US20190194288A1 - Cd80 extracellular domain polypeptides and their use in cancer treatment - Google Patents
Cd80 extracellular domain polypeptides and their use in cancer treatment Download PDFInfo
- Publication number
- US20190194288A1 US20190194288A1 US16/295,978 US201916295978A US2019194288A1 US 20190194288 A1 US20190194288 A1 US 20190194288A1 US 201916295978 A US201916295978 A US 201916295978A US 2019194288 A1 US2019194288 A1 US 2019194288A1
- Authority
- US
- United States
- Prior art keywords
- mol
- ecd
- cancer
- inhibitor
- tumor
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 206010028980 Neoplasm Diseases 0.000 title claims abstract description 230
- 238000011282 treatment Methods 0.000 title claims abstract description 71
- 201000011510 cancer Diseases 0.000 title claims abstract description 66
- 108090000765 processed proteins & peptides Proteins 0.000 title abstract description 67
- 102000004196 processed proteins & peptides Human genes 0.000 title abstract description 60
- 229920001184 polypeptide Polymers 0.000 title abstract description 56
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 claims abstract description 378
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 claims abstract description 365
- 230000004927 fusion Effects 0.000 claims abstract description 218
- 239000012269 PD-1/PD-L1 inhibitor Substances 0.000 claims abstract description 85
- 229940121653 pd-1/pd-l1 inhibitor Drugs 0.000 claims abstract description 85
- 239000003814 drug Substances 0.000 claims abstract description 41
- 229940124597 therapeutic agent Drugs 0.000 claims abstract description 35
- SQVRNKJHWKZAKO-UHFFFAOYSA-N beta-N-Acetyl-D-neuraminic acid Natural products CC(=O)NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO SQVRNKJHWKZAKO-UHFFFAOYSA-N 0.000 claims description 250
- SQVRNKJHWKZAKO-OQPLDHBCSA-N sialic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)OC1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-OQPLDHBCSA-N 0.000 claims description 250
- 230000004614 tumor growth Effects 0.000 claims description 85
- 238000000034 method Methods 0.000 claims description 84
- 239000000203 mixture Substances 0.000 claims description 64
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 41
- 230000005764 inhibitory process Effects 0.000 claims description 38
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 36
- 206010009944 Colon cancer Diseases 0.000 claims description 23
- 238000002560 therapeutic procedure Methods 0.000 claims description 20
- 208000001333 Colorectal Neoplasms Diseases 0.000 claims description 19
- 108010074328 Interferon-gamma Proteins 0.000 claims description 17
- 108020001507 fusion proteins Proteins 0.000 claims description 17
- 102000037865 fusion proteins Human genes 0.000 claims description 17
- 102000008070 Interferon-gamma Human genes 0.000 claims description 10
- 229960003130 interferon gamma Drugs 0.000 claims description 10
- 239000003937 drug carrier Substances 0.000 claims description 9
- 230000001939 inductive effect Effects 0.000 claims description 9
- 206010014733 Endometrial cancer Diseases 0.000 claims description 8
- 206010014759 Endometrial neoplasm Diseases 0.000 claims description 8
- 206010073071 hepatocellular carcinoma Diseases 0.000 claims description 8
- 238000000338 in vitro Methods 0.000 claims description 8
- 208000002154 non-small cell lung carcinoma Diseases 0.000 claims description 8
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 claims description 8
- 201000001441 melanoma Diseases 0.000 claims description 7
- 230000003389 potentiating effect Effects 0.000 claims description 7
- 206010005003 Bladder cancer Diseases 0.000 claims description 6
- 206010006187 Breast cancer Diseases 0.000 claims description 6
- 208000026310 Breast neoplasm Diseases 0.000 claims description 6
- 206010033128 Ovarian cancer Diseases 0.000 claims description 6
- 206010061535 Ovarian neoplasm Diseases 0.000 claims description 6
- 206010061902 Pancreatic neoplasm Diseases 0.000 claims description 6
- 208000006265 Renal cell carcinoma Diseases 0.000 claims description 6
- 208000000102 Squamous Cell Carcinoma of Head and Neck Diseases 0.000 claims description 6
- 208000005718 Stomach Neoplasms Diseases 0.000 claims description 6
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 claims description 6
- 238000002512 chemotherapy Methods 0.000 claims description 6
- 206010017758 gastric cancer Diseases 0.000 claims description 6
- 201000000459 head and neck squamous cell carcinoma Diseases 0.000 claims description 6
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 claims description 6
- 201000002528 pancreatic cancer Diseases 0.000 claims description 6
- 208000008443 pancreatic carcinoma Diseases 0.000 claims description 6
- 229940121655 pd-1 inhibitor Drugs 0.000 claims description 6
- 229940121656 pd-l1 inhibitor Drugs 0.000 claims description 6
- 201000011549 stomach cancer Diseases 0.000 claims description 6
- 238000001356 surgical procedure Methods 0.000 claims description 6
- 201000005112 urinary bladder cancer Diseases 0.000 claims description 6
- 231100000844 hepatocellular carcinoma Toxicity 0.000 claims description 4
- 230000000750 progressive effect Effects 0.000 claims description 4
- 230000000306 recurrent effect Effects 0.000 claims description 4
- 230000005855 radiation Effects 0.000 claims 2
- 239000002269 analeptic agent Substances 0.000 abstract description 74
- 108090000623 proteins and genes Proteins 0.000 description 196
- 102000004169 proteins and genes Human genes 0.000 description 194
- 210000004027 cell Anatomy 0.000 description 115
- 241000699670 Mus sp. Species 0.000 description 94
- 241000282414 Homo sapiens Species 0.000 description 72
- 241000699666 Mus <mouse, genus> Species 0.000 description 58
- 101100519207 Mus musculus Pdcd1 gene Proteins 0.000 description 56
- 239000003795 chemical substances by application Substances 0.000 description 44
- 206010063836 Atrioventricular septal defect Diseases 0.000 description 43
- 241001529936 Murinae Species 0.000 description 40
- 238000009739 binding Methods 0.000 description 40
- 230000027455 binding Effects 0.000 description 39
- 102100024216 Programmed cell death 1 ligand 1 Human genes 0.000 description 36
- 108010074708 B7-H1 Antigen Proteins 0.000 description 35
- 241001465754 Metazoa Species 0.000 description 27
- 239000003446 ligand Substances 0.000 description 27
- 210000001519 tissue Anatomy 0.000 description 25
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 23
- 239000011780 sodium chloride Substances 0.000 description 23
- -1 that of SEQ ID NO:5 Proteins 0.000 description 23
- 230000012010 growth Effects 0.000 description 21
- 230000003993 interaction Effects 0.000 description 21
- 210000004881 tumor cell Anatomy 0.000 description 21
- 230000002401 inhibitory effect Effects 0.000 description 20
- 239000005557 antagonist Substances 0.000 description 19
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 19
- 238000011081 inoculation Methods 0.000 description 19
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 18
- 102000004127 Cytokines Human genes 0.000 description 18
- 108090000695 Cytokines Proteins 0.000 description 18
- 230000000694 effects Effects 0.000 description 18
- 239000000523 sample Substances 0.000 description 18
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 17
- 239000012091 fetal bovine serum Substances 0.000 description 17
- 230000009467 reduction Effects 0.000 description 17
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 16
- 101000889276 Homo sapiens Cytotoxic T-lymphocyte protein 4 Proteins 0.000 description 15
- 101000611936 Homo sapiens Programmed cell death protein 1 Proteins 0.000 description 15
- 239000012980 RPMI-1640 medium Substances 0.000 description 15
- 102000048362 human PDCD1 Human genes 0.000 description 15
- 229960003301 nivolumab Drugs 0.000 description 15
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 14
- 230000001965 increasing effect Effects 0.000 description 14
- 239000002953 phosphate buffered saline Substances 0.000 description 14
- 239000011324 bead Substances 0.000 description 13
- 201000010099 disease Diseases 0.000 description 13
- 238000001211 electron capture detection Methods 0.000 description 13
- 102000054189 human CD80 Human genes 0.000 description 13
- 230000002829 reductive effect Effects 0.000 description 13
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 12
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 12
- 239000000556 agonist Substances 0.000 description 12
- 201000010989 colorectal carcinoma Diseases 0.000 description 12
- 238000002648 combination therapy Methods 0.000 description 12
- 229960002621 pembrolizumab Drugs 0.000 description 12
- 102000005962 receptors Human genes 0.000 description 12
- 108020003175 receptors Proteins 0.000 description 12
- 230000004044 response Effects 0.000 description 12
- 108700030875 Programmed Cell Death 1 Ligand 2 Proteins 0.000 description 11
- 102100024213 Programmed cell death 1 ligand 2 Human genes 0.000 description 11
- 108010076504 Protein Sorting Signals Proteins 0.000 description 11
- 239000003112 inhibitor Substances 0.000 description 11
- 239000004037 angiogenesis inhibitor Substances 0.000 description 10
- 239000002246 antineoplastic agent Substances 0.000 description 10
- 238000007912 intraperitoneal administration Methods 0.000 description 10
- 238000005259 measurement Methods 0.000 description 10
- 108020004414 DNA Proteins 0.000 description 9
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 9
- 229930182816 L-glutamine Natural products 0.000 description 9
- 108010029485 Protein Isoforms Proteins 0.000 description 9
- 102000001708 Protein Isoforms Human genes 0.000 description 9
- 230000006044 T cell activation Effects 0.000 description 9
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 9
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 9
- 239000000427 antigen Substances 0.000 description 9
- 108091007433 antigens Proteins 0.000 description 9
- 102000036639 antigens Human genes 0.000 description 9
- 238000009472 formulation Methods 0.000 description 9
- 238000002513 implantation Methods 0.000 description 9
- 238000001727 in vivo Methods 0.000 description 9
- 230000004936 stimulating effect Effects 0.000 description 9
- 229960005486 vaccine Drugs 0.000 description 9
- 101001117317 Homo sapiens Programmed cell death 1 ligand 1 Proteins 0.000 description 8
- 125000000539 amino acid group Chemical group 0.000 description 8
- 239000012298 atmosphere Substances 0.000 description 8
- 239000012634 fragment Substances 0.000 description 8
- 102000048776 human CD274 Human genes 0.000 description 8
- 108010082117 matrigel Proteins 0.000 description 8
- 238000010172 mouse model Methods 0.000 description 8
- 229920000642 polymer Polymers 0.000 description 8
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 description 7
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 7
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 description 7
- 150000001413 amino acids Chemical class 0.000 description 7
- 229940127089 cytotoxic agent Drugs 0.000 description 7
- 229950010773 pidilizumab Drugs 0.000 description 7
- 239000007787 solid Substances 0.000 description 7
- 241000894007 species Species 0.000 description 7
- 230000004083 survival effect Effects 0.000 description 7
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 6
- 238000011725 BALB/c mouse Methods 0.000 description 6
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 6
- 102000009490 IgG Receptors Human genes 0.000 description 6
- 108010073807 IgG Receptors Proteins 0.000 description 6
- 102100037850 Interferon gamma Human genes 0.000 description 6
- 230000005867 T cell response Effects 0.000 description 6
- 230000000903 blocking effect Effects 0.000 description 6
- 208000035475 disorder Diseases 0.000 description 6
- 229940079593 drug Drugs 0.000 description 6
- 208000014018 liver neoplasm Diseases 0.000 description 6
- 230000035772 mutation Effects 0.000 description 6
- 210000000822 natural killer cell Anatomy 0.000 description 6
- 108091033319 polynucleotide Proteins 0.000 description 6
- 102000040430 polynucleotide Human genes 0.000 description 6
- 239000002157 polynucleotide Substances 0.000 description 6
- 238000012809 post-inoculation Methods 0.000 description 6
- 239000002243 precursor Substances 0.000 description 6
- 238000006467 substitution reaction Methods 0.000 description 6
- YQYGGOPUTPQHAY-KIQLFZLRSA-N (4S)-4-[[(2S)-2-[[(2S)-2-[2-[6-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S,3S)-1-[[(2S)-5-amino-1-[[(4S,7R)-7-[[(2S)-1-[(2S)-6-amino-2-[[(2R)-2-[[(2S)-5-amino-2-[[(2S,3R)-2-[[(2S)-6-amino-2-[[(2S)-4-carboxy-2-hydrazinylbutanoyl]amino]hexanoyl]amino]-3-methylpentanoyl]amino]-5-oxopentanoyl]amino]propanoyl]amino]hexanoyl]pyrrolidine-2-carbonyl]amino]-2-methyl-5,6-dioxooctan-4-yl]amino]-1,5-dioxopentan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-5-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S,3S)-2-[[(2S)-4-amino-2-[[(2S)-2-amino-3-hydroxypropanoyl]amino]-4-oxobutanoyl]amino]-3-hydroxybutanoyl]amino]-3-hydroxypropanoyl]amino]-4-carboxybutanoyl]amino]-3-hydroxypropanoyl]amino]-3-phenylpropanoyl]amino]-6-oxohexyl]hydrazinyl]-3-phenylpropanoyl]amino]-3-hydroxypropanoyl]amino]-5-[[(2S)-1-[[(2S,3S)-1-[[(2S)-4-amino-1-[[(2S)-1-hydroxy-3-oxopropan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-5-oxopentanoic acid Chemical compound CC[C@@H](C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(O)=O)NN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@H](C)C(=O)C(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](Cc1ccccc1)NC(=O)C(CCCCNN[C@@H](Cc1ccccc1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C=O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)CO)[C@H](C)O)C(C)C)[C@H](C)O YQYGGOPUTPQHAY-KIQLFZLRSA-N 0.000 description 5
- 108010002350 Interleukin-2 Proteins 0.000 description 5
- 102000000588 Interleukin-2 Human genes 0.000 description 5
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 5
- 230000001270 agonistic effect Effects 0.000 description 5
- 238000004458 analytical method Methods 0.000 description 5
- 230000000259 anti-tumor effect Effects 0.000 description 5
- 230000008859 change Effects 0.000 description 5
- 229950009791 durvalumab Drugs 0.000 description 5
- 230000006870 function Effects 0.000 description 5
- 230000001976 improved effect Effects 0.000 description 5
- 239000007924 injection Substances 0.000 description 5
- 238000002347 injection Methods 0.000 description 5
- 239000013612 plasmid Substances 0.000 description 5
- 230000035755 proliferation Effects 0.000 description 5
- 238000001959 radiotherapy Methods 0.000 description 5
- 239000000126 substance Substances 0.000 description 5
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 5
- 230000001225 therapeutic effect Effects 0.000 description 5
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 4
- 229940045513 CTLA4 antagonist Drugs 0.000 description 4
- 201000009030 Carcinoma Diseases 0.000 description 4
- 102000001301 EGF receptor Human genes 0.000 description 4
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 4
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 4
- 239000005551 L01XE03 - Erlotinib Substances 0.000 description 4
- 102000017578 LAG3 Human genes 0.000 description 4
- 101150030213 Lag3 gene Proteins 0.000 description 4
- 241000282567 Macaca fascicularis Species 0.000 description 4
- 229930012538 Paclitaxel Natural products 0.000 description 4
- 206010039491 Sarcoma Diseases 0.000 description 4
- 238000000692 Student's t-test Methods 0.000 description 4
- 229920004890 Triton X-100 Polymers 0.000 description 4
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 description 4
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 description 4
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 4
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 4
- 239000002253 acid Substances 0.000 description 4
- 238000007792 addition Methods 0.000 description 4
- 238000010171 animal model Methods 0.000 description 4
- 230000000118 anti-neoplastic effect Effects 0.000 description 4
- 229940034982 antineoplastic agent Drugs 0.000 description 4
- 238000003556 assay Methods 0.000 description 4
- 210000004369 blood Anatomy 0.000 description 4
- 239000008280 blood Substances 0.000 description 4
- 230000000295 complement effect Effects 0.000 description 4
- 230000001419 dependent effect Effects 0.000 description 4
- AAKJLRGGTJKAMG-UHFFFAOYSA-N erlotinib Chemical compound C=12C=C(OCCOC)C(OCCOC)=CC2=NC=NC=1NC1=CC=CC(C#C)=C1 AAKJLRGGTJKAMG-UHFFFAOYSA-N 0.000 description 4
- 229960002949 fluorouracil Drugs 0.000 description 4
- YLMAHDNUQAMNNX-UHFFFAOYSA-N imatinib methanesulfonate Chemical compound CS(O)(=O)=O.C1CN(C)CCN1CC1=CC=C(C(=O)NC=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)C=C1 YLMAHDNUQAMNNX-UHFFFAOYSA-N 0.000 description 4
- 210000002865 immune cell Anatomy 0.000 description 4
- 230000028993 immune response Effects 0.000 description 4
- 230000015788 innate immune response Effects 0.000 description 4
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 4
- 201000007270 liver cancer Diseases 0.000 description 4
- 230000003211 malignant effect Effects 0.000 description 4
- 229960000485 methotrexate Drugs 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- 238000012986 modification Methods 0.000 description 4
- 239000002773 nucleotide Substances 0.000 description 4
- 125000003729 nucleotide group Chemical group 0.000 description 4
- 229960001592 paclitaxel Drugs 0.000 description 4
- 229920001223 polyethylene glycol Polymers 0.000 description 4
- 210000003289 regulatory T cell Anatomy 0.000 description 4
- 230000028327 secretion Effects 0.000 description 4
- 230000011664 signaling Effects 0.000 description 4
- 206010041823 squamous cell carcinoma Diseases 0.000 description 4
- 238000012353 t test Methods 0.000 description 4
- WYWHKKSPHMUBEB-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 4
- 230000004565 tumor cell growth Effects 0.000 description 4
- 230000003442 weekly effect Effects 0.000 description 4
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
- VVIAGPKUTFNRDU-UHFFFAOYSA-N 6S-folinic acid Natural products C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-UHFFFAOYSA-N 0.000 description 3
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 3
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 3
- 102100027207 CD27 antigen Human genes 0.000 description 3
- 102100038078 CD276 antigen Human genes 0.000 description 3
- 102100025221 CD70 antigen Human genes 0.000 description 3
- 241000283707 Capra Species 0.000 description 3
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 3
- 108060006698 EGF receptor Proteins 0.000 description 3
- 102000004190 Enzymes Human genes 0.000 description 3
- 108090000790 Enzymes Proteins 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 102100034458 Hepatitis A virus cellular receptor 2 Human genes 0.000 description 3
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 description 3
- 101001068133 Homo sapiens Hepatitis A virus cellular receptor 2 Proteins 0.000 description 3
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 3
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 3
- 101000610605 Homo sapiens Tumor necrosis factor receptor superfamily member 10A Proteins 0.000 description 3
- 108060003951 Immunoglobulin Proteins 0.000 description 3
- 206010061218 Inflammation Diseases 0.000 description 3
- 102100026878 Interleukin-2 receptor subunit alpha Human genes 0.000 description 3
- 108700020796 Oncogene Proteins 0.000 description 3
- 102100040678 Programmed cell death protein 1 Human genes 0.000 description 3
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 230000018199 S phase Effects 0.000 description 3
- 229930006000 Sucrose Natural products 0.000 description 3
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 3
- 230000017274 T cell anergy Effects 0.000 description 3
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 3
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 3
- 102100040247 Tumor necrosis factor Human genes 0.000 description 3
- 102100040113 Tumor necrosis factor receptor superfamily member 10A Human genes 0.000 description 3
- 102100022203 Tumor necrosis factor receptor superfamily member 25 Human genes 0.000 description 3
- 102000009524 Vascular Endothelial Growth Factor A Human genes 0.000 description 3
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 description 3
- 239000003242 anti bacterial agent Substances 0.000 description 3
- 229940088710 antibiotic agent Drugs 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 150000001875 compounds Chemical class 0.000 description 3
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 3
- 229960003668 docetaxel Drugs 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 235000008191 folinic acid Nutrition 0.000 description 3
- 239000011672 folinic acid Substances 0.000 description 3
- VVIAGPKUTFNRDU-ABLWVSNPSA-N folinic acid Chemical compound C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-ABLWVSNPSA-N 0.000 description 3
- 230000036541 health Effects 0.000 description 3
- 229960002751 imiquimod Drugs 0.000 description 3
- DOUYETYNHWVLEO-UHFFFAOYSA-N imiquimod Chemical compound C1=CC=CC2=C3N(CC(C)C)C=NC3=C(N)N=C21 DOUYETYNHWVLEO-UHFFFAOYSA-N 0.000 description 3
- 230000005934 immune activation Effects 0.000 description 3
- 230000001900 immune effect Effects 0.000 description 3
- 230000003832 immune regulation Effects 0.000 description 3
- 102000018358 immunoglobulin Human genes 0.000 description 3
- 230000004054 inflammatory process Effects 0.000 description 3
- 229960001691 leucovorin Drugs 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 3
- 230000002503 metabolic effect Effects 0.000 description 3
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 3
- 238000007799 mixed lymphocyte reaction assay Methods 0.000 description 3
- 102000039446 nucleic acids Human genes 0.000 description 3
- 108020004707 nucleic acids Proteins 0.000 description 3
- 150000007523 nucleic acids Chemical class 0.000 description 3
- 229960001756 oxaliplatin Drugs 0.000 description 3
- DWAFYCQODLXJNR-BNTLRKBRSA-L oxaliplatin Chemical compound O1C(=O)C(=O)O[Pt]11N[C@@H]2CCCC[C@H]2N1 DWAFYCQODLXJNR-BNTLRKBRSA-L 0.000 description 3
- 230000037361 pathway Effects 0.000 description 3
- HXCHCVDVKSCDHU-PJKCJEBCSA-N s-[(2r,3s,4s,6s)-6-[[(2r,3s,4s,5r,6r)-5-[(2s,4s,5s)-5-(ethylamino)-4-methoxyoxan-2-yl]oxy-4-hydroxy-6-[[(2s,5z,9r,13e)-9-hydroxy-12-(methoxycarbonylamino)-13-[2-(methyltrisulfanyl)ethylidene]-11-oxo-2-bicyclo[7.3.1]trideca-1(12),5-dien-3,7-diynyl]oxy]-2-m Chemical compound C1[C@H](OC)[C@@H](NCC)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@@](C/3=C/CSSSC)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HXCHCVDVKSCDHU-PJKCJEBCSA-N 0.000 description 3
- 230000019491 signal transduction Effects 0.000 description 3
- 150000003384 small molecules Chemical class 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 230000000638 stimulation Effects 0.000 description 3
- 239000005720 sucrose Substances 0.000 description 3
- 210000001179 synovial fluid Anatomy 0.000 description 3
- 229960001603 tamoxifen Drugs 0.000 description 3
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 3
- 239000003981 vehicle Substances 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- FDKXTQMXEQVLRF-ZHACJKMWSA-N (E)-dacarbazine Chemical compound CN(C)\N=N\c1[nH]cnc1C(N)=O FDKXTQMXEQVLRF-ZHACJKMWSA-N 0.000 description 2
- IHWDSEPNZDYMNF-UHFFFAOYSA-N 1H-indol-2-amine Chemical compound C1=CC=C2NC(N)=CC2=C1 IHWDSEPNZDYMNF-UHFFFAOYSA-N 0.000 description 2
- BGFTWECWAICPDG-UHFFFAOYSA-N 2-[bis(4-chlorophenyl)methyl]-4-n-[3-[bis(4-chlorophenyl)methyl]-4-(dimethylamino)phenyl]-1-n,1-n-dimethylbenzene-1,4-diamine Chemical compound C1=C(C(C=2C=CC(Cl)=CC=2)C=2C=CC(Cl)=CC=2)C(N(C)C)=CC=C1NC(C=1)=CC=C(N(C)C)C=1C(C=1C=CC(Cl)=CC=1)C1=CC=C(Cl)C=C1 BGFTWECWAICPDG-UHFFFAOYSA-N 0.000 description 2
- FWBHETKCLVMNFS-UHFFFAOYSA-N 4',6-Diamino-2-phenylindol Chemical compound C1=CC(C(=N)N)=CC=C1C1=CC2=CC=C(C(N)=N)C=C2N1 FWBHETKCLVMNFS-UHFFFAOYSA-N 0.000 description 2
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 2
- 102000002627 4-1BB Ligand Human genes 0.000 description 2
- 108010082808 4-1BB Ligand Proteins 0.000 description 2
- 108010088751 Albumins Proteins 0.000 description 2
- 102000009027 Albumins Human genes 0.000 description 2
- 102000004452 Arginase Human genes 0.000 description 2
- 108700024123 Arginases Proteins 0.000 description 2
- BFYIZQONLCFLEV-DAELLWKTSA-N Aromasine Chemical compound O=C1C=C[C@]2(C)[C@H]3CC[C@](C)(C(CC4)=O)[C@@H]4[C@@H]3CC(=C)C2=C1 BFYIZQONLCFLEV-DAELLWKTSA-N 0.000 description 2
- 206010003571 Astrocytoma Diseases 0.000 description 2
- 102100029822 B- and T-lymphocyte attenuator Human genes 0.000 description 2
- 108010008014 B-Cell Maturation Antigen Proteins 0.000 description 2
- 102000006942 B-Cell Maturation Antigen Human genes 0.000 description 2
- 108010006654 Bleomycin Proteins 0.000 description 2
- 208000003174 Brain Neoplasms Diseases 0.000 description 2
- 101710185679 CD276 antigen Proteins 0.000 description 2
- 108010029697 CD40 Ligand Proteins 0.000 description 2
- 229940123189 CD40 agonist Drugs 0.000 description 2
- 101150013553 CD40 gene Proteins 0.000 description 2
- 102100032937 CD40 ligand Human genes 0.000 description 2
- GAGWJHPBXLXJQN-UORFTKCHSA-N Capecitabine Chemical compound C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](C)O1 GAGWJHPBXLXJQN-UORFTKCHSA-N 0.000 description 2
- 108090000994 Catalytic RNA Proteins 0.000 description 2
- 102000053642 Catalytic RNA Human genes 0.000 description 2
- 206010008342 Cervix carcinoma Diseases 0.000 description 2
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 2
- 108010092160 Dactinomycin Proteins 0.000 description 2
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 2
- 102100037354 Ectodysplasin-A Human genes 0.000 description 2
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 2
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 2
- 101150050927 Fcgrt gene Proteins 0.000 description 2
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 2
- 206010017993 Gastrointestinal neoplasms Diseases 0.000 description 2
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 2
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101000864344 Homo sapiens B- and T-lymphocyte attenuator Proteins 0.000 description 2
- 101000934356 Homo sapiens CD70 antigen Proteins 0.000 description 2
- 101000880080 Homo sapiens Ectodysplasin-A Proteins 0.000 description 2
- 101000610604 Homo sapiens Tumor necrosis factor receptor superfamily member 10B Proteins 0.000 description 2
- 101000679903 Homo sapiens Tumor necrosis factor receptor superfamily member 25 Proteins 0.000 description 2
- 101000679907 Homo sapiens Tumor necrosis factor receptor superfamily member 27 Proteins 0.000 description 2
- 101000920026 Homo sapiens Tumor necrosis factor receptor superfamily member EDAR Proteins 0.000 description 2
- 101000666856 Homo sapiens Vasoactive intestinal polypeptide receptor 1 Proteins 0.000 description 2
- 108010058683 Immobilized Proteins Proteins 0.000 description 2
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 2
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 2
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 2
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 2
- 208000008839 Kidney Neoplasms Diseases 0.000 description 2
- 239000005517 L01XE01 - Imatinib Substances 0.000 description 2
- 206010025323 Lymphomas Diseases 0.000 description 2
- 230000027311 M phase Effects 0.000 description 2
- 206010025654 Malignant melanoma of sites other than skin Diseases 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 108010090054 Membrane Glycoproteins Proteins 0.000 description 2
- 102000012750 Membrane Glycoproteins Human genes 0.000 description 2
- 102000029749 Microtubule Human genes 0.000 description 2
- 108091022875 Microtubule Proteins 0.000 description 2
- 101000597780 Mus musculus Tumor necrosis factor ligand superfamily member 18 Proteins 0.000 description 2
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 2
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 2
- 102000008299 Nitric Oxide Synthase Human genes 0.000 description 2
- 108010021487 Nitric Oxide Synthase Proteins 0.000 description 2
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- 229930040373 Paraformaldehyde Natural products 0.000 description 2
- 208000007913 Pituitary Neoplasms Diseases 0.000 description 2
- ATUOYWHBWRKTHZ-UHFFFAOYSA-N Propane Chemical compound CCC ATUOYWHBWRKTHZ-UHFFFAOYSA-N 0.000 description 2
- 206010060862 Prostate cancer Diseases 0.000 description 2
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 2
- 102100024924 Protein kinase C alpha type Human genes 0.000 description 2
- 101710109947 Protein kinase C alpha type Proteins 0.000 description 2
- 206010038389 Renal cancer Diseases 0.000 description 2
- 206010061934 Salivary gland cancer Diseases 0.000 description 2
- 206010041067 Small cell lung cancer Diseases 0.000 description 2
- 208000021712 Soft tissue sarcoma Diseases 0.000 description 2
- 230000006052 T cell proliferation Effects 0.000 description 2
- 229940123237 Taxane Drugs 0.000 description 2
- 241001116498 Taxus baccata Species 0.000 description 2
- 208000024313 Testicular Neoplasms Diseases 0.000 description 2
- 206010057644 Testis cancer Diseases 0.000 description 2
- FOCVUCIESVLUNU-UHFFFAOYSA-N Thiotepa Chemical compound C1CN1P(N1CC1)(=S)N1CC1 FOCVUCIESVLUNU-UHFFFAOYSA-N 0.000 description 2
- 208000024770 Thyroid neoplasm Diseases 0.000 description 2
- 102100024587 Tumor necrosis factor ligand superfamily member 15 Human genes 0.000 description 2
- 102100035283 Tumor necrosis factor ligand superfamily member 18 Human genes 0.000 description 2
- 102100040112 Tumor necrosis factor receptor superfamily member 10B Human genes 0.000 description 2
- 102100022202 Tumor necrosis factor receptor superfamily member 27 Human genes 0.000 description 2
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 2
- 102100030810 Tumor necrosis factor receptor superfamily member EDAR Human genes 0.000 description 2
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 2
- 108010079206 V-Set Domain-Containing T-Cell Activation Inhibitor 1 Proteins 0.000 description 2
- 102100038929 V-set domain-containing T-cell activation inhibitor 1 Human genes 0.000 description 2
- 108091008605 VEGF receptors Proteins 0.000 description 2
- 102000009484 Vascular Endothelial Growth Factor Receptors Human genes 0.000 description 2
- 102100038388 Vasoactive intestinal polypeptide receptor 1 Human genes 0.000 description 2
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 2
- 206010047741 Vulval cancer Diseases 0.000 description 2
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 2
- 125000001931 aliphatic group Chemical group 0.000 description 2
- 229960003437 aminoglutethimide Drugs 0.000 description 2
- ROBVIMPUHSLWNV-UHFFFAOYSA-N aminoglutethimide Chemical compound C=1C=C(N)C=CC=1C1(CC)CCC(=O)NC1=O ROBVIMPUHSLWNV-UHFFFAOYSA-N 0.000 description 2
- YBBLVLTVTVSKRW-UHFFFAOYSA-N anastrozole Chemical compound N#CC(C)(C)C1=CC(C(C)(C#N)C)=CC(CN2N=CN=C2)=C1 YBBLVLTVTVSKRW-UHFFFAOYSA-N 0.000 description 2
- 239000002870 angiogenesis inducing agent Substances 0.000 description 2
- 229940121369 angiogenesis inhibitor Drugs 0.000 description 2
- 230000002491 angiogenic effect Effects 0.000 description 2
- 230000003042 antagnostic effect Effects 0.000 description 2
- 229940045799 anthracyclines and related substance Drugs 0.000 description 2
- 230000006023 anti-tumor response Effects 0.000 description 2
- 230000030741 antigen processing and presentation Effects 0.000 description 2
- 229940041181 antineoplastic drug Drugs 0.000 description 2
- 210000003719 b-lymphocyte Anatomy 0.000 description 2
- 238000001574 biopsy Methods 0.000 description 2
- 201000000053 blastoma Diseases 0.000 description 2
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical class N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 229930195731 calicheamicin Natural products 0.000 description 2
- 230000005907 cancer growth Effects 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 230000004663 cell proliferation Effects 0.000 description 2
- 229940030156 cell vaccine Drugs 0.000 description 2
- 201000010881 cervical cancer Diseases 0.000 description 2
- 208000006990 cholangiocarcinoma Diseases 0.000 description 2
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 2
- 229960004316 cisplatin Drugs 0.000 description 2
- 208000029742 colonic neoplasm Diseases 0.000 description 2
- 230000000139 costimulatory effect Effects 0.000 description 2
- 230000016396 cytokine production Effects 0.000 description 2
- 206010052015 cytokine release syndrome Diseases 0.000 description 2
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 2
- 229960003901 dacarbazine Drugs 0.000 description 2
- 229960000975 daunorubicin Drugs 0.000 description 2
- 229940029030 dendritic cell vaccine Drugs 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 239000000539 dimer Substances 0.000 description 2
- 229960004679 doxorubicin Drugs 0.000 description 2
- 201000008184 embryoma Diseases 0.000 description 2
- 201000003914 endometrial carcinoma Diseases 0.000 description 2
- 230000002357 endometrial effect Effects 0.000 description 2
- 229960001904 epirubicin Drugs 0.000 description 2
- 229960001433 erlotinib Drugs 0.000 description 2
- 201000004101 esophageal cancer Diseases 0.000 description 2
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 2
- OVBPIULPVIDEAO-LBPRGKRZSA-N folic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-LBPRGKRZSA-N 0.000 description 2
- 201000010175 gallbladder cancer Diseases 0.000 description 2
- 201000007487 gallbladder carcinoma Diseases 0.000 description 2
- CHPZKNULDCNCBW-UHFFFAOYSA-N gallium nitrate Chemical compound [Ga+3].[O-][N+]([O-])=O.[O-][N+]([O-])=O.[O-][N+]([O-])=O CHPZKNULDCNCBW-UHFFFAOYSA-N 0.000 description 2
- 229940080856 gleevec Drugs 0.000 description 2
- 208000005017 glioblastoma Diseases 0.000 description 2
- 230000013595 glycosylation Effects 0.000 description 2
- 238000006206 glycosylation reaction Methods 0.000 description 2
- 201000010536 head and neck cancer Diseases 0.000 description 2
- 208000014829 head and neck neoplasm Diseases 0.000 description 2
- 230000002440 hepatic effect Effects 0.000 description 2
- 229960001101 ifosfamide Drugs 0.000 description 2
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 2
- 229960003685 imatinib mesylate Drugs 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 230000001506 immunosuppresive effect Effects 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- 108091008042 inhibitory receptors Proteins 0.000 description 2
- 229960005386 ipilimumab Drugs 0.000 description 2
- 229960004768 irinotecan Drugs 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- 201000010982 kidney cancer Diseases 0.000 description 2
- HPJKCIUCZWXJDR-UHFFFAOYSA-N letrozole Chemical compound C1=CC(C#N)=CC=C1C(N1N=CN=C1)C1=CC=C(C#N)C=C1 HPJKCIUCZWXJDR-UHFFFAOYSA-N 0.000 description 2
- 208000032839 leukemia Diseases 0.000 description 2
- 210000004072 lung Anatomy 0.000 description 2
- 201000005249 lung adenocarcinoma Diseases 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical compound ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 2
- 229960004961 mechlorethamine Drugs 0.000 description 2
- 210000004379 membrane Anatomy 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 229960001428 mercaptopurine Drugs 0.000 description 2
- 210000004688 microtubule Anatomy 0.000 description 2
- 229960001156 mitoxantrone Drugs 0.000 description 2
- LBWFXVZLPYTWQI-IPOVEDGCSA-N n-[2-(diethylamino)ethyl]-5-[(z)-(5-fluoro-2-oxo-1h-indol-3-ylidene)methyl]-2,4-dimethyl-1h-pyrrole-3-carboxamide;(2s)-2-hydroxybutanedioic acid Chemical compound OC(=O)[C@@H](O)CC(O)=O.CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C LBWFXVZLPYTWQI-IPOVEDGCSA-N 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- QZGIWPZCWHMVQL-UIYAJPBUSA-N neocarzinostatin chromophore Chemical compound O1[C@H](C)[C@H](O)[C@H](O)[C@@H](NC)[C@H]1O[C@@H]1C/2=C/C#C[C@H]3O[C@@]3([C@@H]3OC(=O)OC3)C#CC\2=C[C@H]1OC(=O)C1=C(O)C=CC2=C(C)C=C(OC)C=C12 QZGIWPZCWHMVQL-UIYAJPBUSA-N 0.000 description 2
- 229910052757 nitrogen Inorganic materials 0.000 description 2
- 231100000252 nontoxic Toxicity 0.000 description 2
- 230000003000 nontoxic effect Effects 0.000 description 2
- 210000000056 organ Anatomy 0.000 description 2
- 229920002866 paraformaldehyde Polymers 0.000 description 2
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 2
- 201000002628 peritoneum cancer Diseases 0.000 description 2
- 239000008194 pharmaceutical composition Substances 0.000 description 2
- 201000002511 pituitary cancer Diseases 0.000 description 2
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Chemical compound [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 230000000069 prophylactic effect Effects 0.000 description 2
- RXWNCPJZOCPEPQ-NVWDDTSBSA-N puromycin Chemical compound C1=CC(OC)=CC=C1C[C@H](N)C(=O)N[C@H]1[C@@H](O)[C@H](N2C3=NC=NC(=C3N=C2)N(C)C)O[C@@H]1CO RXWNCPJZOCPEPQ-NVWDDTSBSA-N 0.000 description 2
- 229960004622 raloxifene Drugs 0.000 description 2
- GZUITABIAKMVPG-UHFFFAOYSA-N raloxifene Chemical compound C1=CC(O)=CC=C1C1=C(C(=O)C=2C=CC(OCCN3CCCCC3)=CC=2)C2=CC=C(O)C=C2S1 GZUITABIAKMVPG-UHFFFAOYSA-N 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 108091092562 ribozyme Proteins 0.000 description 2
- 201000003804 salivary gland carcinoma Diseases 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 230000003248 secreting effect Effects 0.000 description 2
- 229940095743 selective estrogen receptor modulator Drugs 0.000 description 2
- 239000000333 selective estrogen receptor modulator Substances 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 208000000587 small cell lung carcinoma Diseases 0.000 description 2
- 229940126586 small molecule drug Drugs 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 208000017572 squamous cell neoplasm Diseases 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- PVYJZLYGTZKPJE-UHFFFAOYSA-N streptonigrin Chemical compound C=1C=C2C(=O)C(OC)=C(N)C(=O)C2=NC=1C(C=1N)=NC(C(O)=O)=C(C)C=1C1=CC=C(OC)C(OC)=C1O PVYJZLYGTZKPJE-UHFFFAOYSA-N 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 230000005737 synergistic response Effects 0.000 description 2
- 229940120982 tarceva Drugs 0.000 description 2
- RCINICONZNJXQF-XAZOAEDWSA-N taxol® Chemical compound O([C@@H]1[C@@]2(CC(C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3(C21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-XAZOAEDWSA-N 0.000 description 2
- 229940063683 taxotere Drugs 0.000 description 2
- 201000003120 testicular cancer Diseases 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 229960001196 thiotepa Drugs 0.000 description 2
- 201000002510 thyroid cancer Diseases 0.000 description 2
- 229960003087 tioguanine Drugs 0.000 description 2
- 238000011269 treatment regimen Methods 0.000 description 2
- 238000011870 unpaired t-test Methods 0.000 description 2
- 206010046766 uterine cancer Diseases 0.000 description 2
- 208000012991 uterine carcinoma Diseases 0.000 description 2
- 229960003048 vinblastine Drugs 0.000 description 2
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 2
- 229960004528 vincristine Drugs 0.000 description 2
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 2
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 2
- 201000005102 vulva cancer Diseases 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- 229940055760 yervoy Drugs 0.000 description 2
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 2
- NNJPGOLRFBJNIW-HNNXBMFYSA-N (-)-demecolcine Chemical compound C1=C(OC)C(=O)C=C2[C@@H](NC)CCC3=CC(OC)=C(OC)C(OC)=C3C2=C1 NNJPGOLRFBJNIW-HNNXBMFYSA-N 0.000 description 1
- ZADWXFSZEAPBJS-SNVBAGLBSA-N (2r)-2-amino-3-(1-methylindol-3-yl)propanoic acid Chemical compound C1=CC=C2N(C)C=C(C[C@@H](N)C(O)=O)C2=C1 ZADWXFSZEAPBJS-SNVBAGLBSA-N 0.000 description 1
- WDQLRUYAYXDIFW-RWKIJVEZSA-N (2r,3r,4s,5r,6r)-4-[(2s,3r,4s,5r,6r)-3,5-dihydroxy-4-[(2r,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-6-[[(2r,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxymethyl]oxan-2-yl]oxy-6-(hydroxymethyl)oxane-2,3,5-triol Chemical compound O[C@@H]1[C@@H](CO)O[C@@H](O)[C@H](O)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)O)[C@H](O)[C@@H](CO[C@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)O)O1 WDQLRUYAYXDIFW-RWKIJVEZSA-N 0.000 description 1
- YXTKHLHCVFUPPT-YYFJYKOTSA-N (2s)-2-[[4-[(2-amino-5-formyl-4-oxo-1,6,7,8-tetrahydropteridin-6-yl)methylamino]benzoyl]amino]pentanedioic acid;(1r,2r)-1,2-dimethanidylcyclohexane;5-fluoro-1h-pyrimidine-2,4-dione;oxalic acid;platinum(2+) Chemical compound [Pt+2].OC(=O)C(O)=O.[CH2-][C@@H]1CCCC[C@H]1[CH2-].FC1=CNC(=O)NC1=O.C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 YXTKHLHCVFUPPT-YYFJYKOTSA-N 0.000 description 1
- FLWWDYNPWOSLEO-HQVZTVAUSA-N (2s)-2-[[4-[1-(2-amino-4-oxo-1h-pteridin-6-yl)ethyl-methylamino]benzoyl]amino]pentanedioic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1C(C)N(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FLWWDYNPWOSLEO-HQVZTVAUSA-N 0.000 description 1
- JPSHPWJJSVEEAX-OWPBQMJCSA-N (2s)-2-amino-4-fluoranylpentanedioic acid Chemical compound OC(=O)[C@@H](N)CC([18F])C(O)=O JPSHPWJJSVEEAX-OWPBQMJCSA-N 0.000 description 1
- CGMTUJFWROPELF-YPAAEMCBSA-N (3E,5S)-5-[(2S)-butan-2-yl]-3-(1-hydroxyethylidene)pyrrolidine-2,4-dione Chemical compound CC[C@H](C)[C@@H]1NC(=O)\C(=C(/C)O)C1=O CGMTUJFWROPELF-YPAAEMCBSA-N 0.000 description 1
- VEEGZPWAAPPXRB-BJMVGYQFSA-N (3e)-3-(1h-imidazol-5-ylmethylidene)-1h-indol-2-one Chemical compound O=C1NC2=CC=CC=C2\C1=C/C1=CN=CN1 VEEGZPWAAPPXRB-BJMVGYQFSA-N 0.000 description 1
- TVIRNGFXQVMMGB-OFWIHYRESA-N (3s,6r,10r,13e,16s)-16-[(2r,3r,4s)-4-chloro-3-hydroxy-4-phenylbutan-2-yl]-10-[(3-chloro-4-methoxyphenyl)methyl]-6-methyl-3-(2-methylpropyl)-1,4-dioxa-8,11-diazacyclohexadec-13-ene-2,5,9,12-tetrone Chemical compound C1=C(Cl)C(OC)=CC=C1C[C@@H]1C(=O)NC[C@@H](C)C(=O)O[C@@H](CC(C)C)C(=O)O[C@H]([C@H](C)[C@@H](O)[C@@H](Cl)C=2C=CC=CC=2)C/C=C/C(=O)N1 TVIRNGFXQVMMGB-OFWIHYRESA-N 0.000 description 1
- ONKCBKDTKZIWHZ-MRWFHJSOSA-N (4r)-4-[[(2r)-6-amino-2-[[(2r)-2-[[4-(aminocarbamothioylamino)benzoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]hexanoyl]amino]-5-[[(2r)-1-amino-6-[bis[2-[[4-[2-(1h-imidazol-5-yl)ethylamino]-4-oxobutanoyl]amino]acetyl]amino]-1-oxohexan-2-yl]amino]-5-oxope Chemical compound C([C@H](C(=O)N[C@H](CCCCN)C(=O)N[C@H](CCC(O)=O)C(=O)N[C@H](CCCCN(C(=O)CNC(=O)CCC(=O)NCCC=1NC=NC=1)C(=O)CNC(=O)CCC(=O)NCCC=1NC=NC=1)C(N)=O)NC(=O)C=1C=CC(NC(=S)NN)=CC=1)C1=CC=C(O)C=C1 ONKCBKDTKZIWHZ-MRWFHJSOSA-N 0.000 description 1
- XRBSKUSTLXISAB-XVVDYKMHSA-N (5r,6r,7r,8r)-8-hydroxy-7-(hydroxymethyl)-5-(3,4,5-trimethoxyphenyl)-5,6,7,8-tetrahydrobenzo[f][1,3]benzodioxole-6-carboxylic acid Chemical compound COC1=C(OC)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@H](O)[C@@H](CO)[C@@H]2C(O)=O)=C1 XRBSKUSTLXISAB-XVVDYKMHSA-N 0.000 description 1
- XRBSKUSTLXISAB-UHFFFAOYSA-N (7R,7'R,8R,8'R)-form-Podophyllic acid Natural products COC1=C(OC)C(OC)=CC(C2C3=CC=4OCOC=4C=C3C(O)C(CO)C2C(O)=O)=C1 XRBSKUSTLXISAB-UHFFFAOYSA-N 0.000 description 1
- AESVUZLWRXEGEX-DKCAWCKPSA-N (7S,9R)-7-[(2S,4R,5R,6R)-4-amino-5-hydroxy-6-methyloxan-2-yl]oxy-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-4-methoxy-8,10-dihydro-7H-tetracene-5,12-dione iron(3+) Chemical compound [Fe+3].COc1cccc2C(=O)c3c(O)c4C[C@@](O)(C[C@H](O[C@@H]5C[C@@H](N)[C@@H](O)[C@@H](C)O5)c4c(O)c3C(=O)c12)C(=O)CO AESVUZLWRXEGEX-DKCAWCKPSA-N 0.000 description 1
- JXVAMODRWBNUSF-KZQKBALLSA-N (7s,9r,10r)-7-[(2r,4s,5s,6s)-5-[[(2s,4as,5as,7s,9s,9ar,10ar)-2,9-dimethyl-3-oxo-4,4a,5a,6,7,9,9a,10a-octahydrodipyrano[4,2-a:4',3'-e][1,4]dioxin-7-yl]oxy]-4-(dimethylamino)-6-methyloxan-2-yl]oxy-10-[(2s,4s,5s,6s)-4-(dimethylamino)-5-hydroxy-6-methyloxan-2 Chemical compound O([C@@H]1C2=C(O)C=3C(=O)C4=CC=CC(O)=C4C(=O)C=3C(O)=C2[C@@H](O[C@@H]2O[C@@H](C)[C@@H](O[C@@H]3O[C@@H](C)[C@H]4O[C@@H]5O[C@@H](C)C(=O)C[C@@H]5O[C@H]4C3)[C@H](C2)N(C)C)C[C@]1(O)CC)[C@H]1C[C@H](N(C)C)[C@H](O)[C@H](C)O1 JXVAMODRWBNUSF-KZQKBALLSA-N 0.000 description 1
- INAUWOVKEZHHDM-PEDBPRJASA-N (7s,9s)-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-7-[(2r,4s,5s,6s)-5-hydroxy-6-methyl-4-morpholin-4-yloxan-2-yl]oxy-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione;hydrochloride Chemical compound Cl.N1([C@H]2C[C@@H](O[C@@H](C)[C@H]2O)O[C@H]2C[C@@](O)(CC=3C(O)=C4C(=O)C=5C=CC=C(C=5C(=O)C4=C(O)C=32)OC)C(=O)CO)CCOCC1 INAUWOVKEZHHDM-PEDBPRJASA-N 0.000 description 1
- RCFNNLSZHVHCEK-IMHLAKCZSA-N (7s,9s)-7-(4-amino-6-methyloxan-2-yl)oxy-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione;hydrochloride Chemical compound [Cl-].O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)C1CC([NH3+])CC(C)O1 RCFNNLSZHVHCEK-IMHLAKCZSA-N 0.000 description 1
- NOPNWHSMQOXAEI-PUCKCBAPSA-N (7s,9s)-7-[(2r,4s,5s,6s)-4-(2,3-dihydropyrrol-1-yl)-5-hydroxy-6-methyloxan-2-yl]oxy-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione Chemical compound N1([C@H]2C[C@@H](O[C@@H](C)[C@H]2O)O[C@H]2C[C@@](O)(CC=3C(O)=C4C(=O)C=5C=CC=C(C=5C(=O)C4=C(O)C=32)OC)C(=O)CO)CCC=C1 NOPNWHSMQOXAEI-PUCKCBAPSA-N 0.000 description 1
- FPVKHBSQESCIEP-UHFFFAOYSA-N (8S)-3-(2-deoxy-beta-D-erythro-pentofuranosyl)-3,6,7,8-tetrahydroimidazo[4,5-d][1,3]diazepin-8-ol Natural products C1C(O)C(CO)OC1N1C(NC=NCC2O)=C2N=C1 FPVKHBSQESCIEP-UHFFFAOYSA-N 0.000 description 1
- IEXUMDBQLIVNHZ-YOUGDJEHSA-N (8s,11r,13r,14s,17s)-11-[4-(dimethylamino)phenyl]-17-hydroxy-17-(3-hydroxypropyl)-13-methyl-1,2,6,7,8,11,12,14,15,16-decahydrocyclopenta[a]phenanthren-3-one Chemical compound C1=CC(N(C)C)=CC=C1[C@@H]1C2=C3CCC(=O)C=C3CC[C@H]2[C@H](CC[C@]2(O)CCCO)[C@@]2(C)C1 IEXUMDBQLIVNHZ-YOUGDJEHSA-N 0.000 description 1
- LKJPYSCBVHEWIU-KRWDZBQOSA-N (R)-bicalutamide Chemical compound C([C@@](O)(C)C(=O)NC=1C=C(C(C#N)=CC=1)C(F)(F)F)S(=O)(=O)C1=CC=C(F)C=C1 LKJPYSCBVHEWIU-KRWDZBQOSA-N 0.000 description 1
- AGNGYMCLFWQVGX-AGFFZDDWSA-N (e)-1-[(2s)-2-amino-2-carboxyethoxy]-2-diazonioethenolate Chemical compound OC(=O)[C@@H](N)CO\C([O-])=C\[N+]#N AGNGYMCLFWQVGX-AGFFZDDWSA-N 0.000 description 1
- FONKWHRXTPJODV-DNQXCXABSA-N 1,3-bis[2-[(8s)-8-(chloromethyl)-4-hydroxy-1-methyl-7,8-dihydro-3h-pyrrolo[3,2-e]indole-6-carbonyl]-1h-indol-5-yl]urea Chemical compound C1([C@H](CCl)CN2C(=O)C=3NC4=CC=C(C=C4C=3)NC(=O)NC=3C=C4C=C(NC4=CC=3)C(=O)N3C4=CC(O)=C5NC=C(C5=C4[C@H](CCl)C3)C)=C2C=C(O)C2=C1C(C)=CN2 FONKWHRXTPJODV-DNQXCXABSA-N 0.000 description 1
- WNXJIVFYUVYPPR-UHFFFAOYSA-N 1,3-dioxolane Chemical compound C1COCO1 WNXJIVFYUVYPPR-UHFFFAOYSA-N 0.000 description 1
- FBFJOZZTIXSPPR-UHFFFAOYSA-N 1-(4-aminobutyl)-2-(ethoxymethyl)imidazo[4,5-c]quinolin-4-amine Chemical compound C1=CC=CC2=C(N(C(COCC)=N3)CCCCN)C3=C(N)N=C21 FBFJOZZTIXSPPR-UHFFFAOYSA-N 0.000 description 1
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 1
- BTOTXLJHDSNXMW-POYBYMJQSA-N 2,3-dideoxyuridine Chemical compound O1[C@H](CO)CC[C@@H]1N1C(=O)NC(=O)C=C1 BTOTXLJHDSNXMW-POYBYMJQSA-N 0.000 description 1
- BOMZMNZEXMAQQW-UHFFFAOYSA-N 2,5,11-trimethyl-6h-pyrido[4,3-b]carbazol-2-ium-9-ol;acetate Chemical compound CC([O-])=O.C[N+]1=CC=C2C(C)=C(NC=3C4=CC(O)=CC=3)C4=C(C)C2=C1 BOMZMNZEXMAQQW-UHFFFAOYSA-N 0.000 description 1
- QCXJFISCRQIYID-IAEPZHFASA-N 2-amino-1-n-[(3s,6s,7r,10s,16s)-3-[(2s)-butan-2-yl]-7,11,14-trimethyl-2,5,9,12,15-pentaoxo-10-propan-2-yl-8-oxa-1,4,11,14-tetrazabicyclo[14.3.0]nonadecan-6-yl]-4,6-dimethyl-3-oxo-9-n-[(3s,6s,7r,10s,16s)-7,11,14-trimethyl-2,5,9,12,15-pentaoxo-3,10-di(propa Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N=C2C(C(=O)N[C@@H]3C(=O)N[C@H](C(N4CCC[C@H]4C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]3C)=O)[C@@H](C)CC)=C(N)C(=O)C(C)=C2O2)C2=C(C)C=C1 QCXJFISCRQIYID-IAEPZHFASA-N 0.000 description 1
- FDAYLTPAFBGXAB-UHFFFAOYSA-N 2-chloro-n,n-bis(2-chloroethyl)ethanamine Chemical compound ClCCN(CCCl)CCCl FDAYLTPAFBGXAB-UHFFFAOYSA-N 0.000 description 1
- VNBAOSVONFJBKP-UHFFFAOYSA-N 2-chloro-n,n-bis(2-chloroethyl)propan-1-amine;hydrochloride Chemical compound Cl.CC(Cl)CN(CCCl)CCCl VNBAOSVONFJBKP-UHFFFAOYSA-N 0.000 description 1
- FJCDSQATIJKQKA-UHFFFAOYSA-N 2-fluoro-n-[[5-(6-methylpyridin-2-yl)-4-([1,2,4]triazolo[1,5-a]pyridin-6-yl)-1h-imidazol-2-yl]methyl]aniline Chemical compound CC1=CC=CC(C2=C(N=C(CNC=3C(=CC=CC=3)F)N2)C2=CN3N=CN=C3C=C2)=N1 FJCDSQATIJKQKA-UHFFFAOYSA-N 0.000 description 1
- XBBVURRQGJPTHH-UHFFFAOYSA-N 2-hydroxyacetic acid;2-hydroxypropanoic acid Chemical compound OCC(O)=O.CC(O)C(O)=O XBBVURRQGJPTHH-UHFFFAOYSA-N 0.000 description 1
- YIMDLWDNDGKDTJ-QLKYHASDSA-N 3'-deamino-3'-(3-cyanomorpholin-4-yl)doxorubicin Chemical compound N1([C@H]2C[C@@H](O[C@@H](C)[C@H]2O)O[C@H]2C[C@@](O)(CC=3C(O)=C4C(=O)C=5C=CC=C(C=5C(=O)C4=C(O)C=32)OC)C(=O)CO)CCOCC1C#N YIMDLWDNDGKDTJ-QLKYHASDSA-N 0.000 description 1
- NDMPLJNOPCLANR-UHFFFAOYSA-N 3,4-dihydroxy-15-(4-hydroxy-18-methoxycarbonyl-5,18-seco-ibogamin-18-yl)-16-methoxy-1-methyl-6,7-didehydro-aspidospermidine-3-carboxylic acid methyl ester Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 NDMPLJNOPCLANR-UHFFFAOYSA-N 0.000 description 1
- PWMYMKOUNYTVQN-UHFFFAOYSA-N 3-(8,8-diethyl-2-aza-8-germaspiro[4.5]decan-2-yl)-n,n-dimethylpropan-1-amine Chemical compound C1C[Ge](CC)(CC)CCC11CN(CCCN(C)C)CC1 PWMYMKOUNYTVQN-UHFFFAOYSA-N 0.000 description 1
- CLPFFLWZZBQMAO-UHFFFAOYSA-N 4-(5,6,7,8-tetrahydroimidazo[1,5-a]pyridin-5-yl)benzonitrile Chemical compound C1=CC(C#N)=CC=C1C1N2C=NC=C2CCC1 CLPFFLWZZBQMAO-UHFFFAOYSA-N 0.000 description 1
- DODQJNMQWMSYGS-QPLCGJKRSA-N 4-[(z)-1-[4-[2-(dimethylamino)ethoxy]phenyl]-1-phenylbut-1-en-2-yl]phenol Chemical compound C=1C=C(O)C=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 DODQJNMQWMSYGS-QPLCGJKRSA-N 0.000 description 1
- TVZGACDUOSZQKY-LBPRGKRZSA-N 4-aminofolic acid Chemical compound C1=NC2=NC(N)=NC(N)=C2N=C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 TVZGACDUOSZQKY-LBPRGKRZSA-N 0.000 description 1
- LGZKGOGODCLQHG-CYBMUJFWSA-N 5-[(2r)-2-hydroxy-2-(3,4,5-trimethoxyphenyl)ethyl]-2-methoxyphenol Chemical compound C1=C(O)C(OC)=CC=C1C[C@@H](O)C1=CC(OC)=C(OC)C(OC)=C1 LGZKGOGODCLQHG-CYBMUJFWSA-N 0.000 description 1
- IDPUKCWIGUEADI-UHFFFAOYSA-N 5-[bis(2-chloroethyl)amino]uracil Chemical compound ClCCN(CCCl)C1=CNC(=O)NC1=O IDPUKCWIGUEADI-UHFFFAOYSA-N 0.000 description 1
- NMUSYJAQQFHJEW-KVTDHHQDSA-N 5-azacytidine Chemical compound O=C1N=C(N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 NMUSYJAQQFHJEW-KVTDHHQDSA-N 0.000 description 1
- WYXSYVWAUAUWLD-SHUUEZRQSA-N 6-azauridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=N1 WYXSYVWAUAUWLD-SHUUEZRQSA-N 0.000 description 1
- 229960005538 6-diazo-5-oxo-L-norleucine Drugs 0.000 description 1
- YCWQAMGASJSUIP-YFKPBYRVSA-N 6-diazo-5-oxo-L-norleucine Chemical compound OC(=O)[C@@H](N)CCC(=O)C=[N+]=[N-] YCWQAMGASJSUIP-YFKPBYRVSA-N 0.000 description 1
- ZGXJTSGNIOSYLO-UHFFFAOYSA-N 88755TAZ87 Chemical compound NCC(=O)CCC(O)=O ZGXJTSGNIOSYLO-UHFFFAOYSA-N 0.000 description 1
- HDZZVAMISRMYHH-UHFFFAOYSA-N 9beta-Ribofuranosyl-7-deazaadenin Natural products C1=CC=2C(N)=NC=NC=2N1C1OC(CO)C(O)C1O HDZZVAMISRMYHH-UHFFFAOYSA-N 0.000 description 1
- 102100022089 Acyl-[acyl-carrier-protein] hydrolase Human genes 0.000 description 1
- 102000007471 Adenosine A2A receptor Human genes 0.000 description 1
- 108010085277 Adenosine A2A receptor Proteins 0.000 description 1
- 102100031934 Adhesion G-protein coupled receptor G1 Human genes 0.000 description 1
- CEIZFXOZIQNICU-UHFFFAOYSA-N Alternaria alternata Crofton-weed toxin Natural products CCC(C)C1NC(=O)C(C(C)=O)=C1O CEIZFXOZIQNICU-UHFFFAOYSA-N 0.000 description 1
- 102400000068 Angiostatin Human genes 0.000 description 1
- 108010079709 Angiostatins Proteins 0.000 description 1
- 108090000644 Angiozyme Proteins 0.000 description 1
- 108020000948 Antisense Oligonucleotides Proteins 0.000 description 1
- 101100067974 Arabidopsis thaliana POP2 gene Proteins 0.000 description 1
- 101001007348 Arachis hypogaea Galactose-binding lectin Proteins 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 102000014654 Aromatase Human genes 0.000 description 1
- 108010078554 Aromatase Proteins 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- NOWKCMXCCJGMRR-UHFFFAOYSA-N Aziridine Chemical class C1CN1 NOWKCMXCCJGMRR-UHFFFAOYSA-N 0.000 description 1
- 229940125565 BMS-986016 Drugs 0.000 description 1
- VGGGPCQERPFHOB-MCIONIFRSA-N Bestatin Chemical compound CC(C)C[C@H](C(O)=O)NC(=O)[C@@H](O)[C@H](N)CC1=CC=CC=C1 VGGGPCQERPFHOB-MCIONIFRSA-N 0.000 description 1
- 229940122361 Bisphosphonate Drugs 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 101000964894 Bos taurus 14-3-3 protein zeta/delta Proteins 0.000 description 1
- MBABCNBNDNGODA-LTGLSHGVSA-N Bullatacin Natural products O=C1C(C[C@H](O)CCCCCCCCCC[C@@H](O)[C@@H]2O[C@@H]([C@@H]3O[C@H]([C@@H](O)CCCCCCCCCC)CC3)CC2)=C[C@H](C)O1 MBABCNBNDNGODA-LTGLSHGVSA-N 0.000 description 1
- KGGVWMAPBXIMEM-JQFCFGFHSA-N Bullatacinone Natural products O=C(C[C@H]1C(=O)O[C@H](CCCCCCCCCC[C@H](O)[C@@H]2O[C@@H]([C@@H]3O[C@@H]([C@@H](O)CCCCCCCCCC)CC3)CC2)C1)C KGGVWMAPBXIMEM-JQFCFGFHSA-N 0.000 description 1
- KGGVWMAPBXIMEM-ZRTAFWODSA-N Bullatacinone Chemical compound O1[C@@H]([C@@H](O)CCCCCCCCCC)CC[C@@H]1[C@@H]1O[C@@H]([C@H](O)CCCCCCCCCC[C@H]2OC(=O)[C@H](CC(C)=O)C2)CC1 KGGVWMAPBXIMEM-ZRTAFWODSA-N 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- 102100031151 C-C chemokine receptor type 2 Human genes 0.000 description 1
- 101710149815 C-C chemokine receptor type 2 Proteins 0.000 description 1
- 101710149863 C-C chemokine receptor type 4 Proteins 0.000 description 1
- 102100028989 C-X-C chemokine receptor type 2 Human genes 0.000 description 1
- 102100031650 C-X-C chemokine receptor type 4 Human genes 0.000 description 1
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 1
- 102100032976 CCR4-NOT transcription complex subunit 6 Human genes 0.000 description 1
- 108010046080 CD27 Ligand Proteins 0.000 description 1
- 229940121697 CD27 agonist Drugs 0.000 description 1
- 102100036008 CD48 antigen Human genes 0.000 description 1
- 108010021064 CTLA-4 Antigen Proteins 0.000 description 1
- 239000012275 CTLA-4 inhibitor Substances 0.000 description 1
- KLWPJMFMVPTNCC-UHFFFAOYSA-N Camptothecin Natural products CCC1(O)C(=O)OCC2=C1C=C3C4Nc5ccccc5C=C4CN3C2=O KLWPJMFMVPTNCC-UHFFFAOYSA-N 0.000 description 1
- 241000282465 Canis Species 0.000 description 1
- GAGWJHPBXLXJQN-UHFFFAOYSA-N Capecitabine Natural products C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1C1C(O)C(O)C(C)O1 GAGWJHPBXLXJQN-UHFFFAOYSA-N 0.000 description 1
- SHHKQEUPHAENFK-UHFFFAOYSA-N Carboquone Chemical compound O=C1C(C)=C(N2CC2)C(=O)C(C(COC(N)=O)OC)=C1N1CC1 SHHKQEUPHAENFK-UHFFFAOYSA-N 0.000 description 1
- AOCCBINRVIKJHY-UHFFFAOYSA-N Carmofur Chemical compound CCCCCCNC(=O)N1C=C(F)C(=O)NC1=O AOCCBINRVIKJHY-UHFFFAOYSA-N 0.000 description 1
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 102000019034 Chemokines Human genes 0.000 description 1
- 108010012236 Chemokines Proteins 0.000 description 1
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 description 1
- JWBOIMRXGHLCPP-UHFFFAOYSA-N Chloditan Chemical compound C=1C=CC=C(Cl)C=1C(C(Cl)Cl)C1=CC=C(Cl)C=C1 JWBOIMRXGHLCPP-UHFFFAOYSA-N 0.000 description 1
- XCDXSSFOJZZGQC-UHFFFAOYSA-N Chlornaphazine Chemical compound C1=CC=CC2=CC(N(CCCl)CCCl)=CC=C21 XCDXSSFOJZZGQC-UHFFFAOYSA-N 0.000 description 1
- MKQWTWSXVILIKJ-LXGUWJNJSA-N Chlorozotocin Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](C=O)NC(=O)N(N=O)CCCl MKQWTWSXVILIKJ-LXGUWJNJSA-N 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 102100031162 Collagen alpha-1(XVIII) chain Human genes 0.000 description 1
- 229930188224 Cryptophycin Natural products 0.000 description 1
- 101710093674 Cyclic nucleotide-gated cation channel beta-1 Proteins 0.000 description 1
- 206010050685 Cytokine storm Diseases 0.000 description 1
- 238000000116 DAPI staining Methods 0.000 description 1
- 239000012624 DNA alkylating agent Substances 0.000 description 1
- 229940124087 DNA topoisomerase II inhibitor Drugs 0.000 description 1
- WEAHRLBPCANXCN-UHFFFAOYSA-N Daunomycin Natural products CCC1(O)CC(OC2CC(N)C(O)C(C)O2)c3cc4C(=O)c5c(OC)cccc5C(=O)c4c(O)c3C1 WEAHRLBPCANXCN-UHFFFAOYSA-N 0.000 description 1
- NNJPGOLRFBJNIW-UHFFFAOYSA-N Demecolcine Natural products C1=C(OC)C(=O)C=C2C(NC)CCC3=CC(OC)=C(OC)C(OC)=C3C2=C1 NNJPGOLRFBJNIW-UHFFFAOYSA-N 0.000 description 1
- 108010002156 Depsipeptides Proteins 0.000 description 1
- AUGQEEXBDZWUJY-ZLJUKNTDSA-N Diacetoxyscirpenol Chemical compound C([C@]12[C@]3(C)[C@H](OC(C)=O)[C@@H](O)[C@H]1O[C@@H]1C=C(C)CC[C@@]13COC(=O)C)O2 AUGQEEXBDZWUJY-ZLJUKNTDSA-N 0.000 description 1
- AUGQEEXBDZWUJY-UHFFFAOYSA-N Diacetoxyscirpenol Natural products CC(=O)OCC12CCC(C)=CC1OC1C(O)C(OC(C)=O)C2(C)C11CO1 AUGQEEXBDZWUJY-UHFFFAOYSA-N 0.000 description 1
- 239000004338 Dichlorodifluoromethane Substances 0.000 description 1
- ZQZFYGIXNQKOAV-OCEACIFDSA-N Droloxifene Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=C(O)C=CC=1)\C1=CC=C(OCCN(C)C)C=C1 ZQZFYGIXNQKOAV-OCEACIFDSA-N 0.000 description 1
- 229930193152 Dynemicin Natural products 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 238000008157 ELISA kit Methods 0.000 description 1
- 102100025137 Early activation antigen CD69 Human genes 0.000 description 1
- 108010079505 Endostatins Proteins 0.000 description 1
- AFMYMMXSQGUCBK-UHFFFAOYSA-N Endynamicin A Natural products C1#CC=CC#CC2NC(C=3C(=O)C4=C(O)C=CC(O)=C4C(=O)C=3C(O)=C3)=C3C34OC32C(C)C(C(O)=O)=C(OC)C41 AFMYMMXSQGUCBK-UHFFFAOYSA-N 0.000 description 1
- 241000792859 Enema Species 0.000 description 1
- SAMRUMKYXPVKPA-VFKOLLTISA-N Enocitabine Chemical compound O=C1N=C(NC(=O)CCCCCCCCCCCCCCCCCCCCC)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 SAMRUMKYXPVKPA-VFKOLLTISA-N 0.000 description 1
- OBMLHUPNRURLOK-XGRAFVIBSA-N Epitiostanol Chemical compound C1[C@@H]2S[C@@H]2C[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CC[C@H]21 OBMLHUPNRURLOK-XGRAFVIBSA-N 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 229930189413 Esperamicin Natural products 0.000 description 1
- JOYRKODLDBILNP-UHFFFAOYSA-N Ethyl urethane Chemical compound CCOC(N)=O JOYRKODLDBILNP-UHFFFAOYSA-N 0.000 description 1
- 208000001382 Experimental Melanoma Diseases 0.000 description 1
- 101150089023 FASLG gene Proteins 0.000 description 1
- 108091006020 Fc-tagged proteins Proteins 0.000 description 1
- 241000282324 Felis Species 0.000 description 1
- 229920001917 Ficoll Polymers 0.000 description 1
- 230000037057 G1 phase arrest Effects 0.000 description 1
- 108010001498 Galectin 1 Proteins 0.000 description 1
- 102100021736 Galectin-1 Human genes 0.000 description 1
- 101710121810 Galectin-9 Proteins 0.000 description 1
- 102100031351 Galectin-9 Human genes 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- BLCLNMBMMGCOAS-URPVMXJPSA-N Goserelin Chemical compound C([C@@H](C(=O)N[C@H](COC(C)(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N1[C@@H](CCC1)C(=O)NNC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H]1NC(=O)CC1)C1=CC=C(O)C=C1 BLCLNMBMMGCOAS-URPVMXJPSA-N 0.000 description 1
- 108010069236 Goserelin Proteins 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 108010007712 Hepatitis A Virus Cellular Receptor 1 Proteins 0.000 description 1
- 102100034459 Hepatitis A virus cellular receptor 1 Human genes 0.000 description 1
- 101000824278 Homo sapiens Acyl-[acyl-carrier-protein] hydrolase Proteins 0.000 description 1
- 101000775042 Homo sapiens Adhesion G-protein coupled receptor G1 Proteins 0.000 description 1
- 101000922348 Homo sapiens C-X-C chemokine receptor type 4 Proteins 0.000 description 1
- 101000884279 Homo sapiens CD276 antigen Proteins 0.000 description 1
- 101100166600 Homo sapiens CD28 gene Proteins 0.000 description 1
- 101000716130 Homo sapiens CD48 antigen Proteins 0.000 description 1
- 101100118549 Homo sapiens EGFR gene Proteins 0.000 description 1
- 101000934374 Homo sapiens Early activation antigen CD69 Proteins 0.000 description 1
- 101001042104 Homo sapiens Inducible T-cell costimulator Proteins 0.000 description 1
- 101000984189 Homo sapiens Leukocyte immunoglobulin-like receptor subfamily B member 2 Proteins 0.000 description 1
- 101001138062 Homo sapiens Leukocyte-associated immunoglobulin-like receptor 1 Proteins 0.000 description 1
- 101001023712 Homo sapiens Nectin-3 Proteins 0.000 description 1
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 1
- 101000831007 Homo sapiens T-cell immunoreceptor with Ig and ITIM domains Proteins 0.000 description 1
- 101100207070 Homo sapiens TNFSF8 gene Proteins 0.000 description 1
- 101000831567 Homo sapiens Toll-like receptor 2 Proteins 0.000 description 1
- 101000764622 Homo sapiens Transmembrane and immunoglobulin domain-containing protein 2 Proteins 0.000 description 1
- 101000830596 Homo sapiens Tumor necrosis factor ligand superfamily member 15 Proteins 0.000 description 1
- 101000764263 Homo sapiens Tumor necrosis factor ligand superfamily member 4 Proteins 0.000 description 1
- 101000610602 Homo sapiens Tumor necrosis factor receptor superfamily member 10C Proteins 0.000 description 1
- 101000610609 Homo sapiens Tumor necrosis factor receptor superfamily member 10D Proteins 0.000 description 1
- 101000798130 Homo sapiens Tumor necrosis factor receptor superfamily member 11B Proteins 0.000 description 1
- 101000795167 Homo sapiens Tumor necrosis factor receptor superfamily member 13B Proteins 0.000 description 1
- 101000795169 Homo sapiens Tumor necrosis factor receptor superfamily member 13C Proteins 0.000 description 1
- 101000801227 Homo sapiens Tumor necrosis factor receptor superfamily member 19 Proteins 0.000 description 1
- 101000679921 Homo sapiens Tumor necrosis factor receptor superfamily member 21 Proteins 0.000 description 1
- 101000611023 Homo sapiens Tumor necrosis factor receptor superfamily member 6 Proteins 0.000 description 1
- 101000597785 Homo sapiens Tumor necrosis factor receptor superfamily member 6B Proteins 0.000 description 1
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 1
- 101000666896 Homo sapiens V-type immunoglobulin domain-containing suppressor of T-cell activation Proteins 0.000 description 1
- VSNHCAURESNICA-UHFFFAOYSA-N Hydroxyurea Chemical compound NC(=O)NO VSNHCAURESNICA-UHFFFAOYSA-N 0.000 description 1
- 102100034980 ICOS ligand Human genes 0.000 description 1
- MPBVHIBUJCELCL-UHFFFAOYSA-N Ibandronate Chemical compound CCCCCN(C)CCC(O)(P(O)(O)=O)P(O)(O)=O MPBVHIBUJCELCL-UHFFFAOYSA-N 0.000 description 1
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 1
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 1
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 description 1
- 108091008028 Immune checkpoint receptors Proteins 0.000 description 1
- 102000037978 Immune checkpoint receptors Human genes 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 206010062016 Immunosuppression Diseases 0.000 description 1
- 108091008026 Inhibitory immune checkpoint proteins Proteins 0.000 description 1
- 102000037984 Inhibitory immune checkpoint proteins Human genes 0.000 description 1
- 206010022095 Injection Site reaction Diseases 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 102000003814 Interleukin-10 Human genes 0.000 description 1
- 108090000174 Interleukin-10 Proteins 0.000 description 1
- 108010065805 Interleukin-12 Proteins 0.000 description 1
- 108090000172 Interleukin-15 Proteins 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 102000004889 Interleukin-6 Human genes 0.000 description 1
- 108010002586 Interleukin-7 Proteins 0.000 description 1
- 108010018951 Interleukin-8B Receptors Proteins 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- 239000002147 L01XE04 - Sunitinib Substances 0.000 description 1
- JLERVPBPJHKRBJ-UHFFFAOYSA-N LY 117018 Chemical compound C1=CC(O)=CC=C1C1=C(C(=O)C=2C=CC(OCCN3CCCC3)=CC=2)C2=CC=C(O)C=C2S1 JLERVPBPJHKRBJ-UHFFFAOYSA-N 0.000 description 1
- 229920001491 Lentinan Polymers 0.000 description 1
- 102100025583 Leukocyte immunoglobulin-like receptor subfamily B member 2 Human genes 0.000 description 1
- 102100020943 Leukocyte-associated immunoglobulin-like receptor 1 Human genes 0.000 description 1
- 108010000817 Leuprolide Proteins 0.000 description 1
- 241000186781 Listeria Species 0.000 description 1
- GQYIWUVLTXOXAJ-UHFFFAOYSA-N Lomustine Chemical compound ClCCN(N=O)C(=O)NC1CCCCC1 GQYIWUVLTXOXAJ-UHFFFAOYSA-N 0.000 description 1
- 102000004083 Lymphotoxin-alpha Human genes 0.000 description 1
- 108090000542 Lymphotoxin-alpha Proteins 0.000 description 1
- VJRAUFKOOPNFIQ-UHFFFAOYSA-N Marcellomycin Natural products C12=C(O)C=3C(=O)C4=C(O)C=CC(O)=C4C(=O)C=3C=C2C(C(=O)OC)C(CC)(O)CC1OC(OC1C)CC(N(C)C)C1OC(OC1C)CC(O)C1OC1CC(O)C(O)C(C)O1 VJRAUFKOOPNFIQ-UHFFFAOYSA-N 0.000 description 1
- 229930126263 Maytansine Natural products 0.000 description 1
- 108010061593 Member 14 Tumor Necrosis Factor Receptors Proteins 0.000 description 1
- IVDYZAAPOLNZKG-KWHRADDSSA-N Mepitiostane Chemical compound O([C@@H]1[C@]2(CC[C@@H]3[C@@]4(C)C[C@H]5S[C@H]5C[C@@H]4CC[C@H]3[C@@H]2CC1)C)C1(OC)CCCC1 IVDYZAAPOLNZKG-KWHRADDSSA-N 0.000 description 1
- VFKZTMPDYBFSTM-KVTDHHQDSA-N Mitobronitol Chemical compound BrC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CBr VFKZTMPDYBFSTM-KVTDHHQDSA-N 0.000 description 1
- 108020005196 Mitochondrial DNA Proteins 0.000 description 1
- 229930192392 Mitomycin Natural products 0.000 description 1
- 101100046559 Mus musculus Tnfrsf12a gene Proteins 0.000 description 1
- 101100207071 Mus musculus Tnfsf8 gene Proteins 0.000 description 1
- 241001467552 Mycobacterium bovis BCG Species 0.000 description 1
- FBKMWOJEPMPVTQ-UHFFFAOYSA-N N'-(3-bromo-4-fluorophenyl)-N-hydroxy-4-[2-(sulfamoylamino)ethylamino]-1,2,5-oxadiazole-3-carboximidamide Chemical compound NS(=O)(=O)NCCNC1=NON=C1C(=NO)NC1=CC=C(F)C(Br)=C1 FBKMWOJEPMPVTQ-UHFFFAOYSA-N 0.000 description 1
- GUVMFDICMFQHSZ-UHFFFAOYSA-N N-(1-aminoethenyl)-1-[4-[[5-(4-amino-5-methyl-2-oxopyrimidin-1-yl)-3-[[5-(4-amino-5-methyl-2-oxopyrimidin-1-yl)-3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(4-amino-5-methyl-2-oxopyrimidin-1-yl)-3-[[5-(4-amino-5-methyl-2-oxopyrimidin-1-yl)-3-[[5-(4-amino-5-methyl-2-oxopyrimidin-1-yl)-3-[[5-(4-amino-5-methyl-2-oxopyrimidin-1-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[hydroxy-[[3-[hydroxy-[[3-hydroxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy]phosphinothioyl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy]phosphinothioyl]oxyoxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxyoxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxyoxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxyoxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxyoxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxyoxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-(2-amino-6-oxo-1H-purin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-(2-amino-6-oxo-1H-purin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxyoxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxyoxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-[[[2-[[[2-[[[5-(2-amino-6-oxo-1H-purin-9-yl)-2-[[[5-(4-amino-2-oxopyrimidin-1-yl)-2-[[hydroxy-[2-(hydroxymethyl)-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-3-yl]oxyphosphinothioyl]oxymethyl]oxolan-3-yl]oxy-hydroxyphosphinothioyl]oxymethyl]oxolan-3-yl]oxy-hydroxyphosphinothioyl]oxymethyl]-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-3-yl]oxy-hydroxyphosphinothioyl]oxymethyl]-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-3-yl]oxy-hydroxyphosphinothioyl]oxymethyl]oxolan-2-yl]-5-methylimidazole-4-carboxamide Chemical compound CC1=C(C(=O)NC(N)=C)N=CN1C1OC(COP(O)(=S)OC2C(OC(C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)OC2C(OC(C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C(NC(=O)C(C)=C2)=O)CO)C(OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C3=C(C(NC(N)=N3)=O)N=C2)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C3=C(C(NC(N)=N3)=O)N=C2)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C3=C(C(NC(N)=N3)=O)N=C2)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C3=C(C(NC(N)=N3)=O)N=C2)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)O)C1 GUVMFDICMFQHSZ-UHFFFAOYSA-N 0.000 description 1
- OVBPIULPVIDEAO-UHFFFAOYSA-N N-Pteroyl-L-glutaminsaeure Natural products C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-UHFFFAOYSA-N 0.000 description 1
- 125000001429 N-terminal alpha-amino-acid group Chemical group 0.000 description 1
- 102100035487 Nectin-3 Human genes 0.000 description 1
- 108010032605 Nerve Growth Factor Receptors Proteins 0.000 description 1
- SYNHCENRCUAUNM-UHFFFAOYSA-N Nitrogen mustard N-oxide hydrochloride Chemical compound Cl.ClCC[N+]([O-])(C)CCCl SYNHCENRCUAUNM-UHFFFAOYSA-N 0.000 description 1
- KGTDRFCXGRULNK-UHFFFAOYSA-N Nogalamycin Natural products COC1C(OC)(C)C(OC)C(C)OC1OC1C2=C(O)C(C(=O)C3=C(O)C=C4C5(C)OC(C(C(C5O)N(C)C)O)OC4=C3C3=O)=C3C=C2C(C(=O)OC)C(C)(O)C1 KGTDRFCXGRULNK-UHFFFAOYSA-N 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 102000004473 OX40 Ligand Human genes 0.000 description 1
- 108010042215 OX40 Ligand Proteins 0.000 description 1
- YGACXVRLDHEXKY-WXRXAMBDSA-N O[C@H](C[C@H]1c2c(cccc2F)-c2cncn12)[C@H]1CC[C@H](O)CC1 Chemical compound O[C@H](C[C@H]1c2c(cccc2F)-c2cncn12)[C@H]1CC[C@H](O)CC1 YGACXVRLDHEXKY-WXRXAMBDSA-N 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- 229930187135 Olivomycin Natural products 0.000 description 1
- 102000043276 Oncogene Human genes 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 239000012272 PD-L2 inhibitor Substances 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- VREZDOWOLGNDPW-MYVCAWNPSA-N Pancratistatin Natural products O=C1N[C@H]2[C@H](O)[C@H](O)[C@H](O)[C@H](O)[C@@H]2c2c1c(O)c1OCOc1c2 VREZDOWOLGNDPW-MYVCAWNPSA-N 0.000 description 1
- VREZDOWOLGNDPW-ALTGWBOUSA-N Pancratistatin Chemical compound C1=C2[C@H]3[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O)[C@@H]3NC(=O)C2=C(O)C2=C1OCO2 VREZDOWOLGNDPW-ALTGWBOUSA-N 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- 108010057150 Peplomycin Proteins 0.000 description 1
- KMSKQZKKOZQFFG-HSUXVGOQSA-N Pirarubicin Chemical compound O([C@H]1[C@@H](N)C[C@@H](O[C@H]1C)O[C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1CCCCO1 KMSKQZKKOZQFFG-HSUXVGOQSA-N 0.000 description 1
- 102000010780 Platelet-Derived Growth Factor Human genes 0.000 description 1
- 108010038512 Platelet-Derived Growth Factor Proteins 0.000 description 1
- 108010051742 Platelet-Derived Growth Factor beta Receptor Proteins 0.000 description 1
- 102100026547 Platelet-derived growth factor receptor beta Human genes 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- HFVNWDWLWUCIHC-GUPDPFMOSA-N Prednimustine Chemical compound O=C([C@@]1(O)CC[C@H]2[C@H]3[C@@H]([C@]4(C=CC(=O)C=C4CC3)C)[C@@H](O)C[C@@]21C)COC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 HFVNWDWLWUCIHC-GUPDPFMOSA-N 0.000 description 1
- 101710094000 Programmed cell death 1 ligand 1 Proteins 0.000 description 1
- 108010067787 Proteoglycans Proteins 0.000 description 1
- 102000014128 RANK Ligand Human genes 0.000 description 1
- 108010025832 RANK Ligand Proteins 0.000 description 1
- 108010052562 RELT Proteins 0.000 description 1
- 102000018795 RELT Human genes 0.000 description 1
- 108091030071 RNAI Proteins 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 101100372762 Rattus norvegicus Flt1 gene Proteins 0.000 description 1
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- OWPCHSCAPHNHAV-UHFFFAOYSA-N Rhizoxin Natural products C1C(O)C2(C)OC2C=CC(C)C(OC(=O)C2)CC2CC2OC2C(=O)OC1C(C)C(OC)C(C)=CC=CC(C)=CC1=COC(C)=N1 OWPCHSCAPHNHAV-UHFFFAOYSA-N 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- NSFWWJIQIKBZMJ-YKNYLIOZSA-N Roridin A Chemical compound C([C@]12[C@]3(C)[C@H]4C[C@H]1O[C@@H]1C=C(C)CC[C@@]13COC(=O)[C@@H](O)[C@H](C)CCO[C@H](\C=C\C=C/C(=O)O4)[C@H](O)C)O2 NSFWWJIQIKBZMJ-YKNYLIOZSA-N 0.000 description 1
- 101100123851 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) HER1 gene Proteins 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 229920000519 Sizofiran Polymers 0.000 description 1
- 108020004459 Small interfering RNA Proteins 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 229940126530 T cell activator Drugs 0.000 description 1
- BXFOFFBJRFZBQZ-QYWOHJEZSA-N T-2 toxin Chemical compound C([C@@]12[C@]3(C)[C@H](OC(C)=O)[C@@H](O)[C@H]1O[C@H]1[C@]3(COC(C)=O)C[C@@H](C(=C1)C)OC(=O)CC(C)C)O2 BXFOFFBJRFZBQZ-QYWOHJEZSA-N 0.000 description 1
- 102100039367 T-cell immunoglobulin and mucin domain-containing protein 4 Human genes 0.000 description 1
- 101710174757 T-cell immunoglobulin and mucin domain-containing protein 4 Proteins 0.000 description 1
- 102100024834 T-cell immunoreceptor with Ig and ITIM domains Human genes 0.000 description 1
- 229940124613 TLR 7/8 agonist Drugs 0.000 description 1
- 108010014401 TWEAK Receptor Proteins 0.000 description 1
- 102000016946 TWEAK Receptor Human genes 0.000 description 1
- CGMTUJFWROPELF-UHFFFAOYSA-N Tenuazonic acid Natural products CCC(C)C1NC(=O)C(=C(C)/O)C1=O CGMTUJFWROPELF-UHFFFAOYSA-N 0.000 description 1
- 229940123384 Toll-like receptor (TLR) agonist Drugs 0.000 description 1
- 102100024333 Toll-like receptor 2 Human genes 0.000 description 1
- 101710183280 Topoisomerase Proteins 0.000 description 1
- 239000000317 Topoisomerase II Inhibitor Substances 0.000 description 1
- IWEQQRMGNVVKQW-OQKDUQJOSA-N Toremifene citrate Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O.C1=CC(OCCN(C)C)=CC=C1C(\C=1C=CC=CC=1)=C(\CCCl)C1=CC=CC=C1 IWEQQRMGNVVKQW-OQKDUQJOSA-N 0.000 description 1
- 102100025946 Transforming growth factor beta activator LRRC32 Human genes 0.000 description 1
- 101710169732 Transforming growth factor beta activator LRRC32 Proteins 0.000 description 1
- 102100026224 Transmembrane and immunoglobulin domain-containing protein 2 Human genes 0.000 description 1
- UMILHIMHKXVDGH-UHFFFAOYSA-N Triethylene glycol diglycidyl ether Chemical compound C1OC1COCCOCCOCCOCC1CO1 UMILHIMHKXVDGH-UHFFFAOYSA-N 0.000 description 1
- 102000004243 Tubulin Human genes 0.000 description 1
- 108090000704 Tubulin Proteins 0.000 description 1
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 description 1
- 102100024584 Tumor necrosis factor ligand superfamily member 12 Human genes 0.000 description 1
- 101710097155 Tumor necrosis factor ligand superfamily member 12 Proteins 0.000 description 1
- 108090000138 Tumor necrosis factor ligand superfamily member 15 Proteins 0.000 description 1
- 102100026890 Tumor necrosis factor ligand superfamily member 4 Human genes 0.000 description 1
- 102100031988 Tumor necrosis factor ligand superfamily member 6 Human genes 0.000 description 1
- 102100032100 Tumor necrosis factor ligand superfamily member 8 Human genes 0.000 description 1
- 102100040115 Tumor necrosis factor receptor superfamily member 10C Human genes 0.000 description 1
- 102100040110 Tumor necrosis factor receptor superfamily member 10D Human genes 0.000 description 1
- 102100032236 Tumor necrosis factor receptor superfamily member 11B Human genes 0.000 description 1
- 102100029675 Tumor necrosis factor receptor superfamily member 13B Human genes 0.000 description 1
- 102100029690 Tumor necrosis factor receptor superfamily member 13C Human genes 0.000 description 1
- 102100028785 Tumor necrosis factor receptor superfamily member 14 Human genes 0.000 description 1
- 102100033725 Tumor necrosis factor receptor superfamily member 16 Human genes 0.000 description 1
- 102100033760 Tumor necrosis factor receptor superfamily member 19 Human genes 0.000 description 1
- 101710187743 Tumor necrosis factor receptor superfamily member 1A Proteins 0.000 description 1
- 102100033732 Tumor necrosis factor receptor superfamily member 1A Human genes 0.000 description 1
- 102100033733 Tumor necrosis factor receptor superfamily member 1B Human genes 0.000 description 1
- 101710187830 Tumor necrosis factor receptor superfamily member 1B Proteins 0.000 description 1
- 102100022205 Tumor necrosis factor receptor superfamily member 21 Human genes 0.000 description 1
- 102100035284 Tumor necrosis factor receptor superfamily member 6B Human genes 0.000 description 1
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 1
- 102100038282 V-type immunoglobulin domain-containing suppressor of T-cell activation Human genes 0.000 description 1
- 241000863480 Vinca Species 0.000 description 1
- 238000012452 Xenomouse strains Methods 0.000 description 1
- SPJCRMJCFSJKDE-ZWBUGVOYSA-N [(3s,8s,9s,10r,13r,14s,17r)-10,13-dimethyl-17-[(2r)-6-methylheptan-2-yl]-2,3,4,7,8,9,11,12,14,15,16,17-dodecahydro-1h-cyclopenta[a]phenanthren-3-yl] 2-[4-[bis(2-chloroethyl)amino]phenyl]acetate Chemical compound O([C@@H]1CC2=CC[C@H]3[C@@H]4CC[C@@H]([C@]4(CC[C@@H]3[C@@]2(C)CC1)C)[C@H](C)CCCC(C)C)C(=O)CC1=CC=C(N(CCCl)CCCl)C=C1 SPJCRMJCFSJKDE-ZWBUGVOYSA-N 0.000 description 1
- IFJUINDAXYAPTO-UUBSBJJBSA-N [(8r,9s,13s,14s,17s)-17-[2-[4-[4-[bis(2-chloroethyl)amino]phenyl]butanoyloxy]acetyl]oxy-13-methyl-6,7,8,9,11,12,14,15,16,17-decahydrocyclopenta[a]phenanthren-3-yl] benzoate Chemical compound C([C@@H]1[C@@H](C2=CC=3)CC[C@]4([C@H]1CC[C@@H]4OC(=O)COC(=O)CCCC=1C=CC(=CC=1)N(CCCl)CCCl)C)CC2=CC=3OC(=O)C1=CC=CC=C1 IFJUINDAXYAPTO-UUBSBJJBSA-N 0.000 description 1
- IHGLINDYFMDHJG-UHFFFAOYSA-N [2-(4-methoxyphenyl)-3,4-dihydronaphthalen-1-yl]-[4-(2-pyrrolidin-1-ylethoxy)phenyl]methanone Chemical compound C1=CC(OC)=CC=C1C(CCC1=CC=CC=C11)=C1C(=O)C(C=C1)=CC=C1OCCN1CCCC1 IHGLINDYFMDHJG-UHFFFAOYSA-N 0.000 description 1
- XZSRRNFBEIOBDA-CFNBKWCHSA-N [2-[(2s,4s)-4-[(2r,4s,5s,6s)-4-amino-5-hydroxy-6-methyloxan-2-yl]oxy-2,5,12-trihydroxy-7-methoxy-6,11-dioxo-3,4-dihydro-1h-tetracen-2-yl]-2-oxoethyl] 2,2-diethoxyacetate Chemical compound O([C@H]1C[C@](CC2=C(O)C=3C(=O)C4=CC=CC(OC)=C4C(=O)C=3C(O)=C21)(O)C(=O)COC(=O)C(OCC)OCC)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 XZSRRNFBEIOBDA-CFNBKWCHSA-N 0.000 description 1
- 108010023617 abarelix Proteins 0.000 description 1
- AIWRTTMUVOZGPW-HSPKUQOVSA-N abarelix Chemical compound C([C@@H](C(=O)N[C@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCNC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@H](C)C(N)=O)N(C)C(=O)[C@H](CO)NC(=O)[C@@H](CC=1C=NC=CC=1)NC(=O)[C@@H](CC=1C=CC(Cl)=CC=1)NC(=O)[C@@H](CC=1C=C2C=CC=CC2=CC=1)NC(C)=O)C1=CC=C(O)C=C1 AIWRTTMUVOZGPW-HSPKUQOVSA-N 0.000 description 1
- 229960002184 abarelix Drugs 0.000 description 1
- 229940028652 abraxane Drugs 0.000 description 1
- ZOZKYEHVNDEUCO-XUTVFYLZSA-N aceglatone Chemical compound O1C(=O)[C@H](OC(C)=O)[C@@H]2OC(=O)[C@@H](OC(=O)C)[C@@H]21 ZOZKYEHVNDEUCO-XUTVFYLZSA-N 0.000 description 1
- 229950002684 aceglatone Drugs 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 229930183665 actinomycin Natural products 0.000 description 1
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 229960005305 adenosine Drugs 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 229950004955 adozelesin Drugs 0.000 description 1
- BYRVKDUQDLJUBX-JJCDCTGGSA-N adozelesin Chemical compound C1=CC=C2OC(C(=O)NC=3C=C4C=C(NC4=CC=3)C(=O)N3C[C@H]4C[C@]44C5=C(C(C=C43)=O)NC=C5C)=CC2=C1 BYRVKDUQDLJUBX-JJCDCTGGSA-N 0.000 description 1
- 210000004100 adrenal gland Anatomy 0.000 description 1
- 229940009456 adriamycin Drugs 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 108700025316 aldesleukin Proteins 0.000 description 1
- 229940045714 alkyl sulfonate alkylating agent Drugs 0.000 description 1
- 150000008052 alkyl sulfonates Chemical class 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- SHGAZHPCJJPHSC-YCNIQYBTSA-N all-trans-retinoic acid Chemical compound OC(=O)\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-YCNIQYBTSA-N 0.000 description 1
- 229960000473 altretamine Drugs 0.000 description 1
- 229960002749 aminolevulinic acid Drugs 0.000 description 1
- 229960003896 aminopterin Drugs 0.000 description 1
- 210000004381 amniotic fluid Anatomy 0.000 description 1
- 229960001220 amsacrine Drugs 0.000 description 1
- XCPGHVQEEXUHNC-UHFFFAOYSA-N amsacrine Chemical compound COC1=CC(NS(C)(=O)=O)=CC=C1NC1=C(C=CC=C2)C2=NC2=CC=CC=C12 XCPGHVQEEXUHNC-UHFFFAOYSA-N 0.000 description 1
- 229960002932 anastrozole Drugs 0.000 description 1
- BBDAGFIXKZCXAH-CCXZUQQUSA-N ancitabine Chemical compound N=C1C=CN2[C@@H]3O[C@H](CO)[C@@H](O)[C@@H]3OC2=N1 BBDAGFIXKZCXAH-CCXZUQQUSA-N 0.000 description 1
- 229950000242 ancitabine Drugs 0.000 description 1
- 239000003098 androgen Substances 0.000 description 1
- 229940030486 androgens Drugs 0.000 description 1
- 230000033115 angiogenesis Effects 0.000 description 1
- 230000002280 anti-androgenic effect Effects 0.000 description 1
- 230000001772 anti-angiogenic effect Effects 0.000 description 1
- 238000011122 anti-angiogenic therapy Methods 0.000 description 1
- 229940046836 anti-estrogen Drugs 0.000 description 1
- 230000001833 anti-estrogenic effect Effects 0.000 description 1
- 230000000340 anti-metabolite Effects 0.000 description 1
- 239000000051 antiandrogen Substances 0.000 description 1
- 229940030495 antiandrogen sex hormone and modulator of the genital system Drugs 0.000 description 1
- 230000005875 antibody response Effects 0.000 description 1
- 239000003146 anticoagulant agent Substances 0.000 description 1
- 229940127219 anticoagulant drug Drugs 0.000 description 1
- 230000009464 antigen specific memory response Effects 0.000 description 1
- 210000000612 antigen-presenting cell Anatomy 0.000 description 1
- 239000013059 antihormonal agent Substances 0.000 description 1
- 229940100197 antimetabolite Drugs 0.000 description 1
- 239000002256 antimetabolite Substances 0.000 description 1
- 229940045687 antimetabolites folic acid analogs Drugs 0.000 description 1
- 239000000074 antisense oligonucleotide Substances 0.000 description 1
- 238000012230 antisense oligonucleotides Methods 0.000 description 1
- 210000000709 aorta Anatomy 0.000 description 1
- 238000002617 apheresis Methods 0.000 description 1
- 230000001640 apoptogenic effect Effects 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 150000008209 arabinosides Chemical class 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 229940078010 arimidex Drugs 0.000 description 1
- 229940087620 aromasin Drugs 0.000 description 1
- 239000003886 aromatase inhibitor Substances 0.000 description 1
- 229940046844 aromatase inhibitors Drugs 0.000 description 1
- 210000003567 ascitic fluid Anatomy 0.000 description 1
- FZCSTZYAHCUGEM-UHFFFAOYSA-N aspergillomarasmine B Natural products OC(=O)CNC(C(O)=O)CNC(C(O)=O)CC(O)=O FZCSTZYAHCUGEM-UHFFFAOYSA-N 0.000 description 1
- 230000002238 attenuated effect Effects 0.000 description 1
- 229940120638 avastin Drugs 0.000 description 1
- 229960002756 azacitidine Drugs 0.000 description 1
- VSRXQHXAPYXROS-UHFFFAOYSA-N azanide;cyclobutane-1,1-dicarboxylic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1 VSRXQHXAPYXROS-UHFFFAOYSA-N 0.000 description 1
- 229950011321 azaserine Drugs 0.000 description 1
- 150000001541 aziridines Chemical class 0.000 description 1
- 229960000190 bacillus calmette–guérin vaccine Drugs 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 108010010804 beta2 Heterotrimer Lymphotoxin alpha1 Proteins 0.000 description 1
- 229960000397 bevacizumab Drugs 0.000 description 1
- 229960000997 bicalutamide Drugs 0.000 description 1
- 230000000975 bioactive effect Effects 0.000 description 1
- 229920002988 biodegradable polymer Polymers 0.000 description 1
- 239000004621 biodegradable polymer Substances 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 229950008548 bisantrene Drugs 0.000 description 1
- 150000004663 bisphosphonates Chemical class 0.000 description 1
- 229950006844 bizelesin Drugs 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- 239000002981 blocking agent Substances 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 229960005520 bryostatin Drugs 0.000 description 1
- MJQUEDHRCUIRLF-TVIXENOKSA-N bryostatin 1 Chemical compound C([C@@H]1CC(/[C@@H]([C@@](C(C)(C)/C=C/2)(O)O1)OC(=O)/C=C/C=C/CCC)=C\C(=O)OC)[C@H]([C@@H](C)O)OC(=O)C[C@H](O)C[C@@H](O1)C[C@H](OC(C)=O)C(C)(C)[C@]1(O)C[C@@H]1C\C(=C\C(=O)OC)C[C@H]\2O1 MJQUEDHRCUIRLF-TVIXENOKSA-N 0.000 description 1
- MUIWQCKLQMOUAT-AKUNNTHJSA-N bryostatin 20 Natural products COC(=O)C=C1C[C@@]2(C)C[C@]3(O)O[C@](C)(C[C@@H](O)CC(=O)O[C@](C)(C[C@@]4(C)O[C@](O)(CC5=CC(=O)O[C@]45C)C(C)(C)C=C[C@@](C)(C1)O2)[C@@H](C)O)C[C@H](OC(=O)C(C)(C)C)C3(C)C MUIWQCKLQMOUAT-AKUNNTHJSA-N 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- 239000006172 buffering agent Substances 0.000 description 1
- MBABCNBNDNGODA-LUVUIASKSA-N bullatacin Chemical compound O1[C@@H]([C@@H](O)CCCCCCCCCC)CC[C@@H]1[C@@H]1O[C@@H]([C@H](O)CCCCCCCCCC[C@@H](O)CC=2C(O[C@@H](C)C=2)=O)CC1 MBABCNBNDNGODA-LUVUIASKSA-N 0.000 description 1
- 229960002092 busulfan Drugs 0.000 description 1
- 108700002839 cactinomycin Proteins 0.000 description 1
- 229950009908 cactinomycin Drugs 0.000 description 1
- 229950009823 calusterone Drugs 0.000 description 1
- IVFYLRMMHVYGJH-PVPPCFLZSA-N calusterone Chemical compound C1C[C@]2(C)[C@](O)(C)CC[C@H]2[C@@H]2[C@@H](C)CC3=CC(=O)CC[C@]3(C)[C@H]21 IVFYLRMMHVYGJH-PVPPCFLZSA-N 0.000 description 1
- 229940088954 camptosar Drugs 0.000 description 1
- 229940127093 camptothecin Drugs 0.000 description 1
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical compound C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 description 1
- 239000012830 cancer therapeutic Substances 0.000 description 1
- 229940022399 cancer vaccine Drugs 0.000 description 1
- 238000009566 cancer vaccine Methods 0.000 description 1
- 229960004117 capecitabine Drugs 0.000 description 1
- 229960004562 carboplatin Drugs 0.000 description 1
- 229960002115 carboquone Drugs 0.000 description 1
- 229930188550 carminomycin Natural products 0.000 description 1
- XREUEWVEMYWFFA-CSKJXFQVSA-N carminomycin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=C(O)C=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XREUEWVEMYWFFA-CSKJXFQVSA-N 0.000 description 1
- XREUEWVEMYWFFA-UHFFFAOYSA-N carminomycin I Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=C(O)C=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XREUEWVEMYWFFA-UHFFFAOYSA-N 0.000 description 1
- 229960003261 carmofur Drugs 0.000 description 1
- 229960005243 carmustine Drugs 0.000 description 1
- 229950001725 carubicin Drugs 0.000 description 1
- 229950007509 carzelesin Drugs 0.000 description 1
- BBZDXMBRAFTCAA-AREMUKBSSA-N carzelesin Chemical compound C1=2NC=C(C)C=2C([C@H](CCl)CN2C(=O)C=3NC4=CC=C(C=C4C=3)NC(=O)C3=CC4=CC=C(C=C4O3)N(CC)CC)=C2C=C1OC(=O)NC1=CC=CC=C1 BBZDXMBRAFTCAA-AREMUKBSSA-N 0.000 description 1
- 108010047060 carzinophilin Proteins 0.000 description 1
- 229960000590 celecoxib Drugs 0.000 description 1
- RZEKVGVHFLEQIL-UHFFFAOYSA-N celecoxib Chemical compound C1=CC(C)=CC=C1C1=CC(C(F)(F)F)=NN1C1=CC=C(S(N)(=O)=O)C=C1 RZEKVGVHFLEQIL-UHFFFAOYSA-N 0.000 description 1
- 230000006369 cell cycle progression Effects 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 230000009134 cell regulation Effects 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 1
- 239000013043 chemical agent Substances 0.000 description 1
- 239000012829 chemotherapy agent Substances 0.000 description 1
- 210000000038 chest Anatomy 0.000 description 1
- 229960004630 chlorambucil Drugs 0.000 description 1
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 1
- 229950008249 chlornaphazine Drugs 0.000 description 1
- 229960001480 chlorozotocin Drugs 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- ACSIXWWBWUQEHA-UHFFFAOYSA-N clodronic acid Chemical compound OP(O)(=O)C(Cl)(Cl)P(O)(O)=O ACSIXWWBWUQEHA-UHFFFAOYSA-N 0.000 description 1
- 229960002286 clodronic acid Drugs 0.000 description 1
- 238000011284 combination treatment Methods 0.000 description 1
- LGZKGOGODCLQHG-UHFFFAOYSA-N combretastatin Natural products C1=C(O)C(OC)=CC=C1CC(O)C1=CC(OC)=C(OC)C(OC)=C1 LGZKGOGODCLQHG-UHFFFAOYSA-N 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 239000013068 control sample Substances 0.000 description 1
- 108091008034 costimulatory receptors Proteins 0.000 description 1
- 229940111134 coxibs Drugs 0.000 description 1
- 230000005574 cross-species transmission Effects 0.000 description 1
- 108010089438 cryptophycin 1 Proteins 0.000 description 1
- PSNOPSMXOBPNNV-VVCTWANISA-N cryptophycin 1 Chemical compound C1=C(Cl)C(OC)=CC=C1C[C@@H]1C(=O)NC[C@@H](C)C(=O)O[C@@H](CC(C)C)C(=O)O[C@H]([C@H](C)[C@@H]2[C@H](O2)C=2C=CC=CC=2)C/C=C/C(=O)N1 PSNOPSMXOBPNNV-VVCTWANISA-N 0.000 description 1
- 108010090203 cryptophycin 8 Proteins 0.000 description 1
- PSNOPSMXOBPNNV-UHFFFAOYSA-N cryptophycin-327 Natural products C1=C(Cl)C(OC)=CC=C1CC1C(=O)NCC(C)C(=O)OC(CC(C)C)C(=O)OC(C(C)C2C(O2)C=2C=CC=CC=2)CC=CC(=O)N1 PSNOPSMXOBPNNV-UHFFFAOYSA-N 0.000 description 1
- 210000004748 cultured cell Anatomy 0.000 description 1
- 208000035250 cutaneous malignant susceptibility to 1 melanoma Diseases 0.000 description 1
- 239000003255 cyclooxygenase 2 inhibitor Substances 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- 229940104302 cytosine Drugs 0.000 description 1
- 239000002254 cytotoxic agent Substances 0.000 description 1
- 231100000599 cytotoxic agent Toxicity 0.000 description 1
- 229960002806 daclizumab Drugs 0.000 description 1
- 229960000640 dactinomycin Drugs 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 229960005052 demecolcine Drugs 0.000 description 1
- 210000004443 dendritic cell Anatomy 0.000 description 1
- 230000000779 depleting effect Effects 0.000 description 1
- 229950003913 detorubicin Drugs 0.000 description 1
- 230000001627 detrimental effect Effects 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- WVYXNIXAMZOZFK-UHFFFAOYSA-N diaziquone Chemical compound O=C1C(NC(=O)OCC)=C(N2CC2)C(=O)C(NC(=O)OCC)=C1N1CC1 WVYXNIXAMZOZFK-UHFFFAOYSA-N 0.000 description 1
- 229950002389 diaziquone Drugs 0.000 description 1
- PXBRQCKWGAHEHS-UHFFFAOYSA-N dichlorodifluoromethane Chemical compound FC(F)(Cl)Cl PXBRQCKWGAHEHS-UHFFFAOYSA-N 0.000 description 1
- 235000019404 dichlorodifluoromethane Nutrition 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- VSJKWCGYPAHWDS-UHFFFAOYSA-N dl-camptothecin Natural products C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-UHFFFAOYSA-N 0.000 description 1
- 239000003534 dna topoisomerase inhibitor Substances 0.000 description 1
- AMRJKAQTDDKMCE-UHFFFAOYSA-N dolastatin Chemical compound CC(C)C(N(C)C)C(=O)NC(C(C)C)C(=O)N(C)C(C(C)C)C(OC)CC(=O)N1CCCC1C(OC)C(C)C(=O)NC(C=1SC=CN=1)CC1=CC=CC=C1 AMRJKAQTDDKMCE-UHFFFAOYSA-N 0.000 description 1
- 229930188854 dolastatin Natural products 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- ZWAOHEXOSAUJHY-ZIYNGMLESA-N doxifluridine Chemical compound O[C@@H]1[C@H](O)[C@@H](C)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ZWAOHEXOSAUJHY-ZIYNGMLESA-N 0.000 description 1
- 229950005454 doxifluridine Drugs 0.000 description 1
- 229950004203 droloxifene Drugs 0.000 description 1
- NOTIQUSPUUHHEH-UXOVVSIBSA-N dromostanolone propionate Chemical compound C([C@@H]1CC2)C(=O)[C@H](C)C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H](OC(=O)CC)[C@@]2(C)CC1 NOTIQUSPUUHHEH-UXOVVSIBSA-N 0.000 description 1
- 229950004683 drostanolone propionate Drugs 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 229960005501 duocarmycin Drugs 0.000 description 1
- VQNATVDKACXKTF-XELLLNAOSA-N duocarmycin Chemical compound COC1=C(OC)C(OC)=C2NC(C(=O)N3C4=CC(=O)C5=C([C@@]64C[C@@H]6C3)C=C(N5)C(=O)OC)=CC2=C1 VQNATVDKACXKTF-XELLLNAOSA-N 0.000 description 1
- 229930184221 duocarmycin Natural products 0.000 description 1
- AFMYMMXSQGUCBK-AKMKHHNQSA-N dynemicin a Chemical compound C1#C\C=C/C#C[C@@H]2NC(C=3C(=O)C4=C(O)C=CC(O)=C4C(=O)C=3C(O)=C3)=C3[C@@]34O[C@]32[C@@H](C)C(C(O)=O)=C(OC)[C@H]41 AFMYMMXSQGUCBK-AKMKHHNQSA-N 0.000 description 1
- FSIRXIHZBIXHKT-MHTVFEQDSA-N edatrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CC(CC)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FSIRXIHZBIXHKT-MHTVFEQDSA-N 0.000 description 1
- 229950006700 edatrexate Drugs 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- VLCYCQAOQCDTCN-UHFFFAOYSA-N eflornithine Chemical compound NCCCC(N)(C(F)F)C(O)=O VLCYCQAOQCDTCN-UHFFFAOYSA-N 0.000 description 1
- 229960002759 eflornithine Drugs 0.000 description 1
- 229940056913 eftilagimod alfa Drugs 0.000 description 1
- 229940121647 egfr inhibitor Drugs 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- XOPYFXBZMVTEJF-PDACKIITSA-N eleutherobin Chemical compound C(/[C@H]1[C@H](C(=CC[C@@H]1C(C)C)C)C[C@@H]([C@@]1(C)O[C@@]2(C=C1)OC)OC(=O)\C=C\C=1N=CN(C)C=1)=C2\CO[C@@H]1OC[C@@H](O)[C@@H](O)[C@@H]1OC(C)=O XOPYFXBZMVTEJF-PDACKIITSA-N 0.000 description 1
- XOPYFXBZMVTEJF-UHFFFAOYSA-N eleutherobin Natural products C1=CC2(OC)OC1(C)C(OC(=O)C=CC=1N=CN(C)C=1)CC(C(=CCC1C(C)C)C)C1C=C2COC1OCC(O)C(O)C1OC(C)=O XOPYFXBZMVTEJF-UHFFFAOYSA-N 0.000 description 1
- 229950000549 elliptinium acetate Drugs 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 230000001804 emulsifying effect Effects 0.000 description 1
- 239000007920 enema Substances 0.000 description 1
- 229940079360 enema for constipation Drugs 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- JOZGNYDSEBIJDH-UHFFFAOYSA-N eniluracil Chemical compound O=C1NC=C(C#C)C(=O)N1 JOZGNYDSEBIJDH-UHFFFAOYSA-N 0.000 description 1
- 229950010213 eniluracil Drugs 0.000 description 1
- 229950011487 enocitabine Drugs 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- 229950002973 epitiostanol Drugs 0.000 description 1
- 229930013356 epothilone Natural products 0.000 description 1
- 150000003883 epothilone derivatives Chemical class 0.000 description 1
- 229950002017 esorubicin Drugs 0.000 description 1
- ITSGNOIFAJAQHJ-BMFNZSJVSA-N esorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)C[C@H](C)O1 ITSGNOIFAJAQHJ-BMFNZSJVSA-N 0.000 description 1
- LJQQFQHBKUKHIS-WJHRIEJJSA-N esperamicin Chemical compound O1CC(NC(C)C)C(OC)CC1OC1C(O)C(NOC2OC(C)C(SC)C(O)C2)C(C)OC1OC1C(\C2=C/CSSSC)=C(NC(=O)OC)C(=O)C(OC3OC(C)C(O)C(OC(=O)C=4C(=CC(OC)=C(OC)C=4)NC(=O)C(=C)OC)C3)C2(O)C#C\C=C/C#C1 LJQQFQHBKUKHIS-WJHRIEJJSA-N 0.000 description 1
- 239000003797 essential amino acid Substances 0.000 description 1
- 235000020776 essential amino acid Nutrition 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 229960001842 estramustine Drugs 0.000 description 1
- FRPJXPJMRWBBIH-RBRWEJTLSA-N estramustine Chemical compound ClCCN(CCCl)C(=O)OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 FRPJXPJMRWBBIH-RBRWEJTLSA-N 0.000 description 1
- 229940011871 estrogen Drugs 0.000 description 1
- 239000000262 estrogen Substances 0.000 description 1
- 239000000328 estrogen antagonist Substances 0.000 description 1
- QSRLNKCNOLVZIR-KRWDZBQOSA-N ethyl (2s)-2-[[2-[4-[bis(2-chloroethyl)amino]phenyl]acetyl]amino]-4-methylsulfanylbutanoate Chemical compound CCOC(=O)[C@H](CCSC)NC(=O)CC1=CC=C(N(CCCl)CCCl)C=C1 QSRLNKCNOLVZIR-KRWDZBQOSA-N 0.000 description 1
- 229960005237 etoglucid Drugs 0.000 description 1
- 229960005420 etoposide Drugs 0.000 description 1
- 229960000255 exemestane Drugs 0.000 description 1
- 210000003722 extracellular fluid Anatomy 0.000 description 1
- 229950011548 fadrozole Drugs 0.000 description 1
- 229940043168 fareston Drugs 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 229940087476 femara Drugs 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 239000000834 fixative Substances 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 229960000961 floxuridine Drugs 0.000 description 1
- ODKNJVUHOIMIIZ-RRKCRQDMSA-N floxuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ODKNJVUHOIMIIZ-RRKCRQDMSA-N 0.000 description 1
- 229960000390 fludarabine Drugs 0.000 description 1
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 1
- IJJVMEJXYNJXOJ-UHFFFAOYSA-N fluquinconazole Chemical compound C=1C=C(Cl)C=C(Cl)C=1N1C(=O)C2=CC(F)=CC=C2N=C1N1C=NC=N1 IJJVMEJXYNJXOJ-UHFFFAOYSA-N 0.000 description 1
- 229960002074 flutamide Drugs 0.000 description 1
- MKXKFYHWDHIYRV-UHFFFAOYSA-N flutamide Chemical compound CC(C)C(=O)NC1=CC=C([N+]([O-])=O)C(C(F)(F)F)=C1 MKXKFYHWDHIYRV-UHFFFAOYSA-N 0.000 description 1
- 235000019152 folic acid Nutrition 0.000 description 1
- 239000011724 folic acid Substances 0.000 description 1
- 229960000304 folic acid Drugs 0.000 description 1
- 150000002224 folic acids Chemical class 0.000 description 1
- 229960004783 fotemustine Drugs 0.000 description 1
- YAKWPXVTIGTRJH-UHFFFAOYSA-N fotemustine Chemical compound CCOP(=O)(OCC)C(C)NC(=O)N(CCCl)N=O YAKWPXVTIGTRJH-UHFFFAOYSA-N 0.000 description 1
- 229940044658 gallium nitrate Drugs 0.000 description 1
- 229950000456 galunisertib Drugs 0.000 description 1
- 229960005277 gemcitabine Drugs 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 229940020967 gemzar Drugs 0.000 description 1
- 230000009368 gene silencing by RNA Effects 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 238000003881 globally optimized alternating phase rectangular pulse Methods 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 125000005456 glyceride group Chemical group 0.000 description 1
- 229930182470 glycoside Natural products 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 229960002913 goserelin Drugs 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- UUVWYPNAQBNQJQ-UHFFFAOYSA-N hexamethylmelamine Chemical compound CN(C)C1=NC(N(C)C)=NC(N(C)C)=N1 UUVWYPNAQBNQJQ-UHFFFAOYSA-N 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 229960001330 hydroxycarbamide Drugs 0.000 description 1
- 229940015872 ibandronate Drugs 0.000 description 1
- 229960000908 idarubicin Drugs 0.000 description 1
- 230000008088 immune pathway Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 description 1
- 230000006028 immune-suppresssive effect Effects 0.000 description 1
- 230000003259 immunoinhibitory effect Effects 0.000 description 1
- 239000002955 immunomodulating agent Substances 0.000 description 1
- DBIGHPPNXATHOF-UHFFFAOYSA-N improsulfan Chemical compound CS(=O)(=O)OCCCNCCCOS(C)(=O)=O DBIGHPPNXATHOF-UHFFFAOYSA-N 0.000 description 1
- 229950008097 improsulfan Drugs 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 229950009034 indoximod Drugs 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 230000014828 interferon-gamma production Effects 0.000 description 1
- 229940047124 interferons Drugs 0.000 description 1
- 108010074108 interleukin-21 Proteins 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 230000002601 intratumoral effect Effects 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000007914 intraventricular administration Methods 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 210000005240 left ventricle Anatomy 0.000 description 1
- 229940115286 lentinan Drugs 0.000 description 1
- 229960003881 letrozole Drugs 0.000 description 1
- GFIJNRVAKGFPGQ-LIJARHBVSA-N leuprolide Chemical compound CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 GFIJNRVAKGFPGQ-LIJARHBVSA-N 0.000 description 1
- 229960004338 leuprorelin Drugs 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 229950011263 lirilumab Drugs 0.000 description 1
- 229960002247 lomustine Drugs 0.000 description 1
- YROQEQPFUCPDCP-UHFFFAOYSA-N losoxantrone Chemical compound OCCNCCN1N=C2C3=CC=CC(O)=C3C(=O)C3=C2C1=CC=C3NCCNCCO YROQEQPFUCPDCP-UHFFFAOYSA-N 0.000 description 1
- 229950008745 losoxantrone Drugs 0.000 description 1
- RVFGKBWWUQOIOU-NDEPHWFRSA-N lurtotecan Chemical compound O=C([C@]1(O)CC)OCC(C(N2CC3=4)=O)=C1C=C2C3=NC1=CC=2OCCOC=2C=C1C=4CN1CCN(C)CC1 RVFGKBWWUQOIOU-NDEPHWFRSA-N 0.000 description 1
- 229950002654 lurtotecan Drugs 0.000 description 1
- 239000008176 lyophilized powder Substances 0.000 description 1
- MQXVYODZCMMZEM-ZYUZMQFOSA-N mannomustine Chemical compound ClCCNC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CNCCCl MQXVYODZCMMZEM-ZYUZMQFOSA-N 0.000 description 1
- 229950008612 mannomustine Drugs 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- WKPWGQKGSOKKOO-RSFHAFMBSA-N maytansine Chemical compound CO[C@@H]([C@@]1(O)C[C@](OC(=O)N1)([C@H]([C@@H]1O[C@@]1(C)[C@@H](OC(=O)[C@H](C)N(C)C(C)=O)CC(=O)N1C)C)[H])\C=C\C=C(C)\CC2=CC(OC)=C(Cl)C1=C2 WKPWGQKGSOKKOO-RSFHAFMBSA-N 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 229960004296 megestrol acetate Drugs 0.000 description 1
- RQZAXGRLVPAYTJ-GQFGMJRRSA-N megestrol acetate Chemical compound C1=C(C)C2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(C)=O)(OC(=O)C)[C@@]1(C)CC2 RQZAXGRLVPAYTJ-GQFGMJRRSA-N 0.000 description 1
- 229960001924 melphalan Drugs 0.000 description 1
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 1
- 229950009246 mepitiostane Drugs 0.000 description 1
- VJRAUFKOOPNFIQ-TVEKBUMESA-N methyl (1r,2r,4s)-4-[(2r,4s,5s,6s)-5-[(2s,4s,5s,6s)-5-[(2s,4s,5s,6s)-4,5-dihydroxy-6-methyloxan-2-yl]oxy-4-hydroxy-6-methyloxan-2-yl]oxy-4-(dimethylamino)-6-methyloxan-2-yl]oxy-2-ethyl-2,5,7,10-tetrahydroxy-6,11-dioxo-3,4-dihydro-1h-tetracene-1-carboxylat Chemical compound O([C@H]1[C@@H](O)C[C@@H](O[C@H]1C)O[C@H]1[C@H](C[C@@H](O[C@H]1C)O[C@H]1C[C@]([C@@H](C2=CC=3C(=O)C4=C(O)C=CC(O)=C4C(=O)C=3C(O)=C21)C(=O)OC)(O)CC)N(C)C)[C@H]1C[C@H](O)[C@H](O)[C@H](C)O1 VJRAUFKOOPNFIQ-TVEKBUMESA-N 0.000 description 1
- HPNSFSBZBAHARI-UHFFFAOYSA-N micophenolic acid Natural products OC1=C(CC=C(C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-UHFFFAOYSA-N 0.000 description 1
- 239000003094 microcapsule Substances 0.000 description 1
- 239000011859 microparticle Substances 0.000 description 1
- 229960005485 mitobronitol Drugs 0.000 description 1
- 229960003539 mitoguazone Drugs 0.000 description 1
- MXWHMTNPTTVWDM-NXOFHUPFSA-N mitoguazone Chemical compound NC(N)=N\N=C(/C)\C=N\N=C(N)N MXWHMTNPTTVWDM-NXOFHUPFSA-N 0.000 description 1
- VFKZTMPDYBFSTM-GUCUJZIJSA-N mitolactol Chemical compound BrC[C@H](O)[C@@H](O)[C@@H](O)[C@H](O)CBr VFKZTMPDYBFSTM-GUCUJZIJSA-N 0.000 description 1
- 229950010913 mitolactol Drugs 0.000 description 1
- 229960004857 mitomycin Drugs 0.000 description 1
- 229960000350 mitotane Drugs 0.000 description 1
- 229950007699 mogamulizumab Drugs 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- RAHBGWKEPAQNFF-UHFFFAOYSA-N motesanib Chemical compound C=1C=C2C(C)(C)CNC2=CC=1NC(=O)C1=CC=CN=C1NCC1=CC=NC=C1 RAHBGWKEPAQNFF-UHFFFAOYSA-N 0.000 description 1
- 239000012120 mounting media Substances 0.000 description 1
- 229960000951 mycophenolic acid Drugs 0.000 description 1
- HPNSFSBZBAHARI-RUDMXATFSA-N mycophenolic acid Chemical compound OC1=C(C\C=C(/C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-RUDMXATFSA-N 0.000 description 1
- 210000000066 myeloid cell Anatomy 0.000 description 1
- NJSMWLQOCQIOPE-OCHFTUDZSA-N n-[(e)-[10-[(e)-(4,5-dihydro-1h-imidazol-2-ylhydrazinylidene)methyl]anthracen-9-yl]methylideneamino]-4,5-dihydro-1h-imidazol-2-amine Chemical compound N1CCN=C1N\N=C\C(C1=CC=CC=C11)=C(C=CC=C2)C2=C1\C=N\NC1=NCCN1 NJSMWLQOCQIOPE-OCHFTUDZSA-N 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 229930014626 natural product Natural products 0.000 description 1
- 229940086322 navelbine Drugs 0.000 description 1
- 230000027498 negative regulation of mitosis Effects 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 229960002653 nilutamide Drugs 0.000 description 1
- XWXYUMMDTVBTOU-UHFFFAOYSA-N nilutamide Chemical compound O=C1C(C)(C)NC(=O)N1C1=CC=C([N+]([O-])=O)C(C(F)(F)F)=C1 XWXYUMMDTVBTOU-UHFFFAOYSA-N 0.000 description 1
- 229960001420 nimustine Drugs 0.000 description 1
- VFEDRRNHLBGPNN-UHFFFAOYSA-N nimustine Chemical compound CC1=NC=C(CNC(=O)N(CCCl)N=O)C(N)=N1 VFEDRRNHLBGPNN-UHFFFAOYSA-N 0.000 description 1
- 229950009266 nogalamycin Drugs 0.000 description 1
- KGTDRFCXGRULNK-JYOBTZKQSA-N nogalamycin Chemical compound CO[C@@H]1[C@@](OC)(C)[C@@H](OC)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=C(O)C=C4[C@@]5(C)O[C@H]([C@H]([C@@H]([C@H]5O)N(C)C)O)OC4=C3C3=O)=C3C=C2[C@@H](C(=O)OC)[C@@](C)(O)C1 KGTDRFCXGRULNK-JYOBTZKQSA-N 0.000 description 1
- 229940085033 nolvadex Drugs 0.000 description 1
- 238000010899 nucleation Methods 0.000 description 1
- 239000002777 nucleoside Substances 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 238000002515 oligonucleotide synthesis Methods 0.000 description 1
- CZDBNBLGZNWKMC-MWQNXGTOSA-N olivomycin Chemical class O([C@@H]1C[C@@H](O[C@H](C)[C@@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1)O[C@H]1O[C@@H](C)[C@H](O)[C@@H](OC2O[C@@H](C)[C@H](O)[C@@H](O)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@H](O)[C@H](OC)[C@H](C)O1 CZDBNBLGZNWKMC-MWQNXGTOSA-N 0.000 description 1
- 229950011093 onapristone Drugs 0.000 description 1
- 239000003002 pH adjusting agent Substances 0.000 description 1
- VREZDOWOLGNDPW-UHFFFAOYSA-N pancratistatine Natural products C1=C2C3C(O)C(O)C(O)C(O)C3NC(=O)C2=C(O)C2=C1OCO2 VREZDOWOLGNDPW-UHFFFAOYSA-N 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 229940121654 pd-l2 inhibitor Drugs 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 229960002340 pentostatin Drugs 0.000 description 1
- FPVKHBSQESCIEP-JQCXWYLXSA-N pentostatin Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC[C@H]2O)=C2N=C1 FPVKHBSQESCIEP-JQCXWYLXSA-N 0.000 description 1
- QIMGFXOHTOXMQP-GFAGFCTOSA-N peplomycin Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCCN[C@@H](C)C=1C=CC=CC=1)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1NC=NC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C QIMGFXOHTOXMQP-GFAGFCTOSA-N 0.000 description 1
- 229950003180 peplomycin Drugs 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 229940124531 pharmaceutical excipient Drugs 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 229960000952 pipobroman Drugs 0.000 description 1
- NJBFOOCLYDNZJN-UHFFFAOYSA-N pipobroman Chemical compound BrCCC(=O)N1CCN(C(=O)CCBr)CC1 NJBFOOCLYDNZJN-UHFFFAOYSA-N 0.000 description 1
- NUKCGLDCWQXYOQ-UHFFFAOYSA-N piposulfan Chemical compound CS(=O)(=O)OCCC(=O)N1CCN(C(=O)CCOS(C)(=O)=O)CC1 NUKCGLDCWQXYOQ-UHFFFAOYSA-N 0.000 description 1
- 229950001100 piposulfan Drugs 0.000 description 1
- 229960001221 pirarubicin Drugs 0.000 description 1
- 229910052697 platinum Inorganic materials 0.000 description 1
- 150000003057 platinum Chemical class 0.000 description 1
- 229960002169 plerixafor Drugs 0.000 description 1
- YIQPUIGJQJDJOS-UHFFFAOYSA-N plerixafor Chemical compound C=1C=C(CN2CCNCCCNCCNCCC2)C=CC=1CN1CCCNCCNCCCNCC1 YIQPUIGJQJDJOS-UHFFFAOYSA-N 0.000 description 1
- 108700002563 poly ICLC Proteins 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 229960004694 prednimustine Drugs 0.000 description 1
- XOFYZVNMUHMLCC-ZPOLXVRWSA-N prednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 XOFYZVNMUHMLCC-ZPOLXVRWSA-N 0.000 description 1
- 229960004618 prednisone Drugs 0.000 description 1
- 229940071643 prefilled syringe Drugs 0.000 description 1
- 230000035935 pregnancy Effects 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- CPTBDICYNRMXFX-UHFFFAOYSA-N procarbazine Chemical compound CNNCC1=CC=C(C(=O)NC(C)C)C=C1 CPTBDICYNRMXFX-UHFFFAOYSA-N 0.000 description 1
- 229960000624 procarbazine Drugs 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 229940087463 proleukin Drugs 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 239000001294 propane Substances 0.000 description 1
- 239000003380 propellant Substances 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 230000004845 protein aggregation Effects 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- WOLQREOUPKZMEX-UHFFFAOYSA-N pteroyltriglutamic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)NC(CCC(=O)NC(CCC(=O)NC(CCC(O)=O)C(O)=O)C(O)=O)C(O)=O)C=C1 WOLQREOUPKZMEX-UHFFFAOYSA-N 0.000 description 1
- 230000005180 public health Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 150000003212 purines Chemical class 0.000 description 1
- 229950010131 puromycin Drugs 0.000 description 1
- 150000003230 pyrimidines Chemical class 0.000 description 1
- BMKDZUISNHGIBY-UHFFFAOYSA-N razoxane Chemical compound C1C(=O)NC(=O)CN1C(C)CN1CC(=O)NC(=O)C1 BMKDZUISNHGIBY-UHFFFAOYSA-N 0.000 description 1
- 229960000460 razoxane Drugs 0.000 description 1
- 230000022983 regulation of cell cycle Effects 0.000 description 1
- 230000001718 repressive effect Effects 0.000 description 1
- 229950010550 resiquimod Drugs 0.000 description 1
- BXNMTOQRYBFHNZ-UHFFFAOYSA-N resiquimod Chemical compound C1=CC=CC2=C(N(C(COCC)=N3)CC(C)(C)O)C3=C(N)N=C21 BXNMTOQRYBFHNZ-UHFFFAOYSA-N 0.000 description 1
- 229930002330 retinoic acid Natural products 0.000 description 1
- OWPCHSCAPHNHAV-LMONGJCWSA-N rhizoxin Chemical compound C/C([C@H](OC)[C@@H](C)[C@@H]1C[C@H](O)[C@]2(C)O[C@@H]2/C=C/[C@@H](C)[C@]2([H])OC(=O)C[C@@](C2)(C[C@@H]2O[C@H]2C(=O)O1)[H])=C\C=C\C(\C)=C\C1=COC(C)=N1 OWPCHSCAPHNHAV-LMONGJCWSA-N 0.000 description 1
- 210000005245 right atrium Anatomy 0.000 description 1
- 229950004892 rodorubicin Drugs 0.000 description 1
- MBABCNBNDNGODA-WPZDJQSSSA-N rolliniastatin 1 Natural products O1[C@@H]([C@@H](O)CCCCCCCCCC)CC[C@H]1[C@H]1O[C@@H]([C@H](O)CCCCCCCCCC[C@@H](O)CC=2C(O[C@@H](C)C=2)=O)CC1 MBABCNBNDNGODA-WPZDJQSSSA-N 0.000 description 1
- IMUQLZLGWJSVMV-UOBFQKKOSA-N roridin A Natural products CC(O)C1OCCC(C)C(O)C(=O)OCC2CC(=CC3OC4CC(OC(=O)C=C/C=C/1)C(C)(C23)C45CO5)C IMUQLZLGWJSVMV-UOBFQKKOSA-N 0.000 description 1
- VHXNKPBCCMUMSW-FQEVSTJZSA-N rubitecan Chemical compound C1=CC([N+]([O-])=O)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VHXNKPBCCMUMSW-FQEVSTJZSA-N 0.000 description 1
- 229930182947 sarcodictyin Natural products 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 125000005629 sialic acid group Chemical group 0.000 description 1
- 230000009450 sialylation Effects 0.000 description 1
- 238000011125 single therapy Methods 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 229950001403 sizofiran Drugs 0.000 description 1
- 229950006315 spirogermanium Drugs 0.000 description 1
- ICXJVZHDZFXYQC-UHFFFAOYSA-N spongistatin 1 Natural products OC1C(O2)(O)CC(O)C(C)C2CCCC=CC(O2)CC(O)CC2(O2)CC(OC)CC2CC(=O)C(C)C(OC(C)=O)C(C)C(=C)CC(O2)CC(C)(O)CC2(O2)CC(OC(C)=O)CC2CC(=O)OC2C(O)C(CC(=C)CC(O)C=CC(Cl)=C)OC1C2C ICXJVZHDZFXYQC-UHFFFAOYSA-N 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 229960001052 streptozocin Drugs 0.000 description 1
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 125000002730 succinyl group Chemical group C(CCC(=O)*)(=O)* 0.000 description 1
- WINHZLLDWRZWRT-ATVHPVEESA-N sunitinib Chemical compound CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C WINHZLLDWRZWRT-ATVHPVEESA-N 0.000 description 1
- 229960002812 sunitinib malate Drugs 0.000 description 1
- 230000002483 superagonistic effect Effects 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 229940034785 sutent Drugs 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 1
- 229960001278 teniposide Drugs 0.000 description 1
- 229960005353 testolactone Drugs 0.000 description 1
- BPEWUONYVDABNZ-DZBHQSCQSA-N testolactone Chemical compound O=C1C=C[C@]2(C)[C@H]3CC[C@](C)(OC(=O)CC4)[C@@H]4[C@@H]3CCC2=C1 BPEWUONYVDABNZ-DZBHQSCQSA-N 0.000 description 1
- 238000011285 therapeutic regimen Methods 0.000 description 1
- 239000004308 thiabendazole Substances 0.000 description 1
- YFTWHEBLORWGNI-UHFFFAOYSA-N tiamiprine Chemical compound CN1C=NC([N+]([O-])=O)=C1SC1=NC(N)=NC2=C1NC=N2 YFTWHEBLORWGNI-UHFFFAOYSA-N 0.000 description 1
- 229950011457 tiamiprine Drugs 0.000 description 1
- 239000003970 toll like receptor agonist Substances 0.000 description 1
- 229940044616 toll-like receptor 7 agonist Drugs 0.000 description 1
- 229940044655 toll-like receptor 9 agonist Drugs 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 229940044693 topoisomerase inhibitor Drugs 0.000 description 1
- 229960000303 topotecan Drugs 0.000 description 1
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 1
- 229960005026 toremifene Drugs 0.000 description 1
- XFCLJVABOIYOMF-QPLCGJKRSA-N toremifene Chemical compound C1=CC(OCCN(C)C)=CC=C1C(\C=1C=CC=CC=1)=C(\CCCl)C1=CC=CC=C1 XFCLJVABOIYOMF-QPLCGJKRSA-N 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 229950007217 tremelimumab Drugs 0.000 description 1
- 229950001353 tretamine Drugs 0.000 description 1
- IUCJMVBFZDHPDX-UHFFFAOYSA-N tretamine Chemical compound C1CN1C1=NC(N2CC2)=NC(N2CC2)=N1 IUCJMVBFZDHPDX-UHFFFAOYSA-N 0.000 description 1
- 229960001727 tretinoin Drugs 0.000 description 1
- 229960004560 triaziquone Drugs 0.000 description 1
- PXSOHRWMIRDKMP-UHFFFAOYSA-N triaziquone Chemical compound O=C1C(N2CC2)=C(N2CC2)C(=O)C=C1N1CC1 PXSOHRWMIRDKMP-UHFFFAOYSA-N 0.000 description 1
- 229930013292 trichothecene Natural products 0.000 description 1
- 150000003327 trichothecene derivatives Chemical class 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- 229960001670 trilostane Drugs 0.000 description 1
- KVJXBPDAXMEYOA-CXANFOAXSA-N trilostane Chemical compound OC1=C(C#N)C[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CC[C@@]32O[C@@H]31 KVJXBPDAXMEYOA-CXANFOAXSA-N 0.000 description 1
- 239000013638 trimer Substances 0.000 description 1
- NOYPYLRCIDNJJB-UHFFFAOYSA-N trimetrexate Chemical compound COC1=C(OC)C(OC)=CC(NCC=2C(=C3C(N)=NC(N)=NC3=CC=2)C)=C1 NOYPYLRCIDNJJB-UHFFFAOYSA-N 0.000 description 1
- 229960001099 trimetrexate Drugs 0.000 description 1
- 229950000212 trioxifene Drugs 0.000 description 1
- 229960000875 trofosfamide Drugs 0.000 description 1
- UMKFEPPTGMDVMI-UHFFFAOYSA-N trofosfamide Chemical compound ClCCN(CCCl)P1(=O)OCCCN1CCCl UMKFEPPTGMDVMI-UHFFFAOYSA-N 0.000 description 1
- 229950010147 troxacitabine Drugs 0.000 description 1
- RXRGZNYSEHTMHC-BQBZGAKWSA-N troxacitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1O[C@@H](CO)OC1 RXRGZNYSEHTMHC-BQBZGAKWSA-N 0.000 description 1
- HDZZVAMISRMYHH-LITAXDCLSA-N tubercidin Chemical compound C1=CC=2C(N)=NC=NC=2N1[C@@H]1O[C@@H](CO)[C@H](O)[C@H]1O HDZZVAMISRMYHH-LITAXDCLSA-N 0.000 description 1
- 102000003298 tumor necrosis factor receptor Human genes 0.000 description 1
- 229940121358 tyrosine kinase inhibitor Drugs 0.000 description 1
- 239000005483 tyrosine kinase inhibitor Substances 0.000 description 1
- 150000004917 tyrosine kinase inhibitor derivatives Chemical class 0.000 description 1
- 229950009811 ubenimex Drugs 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 229960001055 uracil mustard Drugs 0.000 description 1
- 229950005972 urelumab Drugs 0.000 description 1
- 229950001067 varlilumab Drugs 0.000 description 1
- 230000008728 vascular permeability Effects 0.000 description 1
- 230000004862 vasculogenesis Effects 0.000 description 1
- 229950000578 vatalanib Drugs 0.000 description 1
- YCOYDOIWSSHVCK-UHFFFAOYSA-N vatalanib Chemical compound C1=CC(Cl)=CC=C1NC(C1=CC=CC=C11)=NN=C1CC1=CC=NC=C1 YCOYDOIWSSHVCK-UHFFFAOYSA-N 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 210000003462 vein Anatomy 0.000 description 1
- 229960004355 vindesine Drugs 0.000 description 1
- UGGWPQSBPIFKDZ-KOTLKJBCSA-N vindesine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(N)=O)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1N=C1[C]2C=CC=C1 UGGWPQSBPIFKDZ-KOTLKJBCSA-N 0.000 description 1
- GBABOYUKABKIAF-IELIFDKJSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-IELIFDKJSA-N 0.000 description 1
- 229960002066 vinorelbine Drugs 0.000 description 1
- CILBMBUYJCWATM-PYGJLNRPSA-N vinorelbine ditartrate Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O.OC(=O)[C@H](O)[C@@H](O)C(O)=O.C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC CILBMBUYJCWATM-PYGJLNRPSA-N 0.000 description 1
- 229960001771 vorozole Drugs 0.000 description 1
- XLMPPFTZALNBFS-INIZCTEOSA-N vorozole Chemical compound C1([C@@H](C2=CC=C3N=NN(C3=C2)C)N2N=CN=C2)=CC=C(Cl)C=C1 XLMPPFTZALNBFS-INIZCTEOSA-N 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 229940053867 xeloda Drugs 0.000 description 1
- 229950009268 zinostatin Drugs 0.000 description 1
- 229960000641 zorubicin Drugs 0.000 description 1
- FBTUMDXHSRTGRV-ALTNURHMSA-N zorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(\C)=N\NC(=O)C=1C=CC=CC=1)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 FBTUMDXHSRTGRV-ALTNURHMSA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70532—B7 molecules, e.g. CD80, CD86
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/1774—Immunoglobulin superfamily (e.g. CD2, CD4, CD8, ICAM molecules, B7 molecules, Fc-receptors, MHC-molecules)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2827—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/40—Immunoglobulins specific features characterized by post-translational modification
- C07K2317/41—Glycosylation, sialylation, or fucosylation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
Definitions
- This application relates to CD80 (B7-1) extracellular domain (ECD) polypeptides and CD80-ECD fusion molecules and their use in treatment of cancer, both alone and in combination with other therapeutic agents, such as immune stimulating agents such as PD-1/PD-L1 inhibitors.
- CD80 B7-1) extracellular domain (ECD) polypeptides
- CD80-ECD fusion molecules CD80-ECD fusion molecules and their use in treatment of cancer, both alone and in combination with other therapeutic agents, such as immune stimulating agents such as PD-1/PD-L1 inhibitors.
- CD80 also known as B7-1
- B7-1 is one of the B7 family of membrane-bound proteins involved in immune regulation by delivering costimulatory or coinhibitory responses through their ligand binding activities.
- Other members of the B7 family of proteins include CD86 (B7-2), inducible costimulator ligand (ICOS-L), programmed death-1 ligand (PD-L1; B7-H1), programmed death-2 ligand (PD-L2; B7-H2), B7-H3, and B7-H4.
- CD80 is a transmembrane protein expressed on the surface of T cells, B cells, dendritic cells and monocytes, and binds to the receptors CD28, CTLA4 (CD152), and PD-L1.
- CD80 and CD86 and their receptors CTLA4 and CD28 operate as a costimulatory-coinhibitory system, for example, to control T cell activation, expansion, differentiation, and survival.
- CD80 and CD86 interaction with CD28 results in costimulatory signals that lead, for example, to activation of T cell responses.
- CD80 stimulates upregulation of CTLA4, which, upon binding to CD80, acts to suppress the T cell response previously triggered by CD80/CD28 interactions. This feedback loop allows for fine control of immune responses.
- CD80 has also been shown to interact with another B7 family member, PD-L1 with similar affinity to CD28, whereas CD86 does not interact with PD-L1.
- PD-L1 is one of two ligands for the programmed death-1 (PD-1) protein, which is also involved in T cell regulation. Specifically, expression of PD-1 on T cells may be induced after T cells have been activated, and binding of PD-1 to PD-L1 downregulates T cell activity by promoting T cell inactivation. Many tumor cells express PD-L1 on their surface, potentially leading to PD-1/PD-L1 interactions and the inhibition of T cell responses against the tumor. This observation has led to the development of inhibitors of the PD-1/PD-L1 interaction as cancer therapeutics designed to stimulate natural immune responses against tumors in patients.
- Binding of CD80 to PD-L1 may serve as an alternative mechanism to block the PD-1/PD-L1 interaction and prevent inhibition of T cell responses at the site of a tumor.
- increased levels of CD80 might also be available to bind to CD28 and to induce CTLA4, thus either inducing or inhibiting T cell responses.
- Some soluble forms of CD80 may also function to block CTLA4 activation by blocking endogenous CD80 activity.
- different soluble CD80 protein forms may have different effects on tumor growth through other interactions between the protein forms and tumor cells whose impact cannot be predicted in advance of testing. How various soluble forms of CD80 actually impact tumor growth in vivo has also not previously been directly tested.
- CD80 extracellular domain (ECD) fusion molecules with particularly potent effects on tumor growth in a mouse model, both when administered alone, and when administered in conjunction with a PD-1/PD-L1 inhibitor. Based on the data shown in the working examples below, embodiments herein may provide superb therapeutic effects in cancer treatment.
- ECD extracellular domain
- a CD80 extracellular domain (ECD) polypeptide or a CD80 ECD fusion molecule comprises a CD80 ECD and at least one fusion partner, comprising an Fc domain of an immunoglobulin, such as a human IgG1, IgG2, IgG3, or IgG4, albumin, or a polymer such as PEG.
- the CD80 ECD or CD80 ECD fusion molecule comprises a human CD80, such as that of SEQ ID NO:5, or a human CD80 ECD from CD80 isoform 2 or isoform 3 (SEQ ID NOs: 3 and 4).
- the fusion molecule comprises an Fc domain, such as an Fc domain comprising a sequence selected from SEQ ID NOs: 9-16.
- the fusion molecule comprises a human IgG1 Fc domain, such as one with a wild-type sequence such as that of SEQ ID NO:14, or alternatively, a mutant sequence with L234F, L235E, and P331S amino acid substitutions such as that of SEQ ID NO:12.
- the CD80 ECD fusion molecule comprises an amino acid sequence selected from SEQ ID NO: 5, SEQ ID NO: 12, SEQ ID NO:14, SEQ ID NO: 20, and SEQ ID NO: 21.
- the CD80 ECD fusion molecule fusion partner is directly attached to the C-terminal amino acid of the CD80 ECD amino acid sequence or to the N-terminal amino acid of the mature CD80 ECD amino acid sequence.
- the CD80 ECD fusion molecule may be attached to the CD80 ECD through a linker peptide, such as a GS linker.
- the CD80 ECD fusion molecule has a sialic acid content of 10-60 mol sialic acid (SA)/mol protein, such as 15-60 mol SA/mol protein.
- the content is 10-40 mol SA/mol protein, such as 15-40 mol SA/mol protein, such as 20-40 mol SA/mol protein, 20-30 mol SA/mol protein, 15-25 mol SA/mol protein, 15-30 mol SA to mol of protein, or 30-40 mol SA/mol protein.
- the SA content is at least 15, such as at least 20, at least 25, at least 30, at least 35, or at least 40 mol SA/mol protein.
- the SA content is 15, 20, 25, 30, 35, or 40 mol SA/mol protein.
- the CD80 ECD fusion molecule is a CD80 ECD Fc fusion, for example, with a wild-type Fc domain such as a human IgG1, IgG2, or IgG4 Fc domain, or, alternatively, an IgG1 Fc domain with substitutions at L234F, L235E, and P331S.
- the CD80 ECD fusion molecule comprises an amino acid sequence selected from SEQ ID NO: 5, SEQ ID NO: 12, SEQ ID NO:14, SEQ ID NO: 20, and SEQ ID NO: 21.
- the fusion molecule has a greater percentage tumor growth inhibition in a mouse syngeneic or xenograft model, such as in a CT26 mouse model than a fusion molecule of identical amino acid sequence but a lower SA content.
- the fusion molecule comprises at least 10 mol SA/mol protein, such as at least 15 mol SA/mol protein, such as at least 20 mol SA/mol protein
- the fusion molecule has a greater percentage tumor growth inhibition in a mouse syngeneic or xenograft model, such as in a CT26 mouse model than a fusion molecule of identical amino acid sequence but having less than 10 mol SA/mol protein or less than 15 mol SA/mol protein or less than 20 mol SA/mol protein, respectively.
- Some embodiments herein comprise a CD80 ECD fusion molecule wherein the molecule is capable of at least 50%, such as at least 60%, such as at least 70%, such as at least 80%, such as at least 90%, such as at least 95%, such as at least 98% tumor cell growth inhibition in at least one mouse syngeneic or xenograft cancer model, such as a CT26 model, over a period of at least ten days, such as at least two weeks, such as over a period of ten days to two weeks or two to three weeks, or at least three weeks.
- mice are given one to three doses of 0.3 to 3 mg/kg, such as 0.3 to 0.6 mg/kg, of the CD80 ECD Fc fusion molecule.
- the CD80 ECD fusion molecule also has a sialic acid content of 10-60 mol sialic acid (SA)/mol protein, such as 15-60 mol SA/mol protein.
- the content is 10-40 mol SA/mol protein, such as 15-40 mol SA/mol protein, such as 20-40 mol SA/mol protein, 20-30 mol SA/mol protein, 15-25 mol SA/mol protein, 15-30 mol SA to mol of protein, or 30-40 mol SA/mol protein.
- the SA content is at least 15, such as at least 20, at least 25, at least 30, at least 35, or at least 40 mol SA/mol protein. In some embodiments, the SA content is 15, 20, 25, 30, 35, or 40 mol SA/mol protein.
- the CD80 ECD fusion molecule has an Fc as a fusion partner, such as a human IgG1, IgG2, or IgG4 Fc domain. In some embodiments, the CD80 ECD fusion molecule comprises an amino acid sequence selected from SEQ ID NO: 5, SEQ ID NO: 12, SEQ ID NO:14, SEQ ID NO: 20, and SEQ ID NO: 21.
- the fusion molecule comprises at least 10 mol SA/mol protein, such as at least 15 mol SA/mol protein, such as at least 20 mol SA/mol protein
- the molecule has a greater percentage tumor growth inhibition in a mouse syngeneic or xenograft model, such as in a CT26 mouse model, than a fusion molecule of identical amino acid sequence but having less than 10 mol SA/mol protein or less than 15 mol SA/mol protein or less than 20 mol SA/mol protein, respectively.
- the fusion molecule comprises at least 10 mol SA/mol protein, such as at least 15 mol SA/mol protein, such as at least 20 mol SA/mol protein
- the molecule has a greater percentage tumor growth inhibition in a mouse syngeneic or xenograft model, such as in a CT26 mouse model, after at least ten days or at least two weeks or at least three weeks, such as ten days to two weeks or two to three weeks, than an anti-CTLA4 antibody, such as anti-CTLA4 antibody clone 9D9.
- the CD80 ECD Fc fusion molecule is also capable of inducing complete tumor regression in mice from the syngeneic or xenograft tumor model, such as a CT26 model.
- compositions comprising a CD80 ECD or CD80 ECD fusion molecule of any of the embodiments described above, and further comprising at least one pharmaceutically acceptable carrier. Some such compositions further comprise at least one additional therapeutic agent.
- the additional therapeutic agent comprises at least one immune stimulating agent.
- the immune stimulating agent comprises a programmed cell death 1 (PD-1)/programmed cell death ligand 1 (PD-L1) inhibitor.
- the PD-1/PD-L1 inhibitor may be an antibody, such as an anti-PD-1 antibody or anti-PD-L1 antibody, a peptide or fusion molecule, or a small molecule.
- the PD-1/PD-L1 inhibitor is an anti-PD-1 antibody, such as an antibody comprising the heavy chain and light chain CDRs, or comprising the heavy and light chain variable regions, or comprising the full amino acid sequence, of an antibody selected from nivolumab, pidilizumab, and pembrolizumab.
- the PD-1/PD-L1 inhibitor is an anti-PD-L1 antibody, such as an antibody comprising the heavy chain and light chain CDRs, the heavy and light chain variable regions, or the full amino acid sequence, of an antibody selected from BMS-936559, MPDL3280A, MEDI4736, and MSB0010718C.
- the PD-1/PD-L1 inhibitor is a PD-1 fusion molecule, such as AMP-224 or a polypeptide such as AUR-012.
- the cancer is a solid tumor.
- the cancer is selected from colorectal cancer, breast cancer, gastric cancer, non-small cell lung cancer, melanoma, squamous cell carcinoma of the head and neck, ovarian cancer, pancreatic cancer, renal cell carcinoma, hepatocellular carcinoma, bladder cancer, and endometrial cancer.
- the cancer is recurrent or progressive after a therapy selected from surgery, chemotherapy, radiation therapy, or a combination thereof.
- the CD80 ECD, CD80 ECD fusion molecule, or composition is administered in combination with at least one additional therapeutic agent.
- the additional therapeutic agent may be packaged with the CD80 ECD or CD80 ECD fusion molecule as part of the same composition, e.g. mixed together in one composition or provided in separate containers, vials, or other packages.
- the additional therapeutic agent comprises at least one immune stimulating agent.
- the immune stimulating agent comprises a programmed cell death 1 (PD-1)/programmed cell death ligand 1 (PD-L1) inhibitor.
- the PD-1/PD-L1 inhibitor may be an antibody, such as an anti-PD-1 antibody or anti-PD-L1 antibody, a peptide or fusion molecule, or a small molecule.
- the PD-1/PD-L1 inhibitor is an anti-PD-1 antibody, such as an antibody comprising the heavy chain and light chain CDRs, or comprising the heavy and light chain variable regions, or comprising the full amino acid sequence, of an antibody selected from nivolumab, pidilizumab, and pembrolizumab.
- the PD-1/PD-L1 inhibitor is an anti-PD-L1 antibody, such as an antibody comprising the heavy chain and light chain CDRs, the heavy and light chain variable regions, or the full amino acid sequence, of an antibody selected from BMS-936559, MPDL3280A, MEDI4736, and MSB0010718C.
- the PD-1/PD-L1 inhibitor is a PD-1 fusion molecule, such as AMP-224 or a polypeptide such as AUR-012.
- the CD80 ECD or CD80 ECD fusion molecule and the additional therapeutic agent, such as an immune stimulating agent, such as a PD-1/PD-L1 inhibitor may be administered concurrently or sequentially.
- one or more doses of the PD-1/PD-L1 inhibitor are administered prior to administering the CD80 ECD or CD80 ECD fusion molecule.
- the subject has received a complete course of immune stimulating agent, e.g., PD-1/PD-L1 inhibitor therapy prior to administration of the CD80 ECD or CD80 ECD fusion molecule.
- the CD80 ECD or CD80 ECD fusion molecule is administered during a second course of immune stimulation agent, e.g.
- the subject has received at least one, at least two, at least three, or at least four doses of the immune stimulating agent, such as PD-1/PD-L1 inhibitor prior to administration of the CD80 ECD or CD80 ECD fusion molecule.
- at least one dose of the immune stimulating agent, e.g. PD-1/PD-L1 inhibitor is administered concurrently with the CD80 ECD or CD80 ECD fusion molecule.
- one or more doses of the CD80 ECD or CD80 ECD fusion molecule are administered prior to administering an additional therapeutic agent, such as an immune stimulating agent, such as a PD-1/PD-L1 inhibitor.
- an additional therapeutic agent such as an immune stimulating agent, such as a PD-1/PD-L1 inhibitor.
- the subject has received at least one, at least two, at least three, or at least four doses of the CD80 ECD or CD80 ECD fusion molecule prior to administration of an immune stimulating agent, e.g. a PD-1/PD-L1 inhibitor.
- at least one dose of the CD80 ECD or CD80 ECD fusion molecule is administered concurrently with the immune stimulating agent, e.g. PD-1/PD-L1 inhibitor.
- the subject may be resistant to treatment with a PD-1/PD-L1 inhibitor.
- the subject has previously received PD-1/PD-L1 inhibitor therapy, while in other such cases, the subject has not previously received PD-1/PD-L1 inhibitor therapy but is identified as resistant through other means such as certain phenotypic traits.
- the subject may be administered an additional therapeutic agent comprising at least one chemotherapy agent, growth inhibitory agent, anti-angiogenesis agent and/or anti-neoplastic composition, in addition to the CD80 ECD or CD80 ECD fusion molecule.
- the combination of the CD80 ECD or CD80 ECD fusion molecule and an immune stimulating agent, such as a PD-1/PD-L1 inhibitor that is administered to the subject has been shown to reduce or inhibit tumor growth in at least one mouse syngeneic or xenograft cancer model in a synergistic fashion compared to treatment with either the CD80 ECD or fusion molecule or the immune stimulating agent, such as the PD-1/PD-L1 inhibitor, given alone.
- the mouse model is a colorectal cancer model with murine colorectal carcinoma CT26 cells.
- the model may be an MC38 model or a B16 model.
- the CD80 ECD or CD80 ECD fusion molecule administered to the subject may inhibit tumor growth in at least one mouse syngeneic or xenograft cancer model over a period of 1 week, 10 days, 2 weeks, or 3 weeks, for example, by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98%, or may inhibit growth of tumors by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98% in a patient over a period of one month, two months, three months, six months, or one year.
- administration of the CD80 ECD or CD80 ECD fusion molecule may reduce the volume of at least one tumor in an animal or human subject by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98%, for example, over a period of one month, two months, three months, six months, or one year.
- the tumor is a solid tumor.
- the combination of the CD80 ECD or CD80 ECD fusion molecule with an additional therapeutic agent, such as an immune stimulator, such as a PD-1/PD-L1 inhibitor, administered to the subject may inhibit tumor growth in at least one mouse syngeneic or xenograft cancer model over a period of 1 week, 10 days, 2 weeks, or 3 weeks, for example, by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98%, or may inhibit growth of tumors by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98% in a patient over a period of one month, two months, three months, six months, or one year.
- an additional therapeutic agent such as an immune stimulator, such as a PD-1/PD-L1 inhibitor
- the combination of the CD80 ECD or CD80 ECD fusion molecule with an additional therapeutic agent, such as an immune stimulator, such as a PD-1/PD-L1 inhibitor, administered to the subject may reduce the volume of at least one tumor in an animal or human subject by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98%, for example, over a period of one month, two months, three months, six months, or one year.
- the tumor is a solid tumor.
- the CD80 ECD or CD80 ECD fusion molecule is a CD80 ECD fusion molecule comprising 10-60 mol sialic acid (SA) to mol of CD80 ECD protein, such as 15-60 mol SA/mol protein.
- the content is 10-40 mol SA/mol protein, such as 15-40 mol SA/mol protein, such as 20-40 mol SA/mol protein, 20-30 mol SA/mol protein, 15-25 mol SA/mol protein, 15-30 mol SA to mol of protein, or 30-40 mol SA/mol protein.
- the SA content is at least 15, such as at least 20, at least 25, at least 30, at least 35, or at least 40 mol SA/mol protein.
- the SA content is 15, 20, 25, 30, 35, or 40 mol SA/mol protein.
- the CD80 ECD fusion molecule comprises an Fc domain as fusion partner, such as a wild-type Fc domain, such as a wild-type human IgG1, IgG2, or IgG4 Fc domain.
- the CD80 ECD fusion molecule comprises an amino acid sequence selected from SEQ ID NO: 5, SEQ ID NO: 12, SEQ ID NO:14, SEQ ID NO: 20, and SEQ ID NO: 21.
- the CD80 ECD or CD80 ECD fusion molecule is capable of at least 90% reduction of growth of CT26 tumor cells in mice, such as at least 95%, or at least 98%, over a period of at least ten days, such as at least two weeks, such as at least three weeks, such as over a period of ten days to two weeks or two to three weeks. In some embodiments, these results are obtained after mice are given one to three doses of 0.3 to 3 mg/kg, such as 0.3 to 0.6 mg/kg, of the CD80 ECD Fc fusion molecule.
- CD80 ECD fusion molecule comprising a human CD80 ECD polypeptide and a human IgG1 Fc domain, such as a wild-type human IgG1 Fc, wherein the CD80 ECD Fc comprises 10-60 mol SA to mol of CD80 ECD Fc protein, such as 15-60 mol SA/mol protein.
- the content is 10-40 mol SA/mol protein, such as 15-40 mol SA/mol protein, such as 20-40 mol SA/mol protein, 20-30 mol SA/mol protein, 15-25 mol SA/mol protein, 15-30 mol SA to mol of protein, or 30-40 mol SA/mol protein.
- the SA content is at least 15, such as at least 20, at least 25, at least 30, at least 35, or at least 40 mol SA/mol protein. In some embodiments, the SA content is 15, 20, 25, 30, 35, or 40 mol SA/mol protein.
- the Fc domain comprises the amino acid sequence of SEQ ID NO:14.
- the fusion molecule comprises the amino acid sequence of SEQ ID NO:20. In some embodiments, the molecule is capable of at least 90% reduction, such as at least 95%, or at least 98% of growth of CT26 tumor cells in mice over a period of at least ten days, such as at least two weeks, such as at least three weeks, such as over a period of ten days to two weeks or two to three weeks. In some embodiments, these results are obtained after mice are given one to three doses of 0.3 to 3 mg/kg, such as 0.3 to 0.6 mg/kg, of the CD80 ECD Fc fusion molecule.
- compositions comprising the CD80 ECD IgG1 Fc and further comprising at least one pharmaceutically acceptable carrier.
- Such compositions may also contain an additional therapeutic agent.
- the additional therapeutic agent is at least one immune stimulating agent, such as a programmed cell death 1 (PD-1)/programmed cell death ligand 1 (PD-L1) inhibitor.
- the PD-1/PD-L1 inhibitor is an antibody, such as an anti-PD-1 antibody, such as nivolumab, pidilizumab, and pembrolizumab.
- the antibody may have the heavy chain and light chain CDRs or the heavy and light chain variable regions of an antibody selected from nivolumab, pidilizumab, and pembrolizumab.
- the PD-1/PD-L1 inhibitor is an anti-PD-L1 antibody.
- An anti-PD-L1 antibody may have the heavy chain and light chain CDRs of an antibody selected from BMS-936559, MPDL3280A, MEDI4736, and MSB0010718C, for example, or may comprise the heavy chain and light chain variable regions of BMS-936559, MPDL3280A, MEDI4736, or MSB0010718C.
- the anti-PD-1 antibody is selected from BMS-936559, MPDL3280A, MEDI4736, and MSB0010718C.
- the PD-1/PD-L1 inhibitor may be a PD-1 fusion molecule such as AMP-224 or a polypeptide such as AUR-012.
- the cancer is a solid tumor, such as a cancer selected from colorectal cancer, breast cancer, gastric cancer, non-small cell lung cancer, melanoma, squamous cell carcinoma of the head and neck, ovarian cancer, pancreatic cancer, renal cell carcinoma, hepatocellular carcinoma, bladder cancer, and endometrial cancer.
- the cancer is recurrent or progressive after a therapy selected from surgery, chemotherapy, radiation therapy, or a combination thereof.
- the CD80 ECD Fc comprises 10-60 mol SA to mol of CD80 ECD Fc protein, such as 15-60 mol SA/mol protein.
- the content is 10-40 mol SA/mol protein, such as 15-40 mol SA/mol protein, such as 20-40 mol SA/mol protein, 20-30 mol SA/mol protein, 15-25 mol SA/mol protein, 15-30 mol SA to mol of protein, or 30-40 mol SA/mol protein.
- the SA content is at least 15, such as at least 20, at least 25, at least 30, at least 35, or at least 40 mol SA/mol protein.
- the SA content is 15, 20, 25, 30, 35, or 40 mol SA/mol protein.
- the Fc domain is a human IgG1, IgG2, or IgG4 Fc domain. In some embodiments, the Fc domain comprises the amino acid sequence of SEQ ID NO:14. In some embodiments, the fusion molecule comprises the amino acid sequence of SEQ ID NO:20 or 21. In some embodiments, the molecule is capable of at least 90% reduction of growth of CT26 tumor cells in mice over a period of two or three weeks following inoculation of mice with tumor cells. In some embodiments, the molecule is capable of at least 95% reduction of growth of CT26 tumor cells, such as at least 98% reduction, in mice over a period of two or three weeks following inoculation of mice with tumor cells.
- the mice are given one to three doses of 0.3 to 3.0 mg/kg, such as 0.3 to 0.6 mg/kg, of the ECD Fc fusion molecule.
- the CD80 ECD Fc comprises 10-40 mol SA to mol of CD80 ECD Fc protein
- the CD80 ECD Fc reduces growth of CT26 tumor cells in mice over a period of two or three weeks by a greater degree than a CD80 ECD Fc protein of the same amino acid sequence comprising less than 10 mol SA to mol of CD80 ECD Fc protein.
- the disclosure herein also comprises methods of enhancing efficacy of a CD80 ECD fusion protein in treating cancer in a subject comprising increasing the level of sialic acid (SA) in the CD80 ECD fusion protein or providing a CD80 ECD fusion protein with an increased SA level and administering the CD80 ECD fusion protein comprising an increased level of SA to the subject.
- SA sialic acid
- the SA level is increased by 5, 10, 20, 30, 40, or 50 mol to mol of CD80 ECD protein.
- the CD80 ECD Fc comprises 10-60 mol SA to mol of CD80 ECD Fc protein, such as 15-60 mol SA/mol protein.
- the content is 10-40 mol SA/mol protein, such as 15-40 mol SA/mol protein, such as 20-40 mol SA/mol protein, 20-30 mol SA/mol protein, 15-25 mol SA/mol protein, 15-30 mol SA to mol of protein, or 30-40 mol SA/mol protein.
- the SA content is 15, 20, 25, 30, 35, or 40 mol SA/mol protein.
- the Fc domain is a human IgG1, IgG2, or IgG4 Fc domain.
- the Fc domain comprises the amino acid sequence of SEQ ID NO:14.
- the fusion molecule comprises the amino acid sequence of SEQ ID NO:20 or 21.
- the molecule is capable of at least 90% reduction of growth of CT26 tumor cells in mice over a period of two or three weeks. In some embodiments, the molecule is capable of at least 95%, such as at least 98%, reduction of growth of CT26 tumor cells in mice over a period of at least ten days, such as at least two weeks, such as at least three weeks, such as over a period of ten days to two weeks or two to three weeks. In some embodiments, these results are obtained after mice are given one to three doses of 0.3 to 3 mg/kg, such as 0.3 to 0.6 mg/kg, of the CD80 ECD Fc fusion molecule.
- the enhanced efficacy is measured as an increase in overall survival, an increase in disease-free survival, or as a greater reduction in the growth of at least one tumor in an animal or human subject. In other words, one or more of these parameters is improved upon administration of the CD80 ECD fusion molecule with higher SA content compared to a CD80 ECD fusion molecule with a lower SA content. In other embodiments, the enhanced efficacy is measured as a greater reduction in tumor growth in a mouse syngeneic or xenograft model such as a CT26 mouse model or as a reduced rate of clearance in an animal or human subject.
- the efficacy is measured as a greater reduction in tumor growth of at least one tumor in the subject or a greater reduction in tumor growth in at least one mouse syngeneic or xenograft model, and wherein the tumor growth is further reduced by at least 10%, such as at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% upon administration of the CD80 ECD fusion molecule with increased SA level in comparison to administration of the CD80 ECD fusion molecule without the increased SA level.
- FIGS. 1 a -1 b show effects of administering a CD80 ECD Fc fusion molecule compared with a CTLA4 ECD Fc fusion molecule and a saline control to mice implanted with murine colorectal carcinoma cell line CT26 cells.
- FIG. 1 a shows tumor volume at up to 21 days post-inoculation of mice with the CT26 cells.
- CTLA4 ECD Fc enhanced tumor growth while CD80 ECD Fc inhibited tumor growth in a statistically significant manner compared to the saline control.
- P-values were calculated using unpaired, two-tailed t-test analyses of the calculated tumor volumes on each day of the study (*p ⁇ 0.05, **p ⁇ 0.01, ***p ⁇ 0.001).
- FIG. 1 b shows individual tumor volumes on Day 19 post-inoculation for the three groups.
- FIGS. 2 a -2 b show effects of administering a CD80 ECD Fc fusion molecule or an anti-PD-1 antibody or a combination of the two compared to a saline control to mice implanted with murine colorectal carcinoma cell line CT26 cells.
- FIG. 2 a shows tumor volume at up to 14 days post-inoculation. Mice administered with the CD80 ECD Fc and anti-PD-1 combination showed statistically significant reduction in tumor growth compared to either the CD80 ECD Fc (p ⁇ 0.01 beginning after Day 9) or anti-PD-1 (p ⁇ 0.01 on Day 14) single therapies. Statistical significance was determined via two-tailed, unpaired t-Test comparing the combination group to the CD80 ECD Fc group.
- FIG. 2 b shows individual tumor volumes on Day 14.
- FIGS. 3 a - b show the effect of the Fc fusion polypeptide sequence on effects of a CD80 ECD Fc fusion molecule on tumor growth of the CT26 tumors in mice.
- mice were administered saline control, or a CD80 ECD Fc with a human IgG1 wild-type Fc domain fusion partner (CD80-IgG1 WT), or with a CD80 ECD Fc with a mutant (L234F/L235E/P331S) human IgG1 Fc domain fusion partner (CD80-IgG1 MT).
- FIG. 3 a shows changes in tumor volume up to Day 21 post-inoculation.
- FIG. 3 b shows individual tumor volumes on Day 21 post-inoculation.
- FIGS. 4 a - b show staining of murine tumor cells for presence of CD3+ and CD4+ T cells after exposure to saline control or to CD80 ECD Fc fusion molecules with either wild-type and mutant Fc fusion partners.
- FIG. 4 a provides representative images showing CD3+ cells (top images) and corresponding DAPI staining (nuclei, bottom images) in CT26 tumors collected 7 days after injection of Saline, CD80-IgG1 WT or CD80-IgG1 MT. Both CD80-IgG1 WT and CD80-IgG1 MT increased the number of CD3+ cells within the tumors compared to vehicle but the magnitude of the increase was greater after CD80-IgG1 MT.
- FIG. 4 b provides representative images showing CD3+ cells (top row) and CD4+ cells (bottom row) in CT26 tumors collected 7 days after injection of Saline, CD80-IgG1 WT or CD80-IgG1 MT.
- the images were the taken in the same field of view but with different channels.
- Both CD80-IgG1 WT and CD80-IgG1 MT increased the number of infiltrating CD4+ cells compared to vehicle.
- the ratio of CD3+ to CD4+ cells was increased with the CD80-IgG1 MT compared to the CD80-IgG1 WT. Images were collected using the 10 ⁇ objective.
- FIGS. 5 a - d show release of cytokines IFN- ⁇ and TNF- ⁇ from T-cells on 96 well tissue culture plates exposed to protein A beads coated with 0.01, 0.1, or 1 ⁇ g/well of a CD80 ECD IgG1 Fc domain fusion molecule (CD80-Fc).
- FIGS. 5 a and 5 c show that bead-immobilized CD80-Fc alone did not cause significant T-cell activation, as measured by soluble cytokine production.
- FIGS. 5 b and 5 d show that when a small amount of OKT3-scFv (too low to cause T-cell stimulation on its own) was immobilized along with the CD80-Fc, cytokine release was observed.
- FIG. 6 shows tumor growth of murine CT26 tumors following treatment with a saline control or either 0.3 or 0.6 mg/kg doses of three different lots of a CD80 ECD Fc fusion molecule having three different sialic acid (SA) contents.
- Lot A has 5 mol SA/mol protein
- lot D has 15 mol SA/mol protein
- lot E has 20 mol SA/mol protein.
- Treatment with CD80 ECD Fc lot E dosed at 0.3 or 0.6 mg/kg resulted in a 93% and 98% inhibition of tumor growth compared to the control (P ⁇ 0.001).
- Treatment with CD80 ECD Fc lot D dosed at 0.3 or 0.6 mg/kg resulted in a 93% and 95% inhibition of tumor growth compared to the control (P ⁇ 0.001).
- treatment with CD80 ECD Fc lot A at 0.3 mg/kg did not inhibit tumor growth compared to the control and when dosed at 0.6 mg/kg it only induced 70% inhibition (P ⁇ 0.001) of tumor growth.
- FIG. 7 shows tumor growth of CT26 tumors treated with mouse IgG2b at 10 mg/kg; murine CD80 ECD-Fc SA 20 mol/mol at 0.3 mg/kg; anti-CTLA4 antibody clone 9D9 at 10 mg/kg; and anti-CTLA4 antibody clone 9D9 at 1.5 mg/kg.
- Arrows indicate when mice were dosed.
- the asterisk symbol (*) denotes statistically significant differences between murine CD80 ECD-Fc SA 20 mol/mol at 0.3 mg/kg and the other treatments.
- FIG. 8 shows tumor growth of MC38 tumors treated with mouse IgG2b at 10 mg/kg; murine CD80 ECD-Fc SA 20 mol/mol at 3 mg/kg; anti-CTLA4 antibody clone 9D9 at 10 mg/kg; and anti-CTLA4 antibody clone 9D9 at 1.5 mg/kg.
- Arrows indicate when mice were dosed.
- the asterisk symbol (*) denotes statistically significant differences between murine CD80 ECD-Fc SA 20 mol/mol at 3 mg/kg and the other treatments.
- FIG. 9 shows tumor growth of B16 tumors treated with mouse IgG2b at 10 mg/kg; murine CD80 ECD-Fc SA 20 mol/mol at 3 mg/kg; anti-CTLA4 antibody clone 9D9 at 10 mg/kg; and anti-CTLA4 antibody clone 9D9 at 1.5 mg/kg.
- Arrows indicate when mice were dosed.
- the asterisk symbol (*) denotes statistically significant differences between murine CD80 ECD-Fc SA 20 mol/mol at 3 mg/kg and the other treatments.
- nucleic acid molecule and “polynucleotide” may be used interchangeably, and refer to a polymer of nucleotides. Such polymers of nucleotides may contain natural and/or non-natural nucleotides, and include, but are not limited to, DNA, RNA, and PNA.
- Nucleic acid sequence refers to the linear sequence of nucleotides that comprise the nucleic acid molecule or polynucleotide.
- polypeptide and “protein” are used interchangeably to refer to a polymer of amino acid residues, and are not limited to a minimum length. Such polymers of amino acid residues may contain natural or non-natural amino acid residues, and include, but are not limited to, peptides, oligopeptides, dimers, trimers, and multimers of amino acid residues. Both full-length proteins and fragments thereof are encompassed by the definition.
- the terms also include post-expression modifications of the polypeptide, for example, glycosylation, sialylation, acetylation, phosphorylation, and the like.
- a “polypeptide” refers to a protein which includes modifications, such as deletions, additions, and substitutions (generally conservative in nature), to the native sequence, as long as the protein maintains the desired activity. These modifications may be deliberate, as through site-directed mutagenesis, or may be accidental, such as through mutations of hosts which produce the proteins or errors due to PCR amplification.
- CD80 extracellular domain refers to an extracellular domain polypeptide of CD80, including natural and engineered variants thereof.
- Nonlimiting examples of CD80 ECDs include SEQ ID NOs:--.
- a “CD80 ECD fusion molecule” refers to a molecule comprising a CD80 ECD and a fusion partner such as an Fc domain, albumin, or PEG. The fusion partner may be covalently attached, for example, to the N- or C-terminal of the CD80 ECD or at an internal location.
- Nonlimiting examples of CD80 ECD fusion molecules include SEQ ID NOs:--
- PD-1 programmed cell death protein 1
- PD-1 refers to an immunoinhibitory receptor belonging to the CD28 family. PD-1 is expressed predominantly on previously activated T cells in vivo, and binds to two ligands, PD-L1 and PD-L2.
- the term “PD-1” as used herein includes human PD-1 (hPD-1), variants, isoforms, and species homologs of hPD-1, and analogs having at least one common epitope with hPD-1. The complete hPD-1 sequence can be found under GenBank Accession No. U64863.
- the PD-1 is a human PD-1 having the amino acid sequence of SEQ ID NO: -- (precursor, with signal sequence) or SEQ ID NO: -- (mature, without signal sequence).
- the terms “programmed cell death 1 ligand 1” and “PD-L1” refer to one of two cell surface glycoprotein ligands for PD-1 (the other being PD-L2) that down regulate T cell activation and cytokine secretion upon binding to PD-1.
- the term “PD-L1” as used herein includes human PD-L1 (hPD-L1), variants, isoforms, and species homologs of hPD-L1, and analogs having at least one common epitope with hPD-L1.
- the complete hPD-L1 sequence can be found under GenBank® Accession No. Q9NZQ7.
- the PD-L1 is a human PD-L1 having the amino acid sequence of SEQ ID NO: -- (precursor, with signal sequence) or SEQ ID NO: -- (mature, without signal sequence).
- immune stimulating agent refers to a molecule that stimulates the immune system by either acting as an agonist of an immune-stimulatory molecule, including a co-stimulatory molecule, or acting as an antagonist of an immune inhibitory molecule, including a co-inhibitory molecule.
- An immune stimulating agent may be a biologic, such as an antibody or antibody fragment, other protein, or vaccine, or may be a small molecule drug.
- An “immune stimulatory molecule” includes a receptor or ligand that acts to enhance, stimulate, induce, or otherwise “turn-on” an immune response. Immune stimulatory molecules as defined herein include co-stimulatory molecules.
- Immune inhibitory molecule includes a receptor or ligand that acts to reduce, inhibit, suppress, or otherwise “turn-off” an immune response.
- Immune inhibitory molecules as defined herein include co-inhibitory molecules.
- Such immune stimulatory and immune inhibitory molecules may be, for example, receptors or ligands found on immune cells such as a T cells, or found on cells involved in innate immunity such as NK cells.
- PD-1/PD-L1 inhibitor refers to a moiety that disrupts the PD-1/PD-L1 signaling pathway.
- the inhibitor inhibits the PD-1/PD-L1 signaling pathway by binding to PD-1 and/or PD-L1.
- the inhibitor also binds to PD-L2.
- a PD-1/PD-L1 inhibitor blocks binding of PD-1 to PD-L1 and/or PD-L2.
- Nonlimiting exemplary PD-1/PD-L1 inhibitors include antibodies that bind to PD-1; antibodies that bind to PD-L1; fusion proteins, such as AMP-224; and peptides, such as AUR-012.
- antibody that inhibits PD-1 refers to an antibody that binds to PD-1 or binds to PD-L1 and thereby inhibits PD-1 and/or PD-L1 signaling. In some embodiments, an antibody that inhibits PD-1 binds to PD-1 and blocks binding of PD-L1 and/or PD-L2 to PD-1. In some embodiments, an antibody that inhibits PD-1 binds to PD-L1 and blocks binding of PD-1 to PD-L1. An antibody that inhibits PD-1 that binds to PD-L1 may be referred to as an anti-PD-L1 antibody. An antibody that inhibits PD-1 that binds to PD-1 may be referred to as an anti-PD-1 antibody.
- CD80 ECDs and CD80 ECD fusion molecules the term “blocks binding of” a ligand, and grammatical variants thereof, refers to the ability to inhibit an interaction between CD80 and a CD80 ligand, such as CD28, CTLA4, or PD-L1. Such inhibition may occur through any mechanism, including by the CD80 ECDs or CD80 ECD fusion molecules competing for binding with CD80 ligands.
- blocking binding of a ligand such as PD-L1
- a ligand such as PD-L1
- grammatical variants thereof are used to refer to the ability to inhibit the interaction between PD-1 and a PD-1 ligand, such as PD-L1.
- Such inhibition may occur through any mechanism, including direct interference with ligand binding, e.g., because of overlapping binding sites on PD-1, and/or conformational changes in PD-1 induced by the antibody that alter ligand affinity, etc., or, in the case of a PD-1 fusion molecule or peptide, by competing for binding with a PD-1 ligand.
- Binding affinity refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g., a polypeptide) and its binding partner (e.g., a ligand).
- binding affinity refers to intrinsic binding affinity, which reflects a 1:1 interaction between members of a binding pair (e.g., polypeptide and ligand).
- the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (K d ).
- antibody refers to a molecule comprising at least complementarity-determining region (CDR) 1, CDR2, and CDR3 of a heavy chain and at least CDR1, CDR2, and CDR3 of a light chain, wherein the molecule is capable of binding to antigen.
- CDR complementarity-determining region
- the term antibody includes, but is not limited to, fragments that are capable of binding antigen, such as Fv, single-chain Fv (scFv), Fab, Fab′, and (Fab′) 2 .
- the term antibody also includes, but is not limited to, chimeric antibodies, humanized antibodies, and antibodies of various species such as mouse, human, cynomolgus monkey, etc.
- an antibody comprises a heavy chain variable region and a light chain variable region. In some embodiments, an antibody comprises at least one heavy chain comprising a heavy chain variable region and at least a portion of a heavy chain constant region, and at least one light chain comprising a light chain variable region and at least a portion of a light chain constant region. In some embodiments, an antibody comprises two heavy chains, wherein each heavy chain comprises a heavy chain variable region and at least a portion of a heavy chain constant region, and two light chains, wherein each light chain comprises a light chain variable region and at least a portion of a light chain constant region.
- a single-chain Fv or any other antibody that comprises, for example, a single polypeptide chain comprising all six CDRs (three heavy chain CDRs and three light chain CDRs) is considered to have a heavy chain and a light chain.
- the heavy chain is the region of the antibody that comprises the three heavy chain CDRs and the light chain in the region of the antibody that comprises the three light chain CDRs.
- heavy chain variable region refers to a region comprising heavy chain HVR1, framework (FR) 2, HVR2, FR3, and HVR3.
- a heavy chain variable region also comprises at least a portion of an FR1 and/or at least a portion of an FR4.
- heavy chain constant region refers to a region comprising at least three heavy chain constant domains, C H 1, C H 2, and C H 3.
- Nonlimiting exemplary heavy chain constant regions include ⁇ , ⁇ , and ⁇ .
- Nonlimiting exemplary heavy chain constant regions also include ⁇ and ⁇ .
- Each heavy constant region corresponds to an antibody isotype.
- an antibody comprising a ⁇ constant region is an IgG antibody
- an antibody comprising a ⁇ constant region is an IgD antibody
- an antibody comprising an a constant region is an IgA antibody.
- an antibody comprising a ⁇ constant region is an IgM antibody
- an antibody comprising an c constant region is an IgE antibody.
- IgG antibodies include, but are not limited to, IgG1 (comprising a ⁇ 1 constant region), IgG2 (comprising a ⁇ 2 constant region), IgG3 (comprising a ⁇ 3 constant region), and IgG4 (comprising a ⁇ 4 constant region) antibodies;
- IgA antibodies include, but are not limited to, IgA1 (comprising an al constant region) and IgA2 (comprising an ⁇ 2 constant region) antibodies; and IgM antibodies include, but are not limited to, IgM1 and IgM2.
- heavy chain refers to a polypeptide comprising at least a heavy chain variable region, with or without a leader sequence.
- a heavy chain comprises at least a portion of a heavy chain constant region.
- full-length heavy chain refers to a polypeptide comprising a heavy chain variable region and a heavy chain constant region, with or without a leader sequence.
- light chain variable region refers to a region comprising light chain HVR1, framework (FR) 2, HVR2, FR3, and HVR3.
- a light chain variable region also comprises an FR1 and/or an FR4.
- light chain constant region refers to a region comprising a light chain constant domain, C L .
- Nonlimiting exemplary light chain constant regions include ⁇ and ⁇ .
- light chain refers to a polypeptide comprising at least a light chain variable region, with or without a leader sequence.
- a light chain comprises at least a portion of a light chain constant region.
- full-length light chain refers to a polypeptide comprising a light chain variable region and a light chain constant region, with or without a leader sequence.
- hypervariable region refers to each of the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops (“hypervariable loops”).
- native four-chain antibodies comprise six HVRs; three in the V H (H1, H2, H3), and three in the V L (L1, L2, L3).
- HVRs generally comprise amino acid residues from the hypervariable loops and/or from the “complementarity determining regions” (“CDRs”), the latter being of highest sequence variability and/or involved in antigen recognition.
- CDRs complementarity determining regions
- Exemplary hypervariable loops occur at amino acid residues 26-32 (L1), 50-52 (L2), 91-96 (L3), 26-32 (H1), 53-55 (H2), and 96-101 (H3).
- Exemplary CDRs CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, and CDR-H3 occur at amino acid residues 24-34 of L1, 50-56 of L2, 89-97 of L3, 31-35B of H1, 50-65 of H2, and 95-102 of H3.
- hypervariable regions (HVRs) and complementarity determining regions (CDRs) both refer to portions of the variable region that form the antigen binding regions.
- a “chimeric antibody” as used herein refers to an antibody comprising at least one variable region from a first species (such as mouse, rat, cynomolgus monkey, etc.) and at least one constant region from a second species (such as human, cynomolgus monkey, etc.).
- a chimeric antibody comprises at least one mouse variable region and at least one human constant region.
- a chimeric antibody comprises at least one cynomolgus variable region and at least one human constant region.
- a chimeric antibody comprises at least one rat variable region and at least one mouse constant region.
- all of the variable regions of a chimeric antibody are from a first species and all of the constant regions of the chimeric antibody are from a second species.
- a “humanized antibody” as used herein refers to an antibody in which at least one amino acid in a framework region of a non-human variable region has been replaced with the corresponding amino acid from a human variable region.
- a humanized antibody comprises at least one human constant region or fragment thereof.
- a humanized antibody is a Fab, an scFv, a (Fab′) 2 , etc.
- a “human antibody” as used herein refers to antibodies produced in humans, antibodies produced in non-human animals that comprise human immunoglobulin genes, such as XenoMouse®, and antibodies selected using in vitro methods, such as phage display, wherein the antibody repertoire is based on a human immunoglobulin sequences.
- leader sequence refers to a sequence of amino acid residues located at the N terminus of a polypeptide that facilitates secretion of a polypeptide from a mammalian cell.
- a leader sequence may be cleaved upon export of the polypeptide from the mammalian cell, forming a mature protein.
- Leader sequences may be natural or synthetic, and they may be heterologous or homologous to the protein to which they are attached.
- Nonlimiting exemplary leader sequences also include leader sequences from heterologous proteins.
- an antibody lacks a leader sequence.
- an antibody comprises at least one leader sequence, which may be selected from native antibody leader sequences and heterologous leader sequences.
- isolated refers to a molecule that has been separated from at least some of the components with which it is typically found in nature.
- a polypeptide is referred to as “isolated” when it is separated from at least some of the components of the cell in which it was produced.
- a polypeptide is secreted by a cell after expression, physically separating the supernatant containing the polypeptide from the cell that produced it is considered to be “isolating” the polypeptide.
- a polynucleotide is referred to as “isolated” when it is not part of the larger polynucleotide (such as, for example, genomic DNA or mitochondrial DNA, in the case of a DNA polynucleotide) in which it is typically found in nature, or is separated from at least some of the components of the cell in which it was produced, e.g., in the case of an RNA polynucleotide.
- a DNA polynucleotide that is contained in a vector inside a host cell may be referred to as “isolated” so long as that polynucleotide is not found in that vector in nature.
- the term “reduce” or “reduces” when applied to a parameter such as tumor volume means to lower the level of that parameter in an observable, measurable way.
- the reduction may be by at least 10%, such as by at least 20%, at least 30%, at least 40%, or at least 50%.
- the reduction may be statistically significant compared to an alternative treatment or control.
- subject and “patient” are used interchangeably herein to refer to a human.
- methods of treating other mammals including, but not limited to, rodents, simians, felines, canines, equines, bovines, porcines, ovines, caprines, mammalian laboratory animals, mammalian farm animals, mammalian sport animals, and mammalian pets, are also provided.
- resistant when used in the context of treatment with a therapeutic agent, means that the subject shows decreased response or lack of response to a standard dose of the therapeutic agent, relative to the subject's response to the standard dose of the therapeutic agent in the past, or relative to the expected response of a similar subject with a similar disorder to the standard dose of the therapeutic agent.
- a subject may be resistant to therapeutic agent although the subject has not previously been given the therapeutic agent, or the subject may develop resistance to the therapeutic agent after having responded to the agent on one or more previous occasions.
- sample refers to a composition that is obtained or derived from a subject that contains a cellular and/or other molecular entity that is to be characterized, quantitated, and/or identified, for example based on physical, biochemical, chemical and/or physiological characteristics.
- An exemplary sample is a tissue sample.
- tissue sample refers to a collection of similar cells obtained from a tissue of a subject.
- the source of the tissue sample may be solid tissue as from a fresh, frozen and/or preserved organ or tissue sample or biopsy or aspirate; blood or any blood constituents; bodily fluids such as cerebral spinal fluid, amniotic fluid, peritoneal fluid, synovial fluid, or interstitial fluid; cells from any time in gestation or development of the subject.
- a tissue sample is a synovial biopsy tissue sample and/or a synovial fluid sample.
- a tissue sample is a synovial fluid sample.
- the tissue sample may also be primary or cultured cells or cell lines.
- the tissue sample is obtained from a disease tissue/organ.
- the tissue sample may contain compounds that are not naturally intermixed with the tissue in nature such as preservatives, anticoagulants, buffers, fixatives, nutrients, antibiotics, or the like.
- a “control sample” or “control tissue”, as used herein, refers to a sample, cell, or tissue obtained from a source known, or believed, not to be afflicted with the disease for which the subject is being treated.
- a “section” of a tissue sample means a part or piece of a tissue sample, such as a thin slice of tissue or cells cut from a solid tissue sample.
- cancer is used herein to refer to a group of cells that exhibit abnormally high levels of proliferation and growth.
- a cancer may be benign (also referred to as a benign tumor), pre-malignant, or malignant.
- Cancer cells may be solid cancer cells (i.e. “solid tumors”) or may be leukemic cancer cells.
- cancer growth is used herein to refer to proliferation or growth by a cell or cells that comprise a cancer that leads to a corresponding increase in the size or extent of the cancer.
- cancer examples include but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More particular nonlimiting examples of such cancers include squamous cell cancer, small-cell lung cancer, pituitary cancer, esophageal cancer, astrocytoma, soft tissue sarcoma, non-small cell lung cancer (including squamous cell non-small cell lung cancer), adenocarcinoma of the lung, squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney cancer, renal cell carcinoma, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, brain cancer, endometrial cancer, testis cancer, cholangiocarcinom
- Treatment refers to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) the targeted pathologic condition or disorder.
- treatment covers any administration or application of a therapeutic for disease in a mammal, including a human, and includes inhibiting or slowing the disease or progression of the disease; partially or fully relieving the disease, for example, by causing regression, or restoring or repairing a lost, missing, or defective function; stimulating an inefficient process; or causing the disease plateau to have reduced severity.
- treatment also includes reducing the severity of any phenotypic characteristic and/or reducing the incidence, degree, or likelihood of that characteristic. Those in need of treatment include those already with the disorder as well as those prone to have the disorder or those in whom the disorder is to be prevented.
- efficacy may be determined from one or more parameters such as survival or disease-free survival over a period of time such as 1 year, 5 years, or 10 years, as well as parameters such as the reduction in growth of one or more tumors in a subject.
- Pharmacokinetic parameters such as bioavailability and underlying parameters such as clearance rate may also impact efficacy.
- an “enhanced efficacy” i.e. an improvement in efficacy
- an effective amount refers to an amount of a drug effective to treat a disease or disorder in a subject.
- an effective amount refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result.
- a therapeutically effective amount of a CD80 ECD or CD80 ECD fusion molecule may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the drug to elicit a desired response in the individual.
- a therapeutically effective amount encompasses an amount in which any toxic or detrimental effects of the drug are outweighed by the therapeutically beneficial effects.
- the expression “effective amount” refers to an amount of the drug that is effective for treating the cancer.
- Administration “in combination with” one or more further therapeutic agents, such as an immune stimulating agent includes simultaneous (concurrent) and consecutive (sequential) administration in any order.
- a “pharmaceutically acceptable carrier” refers to a non-toxic solid, semisolid, or liquid filler, diluent, encapsulating material, formulation auxiliary, or carrier conventional in the art for use with a therapeutic agent that together comprise a “pharmaceutical composition” for administration to a subject.
- a pharmaceutically acceptable carrier is non-toxic to recipients at the dosages and concentrations employed and is compatible with other ingredients of the formulation.
- the pharmaceutically acceptable carrier is appropriate for the formulation employed.
- the carrier may be a gel capsule. If the therapeutic agent is to be administered subcutaneously, the carrier ideally is not irritable to the skin and does not cause injection site reaction.
- CD80 ECD and CD80 ECD fusion molecules are provided herein.
- CD80 ECDs may comprise the ECDs of human CD80 isoform 1, isoform 2, and isoform 3 (see SEQ ID NOs: 1-3.
- CD80 ECDs and may comprise the amino acid sequence of SEQ ID NO:5.
- CD80 ECD fusion molecules may comprise fusion partners such as polymers, polypeptides, lipophilic moieties, and succinyl groups.
- exemplary polypeptide fusion partners include, but are not limited to, serum albumin and an IgG Fc domain.
- Further exemplary polymer fusion partners include, but are not limited to, polyethylene glycol, including polyethylene glycols having branched and/or linear chains. The amino acid sequences of certain exemplary Fc domains are shown in SEQ ID NOs: 9-16 herein.
- the CD80 ECD or CD80 ECD fusion molecule lacks a signal peptide.
- the CD80 ECD or CD80 ECD fusion molecule includes at least one signal peptide, which may be selected from a native CD80 signal peptide (SEQ ID NO: 7 or amino acids 1-34 of SEQ ID NO:1) and/or a heterologous signal peptide.
- the fusion partner may be linked to either the amino-terminus or the carboxy-terminus of the polypeptide.
- the polypeptide and the fusion partner are covalently linked.
- the fusion partner is also a polypeptide (“the fusion partner polypeptide”)
- the polypeptide and the fusion partner polypeptide may be part of a continuous amino acid sequence.
- the polypeptide and the fusion partner polypeptide may be translated as a single polypeptide from a coding sequence that encodes both the polypeptide and the fusion partner polypeptide.
- the two polypeptides are directly linked in sequence such that the N-terminal of one polypeptide immediately follows the C-terminal of the other with no intervening amino acids.
- a linker peptide sequence is inserted in between the two polypeptides, such as a GS linker sequence.
- a CD80 ECD and the fusion partner are covalently linked through other means, such as, for example, a chemical linkage other than a peptide bond.
- the polypeptide and the fusion partner are noncovalently linked. In certain such embodiments, they may be linked, for example, using binding pairs. Exemplary binding pairs include, but are not limited to, biotin and avidin or streptavidin, an antibody and its antigen, etc.
- the CD80 ECD fusion molecule comprises the sequence of SEQ ID NO: 20 or 21.
- CD80 ECD fusion molecules may, depending on how they are produced, have different levels of particular glycosylation modifications.
- a CD80 ECD fusion molecule may have different concentrations of sialic acid residues in relation to the concentration of the CD80 ECD protein.
- a higher sialic acid content may have a longer clearance time in the body and thus an increased overall bioavailability.
- the sialic acid content of the CD80 ECD fusion molecule is from 10 to 60 mol sialic acid (SA) to mol protein.
- the sialic acid content of the CD80 ECD fusion molecule is from 15 to 60 mol sialic acid (SA) to mol protein.
- the SA content is 10-40 mol SA/mol protein, such as 15-30 mol SA/mol protein, such as 15-25 mol SA/mol protein, such as 20-40 mol SA/mol protein, such as 20-30 mol SA/mol protein, such as 30-40 mol SA/mol protein, such as 10, 15, 20, 25, 30, 35, or 40 mol SA/mol protein.
- the SA content is at least 15 mol SA/mol protein, such as at least 20 mol SA/mol protein, at least 25 mol SA/mol protein, at least 30 mol SA/mol protein, at least 35 mol SA/mol protein, or at least 40 mol SA/mol protein.
- the fusion partner is an Fc domain, such as a human IgG1, IgG2, or IgG4 Fc domain.
- the SA content of the CD80 ECD fusion molecule is increased or is maintained at a relatively high level in comparison to current CD80 ECD fusion molecules.
- an increase in SA content such as by 5, 10, 15, 20, 30, 40 or 50 mol SA to mol of CD80 ECD protein, may lead to an enhanced efficacy in at least one mouse syngeneic or xenograft tumor model.
- tumor growth in a mouse tumor model may be further reduced by at least 5%, 10%, 20%, 30%, 40% 50%, 60%, 70%, 80%, 90%, 95%, or 98% when there is an increase in SA content, such as by 5, 10, 15, 20, 30, 40 or 50 mol SA to mol of CD80 ECD protein.
- a CD80 ECD Fc fusion molecule such as a fusion molecule comprising a human IgG1 Fc domain comprising between 10 and 60 mol SA/mol protein is capable of at least 80%, such as at least 90%, such as at least 95%, such as at least 98% tumor cell growth inhibition in at least one mouse syngeneic or xenograft cancer model over a period of at least ten days or at least two weeks or at least three weeks, such as ten days to two weeks or two to three weeks following inoculation with tumor cells.
- the molecule comprises at least 15 mol SA/mol protein, such as at least 20 mol SA/mol protein, or a range from 15-30, 15-25, or 20-30 mol SA/mol prtotein.
- the mouse model is a CT26, MC38, or B16 mouse tumor model.
- the mice are given one to three doses of the molecule at 0.3 to 3.0 mg/kg, such as at 0.3 to 0.6 mg/kg, for example over a period of one week, once tumors have reached a minimum volume.
- the Fc domain comprises the amino acid sequence of SEQ ID NO:14.
- the CD80 ECD fusion molecule comprises the sequence of SEQ ID NO: 20 or 21.
- the CD80 ECD Fc fusion molecule reduces growth of CT26 tumor cells in mice over a period of at least ten days or at least two weeks or at least three weeks, such as ten days to two weeks or two to three weeks, after inoculation by a greater degree than a CD80 ECD Fc fusion protein with the identical amino acid sequence but a lower level of SA per mol of protein.
- the CD80 ECD Fc fusion molecule reduces growth of CT26 tumors in mice over a period of at least ten days or at least two weeks, such as over ten days to two weeks or two to three weeks, after inoculation by a greater degree than an anti-CTLA4 antibody, such as anti-CTLA4 antibody clone 9D9.
- the CD80 ECD Fc molecule is dosed one to three times at 0.3 mg/kg, 0.6 mg/kg, or 3.0 mg/kg while the anti-CTLA4 antibody is dosed the same number of times at 1.5 or 10 mg/kg.
- the model is a CT26, MC38, or B16 murine tumor model.
- Example 6 herein provides data showing that treatment of a mouse syngeneic tumor model with a CD80 ECD fusion molecule having 15 or 20 mol SA/mol protein resulted in at least 93% inhibition of tumor growth after one dose of 0.3 mg/kg, whereas the same treatment with a molecule having only 5 mol SA/mol protein did not significantly inhibit tumor growth.
- a 0.6 mg/kg dose of the CD80 ECD fusion molecule having 15 or 20 mol SA/mol protein resulted in 95% to 98% inhibition of tumor growth, whereas the same treatment with the molecule with 5 mol SA/mol protein inhibited tumor growth by only 70%. (See FIG. 6 .)
- the degree of inhibition was assessed about three weeks following inoculation with the tumors.
- Example 7 herein shows data on a CD80 ECD Fc fusion molecule (a mouse surrogate) having 20 mol SA/mol protein in three different syngeneic mouse tumor models, the CT26, MC38, and B16 models at 0.3 mg/kg (CT26) or 3.0 mg/kg (MC38 and B16) doses compared to an anti-CTLA4 antibody (clone 9D9) at 1.5 mg/kg and 10 mg/kg doses.
- CT26 CT26
- MC38 and B16 3.0 mg/kg
- clone 9D9 anti-CTLA4 antibody
- the CD80 ECD Fc was superior in tumor growth inhibition to the anti-CTLA4 antibody over the course of the two to three week study.
- FIGS. 7-9 . For example, in the CT26 model at day 21 after inoculation with tumor cells, the CD80 ECD Fc fusion molecule showed a 90% reduction in tumor growth compared to 75% or 53% for the two dose levels of anti-CTLA4.
- the CD80 ECD Fc molecule showed about 80% reduction in tumor growth inhibition compared to only 21% tumor growth for the higher dose of anti-CTLA4 and no tumor growth inhibition for the lower anti-CTLA4 dose.
- the CD80 ECD Fc fusion molecule showed 41% tumor growth inhibition on day 13 after inoculation while the anti-CTLA4 antibody did not inhibit tumor growth at either dose level. (See FIGS. 7-9 .)
- a CD80 ECD fusion molecule may be capable of a certain percentage of tumor growth inhibition over at least a two week period of time, for example, when about two weeks after the mice have been inoculated with the tumor cells, and also following dosing with the fusion molecule, an average tumor growth inhibition at about the stated percentage is observed in the treated mice.
- a CD80 ECD fusion molecule may be capable of a certain percentage of tumor growth inhibition over a two to three week period of time, for example, when between two and three weeks after the mice have been inoculated with the tumor cells, and also following dosing with the fusion molecule, an average tumor growth inhibition at about the stated percentage is observed in the treated mice.
- Examples 6 and 7 also show that many mice from the CT26 model treated with CD80 ECD fusion molecule had a complete tumor regression over these two to three week time periods. Moreover, a larger percentage of mice had complete tumor regression with CD80 ECD fusion molecule with higher SA content than with the comparison treatments and a larger percentage of mice had complete tumor regression with CD80 ECD fusion molecule than with an anti-CTLA4 antibody.
- treatment CD80 ECD fusion molecule such as with 0.3 mg/kg to 0.6 mg/kg CD80 ECD fusion molecule or with 0.3 mg/kg to 3.0 mg/kg CD80 ECD fusion molecule, may result in complete tumor regression in mice in a syngeneic or xenograft model such as CT26, MC38, or B16.
- the CD80 ECD fusion molecule has an Fc domain as fusion partner.
- the Fc domain is derived from human IgG1, IgG2, IgG3, or IgG4.
- the Fc domain has a wild-type sequence, such as a wild-type human IgG1 or IgG2 (e.g. IgG2a) sequence.
- the Fc domain is either a natural or engineered variant.
- an Fc domain is chosen that has altered interactions of the Fc with one or more Fc gamma receptors.
- an Fc domain is chosen that has altered interactions of the Fc with one or more complement factors.
- an Fc domain is chosen that has altered interactions of the Fc with one or more Fc gamma receptors and that has altered interactions with one or more complement factors.
- the Fc domain comprises at least one point mutation as described in WO 2014/144960.
- the Fc domain is a human Fc domain with a substitution at one or more of positions E233, L234, L235, P238, D265, N297, A327, P329, or P331 (wherein the numbering of these positions is according to the EU index as in Kabat).
- the Fc domain is a human Fc domain with a mutation at L234, L235, and/or P331.
- the Fc domain is a human Fc domain with the substitutions L234F, L235E, and P331S.
- the Fc domain has an amino acid substitution at position N297. (See, e.g., SEQ ID NO: 13.) In some embodiments, the Fc domain comprises a C237S mutation. (See, e.g., SEQ ID NO: 9.)
- a mutated Fc fusion partner causes the CD80 ECD Fc fusion molecule to have altered interactions with one or more Fc gamma receptors compared to those of a CD80 ECD fusion molecule with the same amino acid sequence except for the Fc domain mutations.
- the Fc has reduced affinity for Fc gamma receptors such as one or more of FcRN, RI, RIIA, RIIB, and RIII compared to a wild-type Fc domain.
- the Fc has reduced affinity for all of FcRN, RI, RIIA, RIIB, and RIII compared to a wild-type Fc domain.
- a mutated Fc fusion partner causes the CD80 ECD Fc fusion molecule to have altered interactions with at one or more complement factors such as C1, C2, C3, C4, and their cleavage products, such as C4a, C4b, C2a, C2b, C3a, and C3b.
- a mutated Fc fusion partner causes the CD80 ECD Fc fusion molecule to have altered interactions with one or more complement factors compared to those of a CD80 ECD fusion molecule with the same amino acid sequence except for the Fc domain mutations.
- the CD80 ECD and the fusion partner are directly linked such that the N- or C-terminal amino acid of the Fc immediately precedes or follows the N- or C-terminal amino acid of the CD80 ECD sequence.
- the CD80 ECD and fusion partner are joined by a linker molecule, such as by a linker peptide sequence, such as by a GS linker sequence.
- methods for treating cancer comprising administering an effective amount of a CD80 ECD or CD80 ECD fusion molecule.
- the cancer may be benign (also referred to as a benign tumor), pre-malignant, or malignant.
- the cancer may comprise solid cancer cells (i.e. “solid tumors”) or alternatively, it may comprise leukemic cancer cells.
- the CD80 ECD or CD80 ECD fusion molecule is effective to reduce cancer growth in a human or animal subject, or in a mouse syngeneic or xenograft model for the cancer being treated.
- the CD80 ECD or CD80 ECD fusion molecule is effective to reduce tumor volume, such as in a mouse syngeneic or xenograft model for the cancer being treated.
- cancers that may be treated include but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More particular nonlimiting examples of such cancers include but are not limited to squamous cell cancer, small-cell lung cancer, pituitary cancer, esophageal cancer, astrocytoma, soft tissue sarcoma, non-small cell lung cancer (including squamous cell non-small cell lung cancer), adenocarcinoma of the lung, squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney cancer, renal cell carcinoma, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, brain cancer, endometrial cancer,
- the CD80 ECD or CD80 ECD fusion molecule administered to the subject may inhibit tumor growth in a mouse syngeneic xenograft cancer model over a period of 1 week, 10 days, 2 weeks, or 3 weeks, for example, by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98%.
- the CD80 ECD fusion molecule may inhibit tumor growth in a CT26 mouse xenograft tumor model by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98% at two weeks or at three weeks post-inoculation.
- the fusion molecule may be dosed one to three times at 0.3 to 3 mg/kg, such as at 0.3 to 0.6 mg/kg.
- administration of the CD80 ECD or CD80 ECD fusion molecule administered to the subject may reduce the volume of at least one tumor in a human or animal subject by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98%, for example, over a period of one month, two months, three months, six months, or one year.
- the CD80 ECD Fc fusion molecule may be capable of resulting in complete tumor regression in a mouse tumor model such as a CT26 model, for example in a significant portion of tested mice, such as at least 40%, or at least 50% of mice.
- the CD80 ECD or CD80 ECD fusion molecule may be a CD80 ECD Fc comprising 10-60 mol SA to mol of CD80 ECD Fc protein, such as 15-60 mol SA/mol protein.
- the content is 10-40 mol SA/mol protein, such as 15-40 mol SA/mol protein, such as 20-40 mol SA/mol protein, 20-30 mol SA/mol protein, 15-25 mol SA/mol protein, 15-30 mol SA to mol of protein, or 30-40 mol SA/mol protein.
- the SA content is at least 15, such as at least 20, at least 25, at least 30, at least 35, or at least 40 mol SA/mol protein.
- the SA content is 15, 20, 25, 30, 35, or 40 mol SA/mol protein.
- the Fc domain is a human IgG1, IgG2, or IgG4 Fc domain.
- the Fc domain comprises the amino acid sequence of SEQ ID NO:14.
- the fusion molecule comprises the amino acid sequence of SEQ ID NO:20 or 21.
- the CD80 ECD or CD80 ECD fusion molecule is administered to treat one of the above cancers in combination with an effective amount of at least one immune stimulating agent.
- Immune stimulating agents may include, for example, a small molecule drug or a biologic.
- biologic immune stimulating agents include, but are not limited to, antibodies, antibody fragments, fragments of receptor or ligand polypeptides, for example that block receptor-ligand binding, vaccines and cytokines.
- the at least one immune stimulating agent comprises an agonist of an immune stimulatory molecule, including a co-stimulatory molecule, while in some embodiments, the at least one immune stimulating agent comprises an antagonist of an immune inhibitory molecule, including a co-inhibitory molecule. In some embodiments, the at least one immune stimulating agent comprises an agonist of an immune-stimulatory molecule, including a co-stimulatory molecule, found on immune cells, such as T cells. In some embodiments, the at least one immune stimulating agent comprises an antagonist of an immune inhibitory molecule, including a co-inhibitory molecule, found on immune cells, such as T cells.
- the at least one immune stimulating agent comprises an agonist of an immune stimulatory molecule, including a co-stimulatory molecule, found on cells involved in innate immunity, such as NK cells.
- the at least one immune stimulating agent comprises an antagonist of an immune inhibitory molecule, including a co-inhibitory molecule, found on cells involved in innate immunity, such as NK cells.
- the combination enhances the antigen-specific T cell response in the treated subject and/or enhances the innate immunity response in the subject.
- the combination results in an improved anti-tumor response in an animal cancer model, such as a syngeneic or xenograft model, compared to administration of either the CD80 ECD or CD80 ECD fusion molecule or immune stimulating agent alone.
- the combination results in a synergistic response in an animal cancer model, such as a syngeneic or xenograft model, compared to administration of either the CD80 ECD or CD80 ECD fusion molecule or immune stimulating agent alone.
- the combination of the CD80 ECD or CD80 ECD fusion molecule with the immune stimulating agent, such as a PD-1/PD-L1 inhibitor, that is administered to the subject may inhibit tumor growth in a mouse syngeneic or xenograft cancer model over a period of 1 week, 10 days, 2 weeks, or 3 weeks, for example, by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98%.
- the combination of the CD80 ECD or CD80 ECD fusion molecule with the immune stimulating agent, such as a PD-1/PD-L1 inhibitor, that is administered to the subject may reduce the volume of at least one tumor in the subject or in an animal model by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, for example, over a period of one month, two months, three months, six months, or one year.
- the immune stimulating agent such as a PD-1/PD-L1 inhibitor
- the CD80 ECD or CD80 ECD fusion molecule may be a CD80 ECD Fc comprising 10-60 mol SA to mol of CD80 ECD Fc protein, such as 15-60 mol SA/mol protein.
- the content is 10-40 mol SA/mol protein, such as 15-40 mol SA/mol protein, such as 20-40 mol SA/mol protein, 20-30 mol SA/mol protein, 15-25 mol SA/mol protein, 15-30 mol SA to mol of protein, or 30-40 mol SA/mol protein.
- the SA content is at least 15, such as at least 20, at least 25, at least 30, at least 35, or at least 40 mol SA/mol protein.
- the SA content is 15, 20, 25, 30, 35, or 40 mol SA/mol protein.
- the Fc domain is a human IgG1, IgG2, or IgG4 Fc domain.
- the Fc domain comprises the amino acid sequence of SEQ ID NO:14.
- the fusion molecule comprises the amino acid sequence of SEQ ID NO:20 or 21.
- an immune stimulating agent targets a stimulatory or inhibitory molecule that is a member of the immunoglobulin super family (IgSF).
- an immune stimulating agent may be an agent that targets (or binds specifically to) another member of the B7 family of polypeptides.
- An immune stimulating agent may be an agent that targets a member of the TNF family of membrane bound ligands or a co-stimulatory or co-inhibitory receptor binding specifically to a member of the TNF family.
- TNF and TNFR family members that may be targeted by immune stimulating agents include CD40 and CD40L, OX-40, OX-40L, GITR, GITRL, CD70, CD27L, CD30, CD30L, 4-1BBL, CD137 (4-1BB), TRAIL/Apo2-L, TRAILR1/DR4, TRAILR2/DR5, TRAILR3, TRAILR4, OPG, RANK, RANKL, TWEAKR/Fn14, TWEAK, BAFFR, EDAR, XEDAR, TACI, APRIL, BCMA, LT ⁇ R, LIGHT, DcR3, HVEM, VEGI/TL1A, TRAMP/DR3, EDAR, EDA1, XEDAR, EDA2, TNFR1, Lymphotoxin ⁇ /TNF ⁇ , TNFR2, TNF ⁇ , LT ⁇ R, Lymphotoxin ⁇ 1 ⁇ 2, FAS, FASL, RELT, DR6, TROY and NGFR.
- an immune stimulating agent may comprise (i) an antagonist of a protein that inhibits T cell activation (e.g., immune checkpoint inhibitor) such as CTLA4, LAG-3, TIM3, Galectin 9, CEACAM-1, BTLA, CD69, Galectin-1, TIGIT, CD113, GPR56, VISTA, B7-H3, B7-H4, 2B4, CD48, GARP, PD1H, LAIR1, TIM-1, TIM-4, and ILT4 and/or may comprise (ii) an agonist of a protein that stimulates T cell activation such as B7-2, CD28, 4-1BB (CD137), 4-1BBL, ICOS, ICOS-L, OX40, OX40L, GITR, GITRL, CD70, CD27, CD40, CD40L, DR3 and CD28H.
- T cell activation e.g., immune checkpoint inhibitor
- an immune stimulating agent may comprise an agent that inhibits or is an antagonist of a cytokine that inhibits T cell activation (e.g., IL-6, IL-10, TGF- ⁇ , VEGF, and other immunosuppressive cytokines), and it some embodiments an immune stimulating agent may comprise an agent that is an agonist of a cytokine, such as IL-2, IL-7, IL-12, IL-15, IL-21 and IFN ⁇ (e.g., the cytokine itself) that stimulates T cell activation.
- immune stimulating agents may comprise an antagonist of a chemokine, such as CXCR2 (e.g., MK-7123), CXCR4 (e.g. AMD3100), CCR2, or CCR4 (mogamulizumab).
- immune stimulating agents may include antagonists of inhibitory receptors on NK cells or agonists of activating receptors on NK cells.
- a CD80 ECD or CD80 ECD fusion molecule can be combined with an antagonist of KIR.
- Immune stimulating agents may also include agents that inhibit TGF- ⁇ signaling, agents that enhance tumor antigen presentation, e.g., dendritic cell vaccines, GM-CSF secreting cellular vaccines, CpG oligonucleotides, and imiquimod, or therapies that enhance the immunogenicity of tumor cells (e.g., anthracyclines).
- agents that enhance tumor antigen presentation e.g., dendritic cell vaccines, GM-CSF secreting cellular vaccines, CpG oligonucleotides, and imiquimod
- therapies that enhance the immunogenicity of tumor cells e.g., anthracyclines.
- Immune stimulating agents may also include certain vaccines such as mesothelin-targeting vaccines or attenuated listeria cancer vaccines, such as CRS-207.
- Immune stimulating agents may also comprise agents that deplete or block Treg cells, such as agents that specifically bind to CD25.
- Immune stimulating agents may also comprise agents that inhibit a metabolic enzyme such as indoleamine dioxigenase (IDO), dioxigenase, arginase, or nitric oxide synthetase.
- IDO indoleamine dioxigenase
- dioxigenase dioxigenase
- arginase arginase
- nitric oxide synthetase a metabolic enzyme
- Immune stimulating agents may also comprise agents that inhibit the formation of adenosine or inhibit the adenosine A2A receptor.
- Immune stimulating agents may also comprise agents that reverse/prevent T cell anergy or exhaustion and agents that trigger an innate immune activation and/or inflammation at a tumor site.
- immune stimulating agents may comprise a CD40 agonist such as a CD40 agonist antibody.
- the CD80 ECD or CD80 ECD fusion molecule may also be combined with a combinatorial approach that targets multiple elements of the immune pathway, such as one or more of the following: at least one agent that enhances tumor antigen presentation (e.g., dendritic cell vaccine, GM-CSF secreting cellular vaccines, CpG oligonucleotides, imiquimod); at least one agent that inhibits negative immune regulation e.g., by inhibiting CTLA4 pathway and/or depleting or blocking Treg or other immune suppressing cells; a therapy that stimulates positive immune regulation, e.g., with agonists that stimulate the CD-137, OX-40 and/or GITR pathway and/or stimulate T cell effector function; at least one agent that increases systemically the frequency of anti-tumor T cells; a therapy that depletes or inhibits Tregs, such as Tregs in the tumor, e.g.
- a CD80 ECD or CD80 ECD fusion molecule can be used with one or more agonistic agents that ligate positive costimulatory receptors; one or more antagonists (blocking agents) that attenuate signaling through inhibitory receptors, such as antagonists that overcome distinct immune suppressive pathways within the tumor microenvironment; one or more agents that increase systemically the frequency of anti-tumor immune cells, such as T cells, deplete or inhibit Tregs (e.g., by inhibiting CD25); one or more agents that inhibit metabolic enzymes such as IDO; one or more agents that reverse/prevent T cell anergy or exhaustion; and one or more agents that trigger innate immune activation and/or inflammation at tumor sites.
- agonistic agents that ligate positive costimulatory receptors
- antagonists blocking agents that attenuate signaling through inhibitory receptors, such as antagonists that overcome distinct immune suppressive pathways within the tumor microenvironment
- the at least one immune stimulating agent comprises a CTLA4 antagonist, such as an antagonistic CTLA4 antibody.
- CTLA4 antibodies include, for example, YERVOY (ipilimumab) or tremelimumab.
- the at least one immune stimulating agent comprises a LAG-3 antagonist, such as an antagonistic LAG-3 antibody.
- LAG-3 antibodies include, for example, BMS-986016 (WO10/19570, WO014/08218), or IMP-731 or IMP-321 (WO08/132601, WO09/44273).
- the at least one immune stimulating agent comprises a CD137 (4-1BB) agonist, such as an agonistic CD137 antibody.
- Suitable CD137 antibodies include, for example, urelumab or PF-05082566 (WO12/32433).
- the at least one immune stimulating agent comprises a GITR agonist, such as an agonistic GITR antibody.
- GITR antibodies include, for example, TRX-518 (WO06/105021, WO09/009116), MK-4166 (WO11/028683) or a GITR antibody disclosed in WO2015/031667.
- the at least one immune stimulating agent comprises an OX40 agonist, such as an agonistic OX40 antibody.
- OX40 antibodies include, for example, MEDI-6383, MEDI-6469 or MOXR0916 (RG7888; WO06/029879).
- the at least one immune stimulating agent comprises a CD27 agonist, such as an agonistic CD27 antibody.
- Suitable CD27 antibodies include, for example, varlilumab (CDX-1127).
- the at least one immune stimulating agent comprises MGA271, which targets B7H3 (WO11/109400).
- the at least one immune stimulating agent comprises a KIR antagonist, such as lirilumab.
- the at least one immune stimulating agent comprises an IDO antagonist.
- IDO antagonists include, for example, INCB-024360 (WO2006/122150, WO07/75598, WO08/36653, WO08/36642), indoximod, NLG-919 (WO09/73620, WO09/1156652, WO11/56652, WO12/142237) or F001287.
- the at least one immune stimulating agent comprises a Toll-like receptor agonist, e.g., a TLR2/4 agonist (e.g., Bacillus Calmette-Guerin); a TLR7 agonist (e.g., Hiltonol or Imiquimod); a TLR7/8 agonist (e.g., Resiquimod); or a TLR9 agonist (e.g., CpG7909).
- a TLR2/4 agonist e.g., Bacillus Calmette-Guerin
- TLR7 agonist e.g., Hiltonol or Imiquimod
- TLR7/8 agonist e.g., Resiquimod
- a TLR9 agonist e.g., CpG7909
- the at least one immune stimulating agent comprises a TGF- ⁇ inhibitor, e.g., GC1008, LY2157299, TEW7197 or IMC-TR1.
- a TGF- ⁇ inhibitor e.g., GC1008, LY2157299, TEW7197 or IMC-TR1.
- the CD80 ECD or CD80 ECD fusion molecule is administered to treat one of the above cancers in combination with an effective amount of a PD-1/PD-L1 inhibitor.
- PD-1/PD-L1 inhibitors include antibodies, fusion proteins, and peptides.
- a nonlimiting exemplary fusion protein that is a PD-1/PD-L1 inhibitor is AMP-224 (Amplimmune, GlaxoSmithKline).
- a nonlimiting exemplary peptide that is a PD-1/PD-L1 inhibitor is AUR-012.
- Other exemplary PD-1/PD-L1 inhibitors include antibodies that inhibit PD-1, such as anti-PD-1 antibodies and anti-PD-L1 antibodies. Such antibodies may be humanized antibodies, chimeric antibodies, mouse antibodies, and human antibodies.
- the combination results in an improved anti-tumor response in an animal cancer model, such as a xenograft model, compared to administration of either the CD80 ECD or CD80 ECD fusion molecule or PD-1/PD-L1 inhibitor alone.
- the combination results in a synergistic response in an animal cancer model, such as a xenograft model, compared to administration of either the CD80 ECD or CD80 ECD fusion molecule or PD-1/PD-L1 inhibitor alone.
- PD-1 is a key immune checkpoint receptor expressed by activated T and B cells and mediates immunosuppression.
- PD-1 is a member of the CD28 family of receptors, which includes CD28, CTLA4, ICOS, PD-1, and BTLA.
- Two cell surface glycoprotein ligands for PD-1 have been identified, Programmed Death Ligand-1 (PD-L1) and Programmed Death Ligand-2 (PD-L2). These ligands are expressed on antigen-presenting cells as well as many human cancers and have been shown to down regulate T cell activation and cytokine secretion upon binding to PD-1. Inhibition of the PD-1/PD-L1 interaction mediates potent antitumor activity in preclinical models.
- Human monoclonal antibodies that bind specifically to PD-1 with high affinity have been disclosed in U.S. Pat. No. 8,008,449.
- Other anti-PD-1 mAbs have been described in, for example, U.S. Pat. Nos. 6,808,710, 7,488,802, 8,168,757 and 8,354,509, and PCT Publication No. WO 2012/145493.
- Anti-PD-1 antibodies usable in the present invention include antibodies that bind specifically to human PD-1 and exhibit at least one, at least two, at least three, at least
- the anti-PD-1 antibody is nivolumab.
- Nivolumab also known as “Opdivo®”; formerly designated 5C4, BMS-936558, MDX-1106, or ONO-4538
- S228P fully human IgG4
- PD-1 immune checkpoint inhibitor antibody that selectively prevents interaction with PD-1 ligands (PD-L1 and PD-L2), thereby blocking the down-regulation of antitumor T-cell functions
- the anti-PD-1 antibody is pembrolizumab.
- Pembrolizumab also known as “Keytruda®”, lambrolizumab, and MK-3475
- Pembrolizumab has been approved by the FDA for the treatment of relapsed or refractory melanoma.
- the anti-PD-1 antibody is MEDI0608 (formerly AMP-514), which is a monoclonal antibody against the PD-1 receptor.
- the anti-PD-1 antibody is Pidilizumab (CT-011), which is a humanized monoclonal antibody.
- CT-011 Pidilizumab
- CT-011 a humanized monoclonal antibody.
- Pidilizumab is described in U.S. Pat. No. 8,686,119 B2 or WO 2013/014668 A1.
- Anti-PD-1 antibodies usable in the disclosed methods also include isolated antibodies that bind specifically to human PD-1 and cross-compete for binding to human PD-1 with nivolumab (see, e.g., U.S. Pat. No. 8,008,449; WO 2013/173223).
- the ability of antibodies to cross-compete for binding to an antigen indicates that these antibodies bind to the same epitope region of the antigen and sterically hinder the binding of other cross-competing antibodies to that particular epitope region.
- These cross-competing antibodies are expected to have functional properties very similar to those of nivolumab by virtue of their binding to the same epitope region of PD-1.
- Cross-competing antibodies can be readily identified based on their ability to cross-compete with nivolumab in standard PD-1 binding assays such as Biacore analysis, ELISA assays or flow cytometry (see, e.g., WO 2013/173223).
- the antibodies that cross-compete for binding to human PD-1 with, or bind to the same epitope region of human PD-1 as, nivolumab are monoclonal antibodies.
- these cross-competing antibodies can be chimeric antibodies, or can be humanized or human antibodies.
- Anti-PD-1 antibodies usable in the methods of the disclosed invention also include antigen-binding portions of the above antibodies.
- examples include (i) a Fab fragment, a monovalent fragment consisting of the V L , V H , C L and C H1 domains; (ii) a F(ab′)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the V H and C H1 domains; and (iv) a Fv fragment consisting of the V L and V H domains of a single arm of an antibody.
- CD80 ECDs or CD80 ECD Fusion Proteins in Combination with Immune Stimulating Agents or PD-1/PD-L1 Inhibitors
- the CD80 ECD or CD80 ECD fusion molecule and the immune stimulating agent or PD-1/PD-L1 inhibitor are administered concurrently. In some embodiments, the CD80 ECD or CD80 ECD fusion molecule and the immune stimulating agent or PD-1/PD-L1 inhibitor are administered sequentially. In some embodiments, at least one, at least two, at least three doses, at least five doses, or at least ten doses of a CD80 ECD or CD80 fusion molecule is administered prior to administration of an immune stimulating agent or PD-1/PD-L1 inhibitor.
- At least one, at least two, at least three doses, at least five doses, or at least ten doses of an immune stimulating agent or PD-1/PD-L1 inhibitor is administered prior to administration of a CD80 ECD or CD80 fusion molecule.
- the last dose of immune stimulating agent or PD-1/PD-L1 inhibitor is administered at least one, two, three, five, days or ten, or one, two, three, five, twelve, or twenty four weeks prior to the first dose of CD80 ECD or CD80 fusion molecule.
- the last dose of CD80 ECD or CD80 fusion molecule is administered at least one, two, three, five, days or ten, or one, two, three, five, twelve, or twenty four weeks prior to the first dose of immune stimulating agent or PD-1/PD-L1 inhibitor.
- a subject has received, or is receiving, immune stimulating agent or PD-1/PD-L1 inhibitor therapy, and a CD80 ECD or CD80 fusion molecule is added to the therapeutic regimen.
- the subject is an immune stimulating agent or PD-1/PD-L1 inhibitor inadequate responder (i.e. shows resistance to one or more immune stimulating agents or PD-1/PD-L1 inhibitors).
- a subject who is a PD-1/PD-L1 inhibitor inadequate responder may have previously responded to a PD-1/PD-L1 inhibitor, but may have become less responsive to the PD-1/PD-L1 inhibitor, or the subject may have never responded to the PD-1/PD-L1 inhibitor.
- Inadequate response to an immune stimulating agent or PD-1/PD-L1 inhibitor means that aspects of the condition that would be expected to improve following a standard dose of the PD-1/PD-L1 inhibitor do not improve, and/or improvement only occurs if greater than a standard dose is administered.
- an immune stimulating agent or PD-1/PD-L1 inhibitor inadequate responder has experienced, or is experiencing, an inadequate response to the drug after receiving a standard dose for at least two weeks, at least three weeks, at least four weeks, at least six weeks, or at least twelve weeks.
- a “standard” dose of an immune stimulating agent or PD-1/PD-L1 inhibitor may be determined by a medical professional, and may depend on the subject's age, weight, healthy history, severity of disease, the frequency of dosing, etc.
- an immune stimulating agent or PD-1/PD-L1 inhibitor inadequate responder has experienced, or is experiencing, an inadequate response to an anti-PD-1 antibody and/or an anti-PD-L1 antibody.
- a PD-1/PD-L1 inhibitor inadequate responder has experienced, or is experiencing, an inadequate response to AMP-224.
- a PD-1/PD-L1 inhibitor inadequate responder has experienced, or is experiencing, an inadequate response to a PD-1/PD-L1 inhibitor selected from nivolumab, pidilizumab, and pembrolizumab.
- the combination of the CD80 ECD or CD80 ECD fusion molecule with the PD-1/PD-L1 inhibitor that is administered to the subject may inhibit tumor growth in a mouse syngeneic or xenograft cancer model over a period of 1 week, 10 days, or 2 weeks, for example, by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98%.
- the combination of the CD80 ECD or CD80 ECD fusion molecule with the PD-1/PD-L1 inhibitor that is administered to the subject may reduce the volume of at least one tumor in the subject or in an animal model subject by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98%, for example, over a period of one month, two months, three months, six months, or one year.
- the CD80 ECD or CD80 ECD fusion molecule may be a CD80 ECD Fc comprising 10-60 mol SA to mol of CD80 ECD Fc protein, such as 15-60 mol SA/mol protein.
- the content is 10-40 mol SA/mol protein, such as 15-40 mol SA/mol protein, such as 20-40 mol SA/mol protein, 20-30 mol SA/mol protein, 15-25 mol SA/mol protein, 15-30 mol SA to mol of protein, or 30-40 mol SA/mol protein.
- the SA content is at least 15, such as at least 20, at least 25, at least 30, at least 35, or at least 40 mol SA/mol protein.
- the SA content is 15, 20, 25, 30, 35, or 40 mol SA/mol protein.
- the Fc domain is a human IgG1, IgG2, or IgG4 Fc domain.
- the Fc domain comprises the amino acid sequence of SEQ ID NO:14.
- the fusion molecule comprises the amino acid sequence of SEQ ID NO:20 or 21.
- polypeptides and fusion molecules may be administered in vivo by various routes, including, but not limited to, oral, intra-arterial, parenteral, intranasal, intravenous, intramuscular, intracardiac, intraventricular, intratracheal, buccal, rectal, intraperitoneal, intradermal, topical, transdermal, and intrathecal, or otherwise by implantation or inhalation.
- the subject compositions may be formulated into preparations in solid, semi-solid, liquid, or gaseous forms; including, but not limited to, tablets, capsules, powders, granules, ointments, solutions, suppositories, enemas, injections, inhalants, and aerosols.
- a nucleic acid molecule encoding a polypeptide may be coated onto gold microparticles and delivered intradermally by a particle bombardment device, or “gene gun,” as described in the literature (see, e.g., Tang et al., Nature 356:152-154 (1992)).
- a particle bombardment device or “gene gun”
- the appropriate formulation and route of administration may be selected according to the intended application.
- polypeptide-comprising compositions are provided in formulations with a wide variety of pharmaceutically acceptable carriers (see, e.g., Gennaro, Remington: The Science and Practice of Pharmacy with Facts and Comparisons: Drugfacts Plus, 20 th ed. (2003); Ansel et al., Pharmaceutical Dosage Forms and Drug Delivery Systems, 7 th ed., Lippencott Williams and Wilkins (2004); Kibbe et al., Handbook of Pharmaceutical Excipients, 3 rd ed., Pharmaceutical Press (2000)).
- Various pharmaceutically acceptable carriers which include vehicles, adjuvants, and diluents, are available.
- Non-limiting exemplary carriers include saline, buffered saline, dextrose, water, glycerol, ethanol, and combinations thereof.
- compositions comprising polypeptides and fusion molecules may be formulated for injection, including subcutaneous administration, by dissolving, suspending, or emulsifying them in an aqueous or nonaqueous solvent, such as vegetable or other oils, synthetic aliphatic acid glycerides, esters of higher aliphatic acids, or propylene glycol; and if desired, with conventional additives such as solubilizers, isotonic agents, suspending agents, emulsifying agents, stabilizers and preservatives.
- the compositions may be formulated for inhalation, for example, using pressurized acceptable propellants such as dichlorodifluoromethane, propane, nitrogen, and the like.
- compositions may also be formulated, in various embodiments, into sustained release microcapsules, such as with biodegradable or non-biodegradable polymers.
- a non-limiting exemplary biodegradable formulation includes poly lactic acid-glycolic acid polymer.
- a non-limiting exemplary non-biodegradable formulation includes a polyglycerin fatty acid ester. Certain methods of making such formulations are described, for example, in EP 1 125 584 A1.
- compositions comprising a polypeptide or combination of polypeptides, with or without one or more additional agents.
- a unit dosage is supplied in a single-use prefilled syringe for injection.
- the composition contained in the unit dosage may comprise saline, sucrose, or the like; a buffer, such as phosphate, or the like; and/or be formulated within a stable and effective pH range.
- the composition may be provided as a lyophilized powder that may be reconstituted upon addition of an appropriate liquid, for example, sterile water.
- the composition comprises one or more substances that inhibit protein aggregation, including, but not limited to, sucrose and arginine.
- a composition of the invention comprises heparin and/or a proteoglycan.
- compositions are administered in an amount effective for treatment or prophylaxis of the specific indication.
- the therapeutically effective amount is typically dependent on the weight of the subject being treated, his or her physical or health condition, the extensiveness of the condition to be treated, or the age of the subject being treated.
- a PD-1/PD-L1 inhibitor such as an antibody or fusion protein, is administered with the CD80 ECD or CD80 ECD fusion molecule at a dose of 1 to 4 mg/kg.
- a PD-1/PD-L1 inhibitor is administered at a dose of 1, 2, 3, or 4 mg/kg.
- an effective dose of a CD80 ECD or CD80 ECD fusion molecule is administered to a subject one or more times.
- an effective dose is administered to the subject once a month, less than once a month, such as, for example, every two months or every three months.
- an effective dose is administered more than once a month, such as, for example, every three weeks, every two weeks or every week.
- an effective dose is administered once per 1, 2, 3, 4, or 5 weeks.
- an effective dose is administered twice or three times per week.
- An effective dose is administered to the subject at least once.
- the effective dose may be administered multiple times, including for periods of at least a month, at least six months, or at least a year.
- CD80 ECDs or CD80 ECD fusion molecules may be administered alone, with PD-1/PD-L1 inhibitors, and/or with other modes of treatment.
- CD80 ECDs or CD80 ECD fusion molecules may be provided before, substantially contemporaneous with, or after other modes of treatment, for example, surgery, chemotherapy, radiation therapy, or the administration of another biologic.
- the cancer has recurred or progressed following a therapy selected from surgery, chemotherapy, and radiation therapy, or a combination thereof.
- CD80 ECDs or CD80 ECD fusion molecules may be administered in conjunction with one or more additional anti-cancer agents, such as the chemotherapeutic agent, growth inhibitory agent, anti-angiogenesis agent and/or anti-neoplastic composition.
- additional anti-cancer agents such as the chemotherapeutic agent, growth inhibitory agent, anti-angiogenesis agent and/or anti-neoplastic composition.
- chemotherapeutic agent, growth inhibitory agent, anti-angiogenesis agent, anti-cancer agent and anti-neoplastic composition that can be used in combination with the antibodies of the present invention are provided in the following definitions.
- the therapy administered to the subject may inhibit tumor growth in a mouse syngeneic or xenograft cancer model over a period of 1 week, 10 days, or 2 weeks, for example, by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%.
- the therapy administered to the subject may reduce the volume of at least one tumor in the subject or in an animal model subject by at least 1 0% , at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98%, for example, over a period of one month, two months, three months, six months, or one year.
- the CD80 ECD or CD80 ECD fusion molecule may be a CD80 ECD Fc comprising 10-60 mol SA to mol of CD80 ECD Fc protein, such as 15-60 mol SA/mol protein.
- the content is 10-40 mol SA/mol protein, such as 15-40 mol SA/mol protein, such as 20-40 mol SA/mol protein, 20-30 mol SA/mol protein, 15-25 mol SA/mol protein, 15-30 mol SA to mol of protein, or 30-40 mol SA/mol protein.
- the SA content is at least 15, such as at least 20, at least 25, at least 30, at least 35, or at least 40 mol SA/mol protein.
- the SA content is 15, 20, 25, 30, 35, or 40 mol SA/mol protein.
- the Fc domain is a human IgG1, IgG2, or IgG4 Fc domain.
- the Fc domain comprises the amino acid sequence of SEQ ID NO:14.
- the fusion molecule comprises the amino acid sequence of SEQ ID NO:20 or 21.
- chemotherapeutic agent is a chemical compound useful in the treatment of cancer.
- examples of chemotherapeutic agents include, but are not limited to, alkylating agents such as thiotepa and Cytoxan® cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphoramide and trimethylolomelamine; acetogenins (especially bullatacin and bullatacinone); a camptothecin (including the synthetic analogue topotecan); bryostatin; callystatin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic ana
- dynemicin including dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antiobiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, Adriamycin® doxorubicin (including morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin and deoxydoxorubicin), epirubicin, es
- chemotherapeutic agents include anti-hormonal agents that act to regulate or inhibit hormone action on cancers such as anti-estrogens and selective estrogen receptor modulators (SERMs), including, for example, tamoxifen (including Nolvadex® tamoxifen), raloxifene, droloxifene, 4-hydroxytamoxifen, trioxifene, keoxifene, LY117018, onapristone, and Fareston® toremifene; aromatase inhibitors that inhibit the enzyme aromatase, which regulates estrogen production in the adrenal glands, such as, for example, 4(5)-imidazoles, aminoglutethimide, Megase® megestrol acetate, Aromasin® exemestane, formestanie, fadrozole, Rivisor® vorozole, Femara® letrozole, and Arimidex® anastrozole; and anti-androgens such as flutamide,
- an “anti-angiogenesis agent” or “angiogenesis inhibitor” refers to a small molecular weight substance, a polynucleotide (including, e.g., an inhibitory RNA (RNAi or siRNA)), a polypeptide, an isolated protein, a recombinant protein, an antibody, or conjugates or fusion proteins thereof, that inhibits angiogenesis, vasculogenesis, or undesirable vascular permeability, either directly or indirectly.
- RNAi or siRNA inhibitory RNA
- the anti-angiogenesis agent includes those agents that bind and block the angiogenic activity of the angiogenic factor or its receptor.
- an anti-angiogenesis agent is an antibody or other antagonist to an angiogenic agent, e.g., antibodies to VEGF-A (e.g., bevacizumab (Avastin®)) or to the VEGF-A receptor (e.g., KDR receptor or Flt-1 receptor), anti-PDGFR inhibitors such as Gleevec® (Imatinib Mesylate), small molecules that block VEGF receptor signaling (e.g., PTK787/ZK2284, SU6668, Sutent®/SU11248 (sunitinib malate), AMG706, or those described in, e.g., international patent application WO 2004/113304).
- an angiogenic agent e.g., antibodies to VEGF-A (e.g., bevacizumab (Avastin®)) or to the VEGF-A receptor (e.g., KDR receptor or Flt-1 receptor), anti-PDGFR inhibitors such as Gleeve
- Anti-angiogensis agents also include native angiogenesis inhibitors, e.g., angiostatin, endostatin, etc. See, e.g., Klagsbrun and D'Amore (1991) Annu. Rev. Physiol. 53:217-39; Streit and Detmar (2003) Oncogene 22:3172-3179 (e.g., Table 3 listing anti-angiogenic therapy in malignant melanoma); Ferrara & Alitalo (1999) Nature Medicine 5(12):1359-1364; Tonini et al. (2003) Oncogene 22:6549-6556 (e.g., Table 2 listing known anti-angiogenic factors); and, Sato (2003) Int. J. Clin. Oncol. 8:200-206 (e.g., Table 1 listing anti-angiogenic agents used in clinical trials).
- native angiogenesis inhibitors e.g., angiostatin, endostatin, etc. See, e.g., Klagsbru
- a “growth inhibitory agent” as used herein refers to a compound or composition that inhibits growth of a cell (such as a cell expressing VEGF) either in vitro or in vivo.
- the growth inhibitory agent may be one that significantly reduces the percentage of cells (such as a cell expressing VEGF) in S phase.
- growth inhibitory agents include, but are not limited to, agents that block cell cycle progression (at a place other than S phase), such as agents that induce G1 arrest and M-phase arrest.
- Classical M-phase blockers include the vincas (vincristine and vinblastine), taxanes, and topoisomerase II inhibitors such as doxorubicin, epirubicin, daunorubicin, etoposide, and bleomycin.
- Those agents that arrest G1 also spill over into S-phase arrest, for example, DNA alkylating agents such as tamoxifen, prednisone, dacarbazine, mechlorethamine, cisplatin, methotrexate, 5-fluorouracil, and ara-C.
- Taxanes are anticancer drugs both derived from the yew tree.
- Docetaxel (Taxotere®, Rhone-Poulenc Rorer), derived from the European yew, is a semisynthetic analogue of paclitaxel (Taxol®, Bristol-Myers Squibb). Paclitaxel and docetaxel promote the assembly of microtubules from tubulin dimers and stabilize microtubules by preventing depolymerization, which results in the inhibition of mitosis in cells.
- anti-neoplastic composition refers to a composition useful in treating cancer comprising at least one active therapeutic agent.
- therapeutic agents include, but are not limited to, e.g., chemotherapeutic agents, growth inhibitory agents, cytotoxic agents, agents used in radiation therapy, anti-angiogenesis agents, other cancer immunotherapeutic agents aside from PD-1/PD-L1 inhibitors, apoptotic agents, anti-tubulin agents, and other-agents to treat cancer, such as anti-HER-2 antibodies, anti-CD20 antibodies, an epidermal growth factor receptor (EGFR) antagonist (e.g., a tyrosine kinase inhibitor), HER1/EGFR inhibitor (e.g., erlotinib (Tarceva®), platelet derived growth factor inhibitors (e.g., Gleevec® (Imatinib Mesylate)), a COX-2 inhibitor (e.g., celecoxib), interferons, CTLA-4 inhibitors (e.g.,
- Example 1 A CD80 ECD Fc Fusion Molecule Reduces Tumor Growth in Mice Implanted with Murine Colorectal Carcinoma Cell Line CT26
- mice Seven-week old female BALB/c mice were purchased from Charles River Laboratories (Hollister, Calif.) and were acclimated for two weeks before the start of the study.
- the murine colorectal carcinoma cell line CT26 was implanted subcutaneously over the right flank of the mice at 1.0 ⁇ 10 6 cells/200 ⁇ l/mouse. Prior to inoculation, the cells were cultured for no more than three passages in RPMI 1640 medium supplemented with 10% heat-inactivated Fetal Bovine Serum (FBS), 2 mM L-Glutamine. Cells were grown at 37° C. in a humidified atmosphere with 5% CO 2 . Upon reaching 80-85% confluence, cells were harvested and resuspended in a 1:1 mixture of serum-free RPMI 1640 and Matrigel® at 5 ⁇ 10 6 cells per milliliter.
- FBS heat-inactivated Fetal Bovine Serum
- mice were monitored twice-weekly following cell implantation for tumor growth.
- Tumor volume (mm 3 ) (width (mm) ⁇ length (mm)) 2/2.
- RIPPSSM Plasmid DNA that was administered via RIPPSSM contained the sequence for the extracellular domain (ECD) of murine CD80 or CTLA4 as well as the Fc domain of human IgG2a.
- Tumors continued to be measured at least twice per week until tumor volume exceeded 10% of animal weight, or approximately 2000 mm 3 .
- FIG. 1 a . RIPPS with mouse CD80 ECD significantly reduced tumor growth compared to Saline control (p ⁇ 0.05) beginning on Day 11.
- FIG. 1 a - b . P-values were calculated using unpaired, two-tailed t-test analyses of the calculated tumor volumes on each day of the study (*p ⁇ 0.05, **p ⁇ 0.01, ***p ⁇ 0.001).
- Tumor growth inhibition by CD80 ECD was determined to be 78.8% compared to saline control, which was calculated as 100 ⁇ (1-(mean change in tumor volume for CD80/mean change in tumor volume for saline)).
- FIG. 1 a . RIPPS with mouse CD80 ECD significantly reduced tumor growth compared to Saline control (p ⁇ 0.05) beginning on Day 11.
- FIG. 1 a - b . P-values were calculated using unpaired, two-tailed t-test analyses of the calculated tumor volumes on each day of the study (*p ⁇ 0.05, **p ⁇ 0.01, ***p ⁇ 0.001).
- RIPPS with mouse CTLA4-ECD Fc actually enhanced tumor growth compared to the saline control.
- CTLA4-ECD Fc construct might have acted as a ligand trap for CD80, preventing CD80 from binding to CD28 and stimulating T cell activity against tumor cells.
- Example 2 A CD80 ECD Fc Fusion Molecule in Combination with an Anti-PD-1 Antibody Reduces Tumor Growth in Mice Implanted with Murine Colorectal Carcinoma Cell Line CT26
- mice Seven-week old female BALB/c mice were purchased from Charles River Laboratories (Hollister, Calif.) and were acclimated for 12 days before the start of the study.
- the murine colorectal carcinoma cell line CT26 was implanted subcutaneously over the right flank of the mice at 1.0 ⁇ 10 6 cells/200 ⁇ l/mouse. Prior to inoculation, the cells were cultured for no more than three passages in RPMI 1640 medium supplemented with 10% heat-inactivated Fetal Bovine Serum (FBS), 2 mM L-Glutamine. Cells were grown at 37° C. in a humidified atmosphere with 5% CO 2 . Upon reaching 80-85% confluence, cells were harvested and resuspended in a 1:1 mixture of serum-free RPMI 1640 and Matrigel® at 5 ⁇ 10 6 cells per milliliter.
- FBS heat-inactivated Fetal Bovine Serum
- Dosing groups were as follows: 1) Fc RIPPSSM plus Rat IgG2a, 2) CD80 RIPPSSM plus Rat IgG2a, 3) Fc RIPPSSM plus anti-PD1, or 4) CD80 RIPPSSM plus anti-PD1. Tumors continued to be measured at least twice per week until tumor volume exceeded 10% of animal weight, or approximately 2000 mm 3 .
- FIG. 2 a RIPPSSM with mouse CD80 ECD or administration of anti-PD1 reduced tumor growth compared to control.
- FIG. 2 a - b The combination of CD80 RIPPSSM and anti-PD1 resulted in significantly reduced tumor growth compared to either CD80 (p ⁇ 0.01 beginning after Day 9) or anti-PD-1 (p ⁇ 0.01 on Day 14) alone (p ⁇ 0.05) beginning nine days after treatment initiation. P-values were calculated using unpaired, two-tailed t-test analyses of the calculated tumor volumes on each day of measurement.
- TGI Tumor growth inhibition
- mice Seven-week old female BALB/c mice were purchased from Charles River Laboratories (Hollister, Calif.) and were acclimated for two weeks before the start of the study.
- the murine colorectal carcinoma cell line CT26 was implanted subcutaneously over the right flank of the mice at 1.0 ⁇ 10 6 cells/200 ⁇ l/mouse. Prior to inoculation, the cells were cultured for no more than three passages in RPMI 1640 medium supplemented with 10% heat-inactivated Fetal Bovine Serum (FBS), 2 mM L-Glutamine. Cells were grown at 37° C. in a humidified atmosphere with 5% CO 2 . Upon reaching 80-85% confluence, cells were harvested and resuspended in a 1:1 mixture of serum-free RPMI 1640 and Matrigel® at 5 ⁇ 10 6 cells per milliliter.
- FBS heat-inactivated Fetal Bovine Serum
- ECD extracellular domain
- Two clones were administered via RIPPSSM, one with the wild type human IgG1 Fc (CD80-IgG1 WT) and the other with this Fc bearing three mutated amino acids (L234F/L235E/P331S) in order to alter the interaction of Fc with Fc gamma receptors (CD80-IgG1 MT).
- Tumors continued to be measured at least twice per week until tumor volume exceeded 10% of animal weight, or approximately 2000 mm 3 .
- the change in tumor size is shown by graphing mean tumor volume relative to the day upon which animals were inoculated with CT26 cells.
- FIG. 3 a - b . RIPPSSM with CD80-IgG1 WT significantly reduced tumor growth compared to Saline control (p ⁇ 0.05) beginning on Day 14.
- CD80-IgG MT significantly reduced tumor growth compared to CD80-IgG1 WT (p ⁇ 0.01) beginning on Day 14.
- P-values were calculated using unpaired, two-tailed t-test analyses of the calculated tumor volumes on each day of the study (* p ⁇ 0.0 5 , ** p ⁇ 0.01).
- TGI Tumor growth inhibition
- mice Seven-week old female BALB/c mice were purchased from Charles River Laboratories (Hollister, Calif.) and were acclimated for two weeks before the start of the study.
- the murine colorectal carcinoma cell line CT26 was implanted subcutaneously over the right flank of the mice at 1.0 ⁇ 10 6 cells/200 ⁇ l/mouse. Prior to inoculation, the cells were cultured for no more than three passages in RPMI 1640 medium supplemented with 10% heat-inactivated Fetal Bovine Serum (FBS), 2 mM L-Glutamine. Cells were grown at 37° C. in a humidified atmosphere with 5% CO 2 . Upon reaching 80-85% confluence, cells were harvested and resuspended in a 1:1 mixture of serum-free RPMI 1640 and Matrigel® at 5 ⁇ 10 6 cells/mL.
- FBS heat-inactivated Fetal Bovine Serum
- mice were monitored twice-weekly following cell implantation for tumor growth.
- Tumor volume (mm 3 ) (width (mm) ⁇ length (mm)) 2/2.
- the mean tumor volume for all animals enrolled into treatment groups was 72 mm 3 .
- mice were administered saline, a murine extracellular domain (ECD) of CD80 with a wild type human IgG1 Fc (CD80-IgG1 WT), or a murine ECD of CD80 with a mutated human IgG1 Fc (CD80-IgG1 MT, mutated L234F/L235E/P331S) in order to alter the interaction with Fc gamma receptors. Tumors were measured on Days 5 and 11.
- mice were euthanized with CO 2 and perfused with phosphate-buffered saline (PBS), pH 7.4. Briefly, the mouse chest was opened rapidly, and a syringe with 20-gauge needle was used to infuse 40 mL of PBS into the aorta via an incision in the left ventricle. Blood and PBS exited through an opening in the right atrium. The tumors were removed and immersed in 10% neutral buffered formalin at 4° C. After 2 hours the tissues were rinsed 3 times in PBS and then transferred in 30% sucrose in PBS overnight. The next day the tumors were frozen in OCT compound and stored at ⁇ 80 C.
- PBS phosphate-buffered saline
- Cryostat sections were cut at 20- m in thickness. Sections were dried on Superfrost® Plus slides for 1 to 2 hours. Specimens were permeabilized with PBS containing 0.3% Triton® X-100 and incubated in 5% goat normal serum in PBS 0.3% Triton® X-100 (blocking solution) for 1 hour at room temperature to block nonspecific antibodies binding. To detect T-cells, sections were incubated with rat-anti-CD4 (GK1.5/eBiosciences) and rabbit anti-CD3 antibody (SP7/Thermo Scientific) both diluted 1:500 in blocking solution overnight. Control specimens were incubated in 5% normal serum instead of primary antibody for the same period.
- Specimens were examined with a Zeiss Axiophot® 2 plus fluorescence microscope equipped with AxioCam® HRc camera. Representative images for each experimental group showing the amount and distribution of the CD3 + and CD4 + cells within the tumor were collected and are shown in FIGS. 4 a and 4 b.
- CD80-IgG1 WT or CD80-IgG1 MT increased the number of intratumoral CD3 + and CD4+ cells compared to saline ( FIGS. 4 a and 4 b ). While the amount of CD4+ cells was similar between the CD80-IgG1 WT or CD80-IgG1 MT treated tumors, treatment with CD80-IgG1 MT led to a greater increase of tumor infiltrating CD3 + T cells compared to CD80-IgG1 WT ( FIG. 4 b ). The ratio of CD3+ to CD4+ cells was increased with the CD80-IgG1 MT compared to the CD80-IgG1 WT.
- CD80-Fc human CD80 ECD IgG1 Fc fusion molecule
- T-cell proliferation media containing RPMI 1640, 100 IU Penicillin/100 ug/ml Streptomycin, 2 mM L-Glutamine, 100 nM non-essential amino acids, 55 uM 2-mercaptoethanol and 10% ultra low-IgG fetal bovine serum.
- Binding reactions were carried out in 96 well flat-bottom tissue culture plates at a volume of 100 ul per well with a bead concentration of 3 million beads per ml.
- CD80-Fc was bound to the beads across a series of concentrations: 10, 1, 0.1 ug/ml.
- Human PBMCs were isolated from apheresis-enriched blood (buffy coats) collected from healthy donors ⁇ 18 hrs prior to isolation using Ficoll® (Biochrom) gradient density centrifugation.
- Pan T-cells were then isolated from PBMCs using a Human Pan T-cell isolation kit (Miltenyi). T-cells were seeded at a density of 1 million cells/ml in T225 tissue culture flasks in proliferation media (above) supplemented with 8 ng/ml IL-2 and Human T-cell Activator Dynabeads® (Life Tech) 1 bead/cell.
- cells were fed with fresh IL-2 and continually kept at a concentration of 0.3 million cells/ml by the addition of fresh proliferation media every 2 days.
- Cells were kept in a 37° C. water-jacketed incubator maintained at 5% CO 2 .
- the activator-beads were removed using a magnetic tube stand and the cells were resuspended at a concentration of 1 million cells/ml in fresh proliferation media without IL-2. 24 hours later the cells were put into assay with Protein-A bead immobilized proteins.
- Soluble Interferon Gamma (IFN- ⁇ ) and Tumor Necrosis Factor Alpha (TNF- ⁇ ) levels were measured in the supernatants using HTRF-ELISA kits (Cisbio) 24 hours after the cells had been treated with the Protein-A bead immobilized proteins according to the manufacturer's instructions.
- mice Seven week old female BALB/c mice were purchased from Charles River Laboratories (Hollister, Calif.) and were acclimated for one week before the study was initiated.
- the murine colorectal carcinoma cell line CT26 was implanted subcutaneously over the right flank of the mice at 1.0 ⁇ 10 6 cells/200 ⁇ l/mouse. Prior to inoculation, the cells were cultured for no more than three passages in RPMI 1640 medium supplemented with 10% heat-inactivated Fetal Bovine Serum (FBS), 2 mM L-Glutamine. Cells were grown at 37° C. in a humidified atmosphere with 5% CO 2 . Upon reaching 80-85% confluence, cells were harvested and resuspended in a 1:1 mixture of serum-free RPMI 1640 and Matrigel® at 5 ⁇ 10 6 cells per milliliter.
- FBS heat-inactivated Fetal Bovine Serum
- mice were monitored for tumor growth twice weekly following cell implantation.
- tumor volume (mm 3 ) (width (mm) ⁇ length (mm)) 2/2.
- the mean tumor volume for all animals enrolled was 94 mm 3 .
- the first group was injected with 200 ⁇ l of PBS (control) intravenously (i.v.) into the tail vein.
- the second group was injected with CD80 ECD Fc at 20 mol SA/mol protein (lot E) i.v. dosed at 0.3 mg/kg.
- the third group was injected with CD80 ECD Fc at 20 mol SA/mol protein (lot E) i.v. dosed at 0.6 mg/kg.
- the fourth group was injected with CD80 ECD Fc at 15 mol SA/mol protein (lot D) i.v. dosed at 0.3 mg/kg.
- the fifth group was injected with CD80 ECD Fc at 15 mol SA/mol protein (lot D) i.v. dosed at 0.6 mg/kg.
- the sixth group was injected with CD80 ECD Fc at 5 mol SA/mol protein (lot A) i.v. dosed at 0.3 mg/kg.
- the seventh group was injected with CD80 ECD Fc at 5 mol SA/mol protein (lot A) i.v. dosed at 0.6 mg/kg. Tumors were measured on day 10, 14, 16, 18, 22, 24.
- mice Seven week old female BALB/c mice were purchased from Charles River Laboratories (Hollister, Calif.) and were acclimated for one week before the study was initiated.
- the murine colorectal carcinoma cell line CT26 was implanted subcutaneously over the right flank of the mice at 1.0 ⁇ 10 6 cells/200 ⁇ l/mouse. Prior to inoculation, the cells were cultured for no more than three passages in RPMI 1640 medium supplemented with 10% heat-inactivated Fetal Bovine Serum (FBS), 2 mM L-Glutamine. Cells were grown at 37° C. in a humidified atmosphere with 5% CO 2 . Upon reaching 80-85% confluence, cells were harvested and resuspended in a 1:1 mixture of serum-free RPMI 1640 and matrigel.
- FBS heat-inactivated Fetal Bovine Serum
- mice were monitored twice weekly following cell implantation for tumor growth.
- tumor volume (mm 3 ) (width (mm) ⁇ length (mm)) 2/2.
- the mean tumor volume for all animals enrolled was 96 mm 3 .
- Mice were dosed 3 times, on day 4, 7 and 11.
- the first group was injected with mouse IgG2b (mIgG2b) i.p. dosed at 10 mg/kg (control).
- the second group was injected with murine CD80 ECD-Fc 20 mol/mol SA i.v.
- the third group was injected with anti-CTLA4 antibody clone 9D9 (IgG2b) i.p. dosed at 1.5 mg/kg.
- the fourth group was injected with anti-CTLA4 antibody clone 9D9 (IgG2b) i.p. dosed at 10 mg/kg. Tumors were measured on day 10, 13, 17, 19, 21, 24.
- treatment with murine CD80 ECD-Fc at 20 mol/mol SA dosed at 0.3 mg/kg resulted in 90% inhibition of tumor growth compared to the control (P ⁇ 0.001).
- treatment with anti-CTLA4 antibody at 10 mg/kg resulted in 75% inhibition of tumor growth compared to the control (P ⁇ 0.001).
- treatment with anti-CTLA4 antibody at 1.5 mg/kg only induced 53% inhibition of tumor growth (P ⁇ 0.001) ( FIG. 7 ).
- mice The incidence of tumor-free mice was analyzed at day 37.
- mice Seven week old female C57Bl/6 mice were purchased from Charles River Laboratories (Hollister, Calif.) and were acclimated for one week before the study was initiated.
- the murine colorectal carcinoma cell line MC38 was implanted subcutaneously over the right flank of the mice at 0.5 ⁇ 10 6 cells/100 ⁇ l/mouse. Prior to inoculation, the cells were cultured for no more than three passages in RPMI 1640 medium supplemented with 10% heat-inactivated Fetal Bovine Serum (FBS), 2 mM L-Glutamine. Cells were grown at 37° C. in a humidified atmosphere with 5% CO 2 . Upon reaching 80-85% confluence, cells were harvested and resuspended in a 1:1 mixture of serum-free RPMI 1640 and matrigel.
- FBS heat-inactivated Fetal Bovine Serum
- mice were monitored twice weekly following cell implantation for tumor growth.
- tumor volume (mm 3 ) (width (mm) ⁇ length (mm)) 2/2.
- the mean tumor volume for all animals enrolled was 78 mm 3 .
- Mice were dosed 3 times, on day 7, 10 and 14.
- the first group was injected with mouse IgG2b (mIgG2b) i.p. dosed at 10 mg/kg (control).
- the second group was injected with murine CD80 ECD-Fc 20 mol/mol SA i.v. dosed at 3 mg/kg.
- the third group was injected with anti-CTLA4 antibody clone 9D9 (IgG2b) i.p. dosed at 1.5 mg/kg.
- the fourth group was injected with anti-CTLA4 antibody clone 9D9 (IgG2b) i.p. dosed at 10 mg/kg. Tumors were measured on day 11, 14, 17, and 19.
- CD80 ECD-Fc While a 3 mg/kg dose of CD80 ECD-Fc was used for these experiments, a 0.3 mg/kg dose of CD80 ECD-Fc also reduced tumor cell growth in the MC38 tumor model (data not shown).
- mice Seven week old female C57Bl/6 mice were purchased from Charles River Laboratories (Hollister, Calif.) and were acclimated for one week before the study was initiated.
- the murine melanoma cell line B16-F10 was implanted subcutaneously over the right flank of the mice at 0.5 ⁇ 10 6 cells/100 ⁇ l/mouse. Prior to inoculation, the cells were cultured for no more than three passages in DMEM medium supplemented with 10% heat-inactivated Fetal Bovine Serum (FBS), 2 mM L-Glutamine. Cells were grown at 37° C. in a humidified atmosphere with 5% CO 2 . Upon reaching 80-85% confluence, cells were harvested and resuspended in a 1:1 mixture of serum-free DMEM and matrigel.
- FBS heat-inactivated Fetal Bovine Serum
- mice were monitored twice weekly following cell implantation for tumor growth.
- tumor volume (mm 3 ) (width (mm) ⁇ length (mm)) 2/2.
- the mean tumor volume for all animals enrolled was 70 mm 3 .
- Mice were dosed 3 times, on day 3, 6 and 10.
- the first group was injected with mouse IgG2b (mIgG2b) dosed i.p. at 10 mg/kg (control).
- the second group was injected with murine CD80 ECD-Fc 20 mol/mol SA i.v. dosed at 3 mg/kg.
- the third group was injected with anti-CTLA4 antibody clone 9D9 (IgG2b) i.p. dosed at 1.5 mg/kg.
- the fourth group was injected with anti-CTLA4 antibody clone 9D9 (IgG2b) i.p. dosed at 10 mg/kg. Tumors were measured on day 10, 13, 15, 16, 17.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Gastroenterology & Hepatology (AREA)
- Cell Biology (AREA)
- Zoology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Toxicology (AREA)
- Biomedical Technology (AREA)
- Oncology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicinal Preparation (AREA)
Abstract
Description
- This application claims priority to U.S. patent application Ser. No. 15/340,238, filed Nov. 1, 2016 and to US Provisional Patent Application Nos. 62/373,654, filed Aug. 11, 2016, and 62/249,836, filed Nov. 2, 2015, all of which are incorporated herein by reference in their entirety.
- The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Mar. 7, 2019, is named 3986_0010003_SL_ST25.txt and is 60,690 bytes in size.
- This application relates to CD80 (B7-1) extracellular domain (ECD) polypeptides and CD80-ECD fusion molecules and their use in treatment of cancer, both alone and in combination with other therapeutic agents, such as immune stimulating agents such as PD-1/PD-L1 inhibitors.
- CD80, also known as B7-1, is one of the B7 family of membrane-bound proteins involved in immune regulation by delivering costimulatory or coinhibitory responses through their ligand binding activities. Other members of the B7 family of proteins include CD86 (B7-2), inducible costimulator ligand (ICOS-L), programmed death-1 ligand (PD-L1; B7-H1), programmed death-2 ligand (PD-L2; B7-H2), B7-H3, and B7-H4. CD80 is a transmembrane protein expressed on the surface of T cells, B cells, dendritic cells and monocytes, and binds to the receptors CD28, CTLA4 (CD152), and PD-L1. CD80 and CD86 and their receptors CTLA4 and CD28 operate as a costimulatory-coinhibitory system, for example, to control T cell activation, expansion, differentiation, and survival. CD80 and CD86 interaction with CD28 results in costimulatory signals that lead, for example, to activation of T cell responses. CD80, in turn, stimulates upregulation of CTLA4, which, upon binding to CD80, acts to suppress the T cell response previously triggered by CD80/CD28 interactions. This feedback loop allows for fine control of immune responses.
- CD80 has also been shown to interact with another B7 family member, PD-L1 with similar affinity to CD28, whereas CD86 does not interact with PD-L1. PD-L1 is one of two ligands for the programmed death-1 (PD-1) protein, which is also involved in T cell regulation. Specifically, expression of PD-1 on T cells may be induced after T cells have been activated, and binding of PD-1 to PD-L1 downregulates T cell activity by promoting T cell inactivation. Many tumor cells express PD-L1 on their surface, potentially leading to PD-1/PD-L1 interactions and the inhibition of T cell responses against the tumor. This observation has led to the development of inhibitors of the PD-1/PD-L1 interaction as cancer therapeutics designed to stimulate natural immune responses against tumors in patients.
- Binding of CD80 to PD-L1 may serve as an alternative mechanism to block the PD-1/PD-L1 interaction and prevent inhibition of T cell responses at the site of a tumor. At the same time, however, increased levels of CD80 might also be available to bind to CD28 and to induce CTLA4, thus either inducing or inhibiting T cell responses. Some soluble forms of CD80 may also function to block CTLA4 activation by blocking endogenous CD80 activity. In addition, different soluble CD80 protein forms may have different effects on tumor growth through other interactions between the protein forms and tumor cells whose impact cannot be predicted in advance of testing. How various soluble forms of CD80 actually impact tumor growth in vivo has also not previously been directly tested. The present inventors have developed a set of CD80 extracellular domain (ECD) fusion molecules with particularly potent effects on tumor growth in a mouse model, both when administered alone, and when administered in conjunction with a PD-1/PD-L1 inhibitor. Based on the data shown in the working examples below, embodiments herein may provide superb therapeutic effects in cancer treatment.
- In some embodiments, a CD80 extracellular domain (ECD) polypeptide or a CD80 ECD fusion molecule is provided. In some embodiments, the fusion molecule comprises a CD80 ECD and at least one fusion partner, comprising an Fc domain of an immunoglobulin, such as a human IgG1, IgG2, IgG3, or IgG4, albumin, or a polymer such as PEG. In some embodiments, the CD80 ECD or CD80 ECD fusion molecule comprises a human CD80, such as that of SEQ ID NO:5, or a human CD80 ECD from CD80 isoform 2 or isoform 3 (SEQ ID NOs: 3 and 4). In some embodiments, the fusion molecule comprises an Fc domain, such as an Fc domain comprising a sequence selected from SEQ ID NOs: 9-16. In some embodiments, the fusion molecule comprises a human IgG1 Fc domain, such as one with a wild-type sequence such as that of SEQ ID NO:14, or alternatively, a mutant sequence with L234F, L235E, and P331S amino acid substitutions such as that of SEQ ID NO:12. In some embodiments, the CD80 ECD fusion molecule comprises an amino acid sequence selected from SEQ ID NO: 5, SEQ ID NO: 12, SEQ ID NO:14, SEQ ID NO: 20, and SEQ ID NO: 21. In some embodiments, the CD80 ECD fusion molecule fusion partner is directly attached to the C-terminal amino acid of the CD80 ECD amino acid sequence or to the N-terminal amino acid of the mature CD80 ECD amino acid sequence. In some embodiments, the CD80 ECD fusion molecule may be attached to the CD80 ECD through a linker peptide, such as a GS linker.
- In some embodiments, the CD80 ECD fusion molecule has a sialic acid content of 10-60 mol sialic acid (SA)/mol protein, such as 15-60 mol SA/mol protein. In some embodiments, the content is 10-40 mol SA/mol protein, such as 15-40 mol SA/mol protein, such as 20-40 mol SA/mol protein, 20-30 mol SA/mol protein, 15-25 mol SA/mol protein, 15-30 mol SA to mol of protein, or 30-40 mol SA/mol protein. In some embodiments, the SA content is at least 15, such as at least 20, at least 25, at least 30, at least 35, or at least 40 mol SA/mol protein. In some embodiments, the SA content is 15, 20, 25, 30, 35, or 40 mol SA/mol protein. In some such embodiments, the CD80 ECD fusion molecule is a CD80 ECD Fc fusion, for example, with a wild-type Fc domain such as a human IgG1, IgG2, or IgG4 Fc domain, or, alternatively, an IgG1 Fc domain with substitutions at L234F, L235E, and P331S. In some embodiments, the CD80 ECD fusion molecule comprises an amino acid sequence selected from SEQ ID NO: 5, SEQ ID NO: 12, SEQ ID NO:14, SEQ ID NO: 20, and SEQ ID NO: 21. In some embodiments above, the fusion molecule has a greater percentage tumor growth inhibition in a mouse syngeneic or xenograft model, such as in a CT26 mouse model than a fusion molecule of identical amino acid sequence but a lower SA content. In some embodiments above, where the fusion molecule comprises at least 10 mol SA/mol protein, such as at least 15 mol SA/mol protein, such as at least 20 mol SA/mol protein, the fusion molecule has a greater percentage tumor growth inhibition in a mouse syngeneic or xenograft model, such as in a CT26 mouse model than a fusion molecule of identical amino acid sequence but having less than 10 mol SA/mol protein or less than 15 mol SA/mol protein or less than 20 mol SA/mol protein, respectively.
- Some embodiments herein comprise a CD80 ECD fusion molecule wherein the molecule is capable of at least 50%, such as at least 60%, such as at least 70%, such as at least 80%, such as at least 90%, such as at least 95%, such as at least 98% tumor cell growth inhibition in at least one mouse syngeneic or xenograft cancer model, such as a CT26 model, over a period of at least ten days, such as at least two weeks, such as over a period of ten days to two weeks or two to three weeks, or at least three weeks.
- In some embodiments, mice are given one to three doses of 0.3 to 3 mg/kg, such as 0.3 to 0.6 mg/kg, of the CD80 ECD Fc fusion molecule. In some such embodiments, the CD80 ECD fusion molecule also has a sialic acid content of 10-60 mol sialic acid (SA)/mol protein, such as 15-60 mol SA/mol protein. In some embodiments, the content is 10-40 mol SA/mol protein, such as 15-40 mol SA/mol protein, such as 20-40 mol SA/mol protein, 20-30 mol SA/mol protein, 15-25 mol SA/mol protein, 15-30 mol SA to mol of protein, or 30-40 mol SA/mol protein. In some embodiments, the SA content is at least 15, such as at least 20, at least 25, at least 30, at least 35, or at least 40 mol SA/mol protein. In some embodiments, the SA content is 15, 20, 25, 30, 35, or 40 mol SA/mol protein. In some embodiments, the CD80 ECD fusion molecule has an Fc as a fusion partner, such as a human IgG1, IgG2, or IgG4 Fc domain. In some embodiments, the CD80 ECD fusion molecule comprises an amino acid sequence selected from SEQ ID NO: 5, SEQ ID NO: 12, SEQ ID NO:14, SEQ ID NO: 20, and SEQ ID NO: 21. In some embodiments above where the fusion molecule comprises at least 10 mol SA/mol protein, such as at least 15 mol SA/mol protein, such as at least 20 mol SA/mol protein, the molecule has a greater percentage tumor growth inhibition in a mouse syngeneic or xenograft model, such as in a CT26 mouse model, than a fusion molecule of identical amino acid sequence but having less than 10 mol SA/mol protein or less than 15 mol SA/mol protein or less than 20 mol SA/mol protein, respectively. In some embodiments above where the fusion molecule comprises at least 10 mol SA/mol protein, such as at least 15 mol SA/mol protein, such as at least 20 mol SA/mol protein, the molecule has a greater percentage tumor growth inhibition in a mouse syngeneic or xenograft model, such as in a CT26 mouse model, after at least ten days or at least two weeks or at least three weeks, such as ten days to two weeks or two to three weeks, than an anti-CTLA4 antibody, such as anti-CTLA4 antibody clone 9D9.
- In some of the above embodiments, the CD80 ECD Fc fusion molecule is also capable of inducing complete tumor regression in mice from the syngeneic or xenograft tumor model, such as a CT26 model.
- Also provided herein are compositions comprising a CD80 ECD or CD80 ECD fusion molecule of any of the embodiments described above, and further comprising at least one pharmaceutically acceptable carrier. Some such compositions further comprise at least one additional therapeutic agent.
- In some embodiments, the additional therapeutic agent comprises at least one immune stimulating agent. In some embodiments, the immune stimulating agent comprises a programmed cell death 1 (PD-1)/programmed cell death ligand 1 (PD-L1) inhibitor. The PD-1/PD-L1 inhibitor may be an antibody, such as an anti-PD-1 antibody or anti-PD-L1 antibody, a peptide or fusion molecule, or a small molecule.
- In some embodiments, the PD-1/PD-L1 inhibitor is an anti-PD-1 antibody, such as an antibody comprising the heavy chain and light chain CDRs, or comprising the heavy and light chain variable regions, or comprising the full amino acid sequence, of an antibody selected from nivolumab, pidilizumab, and pembrolizumab. In some embodiments, the PD-1/PD-L1 inhibitor is an anti-PD-L1 antibody, such as an antibody comprising the heavy chain and light chain CDRs, the heavy and light chain variable regions, or the full amino acid sequence, of an antibody selected from BMS-936559, MPDL3280A, MEDI4736, and MSB0010718C.
- In some embodiments, the PD-1/PD-L1 inhibitor is a PD-1 fusion molecule, such as AMP-224 or a polypeptide such as AUR-012.
- Also included herein are methods of treating cancer in a subject comprising administering to the subject an effective amount of a CD80 ECD or CD80 ECD fusion protein or a composition from among the embodiments described above. In some embodiments, the cancer is a solid tumor. In some embodiments, the cancer is selected from colorectal cancer, breast cancer, gastric cancer, non-small cell lung cancer, melanoma, squamous cell carcinoma of the head and neck, ovarian cancer, pancreatic cancer, renal cell carcinoma, hepatocellular carcinoma, bladder cancer, and endometrial cancer. In some embodiments, the cancer is recurrent or progressive after a therapy selected from surgery, chemotherapy, radiation therapy, or a combination thereof.
- In some of the methods herein, the CD80 ECD, CD80 ECD fusion molecule, or composition is administered in combination with at least one additional therapeutic agent. In some such embodiments, the additional therapeutic agent may be packaged with the CD80 ECD or CD80 ECD fusion molecule as part of the same composition, e.g. mixed together in one composition or provided in separate containers, vials, or other packages. In some embodiments, the additional therapeutic agent comprises at least one immune stimulating agent. In some embodiments, the immune stimulating agent comprises a programmed cell death 1 (PD-1)/programmed cell death ligand 1 (PD-L1) inhibitor. The PD-1/PD-L1 inhibitor may be an antibody, such as an anti-PD-1 antibody or anti-PD-L1 antibody, a peptide or fusion molecule, or a small molecule.
- In some embodiments, the PD-1/PD-L1 inhibitor is an anti-PD-1 antibody, such as an antibody comprising the heavy chain and light chain CDRs, or comprising the heavy and light chain variable regions, or comprising the full amino acid sequence, of an antibody selected from nivolumab, pidilizumab, and pembrolizumab. In some embodiments, the PD-1/PD-L1 inhibitor is an anti-PD-L1 antibody, such as an antibody comprising the heavy chain and light chain CDRs, the heavy and light chain variable regions, or the full amino acid sequence, of an antibody selected from BMS-936559, MPDL3280A, MEDI4736, and MSB0010718C.
- In some embodiments, the PD-1/PD-L1 inhibitor is a PD-1 fusion molecule, such as AMP-224 or a polypeptide such as AUR-012.
- In some embodiments of the methods herein, the CD80 ECD or CD80 ECD fusion molecule and the additional therapeutic agent, such as an immune stimulating agent, such as a PD-1/PD-L1 inhibitor, may be administered concurrently or sequentially. In some cases, one or more doses of the PD-1/PD-L1 inhibitor are administered prior to administering the CD80 ECD or CD80 ECD fusion molecule. In some cases, the subject has received a complete course of immune stimulating agent, e.g., PD-1/PD-L1 inhibitor therapy prior to administration of the CD80 ECD or CD80 ECD fusion molecule. In some cases, the CD80 ECD or CD80 ECD fusion molecule is administered during a second course of immune stimulation agent, e.g. PD-1/PD-L1 inhibitor therapy. In some cases, the subject has received at least one, at least two, at least three, or at least four doses of the immune stimulating agent, such as PD-1/PD-L1 inhibitor prior to administration of the CD80 ECD or CD80 ECD fusion molecule. In some cases, at least one dose of the immune stimulating agent, e.g. PD-1/PD-L1 inhibitor is administered concurrently with the CD80 ECD or CD80 ECD fusion molecule.
- In some embodiments, one or more doses of the CD80 ECD or CD80 ECD fusion molecule are administered prior to administering an additional therapeutic agent, such as an immune stimulating agent, such as a PD-1/PD-L1 inhibitor. In some such cases, the subject has received at least one, at least two, at least three, or at least four doses of the CD80 ECD or CD80 ECD fusion molecule prior to administration of an immune stimulating agent, e.g. a PD-1/PD-L1 inhibitor. In some cases, at least one dose of the CD80 ECD or CD80 ECD fusion molecule is administered concurrently with the immune stimulating agent, e.g. PD-1/PD-L1 inhibitor.
- In any of the methods herein, the subject may be resistant to treatment with a PD-1/PD-L1 inhibitor. In some such cases, the subject has previously received PD-1/PD-L1 inhibitor therapy, while in other such cases, the subject has not previously received PD-1/PD-L1 inhibitor therapy but is identified as resistant through other means such as certain phenotypic traits.
- In any of the above methods, the subject may be administered an additional therapeutic agent comprising at least one chemotherapy agent, growth inhibitory agent, anti-angiogenesis agent and/or anti-neoplastic composition, in addition to the CD80 ECD or CD80 ECD fusion molecule.
- In some embodiments, the combination of the CD80 ECD or CD80 ECD fusion molecule and an immune stimulating agent, such as a PD-1/PD-L1 inhibitor that is administered to the subject has been shown to reduce or inhibit tumor growth in at least one mouse syngeneic or xenograft cancer model in a synergistic fashion compared to treatment with either the CD80 ECD or fusion molecule or the immune stimulating agent, such as the PD-1/PD-L1 inhibitor, given alone. In some embodiments, the mouse model is a colorectal cancer model with murine colorectal carcinoma CT26 cells. In other embodiments, the model may be an MC38 model or a B16 model.
- In any of the above method embodiments, the CD80 ECD or CD80 ECD fusion molecule administered to the subject may inhibit tumor growth in at least one mouse syngeneic or xenograft cancer model over a period of 1 week, 10 days, 2 weeks, or 3 weeks, for example, by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98%, or may inhibit growth of tumors by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98% in a patient over a period of one month, two months, three months, six months, or one year. In any of the above method embodiments, administration of the CD80 ECD or CD80 ECD fusion molecule may reduce the volume of at least one tumor in an animal or human subject by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98%, for example, over a period of one month, two months, three months, six months, or one year. In some such embodiments, the tumor is a solid tumor.
- In any of the above combination therapy method embodiments, the combination of the CD80 ECD or CD80 ECD fusion molecule with an additional therapeutic agent, such as an immune stimulator, such as a PD-1/PD-L1 inhibitor, administered to the subject may inhibit tumor growth in at least one mouse syngeneic or xenograft cancer model over a period of 1 week, 10 days, 2 weeks, or 3 weeks, for example, by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98%, or may inhibit growth of tumors by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98% in a patient over a period of one month, two months, three months, six months, or one year. In any of the above combination therapy method embodiments, the combination of the CD80 ECD or CD80 ECD fusion molecule with an additional therapeutic agent, such as an immune stimulator, such as a PD-1/PD-L1 inhibitor, administered to the subject may reduce the volume of at least one tumor in an animal or human subject by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98%, for example, over a period of one month, two months, three months, six months, or one year. In some such embodiments, the tumor is a solid tumor.
- In some of the above combination therapy embodiments, the CD80 ECD or CD80 ECD fusion molecule is a CD80 ECD fusion molecule comprising 10-60 mol sialic acid (SA) to mol of CD80 ECD protein, such as 15-60 mol SA/mol protein. In some embodiments, the content is 10-40 mol SA/mol protein, such as 15-40 mol SA/mol protein, such as 20-40 mol SA/mol protein, 20-30 mol SA/mol protein, 15-25 mol SA/mol protein, 15-30 mol SA to mol of protein, or 30-40 mol SA/mol protein. In some embodiments, the SA content is at least 15, such as at least 20, at least 25, at least 30, at least 35, or at least 40 mol SA/mol protein. In some embodiments, the SA content is 15, 20, 25, 30, 35, or 40 mol SA/mol protein. In some such embodiments, the CD80 ECD fusion molecule comprises an Fc domain as fusion partner, such as a wild-type Fc domain, such as a wild-type human IgG1, IgG2, or IgG4 Fc domain. In some embodiments, the CD80 ECD fusion molecule comprises an amino acid sequence selected from SEQ ID NO: 5, SEQ ID NO: 12, SEQ ID NO:14, SEQ ID NO: 20, and SEQ ID NO: 21. In some such embodiments, the CD80 ECD or CD80 ECD fusion molecule is capable of at least 90% reduction of growth of CT26 tumor cells in mice, such as at least 95%, or at least 98%, over a period of at least ten days, such as at least two weeks, such as at least three weeks, such as over a period of ten days to two weeks or two to three weeks. In some embodiments, these results are obtained after mice are given one to three doses of 0.3 to 3 mg/kg, such as 0.3 to 0.6 mg/kg, of the CD80 ECD Fc fusion molecule.
- Also comprised herein is a CD80 ECD fusion molecule comprising a human CD80 ECD polypeptide and a human IgG1 Fc domain, such as a wild-type human IgG1 Fc, wherein the CD80 ECD Fc comprises 10-60 mol SA to mol of CD80 ECD Fc protein, such as 15-60 mol SA/mol protein. In some embodiments, the content is 10-40 mol SA/mol protein, such as 15-40 mol SA/mol protein, such as 20-40 mol SA/mol protein, 20-30 mol SA/mol protein, 15-25 mol SA/mol protein, 15-30 mol SA to mol of protein, or 30-40 mol SA/mol protein. In some embodiments, the SA content is at least 15, such as at least 20, at least 25, at least 30, at least 35, or at least 40 mol SA/mol protein. In some embodiments, the SA content is 15, 20, 25, 30, 35, or 40 mol SA/mol protein. In some embodiments, the Fc domain comprises the amino acid sequence of SEQ ID NO:14. In some embodiments, the fusion molecule comprises the amino acid sequence of SEQ ID NO:20. In some embodiments, the molecule is capable of at least 90% reduction, such as at least 95%, or at least 98% of growth of CT26 tumor cells in mice over a period of at least ten days, such as at least two weeks, such as at least three weeks, such as over a period of ten days to two weeks or two to three weeks. In some embodiments, these results are obtained after mice are given one to three doses of 0.3 to 3 mg/kg, such as 0.3 to 0.6 mg/kg, of the CD80 ECD Fc fusion molecule.
- Also comprised are compositions comprising the CD80 ECD IgG1 Fc and further comprising at least one pharmaceutically acceptable carrier. Such compositions may also contain an additional therapeutic agent. In some embodiments, the additional therapeutic agent is at least one immune stimulating agent, such as a programmed cell death 1 (PD-1)/programmed cell death ligand 1 (PD-L1) inhibitor. In some cases, the PD-1/PD-L1 inhibitor is an antibody, such as an anti-PD-1 antibody, such as nivolumab, pidilizumab, and pembrolizumab. For example, the antibody may have the heavy chain and light chain CDRs or the heavy and light chain variable regions of an antibody selected from nivolumab, pidilizumab, and pembrolizumab. In other embodiments, the PD-1/PD-L1 inhibitor is an anti-PD-L1 antibody. An anti-PD-L1 antibody may have the heavy chain and light chain CDRs of an antibody selected from BMS-936559, MPDL3280A, MEDI4736, and MSB0010718C, for example, or may comprise the heavy chain and light chain variable regions of BMS-936559, MPDL3280A, MEDI4736, or MSB0010718C. In some embodiments, the anti-PD-1 antibody is selected from BMS-936559, MPDL3280A, MEDI4736, and MSB0010718C. Alternatively, the PD-1/PD-L1 inhibitor may be a PD-1 fusion molecule such as AMP-224 or a polypeptide such as AUR-012.
- This disclosure also encompasses methods of treating cancer in a subject comprising administering to the subject an effective amount of a CD80 ECD IgG1 Fc fusion molecule as described above. In some embodiments, the cancer is a solid tumor, such as a cancer selected from colorectal cancer, breast cancer, gastric cancer, non-small cell lung cancer, melanoma, squamous cell carcinoma of the head and neck, ovarian cancer, pancreatic cancer, renal cell carcinoma, hepatocellular carcinoma, bladder cancer, and endometrial cancer. In some embodiments, the cancer is recurrent or progressive after a therapy selected from surgery, chemotherapy, radiation therapy, or a combination thereof.
- In some of these method embodiments, the CD80 ECD Fc comprises 10-60 mol SA to mol of CD80 ECD Fc protein, such as 15-60 mol SA/mol protein. In some embodiments, the content is 10-40 mol SA/mol protein, such as 15-40 mol SA/mol protein, such as 20-40 mol SA/mol protein, 20-30 mol SA/mol protein, 15-25 mol SA/mol protein, 15-30 mol SA to mol of protein, or 30-40 mol SA/mol protein. In some embodiments, the SA content is at least 15, such as at least 20, at least 25, at least 30, at least 35, or at least 40 mol SA/mol protein. In some embodiments, the SA content is 15, 20, 25, 30, 35, or 40 mol SA/mol protein. In some embodiments, the Fc domain is a human IgG1, IgG2, or IgG4 Fc domain. In some embodiments, the Fc domain comprises the amino acid sequence of SEQ ID NO:14. In some embodiments, the fusion molecule comprises the amino acid sequence of SEQ ID NO:20 or 21. In some embodiments, the molecule is capable of at least 90% reduction of growth of CT26 tumor cells in mice over a period of two or three weeks following inoculation of mice with tumor cells. In some embodiments, the molecule is capable of at least 95% reduction of growth of CT26 tumor cells, such as at least 98% reduction, in mice over a period of two or three weeks following inoculation of mice with tumor cells. For example, such results may be obtained when the mice are given one to three doses of 0.3 to 3.0 mg/kg, such as 0.3 to 0.6 mg/kg, of the ECD Fc fusion molecule. In some of the method embodiments, the CD80 ECD Fc comprises 10-40 mol SA to mol of CD80 ECD Fc protein, and the CD80 ECD Fc reduces growth of CT26 tumor cells in mice over a period of two or three weeks by a greater degree than a CD80 ECD Fc protein of the same amino acid sequence comprising less than 10 mol SA to mol of CD80 ECD Fc protein. The disclosure herein also comprises methods of enhancing efficacy of a CD80 ECD fusion protein in treating cancer in a subject comprising increasing the level of sialic acid (SA) in the CD80 ECD fusion protein or providing a CD80 ECD fusion protein with an increased SA level and administering the CD80 ECD fusion protein comprising an increased level of SA to the subject. In some such embodiments, the SA level is increased by 5, 10, 20, 30, 40, or 50 mol to mol of CD80 ECD protein. In some of these method embodiments, the CD80 ECD Fc comprises 10-60 mol SA to mol of CD80 ECD Fc protein, such as 15-60 mol SA/mol protein. In some embodiments, the content is 10-40 mol SA/mol protein, such as 15-40 mol SA/mol protein, such as 20-40 mol SA/mol protein, 20-30 mol SA/mol protein, 15-25 mol SA/mol protein, 15-30 mol SA to mol of protein, or 30-40 mol SA/mol protein. In some embodiments, the SA content is 15, 20, 25, 30, 35, or 40 mol SA/mol protein. In some embodiments, the Fc domain is a human IgG1, IgG2, or IgG4 Fc domain. In some embodiments, the Fc domain comprises the amino acid sequence of SEQ ID NO:14. In some embodiments, the fusion molecule comprises the amino acid sequence of SEQ ID NO:20 or 21. In some embodiments, the molecule is capable of at least 90% reduction of growth of CT26 tumor cells in mice over a period of two or three weeks. In some embodiments, the molecule is capable of at least 95%, such as at least 98%, reduction of growth of CT26 tumor cells in mice over a period of at least ten days, such as at least two weeks, such as at least three weeks, such as over a period of ten days to two weeks or two to three weeks. In some embodiments, these results are obtained after mice are given one to three doses of 0.3 to 3 mg/kg, such as 0.3 to 0.6 mg/kg, of the CD80 ECD Fc fusion molecule.
- In some of these method embodiments, the enhanced efficacy is measured as an increase in overall survival, an increase in disease-free survival, or as a greater reduction in the growth of at least one tumor in an animal or human subject. In other words, one or more of these parameters is improved upon administration of the CD80 ECD fusion molecule with higher SA content compared to a CD80 ECD fusion molecule with a lower SA content. In other embodiments, the enhanced efficacy is measured as a greater reduction in tumor growth in a mouse syngeneic or xenograft model such as a CT26 mouse model or as a reduced rate of clearance in an animal or human subject. In some embodiments, the efficacy is measured as a greater reduction in tumor growth of at least one tumor in the subject or a greater reduction in tumor growth in at least one mouse syngeneic or xenograft model, and wherein the tumor growth is further reduced by at least 10%, such as at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% upon administration of the CD80 ECD fusion molecule with increased SA level in comparison to administration of the CD80 ECD fusion molecule without the increased SA level.
- It is to be understood that both the foregoing general description and the following detailed description are exemplary and explanatory only and are not restrictive of the claims. The section headings used herein are for organizational purposes only and are not to be construed as limiting the subject matter described. All references cited herein, including patent applications and publications, are incorporated herein by reference in their entireties for any purpose.
-
FIGS. 1a-1b show effects of administering a CD80 ECD Fc fusion molecule compared with a CTLA4 ECD Fc fusion molecule and a saline control to mice implanted with murine colorectal carcinoma cell line CT26 cells.FIG. 1a shows tumor volume at up to 21 days post-inoculation of mice with the CT26 cells. As shown in the figure, CTLA4 ECD Fc enhanced tumor growth while CD80 ECD Fc inhibited tumor growth in a statistically significant manner compared to the saline control. P-values were calculated using unpaired, two-tailed t-test analyses of the calculated tumor volumes on each day of the study (*p<0.05, **p<0.01, ***p<0.001).FIG. 1b shows individual tumor volumes onDay 19 post-inoculation for the three groups. -
FIGS. 2a-2b show effects of administering a CD80 ECD Fc fusion molecule or an anti-PD-1 antibody or a combination of the two compared to a saline control to mice implanted with murine colorectal carcinoma cell line CT26 cells.FIG. 2a shows tumor volume at up to 14 days post-inoculation. Mice administered with the CD80 ECD Fc and anti-PD-1 combination showed statistically significant reduction in tumor growth compared to either the CD80 ECD Fc (p<0.01 beginning after Day 9) or anti-PD-1 (p<0.01 on Day 14) single therapies. Statistical significance was determined via two-tailed, unpaired t-Test comparing the combination group to the CD80 ECD Fc group.FIG. 2b shows individual tumor volumes onDay 14. -
FIGS. 3a-b show the effect of the Fc fusion polypeptide sequence on effects of a CD80 ECD Fc fusion molecule on tumor growth of the CT26 tumors in mice. Specifically, mice were administered saline control, or a CD80 ECD Fc with a human IgG1 wild-type Fc domain fusion partner (CD80-IgG1 WT), or with a CD80 ECD Fc with a mutant (L234F/L235E/P331S) human IgG1 Fc domain fusion partner (CD80-IgG1 MT).FIG. 3a shows changes in tumor volume up toDay 21 post-inoculation. The mutated Fc domain resulted in enhanced anti-tumor activity, which was statistically significant beginning onDay 14 after inoculation (p<0.01). Statistical significance was determined via a two-tailed, unpaired t-Test.FIG. 3b shows individual tumor volumes onDay 21 post-inoculation. -
FIGS. 4a-b show staining of murine tumor cells for presence of CD3+ and CD4+ T cells after exposure to saline control or to CD80 ECD Fc fusion molecules with either wild-type and mutant Fc fusion partners.FIG. 4a provides representative images showing CD3+ cells (top images) and corresponding DAPI staining (nuclei, bottom images) in CT26 tumors collected 7 days after injection of Saline, CD80-IgG1 WT or CD80-IgG1 MT. Both CD80-IgG1 WT and CD80-IgG1 MT increased the number of CD3+ cells within the tumors compared to vehicle but the magnitude of the increase was greater after CD80-IgG1 MT. Images were collected using the 10× objective.FIG. 4b provides representative images showing CD3+ cells (top row) and CD4+ cells (bottom row) in CT26 tumors collected 7 days after injection of Saline, CD80-IgG1 WT or CD80-IgG1 MT. The images were the taken in the same field of view but with different channels. Both CD80-IgG1 WT and CD80-IgG1 MT increased the number of infiltrating CD4+ cells compared to vehicle. The ratio of CD3+ to CD4+ cells was increased with the CD80-IgG1 MT compared to the CD80-IgG1 WT. Images were collected using the 10× objective. -
FIGS. 5a-d show release of cytokines IFN-γ and TNF-α from T-cells on 96 well tissue culture plates exposed to protein A beads coated with 0.01, 0.1, or 1 μg/well of a CD80 ECD IgG1 Fc domain fusion molecule (CD80-Fc).FIGS. 5a and 5c show that bead-immobilized CD80-Fc alone did not cause significant T-cell activation, as measured by soluble cytokine production.FIGS. 5b and 5d show that when a small amount of OKT3-scFv (too low to cause T-cell stimulation on its own) was immobilized along with the CD80-Fc, cytokine release was observed. -
FIG. 6 shows tumor growth of murine CT26 tumors following treatment with a saline control or either 0.3 or 0.6 mg/kg doses of three different lots of a CD80 ECD Fc fusion molecule having three different sialic acid (SA) contents. Lot A has 5 mol SA/mol protein, lot D has 15 mol SA/mol protein and lot E has 20 mol SA/mol protein. Treatment with CD80 ECD Fc lot E dosed at 0.3 or 0.6 mg/kg resulted in a 93% and 98% inhibition of tumor growth compared to the control (P<0.001). Treatment with CD80 ECD Fc lot D dosed at 0.3 or 0.6 mg/kg resulted in a 93% and 95% inhibition of tumor growth compared to the control (P<0.001). By comparison, treatment with CD80 ECD Fc lot A at 0.3 mg/kg did not inhibit tumor growth compared to the control and when dosed at 0.6 mg/kg it only induced 70% inhibition (P<0.001) of tumor growth. -
FIG. 7 shows tumor growth of CT26 tumors treated with mouse IgG2b at 10 mg/kg; murine CD80 ECD-Fc SA 20 mol/mol at 0.3 mg/kg; anti-CTLA4 antibody clone 9D9 at 10 mg/kg; and anti-CTLA4 antibody clone 9D9 at 1.5 mg/kg. Arrows indicate when mice were dosed. The asterisk symbol (*) denotes statistically significant differences between murine CD80 ECD-Fc SA 20 mol/mol at 0.3 mg/kg and the other treatments. -
FIG. 8 shows tumor growth of MC38 tumors treated with mouse IgG2b at 10 mg/kg; murine CD80 ECD-Fc SA 20 mol/mol at 3 mg/kg; anti-CTLA4 antibody clone 9D9 at 10 mg/kg; and anti-CTLA4 antibody clone 9D9 at 1.5 mg/kg. Arrows indicate when mice were dosed. The asterisk symbol (*) denotes statistically significant differences between murine CD80 ECD-Fc SA 20 mol/mol at 3 mg/kg and the other treatments. -
FIG. 9 shows tumor growth of B16 tumors treated with mouse IgG2b at 10 mg/kg; murine CD80 ECD-Fc SA 20 mol/mol at 3 mg/kg; anti-CTLA4 antibody clone 9D9 at 10 mg/kg; and anti-CTLA4 antibody clone 9D9 at 1.5 mg/kg. Arrows indicate when mice were dosed. The asterisk symbol (*) denotes statistically significant differences between murine CD80 ECD-Fc SA 20 mol/mol at 3 mg/kg and the other treatments. - Unless otherwise defined, scientific and technical terms used in connection with the present invention shall have the meanings that are commonly understood by those of ordinary skill in the art. Further, unless otherwise required by context, singular terms shall include pluralities and plural terms shall include the singular.
- In this application, the use of “or” means “and/or” unless stated otherwise. In the context of a multiple dependent claim, the use of “or” refers back to more than one preceding independent or dependent claim in the alternative only. Also, terms such as “element” or “component” encompass both elements and components comprising one unit and elements and components that comprise more than one subunit unless specifically stated otherwise.
- Exemplary techniques used in connection with recombinant DNA, oligonucleotide synthesis, tissue culture and transformation (e.g., electroporation, lipofection), enzymatic reactions, and purification techniques are described, e.g., in Sambrook et al. Molecular Cloning: A Laboratory Manual (2nd ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989)), among other places.
- As utilized in accordance with the present disclosure, the following terms, unless otherwise indicated, shall be understood to have the following meanings:
- The terms “nucleic acid molecule” and “polynucleotide” may be used interchangeably, and refer to a polymer of nucleotides. Such polymers of nucleotides may contain natural and/or non-natural nucleotides, and include, but are not limited to, DNA, RNA, and PNA. “Nucleic acid sequence” refers to the linear sequence of nucleotides that comprise the nucleic acid molecule or polynucleotide.
- The terms “polypeptide” and “protein” are used interchangeably to refer to a polymer of amino acid residues, and are not limited to a minimum length. Such polymers of amino acid residues may contain natural or non-natural amino acid residues, and include, but are not limited to, peptides, oligopeptides, dimers, trimers, and multimers of amino acid residues. Both full-length proteins and fragments thereof are encompassed by the definition. The terms also include post-expression modifications of the polypeptide, for example, glycosylation, sialylation, acetylation, phosphorylation, and the like. Furthermore, for purposes of the present invention, a “polypeptide” refers to a protein which includes modifications, such as deletions, additions, and substitutions (generally conservative in nature), to the native sequence, as long as the protein maintains the desired activity. These modifications may be deliberate, as through site-directed mutagenesis, or may be accidental, such as through mutations of hosts which produce the proteins or errors due to PCR amplification.
- A “CD80 extracellular domain” or “CD80 ECD” refers to an extracellular domain polypeptide of CD80, including natural and engineered variants thereof. Nonlimiting examples of CD80 ECDs include SEQ ID NOs:--. A “CD80 ECD fusion molecule” refers to a molecule comprising a CD80 ECD and a fusion partner such as an Fc domain, albumin, or PEG. The fusion partner may be covalently attached, for example, to the N- or C-terminal of the CD80 ECD or at an internal location. Nonlimiting examples of CD80 ECD fusion molecules include SEQ ID NOs:--
- The terms “programmed
cell death protein 1” and “PD-1” refer to an immunoinhibitory receptor belonging to the CD28 family. PD-1 is expressed predominantly on previously activated T cells in vivo, and binds to two ligands, PD-L1 and PD-L2. The term “PD-1” as used herein includes human PD-1 (hPD-1), variants, isoforms, and species homologs of hPD-1, and analogs having at least one common epitope with hPD-1. The complete hPD-1 sequence can be found under GenBank Accession No. U64863. In some embodiments, the PD-1 is a human PD-1 having the amino acid sequence of SEQ ID NO: -- (precursor, with signal sequence) or SEQ ID NO: -- (mature, without signal sequence). - The terms “
programmed cell death 1ligand 1” and “PD-L1” refer to one of two cell surface glycoprotein ligands for PD-1 (the other being PD-L2) that down regulate T cell activation and cytokine secretion upon binding to PD-1. The term “PD-L1” as used herein includes human PD-L1 (hPD-L1), variants, isoforms, and species homologs of hPD-L1, and analogs having at least one common epitope with hPD-L1. The complete hPD-L1 sequence can be found under GenBank® Accession No. Q9NZQ7. In some embodiments, the PD-L1 is a human PD-L1 having the amino acid sequence of SEQ ID NO: -- (precursor, with signal sequence) or SEQ ID NO: -- (mature, without signal sequence). - The term “immune stimulating agent” as used herein refers to a molecule that stimulates the immune system by either acting as an agonist of an immune-stimulatory molecule, including a co-stimulatory molecule, or acting as an antagonist of an immune inhibitory molecule, including a co-inhibitory molecule. An immune stimulating agent may be a biologic, such as an antibody or antibody fragment, other protein, or vaccine, or may be a small molecule drug. An “immune stimulatory molecule” includes a receptor or ligand that acts to enhance, stimulate, induce, or otherwise “turn-on” an immune response. Immune stimulatory molecules as defined herein include co-stimulatory molecules. An “immune inhibitory molecule” includes a receptor or ligand that acts to reduce, inhibit, suppress, or otherwise “turn-off” an immune response. Immune inhibitory molecules as defined herein include co-inhibitory molecules. Such immune stimulatory and immune inhibitory molecules may be, for example, receptors or ligands found on immune cells such as a T cells, or found on cells involved in innate immunity such as NK cells.
- The term “PD-1/PD-L1 inhibitor” refers to a moiety that disrupts the PD-1/PD-L1 signaling pathway. In some embodiments, the inhibitor inhibits the PD-1/PD-L1 signaling pathway by binding to PD-1 and/or PD-L1. In some embodiments, the inhibitor also binds to PD-L2. In some embodiments, a PD-1/PD-L1 inhibitor blocks binding of PD-1 to PD-L1 and/or PD-L2. Nonlimiting exemplary PD-1/PD-L1 inhibitors include antibodies that bind to PD-1; antibodies that bind to PD-L1; fusion proteins, such as AMP-224; and peptides, such as AUR-012.
- The term “antibody that inhibits PD-1” refers to an antibody that binds to PD-1 or binds to PD-L1 and thereby inhibits PD-1 and/or PD-L1 signaling. In some embodiments, an antibody that inhibits PD-1 binds to PD-1 and blocks binding of PD-L1 and/or PD-L2 to PD-1. In some embodiments, an antibody that inhibits PD-1 binds to PD-L1 and blocks binding of PD-1 to PD-L1. An antibody that inhibits PD-1 that binds to PD-L1 may be referred to as an anti-PD-L1 antibody. An antibody that inhibits PD-1 that binds to PD-1 may be referred to as an anti-PD-1 antibody.
- With reference to CD80 ECDs and CD80 ECD fusion molecules, the term “blocks binding of” a ligand, and grammatical variants thereof, refers to the ability to inhibit an interaction between CD80 and a CD80 ligand, such as CD28, CTLA4, or PD-L1. Such inhibition may occur through any mechanism, including by the CD80 ECDs or CD80 ECD fusion molecules competing for binding with CD80 ligands.
- With reference to anti-PD-1 antibodies and PD-1 fusion molecules or peptides the term “blocks binding of” a ligand, such as PD-L1, and grammatical variants thereof, are used to refer to the ability to inhibit the interaction between PD-1 and a PD-1 ligand, such as PD-L1. Such inhibition may occur through any mechanism, including direct interference with ligand binding, e.g., because of overlapping binding sites on PD-1, and/or conformational changes in PD-1 induced by the antibody that alter ligand affinity, etc., or, in the case of a PD-1 fusion molecule or peptide, by competing for binding with a PD-1 ligand.
- “Affinity” or “binding affinity” refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g., a polypeptide) and its binding partner (e.g., a ligand). In some embodiments, “binding affinity” refers to intrinsic binding affinity, which reflects a 1:1 interaction between members of a binding pair (e.g., polypeptide and ligand). The affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (Kd).
- The term “antibody” as used herein refers to a molecule comprising at least complementarity-determining region (CDR) 1, CDR2, and CDR3 of a heavy chain and at least CDR1, CDR2, and CDR3 of a light chain, wherein the molecule is capable of binding to antigen. The term antibody includes, but is not limited to, fragments that are capable of binding antigen, such as Fv, single-chain Fv (scFv), Fab, Fab′, and (Fab′)2. The term antibody also includes, but is not limited to, chimeric antibodies, humanized antibodies, and antibodies of various species such as mouse, human, cynomolgus monkey, etc.
- In some embodiments, an antibody comprises a heavy chain variable region and a light chain variable region. In some embodiments, an antibody comprises at least one heavy chain comprising a heavy chain variable region and at least a portion of a heavy chain constant region, and at least one light chain comprising a light chain variable region and at least a portion of a light chain constant region. In some embodiments, an antibody comprises two heavy chains, wherein each heavy chain comprises a heavy chain variable region and at least a portion of a heavy chain constant region, and two light chains, wherein each light chain comprises a light chain variable region and at least a portion of a light chain constant region. As used herein, a single-chain Fv (scFv), or any other antibody that comprises, for example, a single polypeptide chain comprising all six CDRs (three heavy chain CDRs and three light chain CDRs) is considered to have a heavy chain and a light chain. In some such embodiments, the heavy chain is the region of the antibody that comprises the three heavy chain CDRs and the light chain in the region of the antibody that comprises the three light chain CDRs.
- The term “heavy chain variable region” refers to a region comprising heavy chain HVR1, framework (FR) 2, HVR2, FR3, and HVR3. In some embodiments, a heavy chain variable region also comprises at least a portion of an FR1 and/or at least a portion of an FR4.
- The term “heavy chain constant region” refers to a region comprising at least three heavy chain constant domains,
C H1, CH2, andC H3. Nonlimiting exemplary heavy chain constant regions include γ, δ, and α. Nonlimiting exemplary heavy chain constant regions also include ε and μ. Each heavy constant region corresponds to an antibody isotype. For example, an antibody comprising a γ constant region is an IgG antibody, an antibody comprising a δ constant region is an IgD antibody, and an antibody comprising an a constant region is an IgA antibody. Further, an antibody comprising a μ constant region is an IgM antibody, and an antibody comprising an c constant region is an IgE antibody. Certain isotypes can be further subdivided into subclasses. For example, IgG antibodies include, but are not limited to, IgG1 (comprising a γ1 constant region), IgG2 (comprising a γ2 constant region), IgG3 (comprising a γ3 constant region), and IgG4 (comprising a γ4 constant region) antibodies; IgA antibodies include, but are not limited to, IgA1 (comprising an al constant region) and IgA2 (comprising an α2 constant region) antibodies; and IgM antibodies include, but are not limited to, IgM1 and IgM2. - The term “heavy chain” refers to a polypeptide comprising at least a heavy chain variable region, with or without a leader sequence. In some embodiments, a heavy chain comprises at least a portion of a heavy chain constant region. The term “full-length heavy chain” refers to a polypeptide comprising a heavy chain variable region and a heavy chain constant region, with or without a leader sequence.
- The term “light chain variable region” refers to a region comprising light chain HVR1, framework (FR) 2, HVR2, FR3, and HVR3. In some embodiments, a light chain variable region also comprises an FR1 and/or an FR4.
- The term “light chain constant region” refers to a region comprising a light chain constant domain, CL. Nonlimiting exemplary light chain constant regions include λ and κ.
- The term “light chain” refers to a polypeptide comprising at least a light chain variable region, with or without a leader sequence. In some embodiments, a light chain comprises at least a portion of a light chain constant region. The term “full-length light chain” refers to a polypeptide comprising a light chain variable region and a light chain constant region, with or without a leader sequence.
- The term “hypervariable region” or “HVR” refers to each of the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops (“hypervariable loops”). Generally, native four-chain antibodies comprise six HVRs; three in the VH (H1, H2, H3), and three in the VL (L1, L2, L3). HVRs generally comprise amino acid residues from the hypervariable loops and/or from the “complementarity determining regions” (“CDRs”), the latter being of highest sequence variability and/or involved in antigen recognition. Exemplary hypervariable loops occur at amino acid residues 26-32 (L1), 50-52 (L2), 91-96 (L3), 26-32 (H1), 53-55 (H2), and 96-101 (H3). (Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987).) Exemplary CDRs (CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, and CDR-H3) occur at amino acid residues 24-34 of L1, 50-56 of L2, 89-97 of L3, 31-35B of H1, 50-65 of H2, and 95-102 of H3. (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)). The terms hypervariable regions (HVRs) and complementarity determining regions (CDRs) both refer to portions of the variable region that form the antigen binding regions.
- A “chimeric antibody” as used herein refers to an antibody comprising at least one variable region from a first species (such as mouse, rat, cynomolgus monkey, etc.) and at least one constant region from a second species (such as human, cynomolgus monkey, etc.). In some embodiments, a chimeric antibody comprises at least one mouse variable region and at least one human constant region. In some embodiments, a chimeric antibody comprises at least one cynomolgus variable region and at least one human constant region. In some embodiments, a chimeric antibody comprises at least one rat variable region and at least one mouse constant region. In some embodiments, all of the variable regions of a chimeric antibody are from a first species and all of the constant regions of the chimeric antibody are from a second species.
- A “humanized antibody” as used herein refers to an antibody in which at least one amino acid in a framework region of a non-human variable region has been replaced with the corresponding amino acid from a human variable region. In some embodiments, a humanized antibody comprises at least one human constant region or fragment thereof. In some embodiments, a humanized antibody is a Fab, an scFv, a (Fab′)2, etc.
- A “human antibody” as used herein refers to antibodies produced in humans, antibodies produced in non-human animals that comprise human immunoglobulin genes, such as XenoMouse®, and antibodies selected using in vitro methods, such as phage display, wherein the antibody repertoire is based on a human immunoglobulin sequences.
- The term “leader sequence” refers to a sequence of amino acid residues located at the N terminus of a polypeptide that facilitates secretion of a polypeptide from a mammalian cell. A leader sequence may be cleaved upon export of the polypeptide from the mammalian cell, forming a mature protein. Leader sequences may be natural or synthetic, and they may be heterologous or homologous to the protein to which they are attached. Nonlimiting exemplary leader sequences also include leader sequences from heterologous proteins. In some embodiments, an antibody lacks a leader sequence. In some embodiments, an antibody comprises at least one leader sequence, which may be selected from native antibody leader sequences and heterologous leader sequences.
- The term “isolated” as used herein refers to a molecule that has been separated from at least some of the components with which it is typically found in nature. For example, a polypeptide is referred to as “isolated” when it is separated from at least some of the components of the cell in which it was produced. Where a polypeptide is secreted by a cell after expression, physically separating the supernatant containing the polypeptide from the cell that produced it is considered to be “isolating” the polypeptide. Similarly, a polynucleotide is referred to as “isolated” when it is not part of the larger polynucleotide (such as, for example, genomic DNA or mitochondrial DNA, in the case of a DNA polynucleotide) in which it is typically found in nature, or is separated from at least some of the components of the cell in which it was produced, e.g., in the case of an RNA polynucleotide. Thus, a DNA polynucleotide that is contained in a vector inside a host cell may be referred to as “isolated” so long as that polynucleotide is not found in that vector in nature.
- The term “reduce” or “reduces” when applied to a parameter such as tumor volume means to lower the level of that parameter in an observable, measurable way. In some embodiments, the reduction may be by at least 10%, such as by at least 20%, at least 30%, at least 40%, or at least 50%. In some embodiments, the reduction may be statistically significant compared to an alternative treatment or control.
- The terms “subject” and “patient” are used interchangeably herein to refer to a human. In some embodiments, methods of treating other mammals, including, but not limited to, rodents, simians, felines, canines, equines, bovines, porcines, ovines, caprines, mammalian laboratory animals, mammalian farm animals, mammalian sport animals, and mammalian pets, are also provided.
- The terms “resistant” or “nonresponsive” when used in the context of treatment with a therapeutic agent, means that the subject shows decreased response or lack of response to a standard dose of the therapeutic agent, relative to the subject's response to the standard dose of the therapeutic agent in the past, or relative to the expected response of a similar subject with a similar disorder to the standard dose of the therapeutic agent. Thus, in some embodiments, a subject may be resistant to therapeutic agent although the subject has not previously been given the therapeutic agent, or the subject may develop resistance to the therapeutic agent after having responded to the agent on one or more previous occasions.
- The term “sample,” as used herein, refers to a composition that is obtained or derived from a subject that contains a cellular and/or other molecular entity that is to be characterized, quantitated, and/or identified, for example based on physical, biochemical, chemical and/or physiological characteristics. An exemplary sample is a tissue sample.
- The term “tissue sample” refers to a collection of similar cells obtained from a tissue of a subject. The source of the tissue sample may be solid tissue as from a fresh, frozen and/or preserved organ or tissue sample or biopsy or aspirate; blood or any blood constituents; bodily fluids such as cerebral spinal fluid, amniotic fluid, peritoneal fluid, synovial fluid, or interstitial fluid; cells from any time in gestation or development of the subject. In some embodiments, a tissue sample is a synovial biopsy tissue sample and/or a synovial fluid sample. In some embodiments, a tissue sample is a synovial fluid sample. The tissue sample may also be primary or cultured cells or cell lines. Optionally, the tissue sample is obtained from a disease tissue/organ. The tissue sample may contain compounds that are not naturally intermixed with the tissue in nature such as preservatives, anticoagulants, buffers, fixatives, nutrients, antibiotics, or the like. A “control sample” or “control tissue”, as used herein, refers to a sample, cell, or tissue obtained from a source known, or believed, not to be afflicted with the disease for which the subject is being treated.
- For the purposes herein a “section” of a tissue sample means a part or piece of a tissue sample, such as a thin slice of tissue or cells cut from a solid tissue sample.
- The term “cancer” is used herein to refer to a group of cells that exhibit abnormally high levels of proliferation and growth. A cancer may be benign (also referred to as a benign tumor), pre-malignant, or malignant. Cancer cells may be solid cancer cells (i.e. “solid tumors”) or may be leukemic cancer cells. The term “cancer growth” is used herein to refer to proliferation or growth by a cell or cells that comprise a cancer that leads to a corresponding increase in the size or extent of the cancer.
- Examples of cancer include but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More particular nonlimiting examples of such cancers include squamous cell cancer, small-cell lung cancer, pituitary cancer, esophageal cancer, astrocytoma, soft tissue sarcoma, non-small cell lung cancer (including squamous cell non-small cell lung cancer), adenocarcinoma of the lung, squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney cancer, renal cell carcinoma, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, brain cancer, endometrial cancer, testis cancer, cholangiocarcinoma, gallbladder carcinoma, gastric cancer, melanoma, and various types of head and neck cancer (including squamous cell carcinoma of the head and neck).
- “Treatment,” as used herein, refers to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) the targeted pathologic condition or disorder. In certain embodiments, the term “treatment” covers any administration or application of a therapeutic for disease in a mammal, including a human, and includes inhibiting or slowing the disease or progression of the disease; partially or fully relieving the disease, for example, by causing regression, or restoring or repairing a lost, missing, or defective function; stimulating an inefficient process; or causing the disease plateau to have reduced severity. The term “treatment” also includes reducing the severity of any phenotypic characteristic and/or reducing the incidence, degree, or likelihood of that characteristic. Those in need of treatment include those already with the disorder as well as those prone to have the disorder or those in whom the disorder is to be prevented.
- The term “efficacy” as used herein may be determined from one or more parameters such as survival or disease-free survival over a period of time such as 1 year, 5 years, or 10 years, as well as parameters such as the reduction in growth of one or more tumors in a subject. Pharmacokinetic parameters such as bioavailability and underlying parameters such as clearance rate may also impact efficacy. Thus, an “enhanced efficacy” (i.e. an improvement in efficacy) may be due to improved pharmacokinetic parameters as well as improved potency, and may be measured by comparing clearance rates and tumor growth in test animals or in human subjects, as well as parameters such as survival, rate of recurrence, or disease-free survival.
- The term “effective amount” or “therapeutically effective amount” refers to an amount of a drug effective to treat a disease or disorder in a subject. In certain embodiments, an effective amount refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result. A therapeutically effective amount of a CD80 ECD or CD80 ECD fusion molecule may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the drug to elicit a desired response in the individual. A therapeutically effective amount encompasses an amount in which any toxic or detrimental effects of the drug are outweighed by the therapeutically beneficial effects. In some embodiments, the expression “effective amount” refers to an amount of the drug that is effective for treating the cancer.
- Administration “in combination with” one or more further therapeutic agents, such as an immune stimulating agent, includes simultaneous (concurrent) and consecutive (sequential) administration in any order.
- A “pharmaceutically acceptable carrier” refers to a non-toxic solid, semisolid, or liquid filler, diluent, encapsulating material, formulation auxiliary, or carrier conventional in the art for use with a therapeutic agent that together comprise a “pharmaceutical composition” for administration to a subject. A pharmaceutically acceptable carrier is non-toxic to recipients at the dosages and concentrations employed and is compatible with other ingredients of the formulation. The pharmaceutically acceptable carrier is appropriate for the formulation employed. For example, if the therapeutic agent is to be administered orally, the carrier may be a gel capsule. If the therapeutic agent is to be administered subcutaneously, the carrier ideally is not irritable to the skin and does not cause injection site reaction.
- CD80 ECD and CD80 ECD fusion molecules are provided herein. CD80 ECDs, for example, may comprise the ECDs of
human CD80 isoform 1, isoform 2, and isoform 3 (see SEQ ID NOs: 1-3. In some embodiments, CD80 ECDs and may comprise the amino acid sequence of SEQ ID NO:5. - CD80 ECD fusion molecules may comprise fusion partners such as polymers, polypeptides, lipophilic moieties, and succinyl groups. Exemplary polypeptide fusion partners include, but are not limited to, serum albumin and an IgG Fc domain. Further exemplary polymer fusion partners include, but are not limited to, polyethylene glycol, including polyethylene glycols having branched and/or linear chains. The amino acid sequences of certain exemplary Fc domains are shown in SEQ ID NOs: 9-16 herein.
- In certain embodiments, the CD80 ECD or CD80 ECD fusion molecule lacks a signal peptide. In certain embodiments, the CD80 ECD or CD80 ECD fusion molecule includes at least one signal peptide, which may be selected from a native CD80 signal peptide (SEQ ID NO: 7 or amino acids 1-34 of SEQ ID NO:1) and/or a heterologous signal peptide.
- In the case of a CD80 ECD fusion molecule, the fusion partner may be linked to either the amino-terminus or the carboxy-terminus of the polypeptide. In certain embodiments, the polypeptide and the fusion partner are covalently linked. If the fusion partner is also a polypeptide (“the fusion partner polypeptide”), the polypeptide and the fusion partner polypeptide may be part of a continuous amino acid sequence. In such cases, the polypeptide and the fusion partner polypeptide may be translated as a single polypeptide from a coding sequence that encodes both the polypeptide and the fusion partner polypeptide. In some such cases, the two polypeptides are directly linked in sequence such that the N-terminal of one polypeptide immediately follows the C-terminal of the other with no intervening amino acids. In other cases, a linker peptide sequence is inserted in between the two polypeptides, such as a GS linker sequence. In certain embodiments, a CD80 ECD and the fusion partner are covalently linked through other means, such as, for example, a chemical linkage other than a peptide bond. In certain embodiments, the polypeptide and the fusion partner are noncovalently linked. In certain such embodiments, they may be linked, for example, using binding pairs. Exemplary binding pairs include, but are not limited to, biotin and avidin or streptavidin, an antibody and its antigen, etc.
- In some embodiments, the CD80 ECD fusion molecule comprises the sequence of SEQ ID NO: 20 or 21.
- CD80 ECD fusion molecules may, depending on how they are produced, have different levels of particular glycosylation modifications. For example, a CD80 ECD fusion molecule may have different concentrations of sialic acid residues in relation to the concentration of the CD80 ECD protein. In some embodiments, a higher sialic acid content may have a longer clearance time in the body and thus an increased overall bioavailability. In some embodiments, the sialic acid content of the CD80 ECD fusion molecule is from 10 to 60 mol sialic acid (SA) to mol protein. In some embodiments, the sialic acid content of the CD80 ECD fusion molecule is from 15 to 60 mol sialic acid (SA) to mol protein. For example, in some embodiments, the SA content is 10-40 mol SA/mol protein, such as 15-30 mol SA/mol protein, such as 15-25 mol SA/mol protein, such as 20-40 mol SA/mol protein, such as 20-30 mol SA/mol protein, such as 30-40 mol SA/mol protein, such as 10, 15, 20, 25, 30, 35, or 40 mol SA/mol protein. In some embodiments, the SA content is at least 15 mol SA/mol protein, such as at least 20 mol SA/mol protein, at least 25 mol SA/mol protein, at least 30 mol SA/mol protein, at least 35 mol SA/mol protein, or at least 40 mol SA/mol protein. In some such embodiments, the fusion partner is an Fc domain, such as a human IgG1, IgG2, or IgG4 Fc domain.
- In some embodiments, the SA content of the CD80 ECD fusion molecule is increased or is maintained at a relatively high level in comparison to current CD80 ECD fusion molecules. In some embodiments, an increase in SA content, such as by 5, 10, 15, 20, 30, 40 or 50 mol SA to mol of CD80 ECD protein, may lead to an enhanced efficacy in at least one mouse syngeneic or xenograft tumor model. For example, in some embodiments, tumor growth in a mouse tumor model may be further reduced by at least 5%, 10%, 20%, 30%, 40% 50%, 60%, 70%, 80%, 90%, 95%, or 98% when there is an increase in SA content, such as by 5, 10, 15, 20, 30, 40 or 50 mol SA to mol of CD80 ECD protein.
- For example, in some embodiments, a CD80 ECD Fc fusion molecule, such as a fusion molecule comprising a human IgG1 Fc domain comprising between 10 and 60 mol SA/mol protein is capable of at least 80%, such as at least 90%, such as at least 95%, such as at least 98% tumor cell growth inhibition in at least one mouse syngeneic or xenograft cancer model over a period of at least ten days or at least two weeks or at least three weeks, such as ten days to two weeks or two to three weeks following inoculation with tumor cells. In some such embodiments, the molecule comprises at least 15 mol SA/mol protein, such as at least 20 mol SA/mol protein, or a range from 15-30, 15-25, or 20-30 mol SA/mol prtotein. In some embodiments, the mouse model is a CT26, MC38, or B16 mouse tumor model. In some embodiments, the mice are given one to three doses of the molecule at 0.3 to 3.0 mg/kg, such as at 0.3 to 0.6 mg/kg, for example over a period of one week, once tumors have reached a minimum volume. In some embodiments, the Fc domain comprises the amino acid sequence of SEQ ID NO:14. In some embodiments, the CD80 ECD fusion molecule comprises the sequence of SEQ ID NO: 20 or 21.
- In some embodiments, the CD80 ECD Fc fusion molecule reduces growth of CT26 tumor cells in mice over a period of at least ten days or at least two weeks or at least three weeks, such as ten days to two weeks or two to three weeks, after inoculation by a greater degree than a CD80 ECD Fc fusion protein with the identical amino acid sequence but a lower level of SA per mol of protein. In some embodiments, the CD80 ECD Fc fusion molecule reduces growth of CT26 tumors in mice over a period of at least ten days or at least two weeks, such as over ten days to two weeks or two to three weeks, after inoculation by a greater degree than an anti-CTLA4 antibody, such as anti-CTLA4 antibody clone 9D9. In some such embodiments, the CD80 ECD Fc molecule is dosed one to three times at 0.3 mg/kg, 0.6 mg/kg, or 3.0 mg/kg while the anti-CTLA4 antibody is dosed the same number of times at 1.5 or 10 mg/kg. In some such embodiments, the model is a CT26, MC38, or B16 murine tumor model.
- Example 6 herein, for example, provides data showing that treatment of a mouse syngeneic tumor model with a CD80 ECD fusion molecule having 15 or 20 mol SA/mol protein resulted in at least 93% inhibition of tumor growth after one dose of 0.3 mg/kg, whereas the same treatment with a molecule having only 5 mol SA/mol protein did not significantly inhibit tumor growth. Similarly, a 0.6 mg/kg dose of the CD80 ECD fusion molecule having 15 or 20 mol SA/mol protein resulted in 95% to 98% inhibition of tumor growth, whereas the same treatment with the molecule with 5 mol SA/mol protein inhibited tumor growth by only 70%. (See
FIG. 6 .) The degree of inhibition was assessed about three weeks following inoculation with the tumors. - Further, Example 7 herein shows data on a CD80 ECD Fc fusion molecule (a mouse surrogate) having 20 mol SA/mol protein in three different syngeneic mouse tumor models, the CT26, MC38, and B16 models at 0.3 mg/kg (CT26) or 3.0 mg/kg (MC38 and B16) doses compared to an anti-CTLA4 antibody (clone 9D9) at 1.5 mg/kg and 10 mg/kg doses. Each protein was dosed three times over a 7-day period a few days after inoculation with tumor cells, as depicted in
FIGS. 7-9 (the arrows showing the days of dosing). In each case, the CD80 ECD Fc was superior in tumor growth inhibition to the anti-CTLA4 antibody over the course of the two to three week study. (FIGS. 7-9 .) For example, in the CT26 model atday 21 after inoculation with tumor cells, the CD80 ECD Fc fusion molecule showed a 90% reduction in tumor growth compared to 75% or 53% for the two dose levels of anti-CTLA4. In the MC38 model atday 19 after inoculation, the CD80 ECD Fc molecule showed about 80% reduction in tumor growth inhibition compared to only 21% tumor growth for the higher dose of anti-CTLA4 and no tumor growth inhibition for the lower anti-CTLA4 dose. In the B16 model, the CD80 ECD Fc fusion molecule showed 41% tumor growth inhibition on day 13 after inoculation while the anti-CTLA4 antibody did not inhibit tumor growth at either dose level. (SeeFIGS. 7-9 .) - Based on these studies, a CD80 ECD fusion molecule may be capable of a certain percentage of tumor growth inhibition over at least a two week period of time, for example, when about two weeks after the mice have been inoculated with the tumor cells, and also following dosing with the fusion molecule, an average tumor growth inhibition at about the stated percentage is observed in the treated mice. A CD80 ECD fusion molecule may be capable of a certain percentage of tumor growth inhibition over a two to three week period of time, for example, when between two and three weeks after the mice have been inoculated with the tumor cells, and also following dosing with the fusion molecule, an average tumor growth inhibition at about the stated percentage is observed in the treated mice.
- Examples 6 and 7 also show that many mice from the CT26 model treated with CD80 ECD fusion molecule had a complete tumor regression over these two to three week time periods. Moreover, a larger percentage of mice had complete tumor regression with CD80 ECD fusion molecule with higher SA content than with the comparison treatments and a larger percentage of mice had complete tumor regression with CD80 ECD fusion molecule than with an anti-CTLA4 antibody. Thus, in some embodiments, treatment CD80 ECD fusion molecule, such as with 0.3 mg/kg to 0.6 mg/kg CD80 ECD fusion molecule or with 0.3 mg/kg to 3.0 mg/kg CD80 ECD fusion molecule, may result in complete tumor regression in mice in a syngeneic or xenograft model such as CT26, MC38, or B16.
- Exemplary Fc Domain Fusion Partners
- In some embodiments, the CD80 ECD fusion molecule has an Fc domain as fusion partner. In some embodiments, the Fc domain is derived from human IgG1, IgG2, IgG3, or IgG4. In some embodiments, the Fc domain has a wild-type sequence, such as a wild-type human IgG1 or IgG2 (e.g. IgG2a) sequence. In other embodiments, the Fc domain is either a natural or engineered variant. In some embodiments, an Fc domain is chosen that has altered interactions of the Fc with one or more Fc gamma receptors. In some embodiments, an Fc domain is chosen that has altered interactions of the Fc with one or more complement factors. In some embodiments, an Fc domain is chosen that has altered interactions of the Fc with one or more Fc gamma receptors and that has altered interactions with one or more complement factors.
- In some embodiments, the Fc domain comprises at least one point mutation as described in WO 2014/144960. In some embodiments, the Fc domain is a human Fc domain with a substitution at one or more of positions E233, L234, L235, P238, D265, N297, A327, P329, or P331 (wherein the numbering of these positions is according to the EU index as in Kabat). In some embodiments, the Fc domain is a human Fc domain with a mutation at L234, L235, and/or P331. In some embodiments, the Fc domain is a human Fc domain with the substitutions L234F, L235E, and P331S. (See, e.g., SEQ ID NO:12.) In some embodiments, the Fc domain has an amino acid substitution at position N297. (See, e.g., SEQ ID NO: 13.) In some embodiments, the Fc domain comprises a C237S mutation. (See, e.g., SEQ ID NO: 9.)
- In some embodiments, a mutated Fc fusion partner causes the CD80 ECD Fc fusion molecule to have altered interactions with one or more Fc gamma receptors compared to those of a CD80 ECD fusion molecule with the same amino acid sequence except for the Fc domain mutations. In some embodiment, the Fc has reduced affinity for Fc gamma receptors such as one or more of FcRN, RI, RIIA, RIIB, and RIII compared to a wild-type Fc domain. In some embodiments, the Fc has reduced affinity for all of FcRN, RI, RIIA, RIIB, and RIII compared to a wild-type Fc domain.
- In some embodiments, a mutated Fc fusion partner causes the CD80 ECD Fc fusion molecule to have altered interactions with at one or more complement factors such as C1, C2, C3, C4, and their cleavage products, such as C4a, C4b, C2a, C2b, C3a, and C3b. In some embodiments, a mutated Fc fusion partner causes the CD80 ECD Fc fusion molecule to have altered interactions with one or more complement factors compared to those of a CD80 ECD fusion molecule with the same amino acid sequence except for the Fc domain mutations.
- In some embodiments the CD80 ECD and the fusion partner, such as an Fc fusion partner, are directly linked such that the N- or C-terminal amino acid of the Fc immediately precedes or follows the N- or C-terminal amino acid of the CD80 ECD sequence. (See, e.g., SEQ ID NOs: 20 and 21.) In other embodiments, the CD80 ECD and fusion partner are joined by a linker molecule, such as by a linker peptide sequence, such as by a GS linker sequence.
- Methods of Treating Cancer
- In some embodiments, methods for treating cancer are provided, comprising administering an effective amount of a CD80 ECD or CD80 ECD fusion molecule.
- In some embodiments, the cancer may be benign (also referred to as a benign tumor), pre-malignant, or malignant. In some embodiments, the cancer may comprise solid cancer cells (i.e. “solid tumors”) or alternatively, it may comprise leukemic cancer cells. In some embodiments, the CD80 ECD or CD80 ECD fusion molecule is effective to reduce cancer growth in a human or animal subject, or in a mouse syngeneic or xenograft model for the cancer being treated. In some embodiments, the CD80 ECD or CD80 ECD fusion molecule is effective to reduce tumor volume, such as in a mouse syngeneic or xenograft model for the cancer being treated.
- Examples of particular cancers that may be treated include but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More particular nonlimiting examples of such cancers include but are not limited to squamous cell cancer, small-cell lung cancer, pituitary cancer, esophageal cancer, astrocytoma, soft tissue sarcoma, non-small cell lung cancer (including squamous cell non-small cell lung cancer), adenocarcinoma of the lung, squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney cancer, renal cell carcinoma, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, brain cancer, endometrial cancer, testis cancer, cholangiocarcinoma, gallbladder carcinoma, gastric cancer, melanoma, and various types of head and neck cancer (including squamous cell carcinoma of the head and neck).
- In any of the above method embodiments, the CD80 ECD or CD80 ECD fusion molecule administered to the subject may inhibit tumor growth in a mouse syngeneic xenograft cancer model over a period of 1 week, 10 days, 2 weeks, or 3 weeks, for example, by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98%. In some embodiments, the CD80 ECD fusion molecule may inhibit tumor growth in a CT26 mouse xenograft tumor model by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98% at two weeks or at three weeks post-inoculation. In some such cases, the fusion molecule may be dosed one to three times at 0.3 to 3 mg/kg, such as at 0.3 to 0.6 mg/kg. In any of the above method embodiments, administration of the CD80 ECD or CD80 ECD fusion molecule administered to the subject may reduce the volume of at least one tumor in a human or animal subject by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98%, for example, over a period of one month, two months, three months, six months, or one year. In some cases, the CD80 ECD Fc fusion molecule may be capable of resulting in complete tumor regression in a mouse tumor model such as a CT26 model, for example in a significant portion of tested mice, such as at least 40%, or at least 50% of mice.
- In any of these methods, the CD80 ECD or CD80 ECD fusion molecule may be a CD80 ECD Fc comprising 10-60 mol SA to mol of CD80 ECD Fc protein, such as 15-60 mol SA/mol protein. In some embodiments, the content is 10-40 mol SA/mol protein, such as 15-40 mol SA/mol protein, such as 20-40 mol SA/mol protein, 20-30 mol SA/mol protein, 15-25 mol SA/mol protein, 15-30 mol SA to mol of protein, or 30-40 mol SA/mol protein. In some embodiments, the SA content is at least 15, such as at least 20, at least 25, at least 30, at least 35, or at least 40 mol SA/mol protein. In some embodiments, the SA content is 15, 20, 25, 30, 35, or 40 mol SA/mol protein. In some embodiments, the Fc domain is a human IgG1, IgG2, or IgG4 Fc domain. In some embodiments, the Fc domain comprises the amino acid sequence of SEQ ID NO:14. In some embodiments, the fusion molecule comprises the amino acid sequence of SEQ ID NO:20 or 21.
- Combination Treatments with Immune Stimulating Agents Including PD-1/PD-L1 Inhibitors
- In some embodiments, the CD80 ECD or CD80 ECD fusion molecule is administered to treat one of the above cancers in combination with an effective amount of at least one immune stimulating agent. Immune stimulating agents may include, for example, a small molecule drug or a biologic. Examples of biologic immune stimulating agents include, but are not limited to, antibodies, antibody fragments, fragments of receptor or ligand polypeptides, for example that block receptor-ligand binding, vaccines and cytokines.
- In some embodiments, the at least one immune stimulating agent comprises an agonist of an immune stimulatory molecule, including a co-stimulatory molecule, while in some embodiments, the at least one immune stimulating agent comprises an antagonist of an immune inhibitory molecule, including a co-inhibitory molecule. In some embodiments, the at least one immune stimulating agent comprises an agonist of an immune-stimulatory molecule, including a co-stimulatory molecule, found on immune cells, such as T cells. In some embodiments, the at least one immune stimulating agent comprises an antagonist of an immune inhibitory molecule, including a co-inhibitory molecule, found on immune cells, such as T cells. In some embodiments, the at least one immune stimulating agent comprises an agonist of an immune stimulatory molecule, including a co-stimulatory molecule, found on cells involved in innate immunity, such as NK cells. In some embodiments, the at least one immune stimulating agent comprises an antagonist of an immune inhibitory molecule, including a co-inhibitory molecule, found on cells involved in innate immunity, such as NK cells. In some embodiments, the combination enhances the antigen-specific T cell response in the treated subject and/or enhances the innate immunity response in the subject. In some embodiments, the combination results in an improved anti-tumor response in an animal cancer model, such as a syngeneic or xenograft model, compared to administration of either the CD80 ECD or CD80 ECD fusion molecule or immune stimulating agent alone. In some embodiments, the combination results in a synergistic response in an animal cancer model, such as a syngeneic or xenograft model, compared to administration of either the CD80 ECD or CD80 ECD fusion molecule or immune stimulating agent alone.
- In any of the above combination therapy method embodiments, the combination of the CD80 ECD or CD80 ECD fusion molecule with the immune stimulating agent, such as a PD-1/PD-L1 inhibitor, that is administered to the subject may inhibit tumor growth in a mouse syngeneic or xenograft cancer model over a period of 1 week, 10 days, 2 weeks, or 3 weeks, for example, by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98%. In any of the above combination therapy method embodiments, the combination of the CD80 ECD or CD80 ECD fusion molecule with the immune stimulating agent, such as a PD-1/PD-L1 inhibitor, that is administered to the subject may reduce the volume of at least one tumor in the subject or in an animal model by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, for example, over a period of one month, two months, three months, six months, or one year.
- In any of the combination therapy methods, the CD80 ECD or CD80 ECD fusion molecule may be a CD80 ECD Fc comprising 10-60 mol SA to mol of CD80 ECD Fc protein, such as 15-60 mol SA/mol protein. In some embodiments, the content is 10-40 mol SA/mol protein, such as 15-40 mol SA/mol protein, such as 20-40 mol SA/mol protein, 20-30 mol SA/mol protein, 15-25 mol SA/mol protein, 15-30 mol SA to mol of protein, or 30-40 mol SA/mol protein. In some embodiments, the SA content is at least 15, such as at least 20, at least 25, at least 30, at least 35, or at least 40 mol SA/mol protein. In some embodiments, the SA content is 15, 20, 25, 30, 35, or 40 mol SA/mol protein. In some embodiments, the Fc domain is a human IgG1, IgG2, or IgG4 Fc domain. In some embodiments, the Fc domain comprises the amino acid sequence of SEQ ID NO:14. In some embodiments, the fusion molecule comprises the amino acid sequence of SEQ ID NO:20 or 21.
- In certain embodiments, an immune stimulating agent targets a stimulatory or inhibitory molecule that is a member of the immunoglobulin super family (IgSF). For example, an immune stimulating agent may be an agent that targets (or binds specifically to) another member of the B7 family of polypeptides. An immune stimulating agent may be an agent that targets a member of the TNF family of membrane bound ligands or a co-stimulatory or co-inhibitory receptor binding specifically to a member of the TNF family. Exemplary TNF and TNFR family members that may be targeted by immune stimulating agents include CD40 and CD40L, OX-40, OX-40L, GITR, GITRL, CD70, CD27L, CD30, CD30L, 4-1BBL, CD137 (4-1BB), TRAIL/Apo2-L, TRAILR1/DR4, TRAILR2/DR5, TRAILR3, TRAILR4, OPG, RANK, RANKL, TWEAKR/Fn14, TWEAK, BAFFR, EDAR, XEDAR, TACI, APRIL, BCMA, LTβR, LIGHT, DcR3, HVEM, VEGI/TL1A, TRAMP/DR3, EDAR, EDA1, XEDAR, EDA2, TNFR1, Lymphotoxin α/TNFβ, TNFR2, TNFα, LTβR, Lymphotoxin α1β2, FAS, FASL, RELT, DR6, TROY and NGFR.
- In some embodiments, an immune stimulating agent may comprise (i) an antagonist of a protein that inhibits T cell activation (e.g., immune checkpoint inhibitor) such as CTLA4, LAG-3, TIM3,
Galectin 9, CEACAM-1, BTLA, CD69, Galectin-1, TIGIT, CD113, GPR56, VISTA, B7-H3, B7-H4, 2B4, CD48, GARP, PD1H, LAIR1, TIM-1, TIM-4, and ILT4 and/or may comprise (ii) an agonist of a protein that stimulates T cell activation such as B7-2, CD28, 4-1BB (CD137), 4-1BBL, ICOS, ICOS-L, OX40, OX40L, GITR, GITRL, CD70, CD27, CD40, CD40L, DR3 and CD28H. - In some embodiments, an immune stimulating agent may comprise an agent that inhibits or is an antagonist of a cytokine that inhibits T cell activation (e.g., IL-6, IL-10, TGF-β, VEGF, and other immunosuppressive cytokines), and it some embodiments an immune stimulating agent may comprise an agent that is an agonist of a cytokine, such as IL-2, IL-7, IL-12, IL-15, IL-21 and IFNα (e.g., the cytokine itself) that stimulates T cell activation. In some embodiments, immune stimulating agents may comprise an antagonist of a chemokine, such as CXCR2 (e.g., MK-7123), CXCR4 (e.g. AMD3100), CCR2, or CCR4 (mogamulizumab).
- In some embodiments, immune stimulating agents may include antagonists of inhibitory receptors on NK cells or agonists of activating receptors on NK cells. For example, a CD80 ECD or CD80 ECD fusion molecule can be combined with an antagonist of KIR.
- Immune stimulating agents may also include agents that inhibit TGF-β signaling, agents that enhance tumor antigen presentation, e.g., dendritic cell vaccines, GM-CSF secreting cellular vaccines, CpG oligonucleotides, and imiquimod, or therapies that enhance the immunogenicity of tumor cells (e.g., anthracyclines).
- Immune stimulating agents may also include certain vaccines such as mesothelin-targeting vaccines or attenuated listeria cancer vaccines, such as CRS-207.
- Immune stimulating agents may also comprise agents that deplete or block Treg cells, such as agents that specifically bind to CD25.
- Immune stimulating agents may also comprise agents that inhibit a metabolic enzyme such as indoleamine dioxigenase (IDO), dioxigenase, arginase, or nitric oxide synthetase.
- Immune stimulating agents may also comprise agents that inhibit the formation of adenosine or inhibit the adenosine A2A receptor.
- Immune stimulating agents may also comprise agents that reverse/prevent T cell anergy or exhaustion and agents that trigger an innate immune activation and/or inflammation at a tumor site.
- In some embodiments, immune stimulating agents may comprise a CD40 agonist such as a CD40 agonist antibody. The CD80 ECD or CD80 ECD fusion molecule may also be combined with a combinatorial approach that targets multiple elements of the immune pathway, such as one or more of the following: at least one agent that enhances tumor antigen presentation (e.g., dendritic cell vaccine, GM-CSF secreting cellular vaccines, CpG oligonucleotides, imiquimod); at least one agent that inhibits negative immune regulation e.g., by inhibiting CTLA4 pathway and/or depleting or blocking Treg or other immune suppressing cells; a therapy that stimulates positive immune regulation, e.g., with agonists that stimulate the CD-137, OX-40 and/or GITR pathway and/or stimulate T cell effector function; at least one agent that increases systemically the frequency of anti-tumor T cells; a therapy that depletes or inhibits Tregs, such as Tregs in the tumor, e.g., using an antagonist of CD25 (e.g., daclizumab) or by ex vivo anti-CD25 bead depletion; at least one agent that impacts the function of suppressor myeloid cells in the tumor; a therapy that enhances immunogenicity of tumor cells (e.g., anthracyclines); adoptive T cell or NK cell transfer including genetically modified cells, e.g., cells modified by chimeric antigen receptors (CAR-T therapy); at least one agent that inhibits a metabolic enzyme such as indoleamine dioxigenase (IDO), dioxigenase, arginase or nitric oxide synthetase; at least one agent that reverses/prevents T cell anergy or exhaustion; a therapy that triggers an innate immune activation and/or inflammation at a tumor site; administration of immune stimulatory cytokines or blocking of immuno repressive cytokines.
- For example, a CD80 ECD or CD80 ECD fusion molecule can be used with one or more agonistic agents that ligate positive costimulatory receptors; one or more antagonists (blocking agents) that attenuate signaling through inhibitory receptors, such as antagonists that overcome distinct immune suppressive pathways within the tumor microenvironment; one or more agents that increase systemically the frequency of anti-tumor immune cells, such as T cells, deplete or inhibit Tregs (e.g., by inhibiting CD25); one or more agents that inhibit metabolic enzymes such as IDO; one or more agents that reverse/prevent T cell anergy or exhaustion; and one or more agents that trigger innate immune activation and/or inflammation at tumor sites.
- In one embodiment, the at least one immune stimulating agent comprises a CTLA4 antagonist, such as an antagonistic CTLA4 antibody. Suitable CTLA4 antibodies include, for example, YERVOY (ipilimumab) or tremelimumab.
- In some embodiments, the at least one immune stimulating agent comprises a LAG-3 antagonist, such as an antagonistic LAG-3 antibody. Suitable LAG-3 antibodies include, for example, BMS-986016 (WO10/19570, WO014/08218), or IMP-731 or IMP-321 (WO08/132601, WO09/44273).
- In some embodiments, the at least one immune stimulating agent comprises a CD137 (4-1BB) agonist, such as an agonistic CD137 antibody. Suitable CD137 antibodies include, for example, urelumab or PF-05082566 (WO12/32433).
- In some embodiments, the at least one immune stimulating agent comprises a GITR agonist, such as an agonistic GITR antibody. Suitable GITR antibodies include, for example, TRX-518 (WO06/105021, WO09/009116), MK-4166 (WO11/028683) or a GITR antibody disclosed in WO2015/031667.
- In some embodiments, the at least one immune stimulating agent comprises an OX40 agonist, such as an agonistic OX40 antibody. Suitable OX40 antibodies include, for example, MEDI-6383, MEDI-6469 or MOXR0916 (RG7888; WO06/029879).
- In some embodiments, the at least one immune stimulating agent comprises a CD27 agonist, such as an agonistic CD27 antibody. Suitable CD27 antibodies include, for example, varlilumab (CDX-1127).
- In some embodiments, the at least one immune stimulating agent comprises MGA271, which targets B7H3 (WO11/109400).
- In some embodiments, the at least one immune stimulating agent comprises a KIR antagonist, such as lirilumab.
- In some embodiments, the at least one immune stimulating agent comprises an IDO antagonist. IDO antagonists include, for example, INCB-024360 (WO2006/122150, WO07/75598, WO08/36653, WO08/36642), indoximod, NLG-919 (WO09/73620, WO09/1156652, WO11/56652, WO12/142237) or F001287.
- In some embodiments, the at least one immune stimulating agent comprises a Toll-like receptor agonist, e.g., a TLR2/4 agonist (e.g., Bacillus Calmette-Guerin); a TLR7 agonist (e.g., Hiltonol or Imiquimod); a TLR7/8 agonist (e.g., Resiquimod); or a TLR9 agonist (e.g., CpG7909).
- In some embodiments, the at least one immune stimulating agent comprises a TGF-β inhibitor, e.g., GC1008, LY2157299, TEW7197 or IMC-TR1.
- In some embodiments, the CD80 ECD or CD80 ECD fusion molecule is administered to treat one of the above cancers in combination with an effective amount of a PD-1/PD-L1 inhibitor.
- Exemplary PD-1/PD-L1 Inhibitors
- PD-1/PD-L1 inhibitors include antibodies, fusion proteins, and peptides. A nonlimiting exemplary fusion protein that is a PD-1/PD-L1 inhibitor is AMP-224 (Amplimmune, GlaxoSmithKline). A nonlimiting exemplary peptide that is a PD-1/PD-L1 inhibitor is AUR-012. Other exemplary PD-1/PD-L1 inhibitors include antibodies that inhibit PD-1, such as anti-PD-1 antibodies and anti-PD-L1 antibodies. Such antibodies may be humanized antibodies, chimeric antibodies, mouse antibodies, and human antibodies.
- In some embodiments, the combination results in an improved anti-tumor response in an animal cancer model, such as a xenograft model, compared to administration of either the CD80 ECD or CD80 ECD fusion molecule or PD-1/PD-L1 inhibitor alone. In some embodiments, the combination results in a synergistic response in an animal cancer model, such as a xenograft model, compared to administration of either the CD80 ECD or CD80 ECD fusion molecule or PD-1/PD-L1 inhibitor alone.
- PD-1 is a key immune checkpoint receptor expressed by activated T and B cells and mediates immunosuppression. PD-1 is a member of the CD28 family of receptors, which includes CD28, CTLA4, ICOS, PD-1, and BTLA. Two cell surface glycoprotein ligands for PD-1 have been identified, Programmed Death Ligand-1 (PD-L1) and Programmed Death Ligand-2 (PD-L2). These ligands are expressed on antigen-presenting cells as well as many human cancers and have been shown to down regulate T cell activation and cytokine secretion upon binding to PD-1. Inhibition of the PD-1/PD-L1 interaction mediates potent antitumor activity in preclinical models.
- Human monoclonal antibodies (HuMAbs) that bind specifically to PD-1 with high affinity have been disclosed in U.S. Pat. No. 8,008,449. Other anti-PD-1 mAbs have been described in, for example, U.S. Pat. Nos. 6,808,710, 7,488,802, 8,168,757 and 8,354,509, and PCT Publication No. WO 2012/145493. Each of the anti-PD-1 HuMAbs disclosed in U.S. Pat. No. 8,008,449: (a) binds to human PD-1 with a KD of 1×10−7 M or less, as determined by surface plasmon resonance using a Biacore biosensor system; (b) does not substantially bind to human CD28, CTLA-4 or ICOS; (c) increases T-cell proliferation in a Mixed Lymphocyte Reaction (MLR) assay; (d) increases interferon-γ production in an MLR assay; (e) increases IL-2 secretion in an MLR assay; (f) binds to human PD-1 and cynomolgus monkey PD-1; (g) inhibits the binding of PD-L1 and/or PD-L2 to PD-1; (h) stimulates antigen-specific memory responses; (i) stimulates antibody responses; and/or (j) inhibits tumor cell growth in vivo. Anti-PD-1 antibodies usable in the present invention include antibodies that bind specifically to human PD-1 and exhibit at least one, at least two, at least three, at least four or at least five of the preceding characteristics (a) through (j).
- In one embodiment, the anti-PD-1 antibody is nivolumab. Nivolumab (also known as “Opdivo®”; formerly designated 5C4, BMS-936558, MDX-1106, or ONO-4538) is a fully human IgG4 (S228P) PD-1 immune checkpoint inhibitor antibody that selectively prevents interaction with PD-1 ligands (PD-L1 and PD-L2), thereby blocking the down-regulation of antitumor T-cell functions (U.S. Pat. No. 8,008,449; Wang et al., 2014 Cancer Immunol Res. 2(9):846-56).
- In another embodiment, the anti-PD-1 antibody is pembrolizumab. Pembrolizumab (also known as “Keytruda®”, lambrolizumab, and MK-3475) is a humanized monoclonal IgG4 antibody directed against human cell surface receptor PD-1 (programmed death-1 or programmed cell death-1). Pembrolizumab is described, for example, in U.S. Pat. No. 8,900,587; see also the site with the address: “www” dot “cancer” dot “gov” slash “drugdictionary?cdrid=695789” (last accessed: Dec. 14, 2014). Pembrolizumab has been approved by the FDA for the treatment of relapsed or refractory melanoma.
- In other embodiments, the anti-PD-1 antibody is MEDI0608 (formerly AMP-514), which is a monoclonal antibody against the PD-1 receptor. MEDI0608 is described, for example, in U.S. Pat. No. 8,609,089, B2 or at www “dot” cancer “dot” gov “slash” drugdictionary?cdrid=756047 (last accessed Dec. 14, 2014).
- In some embodiments, the anti-PD-1 antibody is Pidilizumab (CT-011), which is a humanized monoclonal antibody. Pidilizumab is described in U.S. Pat. No. 8,686,119 B2 or WO 2013/014668 A1.
- Anti-PD-1 antibodies usable in the disclosed methods also include isolated antibodies that bind specifically to human PD-1 and cross-compete for binding to human PD-1 with nivolumab (see, e.g., U.S. Pat. No. 8,008,449; WO 2013/173223). The ability of antibodies to cross-compete for binding to an antigen indicates that these antibodies bind to the same epitope region of the antigen and sterically hinder the binding of other cross-competing antibodies to that particular epitope region. These cross-competing antibodies are expected to have functional properties very similar to those of nivolumab by virtue of their binding to the same epitope region of PD-1. Cross-competing antibodies can be readily identified based on their ability to cross-compete with nivolumab in standard PD-1 binding assays such as Biacore analysis, ELISA assays or flow cytometry (see, e.g., WO 2013/173223).
- In certain embodiments, the antibodies that cross-compete for binding to human PD-1 with, or bind to the same epitope region of human PD-1 as, nivolumab are monoclonal antibodies. For administration to human subjects, these cross-competing antibodies can be chimeric antibodies, or can be humanized or human antibodies.
- Anti-PD-1 antibodies usable in the methods of the disclosed invention also include antigen-binding portions of the above antibodies. Examples include (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab′)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains; and (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody.
- Administration of CD80 ECDs or CD80 ECD Fusion Proteins in Combination with Immune Stimulating Agents or PD-1/PD-L1 Inhibitors
- In some embodiments, the CD80 ECD or CD80 ECD fusion molecule and the immune stimulating agent or PD-1/PD-L1 inhibitor are administered concurrently. In some embodiments, the CD80 ECD or CD80 ECD fusion molecule and the immune stimulating agent or PD-1/PD-L1 inhibitor are administered sequentially. In some embodiments, at least one, at least two, at least three doses, at least five doses, or at least ten doses of a CD80 ECD or CD80 fusion molecule is administered prior to administration of an immune stimulating agent or PD-1/PD-L1 inhibitor. In some embodiments, at least one, at least two, at least three doses, at least five doses, or at least ten doses of an immune stimulating agent or PD-1/PD-L1 inhibitor is administered prior to administration of a CD80 ECD or CD80 fusion molecule. In some embodiments, the last dose of immune stimulating agent or PD-1/PD-L1 inhibitor is administered at least one, two, three, five, days or ten, or one, two, three, five, twelve, or twenty four weeks prior to the first dose of CD80 ECD or CD80 fusion molecule. In some other embodiment, the last dose of CD80 ECD or CD80 fusion molecule is administered at least one, two, three, five, days or ten, or one, two, three, five, twelve, or twenty four weeks prior to the first dose of immune stimulating agent or PD-1/PD-L1 inhibitor. In some embodiments, a subject has received, or is receiving, immune stimulating agent or PD-1/PD-L1 inhibitor therapy, and a CD80 ECD or CD80 fusion molecule is added to the therapeutic regimen.
- In some embodiments, the subject is an immune stimulating agent or PD-1/PD-L1 inhibitor inadequate responder (i.e. shows resistance to one or more immune stimulating agents or PD-1/PD-L1 inhibitors). A subject who is a PD-1/PD-L1 inhibitor inadequate responder, for example, may have previously responded to a PD-1/PD-L1 inhibitor, but may have become less responsive to the PD-1/PD-L1 inhibitor, or the subject may have never responded to the PD-1/PD-L1 inhibitor. Inadequate response to an immune stimulating agent or PD-1/PD-L1 inhibitor means that aspects of the condition that would be expected to improve following a standard dose of the PD-1/PD-L1 inhibitor do not improve, and/or improvement only occurs if greater than a standard dose is administered. In some embodiments, an immune stimulating agent or PD-1/PD-L1 inhibitor inadequate responder has experienced, or is experiencing, an inadequate response to the drug after receiving a standard dose for at least two weeks, at least three weeks, at least four weeks, at least six weeks, or at least twelve weeks. A “standard” dose of an immune stimulating agent or PD-1/PD-L1 inhibitor may be determined by a medical professional, and may depend on the subject's age, weight, healthy history, severity of disease, the frequency of dosing, etc. In some embodiments, an immune stimulating agent or PD-1/PD-L1 inhibitor inadequate responder has experienced, or is experiencing, an inadequate response to an anti-PD-1 antibody and/or an anti-PD-L1 antibody. In some embodiments, a PD-1/PD-L1 inhibitor inadequate responder has experienced, or is experiencing, an inadequate response to AMP-224. In some embodiments, a PD-1/PD-L1 inhibitor inadequate responder has experienced, or is experiencing, an inadequate response to a PD-1/PD-L1 inhibitor selected from nivolumab, pidilizumab, and pembrolizumab.
- In any of the above embodiments, the combination of the CD80 ECD or CD80 ECD fusion molecule with the PD-1/PD-L1 inhibitor that is administered to the subject may inhibit tumor growth in a mouse syngeneic or xenograft cancer model over a period of 1 week, 10 days, or 2 weeks, for example, by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98%. In any of the above combination therapy method embodiments, the combination of the CD80 ECD or CD80 ECD fusion molecule with the PD-1/PD-L1 inhibitor that is administered to the subject may reduce the volume of at least one tumor in the subject or in an animal model subject by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98%, for example, over a period of one month, two months, three months, six months, or one year.
- In any of these combination therapy methods, the CD80 ECD or CD80 ECD fusion molecule may be a CD80 ECD Fc comprising 10-60 mol SA to mol of CD80 ECD Fc protein, such as 15-60 mol SA/mol protein. In some embodiments, the content is 10-40 mol SA/mol protein, such as 15-40 mol SA/mol protein, such as 20-40 mol SA/mol protein, 20-30 mol SA/mol protein, 15-25 mol SA/mol protein, 15-30 mol SA to mol of protein, or 30-40 mol SA/mol protein. In some embodiments, the SA content is at least 15, such as at least 20, at least 25, at least 30, at least 35, or at least 40 mol SA/mol protein. In some embodiments, the SA content is 15, 20, 25, 30, 35, or 40 mol SA/mol protein. In some embodiments, the Fc domain is a human IgG1, IgG2, or IgG4 Fc domain. In some embodiments, the Fc domain comprises the amino acid sequence of SEQ ID NO:14. In some embodiments, the fusion molecule comprises the amino acid sequence of SEQ ID NO:20 or 21.
- In various embodiments, polypeptides and fusion molecules may be administered in vivo by various routes, including, but not limited to, oral, intra-arterial, parenteral, intranasal, intravenous, intramuscular, intracardiac, intraventricular, intratracheal, buccal, rectal, intraperitoneal, intradermal, topical, transdermal, and intrathecal, or otherwise by implantation or inhalation. The subject compositions may be formulated into preparations in solid, semi-solid, liquid, or gaseous forms; including, but not limited to, tablets, capsules, powders, granules, ointments, solutions, suppositories, enemas, injections, inhalants, and aerosols. A nucleic acid molecule encoding a polypeptide may be coated onto gold microparticles and delivered intradermally by a particle bombardment device, or “gene gun,” as described in the literature (see, e.g., Tang et al., Nature 356:152-154 (1992)). The appropriate formulation and route of administration may be selected according to the intended application.
- In various embodiments, polypeptide-comprising compositions are provided in formulations with a wide variety of pharmaceutically acceptable carriers (see, e.g., Gennaro, Remington: The Science and Practice of Pharmacy with Facts and Comparisons: Drugfacts Plus, 20th ed. (2003); Ansel et al., Pharmaceutical Dosage Forms and Drug Delivery Systems, 7th ed., Lippencott Williams and Wilkins (2004); Kibbe et al., Handbook of Pharmaceutical Excipients, 3rd ed., Pharmaceutical Press (2000)). Various pharmaceutically acceptable carriers, which include vehicles, adjuvants, and diluents, are available. Moreover, various pharmaceutically acceptable auxiliary substances, such as pH adjusting and buffering agents, tonicity adjusting agents, stabilizers, wetting agents and the like, are also available. Non-limiting exemplary carriers include saline, buffered saline, dextrose, water, glycerol, ethanol, and combinations thereof.
- In various embodiments, compositions comprising polypeptides and fusion molecules may be formulated for injection, including subcutaneous administration, by dissolving, suspending, or emulsifying them in an aqueous or nonaqueous solvent, such as vegetable or other oils, synthetic aliphatic acid glycerides, esters of higher aliphatic acids, or propylene glycol; and if desired, with conventional additives such as solubilizers, isotonic agents, suspending agents, emulsifying agents, stabilizers and preservatives. In various embodiments, the compositions may be formulated for inhalation, for example, using pressurized acceptable propellants such as dichlorodifluoromethane, propane, nitrogen, and the like. The compositions may also be formulated, in various embodiments, into sustained release microcapsules, such as with biodegradable or non-biodegradable polymers. A non-limiting exemplary biodegradable formulation includes poly lactic acid-glycolic acid polymer. A non-limiting exemplary non-biodegradable formulation includes a polyglycerin fatty acid ester. Certain methods of making such formulations are described, for example, in
EP 1 125 584 A1. - Pharmaceutical packs and kits comprising one or more containers, each containing one or more doses of a polypeptide or combination of polypeptides are also provided. In some embodiments, a unit dosage is provided wherein the unit dosage contains a predetermined amount of a composition comprising a polypeptide or combination of polypeptides, with or without one or more additional agents. In some embodiments, such a unit dosage is supplied in a single-use prefilled syringe for injection. In various embodiments, the composition contained in the unit dosage may comprise saline, sucrose, or the like; a buffer, such as phosphate, or the like; and/or be formulated within a stable and effective pH range. Alternatively, in some embodiments, the composition may be provided as a lyophilized powder that may be reconstituted upon addition of an appropriate liquid, for example, sterile water. In some embodiments, the composition comprises one or more substances that inhibit protein aggregation, including, but not limited to, sucrose and arginine. In some embodiments, a composition of the invention comprises heparin and/or a proteoglycan.
- Pharmaceutical compositions are administered in an amount effective for treatment or prophylaxis of the specific indication. The therapeutically effective amount is typically dependent on the weight of the subject being treated, his or her physical or health condition, the extensiveness of the condition to be treated, or the age of the subject being treated. In some embodiments, a PD-1/PD-L1 inhibitor, such as an antibody or fusion protein, is administered with the CD80 ECD or CD80 ECD fusion molecule at a dose of 1 to 4 mg/kg. In some embodiments, a PD-1/PD-L1 inhibitor is administered at a dose of 1, 2, 3, or 4 mg/kg.
- Determination of the frequency of administration may be made by persons skilled in the art, such as an attending physician based on considerations of the condition being treated, age of the subject being treated, severity of the condition being treated, general state of health of the subject being treated and the like. In some embodiments, an effective dose of a CD80 ECD or CD80 ECD fusion molecule is administered to a subject one or more times. In various embodiments, an effective dose is administered to the subject once a month, less than once a month, such as, for example, every two months or every three months. In other embodiments, an effective dose is administered more than once a month, such as, for example, every three weeks, every two weeks or every week. In some embodiments, an effective dose is administered once per 1, 2, 3, 4, or 5 weeks. In some embodiments, an effective dose is administered twice or three times per week. An effective dose is administered to the subject at least once. In some embodiments, the effective dose may be administered multiple times, including for periods of at least a month, at least six months, or at least a year.
- CD80 ECDs or CD80 ECD fusion molecules may be administered alone, with PD-1/PD-L1 inhibitors, and/or with other modes of treatment. CD80 ECDs or CD80 ECD fusion molecules may be provided before, substantially contemporaneous with, or after other modes of treatment, for example, surgery, chemotherapy, radiation therapy, or the administration of another biologic. In some embodiments, the cancer has recurred or progressed following a therapy selected from surgery, chemotherapy, and radiation therapy, or a combination thereof.
- For treatment of cancer, CD80 ECDs or CD80 ECD fusion molecules may be administered in conjunction with one or more additional anti-cancer agents, such as the chemotherapeutic agent, growth inhibitory agent, anti-angiogenesis agent and/or anti-neoplastic composition. Nonlimiting examples of chemotherapeutic agent, growth inhibitory agent, anti-angiogenesis agent, anti-cancer agent and anti-neoplastic composition that can be used in combination with the antibodies of the present invention are provided in the following definitions.
- In any of the above combination therapy method embodiments, the therapy administered to the subject may inhibit tumor growth in a mouse syngeneic or xenograft cancer model over a period of 1 week, 10 days, or 2 weeks, for example, by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%. In any of the above combination therapy method embodiments, the therapy administered to the subject may reduce the volume of at least one tumor in the subject or in an animal model subject by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98%, for example, over a period of one month, two months, three months, six months, or one year.
- In any of these further combination therapy methods, the CD80 ECD or CD80 ECD fusion molecule may be a CD80 ECD Fc comprising 10-60 mol SA to mol of CD80 ECD Fc protein, such as 15-60 mol SA/mol protein. In some embodiments, the content is 10-40 mol SA/mol protein, such as 15-40 mol SA/mol protein, such as 20-40 mol SA/mol protein, 20-30 mol SA/mol protein, 15-25 mol SA/mol protein, 15-30 mol SA to mol of protein, or 30-40 mol SA/mol protein. In some embodiments, the SA content is at least 15, such as at least 20, at least 25, at least 30, at least 35, or at least 40 mol SA/mol protein. In some embodiments, the SA content is 15, 20, 25, 30, 35, or 40 mol SA/mol protein. In some embodiments, the Fc domain is a human IgG1, IgG2, or IgG4 Fc domain. In some embodiments the Fc domain comprises the amino acid sequence of SEQ ID NO:14. In some embodiments, the fusion molecule comprises the amino acid sequence of SEQ ID NO:20 or 21.
- A “chemotherapeutic agent” is a chemical compound useful in the treatment of cancer. Examples of chemotherapeutic agents include, but are not limited to, alkylating agents such as thiotepa and Cytoxan® cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphoramide and trimethylolomelamine; acetogenins (especially bullatacin and bullatacinone); a camptothecin (including the synthetic analogue topotecan); bryostatin; callystatin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogues); cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (including the synthetic analogues, KW-2189 and CB1-TM1); eleutherobin; pancratistatin; a sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, and ranimnustine; antibiotics such as the enediyne antibiotics (e.g., calicheamicin, especially calicheamicin gamma1I and calicheamicin omegaI1 (see, e.g., Agnew, Chem Intl. Ed. Engl., 33: 183-186 (1994)); dynemicin, including dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antiobiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, Adriamycin® doxorubicin (including morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin and deoxydoxorubicin), epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate and 5-fluorouracil (5-FU); folic acid analogues such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elfornithine; elliptinium acetate; an epothilone; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidainine; maytansinoids such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidanmol; nitraerine; pentostatin; phenamet; pirarubicin; losoxantrone; podophyllinic acid; 2- ethylhydrazide; procarbazine; PSKI polysaccharide complex (JHS Natural Products, Eugene, Oreg.); razoxane; rhizoxin; sizofiran; spirogermanium; tenuazonic acid; triaziquone; 2,2′,2″-trichlorotriethylamine; trichothecenes (especially T-2 toxin, verracurin A, roridin A and anguidine); urethan; vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside (“Ara-C”); cyclophosphamide; thiotepa; taxoids, e.g., Taxol® paclitaxel (Bristol- Myers Squibb Oncology, Princeton, N.J.), Abraxane® Cremophor-free, albumin-engineered nanoparticle formulation of paclitaxel (American Pharmaceutical Partners, Schaumberg, Ill.), and Taxotere® doxetaxel (Rhône- Poulenc Rorer, Antony, France); chloranbucil; Gemzar® gemcitabine; 6-thioguanine; mercaptopurine; methotrexate; platinum analogs such as cisplatin, oxaliplatin and carboplatin; vinblastine; platinum; etoposide (VP-16); ifosfamide; mitoxantrone; vincristine; Navelbine® vinorelbine; novantrone; teniposide; edatrexate; daunomycin; aminopterin; xeloda; ibandronate; irinotecan (Camptosar, CPT-11) (including the treatment regimen of irinotecan with 5-FU and leucovorin); topoisomerase inhibitor RFS 2000; difluorometlhylornithine (DMFO); retinoids such as retinoic acid; capecitabine; combretastatin; leucovorin (LV); oxaliplatin, including the oxaliplatin treatment regimen (FOLFOX); inhibitors of PKC-alpha, Raf, H-Ras, EGFR (e.g., erlotinib (Tarceva®)) and VEGF-A that reduce cell proliferation and pharmaceutically acceptable salts, acids or derivatives of any of the above.
- Further nonlimiting exemplary chemotherapeutic agents include anti-hormonal agents that act to regulate or inhibit hormone action on cancers such as anti-estrogens and selective estrogen receptor modulators (SERMs), including, for example, tamoxifen (including Nolvadex® tamoxifen), raloxifene, droloxifene, 4-hydroxytamoxifen, trioxifene, keoxifene, LY117018, onapristone, and Fareston® toremifene; aromatase inhibitors that inhibit the enzyme aromatase, which regulates estrogen production in the adrenal glands, such as, for example, 4(5)-imidazoles, aminoglutethimide, Megase® megestrol acetate, Aromasin® exemestane, formestanie, fadrozole, Rivisor® vorozole, Femara® letrozole, and Arimidex® anastrozole; and anti-androgens such as flutamide, nilutamide, bicalutamide, leuprolide, and goserelin; as well as troxacitabine (a 1,3-dioxolane nucleoside cytosine analog); antisense oligonucleotides, particularly those which inhibit expression of genes in signaling pathways implicated in abherant cell proliferation, such as, for example, PKC-alpha, Ralf and H-Ras; ribozymes such as a VEGF expression inhibitor (e.g., Angiozyme® ribozyme) and a HER2 expression inhibitor; vaccines such as gene therapy vaccines, for example, Allovectin® vaccine, Leuvectin® vaccine, and Vaxid® vaccine; Proleukin® rIL-2; Lurtotecan® topoisomerase 1 inhibitor; Abarelix® rmRH; and pharmaceutically acceptable salts, acids or derivatives of any of the above.
- An “anti-angiogenesis agent” or “angiogenesis inhibitor” refers to a small molecular weight substance, a polynucleotide (including, e.g., an inhibitory RNA (RNAi or siRNA)), a polypeptide, an isolated protein, a recombinant protein, an antibody, or conjugates or fusion proteins thereof, that inhibits angiogenesis, vasculogenesis, or undesirable vascular permeability, either directly or indirectly. It should be understood that the anti-angiogenesis agent includes those agents that bind and block the angiogenic activity of the angiogenic factor or its receptor. For example, an anti-angiogenesis agent is an antibody or other antagonist to an angiogenic agent, e.g., antibodies to VEGF-A (e.g., bevacizumab (Avastin®)) or to the VEGF-A receptor (e.g., KDR receptor or Flt-1 receptor), anti-PDGFR inhibitors such as Gleevec® (Imatinib Mesylate), small molecules that block VEGF receptor signaling (e.g., PTK787/ZK2284, SU6668, Sutent®/SU11248 (sunitinib malate), AMG706, or those described in, e.g., international patent application WO 2004/113304). Anti-angiogensis agents also include native angiogenesis inhibitors, e.g., angiostatin, endostatin, etc. See, e.g., Klagsbrun and D'Amore (1991) Annu. Rev. Physiol. 53:217-39; Streit and Detmar (2003) Oncogene 22:3172-3179 (e.g., Table 3 listing anti-angiogenic therapy in malignant melanoma); Ferrara & Alitalo (1999) Nature Medicine 5(12):1359-1364; Tonini et al. (2003) Oncogene 22:6549-6556 (e.g., Table 2 listing known anti-angiogenic factors); and, Sato (2003) Int. J. Clin. Oncol. 8:200-206 (e.g., Table 1 listing anti-angiogenic agents used in clinical trials).
- A “growth inhibitory agent” as used herein refers to a compound or composition that inhibits growth of a cell (such as a cell expressing VEGF) either in vitro or in vivo. Thus, the growth inhibitory agent may be one that significantly reduces the percentage of cells (such as a cell expressing VEGF) in S phase. Examples of growth inhibitory agents include, but are not limited to, agents that block cell cycle progression (at a place other than S phase), such as agents that induce G1 arrest and M-phase arrest. Classical M-phase blockers include the vincas (vincristine and vinblastine), taxanes, and topoisomerase II inhibitors such as doxorubicin, epirubicin, daunorubicin, etoposide, and bleomycin. Those agents that arrest G1 also spill over into S-phase arrest, for example, DNA alkylating agents such as tamoxifen, prednisone, dacarbazine, mechlorethamine, cisplatin, methotrexate, 5-fluorouracil, and ara-C. Further information can be found in Mendelsohn and Israel, eds., The Molecular Basis of Cancer,
Chapter 1, entitled “Cell cycle regulation, oncogenes, and antineoplastic drugs” by Murakami et al. (W.B. Saunders, Philadelphia, 1995), e.g., p. 13. The taxanes (paclitaxel and docetaxel) are anticancer drugs both derived from the yew tree. Docetaxel (Taxotere®, Rhone-Poulenc Rorer), derived from the European yew, is a semisynthetic analogue of paclitaxel (Taxol®, Bristol-Myers Squibb). Paclitaxel and docetaxel promote the assembly of microtubules from tubulin dimers and stabilize microtubules by preventing depolymerization, which results in the inhibition of mitosis in cells. - The term “anti-neoplastic composition” refers to a composition useful in treating cancer comprising at least one active therapeutic agent. Examples of therapeutic agents include, but are not limited to, e.g., chemotherapeutic agents, growth inhibitory agents, cytotoxic agents, agents used in radiation therapy, anti-angiogenesis agents, other cancer immunotherapeutic agents aside from PD-1/PD-L1 inhibitors, apoptotic agents, anti-tubulin agents, and other-agents to treat cancer, such as anti-HER-2 antibodies, anti-CD20 antibodies, an epidermal growth factor receptor (EGFR) antagonist (e.g., a tyrosine kinase inhibitor), HER1/EGFR inhibitor (e.g., erlotinib (Tarceva®), platelet derived growth factor inhibitors (e.g., Gleevec® (Imatinib Mesylate)), a COX-2 inhibitor (e.g., celecoxib), interferons, CTLA-4 inhibitors (e.g., anti-CTLA antibody ipilimumab (YERVOY®)), PD-L2 inhibitors (e.g., anti-PD-L2 antibodies), TIM3 inhibitors (e.g., anti-TIM3 antibodies), cytokines, antagonists (e.g., neutralizing antibodies) that bind to one or more of the following targets ErbB2, ErbB3, ErbB4, PDGFR-beta, BlyS, APRIL, BCMA, PD-L2, CTLA-4, TIM3, or VEGF receptor(s), TRAIL/Apo2, and other bioactive and organic chemical agents, etc. Combinations thereof are also included in the invention.
- The examples discussed below are intended to be purely exemplary of the invention and should not be considered to limit the invention in any way. The examples are not intended to represent that the experiments below are all or the only experiments performed. Efforts have been made to ensure accuracy with respect to numbers used (for example, amounts, temperature, etc.) but some experimental errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, molecular weight is weight average molecular weight, temperature is in degrees Centigrade, and pressure is at or near atmospheric.
- Seven-week old female BALB/c mice were purchased from Charles River Laboratories (Hollister, Calif.) and were acclimated for two weeks before the start of the study. The murine colorectal carcinoma cell line CT26 was implanted subcutaneously over the right flank of the mice at 1.0×106 cells/200 μl/mouse. Prior to inoculation, the cells were cultured for no more than three passages in RPMI 1640 medium supplemented with 10% heat-inactivated Fetal Bovine Serum (FBS), 2 mM L-Glutamine. Cells were grown at 37° C. in a humidified atmosphere with 5% CO2. Upon reaching 80-85% confluence, cells were harvested and resuspended in a 1:1 mixture of serum-free RPMI 1640 and Matrigel® at 5×106 cells per milliliter.
- Mice were monitored twice-weekly following cell implantation for tumor growth. For tumor measurements, the length and width of each tumor was measured using calipers and volume was calculated according to the formula: Tumor volume (mm3)=(width (mm)×length (mm)) 2/2. On
Day 7, all tumors were measured, and mice were randomly assigned to treatment groups. The mean tumor volume for all animals enrolled into treatment groups was 175 mm3. Mice were administered Saline or plasmid DNA via RIPPS℠. Plasmid DNA that was administered via RIPPS℠ contained the sequence for the extracellular domain (ECD) of murine CD80 or CTLA4 as well as the Fc domain of human IgG2a. Tumors continued to be measured at least twice per week until tumor volume exceeded 10% of animal weight, or approximately 2000 mm3. - The change in tumor size is shown by graphing mean tumor volume relative to the day upon which animals were inoculated with CT26 cells. (
FIG. 1a .) RIPPS with mouse CD80 ECD significantly reduced tumor growth compared to Saline control (p<0.05) beginning on Day 11. (FIG. 1a-b .) P-values were calculated using unpaired, two-tailed t-test analyses of the calculated tumor volumes on each day of the study (*p<0.05, **p<0.01, ***p<0.001). Tumor growth inhibition by CD80 ECD was determined to be 78.8% compared to saline control, which was calculated as 100×(1-(mean change in tumor volume for CD80/mean change in tumor volume for saline)). As also shown inFIG. 1a , RIPPS with mouse CTLA4-ECD Fc actually enhanced tumor growth compared to the saline control. One explanation for this result is that the CTLA4-ECD Fc construct might have acted as a ligand trap for CD80, preventing CD80 from binding to CD28 and stimulating T cell activity against tumor cells. - Seven-week old female BALB/c mice were purchased from Charles River Laboratories (Hollister, Calif.) and were acclimated for 12 days before the start of the study. The murine colorectal carcinoma cell line CT26 was implanted subcutaneously over the right flank of the mice at 1.0×106 cells/200 μl/mouse. Prior to inoculation, the cells were cultured for no more than three passages in RPMI 1640 medium supplemented with 10% heat-inactivated Fetal Bovine Serum (FBS), 2 mM L-Glutamine. Cells were grown at 37° C. in a humidified atmosphere with 5% CO2. Upon reaching 80-85% confluence, cells were harvested and resuspended in a 1:1 mixture of serum-free RPMI 1640 and Matrigel® at 5×106 cells per milliliter.
- Mice were monitored twice-weekly following cell implantation for tumor growth. For tumor measurements, the length and width of each tumor was measured using calipers and volume was calculated according to the formula: Tumor volume (mm3)=(width (mm)×length (mm)) 2/2. On
Day 7, all tumors were measured, and mice were randomly assigned to treatment groups. The mean tumor volume for all animals enrolled into treatment groups was approximately 150 mm3. Mice were administered plasmid DNA coding for mouse CD80 ECD plus Fc from human IgG2a or Fc alone (negative control) via RIPPS℠. Protein was administered for anti-PD1 (Clone RMP1-14) or Rat IgG2a (Clone 2A3, negative control). Dosing groups were as follows: 1) Fc RIPPS℠ plus Rat IgG2a, 2) CD80 RIPPS℠ plus Rat IgG2a, 3) Fc RIPPS℠ plus anti-PD1, or 4) CD80 RIPPS℠ plus anti-PD1. Tumors continued to be measured at least twice per week until tumor volume exceeded 10% of animal weight, or approximately 2000 mm3. - The change in tumor size is shown by graphing mean tumor weight for all groups at the end of the study. (
FIG. 2a .) RIPPS℠ with mouse CD80 ECD or administration of anti-PD1 reduced tumor growth compared to control. (FIG. 2a-b .) The combination of CD80 RIPPS℠ and anti-PD1 resulted in significantly reduced tumor growth compared to either CD80 (p<0.01 beginning after Day 9) or anti-PD-1 (p<0.01 on Day 14) alone (p<0.05) beginning nine days after treatment initiation. P-values were calculated using unpaired, two-tailed t-test analyses of the calculated tumor volumes on each day of measurement. - Tumor growth inhibition (TGI) by CD80 ECD and anti-PD1 were determined to be 28.7% and 41.5%, respectively, compared to control. TGI by the combination of CD80 ECD and anti-PD1 combination was determined to be 83%. (See
FIG. 2b .) TGI was calculated using the formula 100×(1-(Mean Δvolume Treatment group/Mean Δvolume Saline). - Seven-week old female BALB/c mice were purchased from Charles River Laboratories (Hollister, Calif.) and were acclimated for two weeks before the start of the study. The murine colorectal carcinoma cell line CT26 was implanted subcutaneously over the right flank of the mice at 1.0×106 cells/200 μl/mouse. Prior to inoculation, the cells were cultured for no more than three passages in RPMI 1640 medium supplemented with 10% heat-inactivated Fetal Bovine Serum (FBS), 2 mM L-Glutamine. Cells were grown at 37° C. in a humidified atmosphere with 5% CO2. Upon reaching 80-85% confluence, cells were harvested and resuspended in a 1:1 mixture of serum-free RPMI 1640 and Matrigel® at 5×106 cells per milliliter.
- Mice were monitored twice-weekly following cell implantation for tumor growth. For tumor measurements, the length and width of each tumor was measured using calipers and volume was calculated according to the formula: Tumor volume (mm3)=(width (mm)×length (mm)) 2/2. On
Day 5, all tumors were measured, and mice were randomly assigned to treatment groups. The mean tumor volume for all animals enrolled into treatment groups was 175 mm3. Mice were administered Saline or plasmid DNA via RIPPS℠. Plasmid DNA that was administered via RIPPS℠ contained the sequence for the extracellular domain (ECD) of murine CD80 with the Fc domain of human IgG1. Two clones were administered via RIPPSSM, one with the wild type human IgG1 Fc (CD80-IgG1 WT) and the other with this Fc bearing three mutated amino acids (L234F/L235E/P331S) in order to alter the interaction of Fc with Fc gamma receptors (CD80-IgG1 MT). Tumors continued to be measured at least twice per week until tumor volume exceeded 10% of animal weight, or approximately 2000 mm3. - The change in tumor size is shown by graphing mean tumor volume relative to the day upon which animals were inoculated with CT26 cells. (
FIG. 3a-b .) RIPPS℠ with CD80-IgG1 WT significantly reduced tumor growth compared to Saline control (p<0.05) beginning onDay 14. CD80-IgG MT significantly reduced tumor growth compared to CD80-IgG1 WT (p<0.01) beginning onDay 14. P-values were calculated using unpaired, two-tailed t-test analyses of the calculated tumor volumes on each day of the study (* p<0.05, ** p<0.01). Tumor growth inhibition (TGI) by CD80-IgG1 WT was determined to be 69.4% compared to Saline control, compared to TGI for CD80-IgG MT, which was calculated as 98%. (SeeFIG. 3b .) TGI was determined using the formula 100×(1−(Mean Δvolume Treatment group/Mean Δvolume Saline). - A separate in vivo study was conducted to analyze the effects of the CD80-IgG1 WT and CD80-IgG1 MT on infiltrating T cells in CT26 tumors at an early stage of the treatment.
- Seven-week old female BALB/c mice were purchased from Charles River Laboratories (Hollister, Calif.) and were acclimated for two weeks before the start of the study. The murine colorectal carcinoma cell line CT26 was implanted subcutaneously over the right flank of the mice at 1.0×106 cells/200 μl/mouse. Prior to inoculation, the cells were cultured for no more than three passages in RPMI 1640 medium supplemented with 10% heat-inactivated Fetal Bovine Serum (FBS), 2 mM L-Glutamine. Cells were grown at 37° C. in a humidified atmosphere with 5% CO2. Upon reaching 80-85% confluence, cells were harvested and resuspended in a 1:1 mixture of serum-free RPMI 1640 and Matrigel® at 5×106 cells/mL.
- Mice were monitored twice-weekly following cell implantation for tumor growth. For tumor measurements, the length and width of each tumor was measured using calipers and volume was calculated according to the formula: Tumor volume (mm3)=(width (mm)×length (mm)) 2/2. On
Day 5, all tumors were measured, and mice were randomly assigned to treatment groups (n=5 mice per group). The mean tumor volume for all animals enrolled into treatment groups was 72 mm3. Mice were administered saline, a murine extracellular domain (ECD) of CD80 with a wild type human IgG1 Fc (CD80-IgG1 WT), or a murine ECD of CD80 with a mutated human IgG1 Fc (CD80-IgG1 MT, mutated L234F/L235E/P331S) in order to alter the interaction with Fc gamma receptors. Tumors were measured onDays 5 and 11. - On Day 12, mice were euthanized with CO2 and perfused with phosphate-buffered saline (PBS), pH 7.4. Briefly, the mouse chest was opened rapidly, and a syringe with 20-gauge needle was used to infuse 40 mL of PBS into the aorta via an incision in the left ventricle. Blood and PBS exited through an opening in the right atrium. The tumors were removed and immersed in 10% neutral buffered formalin at 4° C. After 2 hours the tissues were rinsed 3 times in PBS and then transferred in 30% sucrose in PBS overnight. The next day the tumors were frozen in OCT compound and stored at −80 C.
- Cryostat sections were cut at 20- m in thickness. Sections were dried on Superfrost® Plus slides for 1 to 2 hours. Specimens were permeabilized with PBS containing 0.3% Triton® X-100 and incubated in 5% goat normal serum in PBS 0.3% Triton® X-100 (blocking solution) for 1 hour at room temperature to block nonspecific antibodies binding. To detect T-cells, sections were incubated with rat-anti-CD4 (GK1.5/eBiosciences) and rabbit anti-CD3 antibody (SP7/Thermo Scientific) both diluted 1:500 in blocking solution overnight. Control specimens were incubated in 5% normal serum instead of primary antibody for the same period. After rinsing with PBS containing 0.3% Triton® X-100, specimens were incubated for 4 hours at room temperature with Alexa® 594-labeled goat anti-rat and Alexa® 488-labeled goat anti-rabbit secondary antibodies diluted 1:400 in PBS (Jackson ImmunoResearch). Specimens were rinsed with PBS containing 0.3% Triton® X-100, fixed in 1% paraformaldehyde (PFA), rinsed again with PBS, and mounted in Vectashield antifade mounting medium with DAPI (Vector laboratories).
- Specimens were examined with a Zeiss Axiophot® 2 plus fluorescence microscope equipped with AxioCam® HRc camera. Representative images for each experimental group showing the amount and distribution of the CD3+ and CD4+ cells within the tumor were collected and are shown in
FIGS. 4a and 4 b. - Treatment with CD80-IgG1 WT or CD80-IgG1 MT increased the number of intratumoral CD3+ and CD4+ cells compared to saline (
FIGS. 4a and 4b ). While the amount of CD4+ cells was similar between the CD80-IgG1 WT or CD80-IgG1 MT treated tumors, treatment with CD80-IgG1 MT led to a greater increase of tumor infiltrating CD3+ T cells compared to CD80-IgG1 WT (FIG. 4b ). The ratio of CD3+ to CD4+ cells was increased with the CD80-IgG1 MT compared to the CD80-IgG1 WT. - A human CD80 ECD IgG1 Fc fusion molecule (CD80-Fc) was bound to magnetic protein-A beads (Life Technologies) in T-cell proliferation media containing RPMI 1640, 100 IU Penicillin/100 ug/ml Streptomycin, 2 mM L-Glutamine, 100 nM non-essential amino acids, 55 uM 2-mercaptoethanol and 10% ultra low-IgG fetal bovine serum. Binding reactions were carried out in 96 well flat-bottom tissue culture plates at a volume of 100 ul per well with a bead concentration of 3 million beads per ml. CD80-Fc was bound to the beads across a series of concentrations: 10, 1, 0.1 ug/ml. An additional set of binding reactions was also performed with the addition of 3 ng/ml OKT3-scFv. Proteins were allowed to bind for 1 hour at room temperature on a rocking platform, following which 100 ul of 20 ug/ml (
final concentration 10 ug/ml) IgG1 Free-Fc (FPT) was added to each well and allowed to bind for an additional hour in order to block any unoccupied Protein-A binding sites on the beads. The fully loaded and blocked beads were then washed 3 times with PBS using a magnetic 96-well plate stand in order to remove unbound proteins. 100 ul of Human Pan T-cells at a concentration of 1×106 cells/ml was then added to each well of dry, washed beads. Each condition was tested in triplicate. - Human PBMCs were isolated from apheresis-enriched blood (buffy coats) collected from healthy donors ˜18 hrs prior to isolation using Ficoll® (Biochrom) gradient density centrifugation. Pan T-cells were then isolated from PBMCs using a Human Pan T-cell isolation kit (Miltenyi). T-cells were seeded at a density of 1 million cells/ml in T225 tissue culture flasks in proliferation media (above) supplemented with 8 ng/ml IL-2 and Human T-cell Activator Dynabeads® (Life Tech) 1 bead/cell. Following seeding, cells were fed with fresh IL-2 and continually kept at a concentration of 0.3 million cells/ml by the addition of fresh proliferation media every 2 days. Cells were kept in a 37° C. water-jacketed incubator maintained at 5% CO2. After 6 days of expansion, the activator-beads were removed using a magnetic tube stand and the cells were resuspended at a concentration of 1 million cells/ml in fresh proliferation media without IL-2. 24 hours later the cells were put into assay with Protein-A bead immobilized proteins.
- Soluble Interferon Gamma (IFN-γ) and Tumor Necrosis Factor Alpha (TNF-α) levels were measured in the supernatants using HTRF-ELISA kits (Cisbio) 24 hours after the cells had been treated with the Protein-A bead immobilized proteins according to the manufacturer's instructions.
- Bead-immobilized CD80-Fc alone did not cause significant human T-cell activation, as measured by soluble cytokine production (
FIGS. 5a & c). However, when a small amount of OKT3-scFv was immobilized along with CD80-Fc, robust CD80-dependent IFN-γ and TNF-α release was observed (FIGS. 5b & d). The amount of OKT3-scFv used here was too low to cause T-cell stimulation on its own and therefore required the presence of CD80 as a co-stimulatory protein. These results therefor confirm the CD80-Fc used in this assay was indeed biologically active. - While release of IFN-γ and TNF-α in this assay showed that the CD80-Fc was biologically active, an excessive release of cytokines such as IFN-γ and TNF-α can be harmful. Thus, to address the potential safety of CD80 ECD Fc treatment, these results were compared to earlier published results with TGN1412, a monocolonal anti-CD28 antibody that was shown to be a T-cell “superagonist” and to release excessive and harmful levels of cytokines such as IFN-γ and TNF-α in human subjects.
- Immobilized TGN1412 alone appears to be significantly more potent at inducing cytokine release from human T-cells than human CD80 alone. Findlay et al., J. Immunological Methods 352: 1-12 (2010), reported that 1 ug/well of TGN1412 caused robust TNFα release, ˜2000 pg/ml, and Vessillier et al., J. Immunological Methods 424: 43-52 (2015), reported the same amount of TGN1412 caused robust IFN-γ, ˜10000 pg/ml. In our assay, the same amount of immobilized CD80-Fc did not cause significant release of either cytokine. These results suggest that CD80-Fc is at least 1000-fold less potent at inducing cytokine release compared to TGN1412 and therefore poses a significantly lower risk of inducing cytokine storm in humans than TGN1412.
- An in vivo study was conducted in CT26 tumors to analyze the effects of three different lots of CD80 ECD fused to wild-type human IgG1 Fc having different sialic acid (SA) contents. Specifically, lot E of the CD80 ECD Fc contains 20 mol SA/mol protein, lot D contains 15 mol SA/mol protein, and lot A contains 5 mol SA/mol protein.
- Seven week old female BALB/c mice were purchased from Charles River Laboratories (Hollister, Calif.) and were acclimated for one week before the study was initiated. The murine colorectal carcinoma cell line CT26 was implanted subcutaneously over the right flank of the mice at 1.0×106 cells/200 μl/mouse. Prior to inoculation, the cells were cultured for no more than three passages in RPMI 1640 medium supplemented with 10% heat-inactivated Fetal Bovine Serum (FBS), 2 mM L-Glutamine. Cells were grown at 37° C. in a humidified atmosphere with 5% CO2. Upon reaching 80-85% confluence, cells were harvested and resuspended in a 1:1 mixture of serum-free RPMI 1640 and Matrigel® at 5×106 cells per milliliter.
- Mice were monitored for tumor growth twice weekly following cell implantation. For tumor measurements, the length and width of each tumor was measured using calipers and volume was calculated according to the formula: tumor volume (mm3)=(width (mm)×length (mm)) 2/2. On
Day 7, all tumors were measured, and mice were randomly assigned to seven treatment groups (n=10 mice per experimental group). The mean tumor volume for all animals enrolled was 94 mm3. The first group was injected with 200 μl of PBS (control) intravenously (i.v.) into the tail vein. The second group was injected with CD80 ECD Fc at 20 mol SA/mol protein (lot E) i.v. dosed at 0.3 mg/kg. The third group was injected with CD80 ECD Fc at 20 mol SA/mol protein (lot E) i.v. dosed at 0.6 mg/kg. The fourth group was injected with CD80 ECD Fc at 15 mol SA/mol protein (lot D) i.v. dosed at 0.3 mg/kg. The fifth group was injected with CD80 ECD Fc at 15 mol SA/mol protein (lot D) i.v. dosed at 0.6 mg/kg. The sixth group was injected with CD80 ECD Fc at 5 mol SA/mol protein (lot A) i.v. dosed at 0.3 mg/kg. The seventh group was injected with CD80 ECD Fc at 5 mol SA/mol protein (lot A) i.v. dosed at 0.6 mg/kg. Tumors were measured onday - Treatment with CD80 ECD Fc at 20 mol SA/mol protein (lot E) dosed at 0.3 or 0.6 mg/kg resulted in a 93% and 98% inhibition of tumor growth compared to the control (P<0.001). Treatment with CD80 ECD Fc at 15 mol SA/mol protein (lot D) dosed at 0.3 or 0.6 mg/kg resulted in a 93% and 95% inhibition of tumor growth compared to the control (P<0.001). By comparison, treatment with CD80 ECD Fc lot A at 0.3 mg/kg (with 5 mol SA/mol protein) did not inhibit tumor growth compared to the control and when dosed at 0.6 mg/kg it only induced 70% inhibition (P<0.001) (
FIG. 6 ). - The incidence of tumor-free mice was analyzed at day 37. Treatment with CD80 ECD-Fc at 20 mol/mol SA (lot E) dosed at 0.3 or 0.6 mg/kg led to complete tumor regression in 8/10 (80%) or 10/10 (100%) of the mice. Treatment with CD80 ECD-Fc at 15 mol/mol SA (lot D) dosed at 0.3 or 0.6 mg/kg led to complete tumor regression in 9/10 (90%) of the mice. By comparison, treatment with CD80 ECD-Fc lot A dosed at 0.6 mg/kg induced tumor regression only in 1/10 (10%) of the mice, as shown in the table below.
-
Treatment group Tumor free mice at day 37 Saline 0% (0/10 mice) CD80 ECD- Fc SA 20 mol/mol (lot E) at 0.380% (8/10 mice) mg/ kg 1 doseCD80 ECD- Fc SA 20 mol/mol (lot E) at 0.6100% (10/10 mice) mg/ kg 1 doseCD80 ECD- Fc SA 15 mol/mol (lot D) at 0.390% (9/10 mice) mg/ kg 1 doseCD80 ECD- Fc SA 15 mol/mol (lot D) at 0.690% (9/10 mice) mg/ kg 1 doseCD80 ECD- Fc SA 5 mol/mol (lot A) at 0.30% (0/10 mice) mg/ kg 1 doseCD80 ECD- Fc SA 5 mol/mol (lot A) at 0.610% (1/10 mice) mg/ kg 1 dose - In vivo studies were conducted using a mouse surrogate comprising the extracellular domain (ECD) of murine CD80 linked to the Fc domain of mouse IgG2a wild type (murine CD80 ECD-Fc). The effects of murine CD80 ECD-Fc were compared with those of the anti-CTLA4 antibody clone 9D9 (IgG2b) in three different syngeneic tumor models: the CT26 colon carcinoma, the MC38 colon carcinoma and the B16 melanoma models.
- CT26 Tumor Model
- Seven week old female BALB/c mice were purchased from Charles River Laboratories (Hollister, Calif.) and were acclimated for one week before the study was initiated. The murine colorectal carcinoma cell line CT26 was implanted subcutaneously over the right flank of the mice at 1.0×106 cells/200 μl/mouse. Prior to inoculation, the cells were cultured for no more than three passages in RPMI 1640 medium supplemented with 10% heat-inactivated Fetal Bovine Serum (FBS), 2 mM L-Glutamine. Cells were grown at 37° C. in a humidified atmosphere with 5% CO2. Upon reaching 80-85% confluence, cells were harvested and resuspended in a 1:1 mixture of serum-free RPMI 1640 and matrigel.
- Mice were monitored twice weekly following cell implantation for tumor growth. For tumor measurements, the length and width of each tumor was measured using calipers and volume was calculated according to the formula: tumor volume (mm3)=(width (mm)×length (mm)) 2/2. On
Day 7, all tumors were measured, and mice were randomly assigned to seven treatment groups (n=15 mice per experimental group). The mean tumor volume for all animals enrolled was 96 mm3. Mice were dosