells |
US9238150B2 (en) | 2005-07-22 | 2016-01-19 | The Board Of Trustees Of The Leland Stanford Junior University | Optical tissue interface method and apparatus for stimulating cells |
US20070053996A1 (en) | 2005-07-22 | 2007-03-08 | Boyden Edward S | Light-activated cation channel and uses thereof |
US7736382B2 (en) | 2005-09-09 | 2010-06-15 | Lockheed Martin Corporation | Apparatus for optical stimulation of nerves and other animal tissue |
US8852184B2 (en) | 2005-09-15 | 2014-10-07 | Cannuflow, Inc. | Arthroscopic surgical temperature control system |
US7988688B2 (en) | 2006-09-21 | 2011-08-02 | Lockheed Martin Corporation | Miniature apparatus and method for optical stimulation of nerves and other animal tissue |
US8058509B2 (en) | 2005-12-21 | 2011-11-15 | Pioneer Hi-Bred International, Inc. | Methods and compositions for in planta production of inverted repeats |
US7610100B2 (en) | 2005-12-30 | 2009-10-27 | Boston Scientific Neuromodulation Corporation | Methods and systems for treating osteoarthritis |
US20070191906A1 (en) | 2006-02-13 | 2007-08-16 | Anand Iyer | Method and apparatus for selective nerve stimulation |
US20070219600A1 (en) | 2006-03-17 | 2007-09-20 | Michael Gertner | Devices and methods for targeted nasal phototherapy |
US20070282404A1 (en) | 2006-04-10 | 2007-12-06 | University Of Rochester | Side-firing linear optic array for interstitial optical therapy and monitoring using compact helical geometry |
US20070253995A1 (en) | 2006-04-28 | 2007-11-01 | Medtronic, Inc. | Drug Delivery Methods and Devices for Treating Stress Urinary Incontinence |
US8057464B2 (en) | 2006-05-03 | 2011-11-15 | Light Sciences Oncology, Inc. | Light transmission system for photoreactive therapy |
JP2009536219A (en) | 2006-05-04 | 2009-10-08 | ウェイン・ステート・ユニバーシティー | Recovery of visual response by in vivo delivery of rhodopsin diffusion |
US20080176076A1 (en) | 2006-05-11 | 2008-07-24 | University Of Victoria Innovation And Development Corporation | Functionalized lanthanide rich nanoparticles and use thereof |
US20080262411A1 (en) | 2006-06-02 | 2008-10-23 | Dobak John D | Dynamic nerve stimulation in combination with other eating disorder treatment modalities |
WO2007149811A2 (en) | 2006-06-19 | 2007-12-27 | Highland Instruments, Inc. | Apparatus and method for stimulation of biological tissue |
US7795632B2 (en) | 2006-06-26 | 2010-09-14 | Osram Sylvania Inc. | Light emitting diode with direct view optic |
US20080027505A1 (en) | 2006-07-26 | 2008-01-31 | G&L Consulting, Llc | System and method for treatment of headaches |
US9284363B2 (en) | 2006-07-26 | 2016-03-15 | Case Western Reserve University | System and method for controlling G-protein coupled receptor pathways |
SG139588A1 (en) | 2006-07-28 | 2008-02-29 | St Microelectronics Asia | Addressable led architecure |
US7848797B2 (en) | 2006-08-17 | 2010-12-07 | Neurometrix, Inc. | Motor unit number estimation (MUNE) for the assessment of neuromuscular function |
US7521590B2 (en) | 2006-09-01 | 2009-04-21 | Korea Institute Of Science And Technology | Phospholipase C β1 (PLCβ1) knockout mice as a model system for testing schizophrenia drugs |
US10420948B2 (en) | 2006-10-30 | 2019-09-24 | Medtronic, Inc. | Implantable medical device with variable data retransmission characteristics based upon data type |
WO2008070765A2 (en) | 2006-12-06 | 2008-06-12 | Case Western Reserve University | Light-sensitive constructs for inducing cell death and cell signaling |
EE200600039A (en) | 2006-12-12 | 2008-10-15 | Tartu Ülikool | Animal Transgenic Model for Modeling Pathological Anxiety, Method for Identifying Compounds Suitable for the Treatment of Pathological Anxiety Diseases or Conditions, and Method for Wfs1 Protein Targeting Against Pathological Anxiety |
US8398692B2 (en) | 2007-01-10 | 2013-03-19 | The Board Of Trustees Of The Leland Stanford Junior University | System for optical stimulation of target cells |
US7883536B1 (en) | 2007-01-19 | 2011-02-08 | Lockheed Martin Corporation | Hybrid optical-electrical probes |
US8401609B2 (en) | 2007-02-14 | 2013-03-19 | The Board Of Trustees Of The Leland Stanford Junior University | System, method and applications involving identification of biological circuits such as neurological characteristics |
WO2008106694A2 (en) | 2007-03-01 | 2008-09-04 | The Board Of Trustees Of The Leland Stanford Junior University | Systems, methods and compositions for optical stimulation of target cells |
US8282559B2 (en) | 2007-03-09 | 2012-10-09 | Philip Chidi Njemanze | Method for inducing and monitoring long-term potentiation and long-term depression using transcranial doppler ultrasound device in head-down bed rest |
US8139339B2 (en) | 2007-03-16 | 2012-03-20 | Old Dominion University Research Foundation | Modulation of neuromuscular functions with ultrashort electrical pulses |
US20080287821A1 (en) | 2007-03-30 | 2008-11-20 | Searete Llc, A Limited Liability Corporation Of The State Of Delaware | Computational user-health testing |
EP2142082A4 (en) | 2007-05-01 | 2015-10-28 | Neurofocus Inc | Neuro-informatics repository system |
US20110165681A1 (en) | 2009-02-26 | 2011-07-07 | Massachusetts Institute Of Technology | Light-Activated Proton Pumps and Applications Thereof |
US8097422B2 (en) * | 2007-06-20 | 2012-01-17 | Salk Institute For Biological Studies | Kir channel modulators |
US9138596B2 (en) | 2007-08-22 | 2015-09-22 | Cardiac Pacemakers, Inc. | Optical depolarization of cardiac tissue |
US10434327B2 (en) | 2007-10-31 | 2019-10-08 | The Board Of Trustees Of The Leland Stanford Junior University | Implantable optical stimulators |
US10035027B2 (en) | 2007-10-31 | 2018-07-31 | The Board Of Trustees Of The Leland Stanford Junior University | Device and method for ultrasonic neuromodulation via stereotactic frame based technique |
US9302116B2 (en) | 2007-11-06 | 2016-04-05 | Duke University | Non-invasive energy upconversion methods and systems for in-situ photobiomodulation |
US20090157145A1 (en) | 2007-11-26 | 2009-06-18 | Lawrence Cauller | Transfer Coil Architecture |
EP2222372A2 (en) * | 2007-12-06 | 2010-09-01 | Technion Research & Development Foundation Ltd. | Method and system for optical stimulation of neurons |
US8883719B2 (en) | 2008-01-16 | 2014-11-11 | University Of Connecticut | Bacteriorhodopsin protein variants and methods of use for long term data storage |
US20090254134A1 (en) | 2008-02-04 | 2009-10-08 | Medtrode Inc. | Hybrid ultrasound/electrode device for neural stimulation and recording |
JP5544659B2 (en) * | 2008-03-24 | 2014-07-09 | 国立大学法人東北大学 | Modified photoreceptor channel-type rhodopsin protein |
CN105288619A (en) | 2008-04-04 | 2016-02-03 | 免疫之光有限责任公司 | Non-invasive systems and methods for in-situ photobiomodulation |
RU2010147661A (en) | 2008-04-23 | 2012-05-27 | Дзе Борд Оф Трастиз Оф Дзе Лелэнд Стэнфорд Джуниор Юниверсити (Us) | SYSTEMS, METHODS AND COMPOSITIONS FOR THE OPTICAL STIMULATION OF TARGET CELLS |
CN102159713A (en) | 2008-05-20 | 2011-08-17 | Eos神经科学公司 | Vectors for delivery of light-sensitive proteins and methods of use |
EP2610350B1 (en) | 2008-05-29 | 2014-12-17 | The Board Of Trustees Of The Leland Stanford Junior University | Cell line, system and method for optical control of secondary messengers |
US8636653B2 (en) | 2008-06-09 | 2014-01-28 | Capso Vision, Inc. | In vivo camera with multiple sources to illuminate tissue at different distances |
AU2009260029B2 (en) | 2008-06-17 | 2016-03-17 | The Board Of Trustees Of The Leland Stanford Junior University | Methods, systems and devices for optical stimulation of target cells using an optical transmission element |
US10711242B2 (en) | 2008-06-17 | 2020-07-14 | The Board Of Trustees Of The Leland Stanford Junior University | Apparatus and methods for controlling cellular development |
WO2010006049A1 (en) | 2008-07-08 | 2010-01-14 | The Board Of Trustees Of The Leland Stanford Junior University | Materials and approaches for optical stimulation of the peripheral nervous system |
JP2012503798A (en) | 2008-09-25 | 2012-02-09 | ザ トラスティーズ オブ コロンビア ユニヴァーシティ イン ザ シティ オブ ニューヨーク | Device, apparatus and method for providing light stimulation and imaging of structures |
NZ602416A (en) | 2008-11-14 | 2014-08-29 | Univ Leland Stanford Junior | Optically-based stimulation of target cells and modifications thereto |
WO2010061686A1 (en) | 2008-11-26 | 2010-06-03 | シャープ株式会社 | Liquid crystal display device, liquid crystal display device drive method, and television receiver |
EP2411091A4 (en) | 2009-03-24 | 2012-09-12 | Spinal Modulation Inc | Pain management with stimulation subthreshold to paresthesia |
KR101081360B1 (en) | 2009-03-25 | 2011-11-08 | 한국과학기술연구원 | Photostimulation array apparatus |
WO2011005978A2 (en) | 2009-07-08 | 2011-01-13 | Duke University | Methods of manipulating cell signaling |
EP2465931B1 (en) * | 2009-08-10 | 2014-12-24 | Tohoku University | Light-receiving channel rhodopsin having improved expression efficiency |
US20110112463A1 (en) | 2009-11-12 | 2011-05-12 | Jerry Silver | Compositions and methods for treating a neuronal injury or neuronal disorders |
US20110125078A1 (en) | 2009-11-25 | 2011-05-26 | Medtronic, Inc. | Optical stimulation therapy |
CN102858402B (en) | 2010-02-26 | 2016-03-30 | 康奈尔大学 | Retina prosthese |
AU2011227131B2 (en) | 2010-03-17 | 2014-11-13 | The Board Of Trustees Of The Leland Stanford Junior University | Light-sensitive ion-passing molecules |
WO2011127088A2 (en) | 2010-04-05 | 2011-10-13 | Eos Neuroscience, Inc. | Methods and compositions for decreasing chronic pain |
US10051240B2 (en) | 2010-06-14 | 2018-08-14 | Howard Hughes Medical Institute | Structured plane illumination microscopy |
WO2012027358A1 (en) | 2010-08-23 | 2012-03-01 | President And Fellows Of Harvard College | Optogenetic probes for measuring membrane potential |
SG188409A1 (en) | 2010-09-08 | 2013-04-30 | Max Planck Gesellschaft | Mutant channelrhodopsin 2 |
CN105941328B (en) | 2010-11-05 | 2019-04-09 | 斯坦福大学托管董事会 | It is a kind of to identify the system for inhibiting the compound of depolarising of excitability or inhibitory neuron in prefrontal cortex |
CA2816968C (en) | 2010-11-05 | 2019-11-26 | The Board Of Trustees Of The Leland Stanford Junior University | Optically-controlled cns dysfunction |
EP2635110B1 (en) * | 2010-11-05 | 2018-05-09 | The Board of Trustees of the Leland Stanford Junior University | Control and characterization of psychotic states |
EP2635346B1 (en) | 2010-11-05 | 2017-03-29 | The Board of Trustees of the Leland Stanford Junior University | Optogenetic control of reward-related behaviors |
JP6328424B6 (en) | 2010-11-05 | 2018-07-11 | ザ ボード オブ トラスティーズ オブ ザ レランド スタンフォード ジュニア ユニバーシティー | Control and characterization of memory functions |
EP2635108B1 (en) | 2010-11-05 | 2019-01-23 | The Board of Trustees of the Leland Stanford Junior University | Light-activated chimeric opsins and methods of using the same |
CN110215614A (en) | 2010-11-05 | 2019-09-10 | 斯坦福大学托管董事会 | The upper conversion of light for light genetic method |
US8957028B2 (en) | 2010-11-13 | 2015-02-17 | Massachusetts Institute Of Technology | Red-shifted opsin molecules and uses thereof |
US8696722B2 (en) | 2010-11-22 | 2014-04-15 | The Board Of Trustees Of The Leland Stanford Junior University | Optogenetic magnetic resonance imaging |
US9939449B2 (en) | 2011-02-01 | 2018-04-10 | The University Of Vermont And State Agricultural College | Diagnostic and therapeutic methods and products related to anxiety disorders |
US20120253261A1 (en) | 2011-03-29 | 2012-10-04 | Medtronic, Inc. | Systems and methods for optogenetic modulation of cells within a patient |
WO2013003557A1 (en) | 2011-06-28 | 2013-01-03 | University Of Rochester | Photoactivatable receptors and their uses |
US9782091B2 (en) | 2011-07-25 | 2017-10-10 | Neuronexus Technologies, Inc. | Opto-electrical device for artifact reduction |
KR102023754B1 (en) | 2011-07-27 | 2019-09-20 | 더 보오드 오브 트러스티스 오브 더 유니버시티 오브 일리노이즈 | Nanopore sensors for biomolecular characterization |
CN104093833B (en) | 2011-12-16 | 2017-11-07 | 斯坦福大学托管董事会 | Opsin polypeptide and its application method |
EP2817068B1 (en) * | 2012-02-21 | 2017-04-12 | The Board of Trustees of the Leland Stanford Junior University | Compositions for treating neurogenic disorders of the pelvic floor |
JP6140737B2 (en) | 2012-02-23 | 2017-05-31 | ザ ユナイテッド ステイツ オブ アメリカ, アズ リプレゼンテッド バイ ザ セクレタリー, デパートメント オブ ヘルス アンド ヒューマン サービシーズ | Multifocal structured irradiation microscopy system and method |
EP2827707A4 (en) * | 2012-03-20 | 2015-10-21 | Univ Leland Stanford Junior | Non-human animal models of depression and methods of use thereof |
EP3659518A1 (en) | 2012-11-21 | 2020-06-03 | Circuit Therapeutics, Inc. | System and method for optogenetic therapy |
US20150323787A1 (en) | 2013-01-25 | 2015-11-12 | The Trustees Of Columbia University In The City Of New York | System, method and computer-accessible medium for depth of field imaging for three-dimensional sensing utilizing a spatial light modulator microscope arrangement |
US9636380B2 (en) | 2013-03-15 | 2017-05-02 | The Board Of Trustees Of The Leland Stanford Junior University | Optogenetic control of inputs to the ventral tegmental area |
EP2968997B1 (en) | 2013-03-15 | 2019-06-26 | The Board of Trustees of the Leland Stanford Junior University | Optogenetic control of behavioral state |
WO2014179331A2 (en) | 2013-04-29 | 2014-11-06 | The Board Of Trustees Of The Leland Stanford Junior University | Devices, systems and methods for optogenetic modulation of action potentials in target cells |
AU2014306679A1 (en) | 2013-08-14 | 2016-03-10 | Circuit Therapeutics, Inc. | Compositions and methods for controlling pain |
US20150112411A1 (en) | 2013-10-18 | 2015-04-23 | Varaya Photoceuticals, Llc | High powered light emitting diode photobiology compositions, methods and systems |
AU2015237265A1 (en) | 2014-03-28 | 2016-10-13 | The Board Of Trustees Of The Leland Stanford Junior University | Engineered light-activated anion channel proteins and methods of use thereof |
CN107106862A (en) | 2014-07-29 | 2017-08-29 | 电路治疗公司 | System and method for light genetic therapy |
CN106063076B (en) | 2014-11-11 | 2018-09-04 | 广东欧珀移动通信有限公司 | Power supply adaptor, terminal and charging system |
-
2011
- 2011-11-04 EP EP11838855.2A patent/EP2635108B1/en not_active Not-in-force
- 2011-11-04 WO PCT/US2011/059276 patent/WO2012061679A2/en active Application Filing
- 2011-11-04 CN CN201180061697.8A patent/CN103492564B/en not_active Expired - Fee Related
- 2011-11-04 EP EP18212473.5A patent/EP3486253A1/en not_active Withdrawn
- 2011-11-04 CA CA2816971A patent/CA2816971A1/en not_active Abandoned
- 2011-11-04 JP JP2013537851A patent/JP6276591B2/en not_active Expired - Fee Related
- 2011-11-04 AU AU2011323226A patent/AU2011323226B2/en not_active Ceased
- 2011-11-04 WO PCT/US2011/059272 patent/WO2012061676A1/en active Application Filing
- 2011-11-04 ES ES11838855T patent/ES2716819T3/en active Active
- 2011-11-04 CN CN201710163507.2A patent/CN106947741A/en active Pending
-
2013
- 2013-05-02 US US13/875,966 patent/US9175095B2/en active Active
-
2015
- 2015-09-23 US US14/862,926 patent/US9340589B2/en not_active Expired - Fee Related
-
2016
- 2016-05-05 US US15/147,772 patent/US9850290B2/en active Active
- 2016-12-05 JP JP2016235566A patent/JP6590786B2/en not_active Expired - Fee Related
-
2017
- 2017-11-03 US US15/803,472 patent/US10196431B2/en active Active
-
2018
- 2018-12-05 US US16/211,083 patent/US20190241627A1/en not_active Abandoned
-
2019
- 2019-07-26 JP JP2019137443A patent/JP2019205455A/en active Pending
Also Published As
Publication number | Publication date |
---|---|
JP6590786B2 (en) | 2019-10-16 |
US20130224821A1 (en) | 2013-08-29 |
EP3486253A1 (en) | 2019-05-22 |
EP2635108B1 (en) | 2019-01-23 |
JP2017074056A (en) | 2017-04-20 |
US9340589B2 (en) | 2016-05-17 |
US10196431B2 (en) | 2019-02-05 |
JP2014500716A (en) | 2014-01-16 |
WO2012061676A1 (en) | 2012-05-10 |
WO2012061679A2 (en) | 2012-05-10 |
AU2011323226B2 (en) | 2015-03-12 |
CN103492564A (en) | 2014-01-01 |
US9850290B2 (en) | 2017-12-26 |
CN103492564B (en) | 2017-04-19 |
WO2012061679A3 (en) | 2013-08-08 |
US9175095B2 (en) | 2015-11-03 |
JP6276591B2 (en) | 2018-02-07 |
EP2635108A2 (en) | 2013-09-11 |
AU2011323226A1 (en) | 2013-05-09 |
CA2816971A1 (en) | 2012-05-10 |
EP2635108A4 (en) | 2014-02-26 |
US20160237126A1 (en) | 2016-08-18 |
ES2716819T3 (en) | 2019-06-17 |
US20160002302A1 (en) | 2016-01-07 |
CN106947741A (en) | 2017-07-14 |
JP2019205455A (en) | 2019-12-05 |
US20180051058A1 (en) | 2018-02-22 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US10196431B2 (en) | Light-activated chimeric opsins and methods of using the same | |
AU2016202046B2 (en) | Stabilized step function opsin proteins and methods of using the same | |
US9636380B2 (en) | Optogenetic control of inputs to the ventral tegmental area | |
CN106687588A (en) | Calcium reporter gene | |
US10882892B2 (en) | Channelrhodopsin variants and uses thereof | |
AU2015203097B2 (en) | Light-activated chimeric opsins and methods of using the same | |
Fenno | Development of Novel Optogenetic and Molecular Tools and Their Application to Understanding the Neurological Basis of Behavior |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: THE BOARD OF TRUSTEES OF THE LELAND STANFORD JUNIO Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:DEISSEROTH, KARL;YIZHAR, OFER;FENNO, LIEF;AND OTHERS;SIGNING DATES FROM 20150107 TO 20150814;REEL/FRAME:047927/0460 |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |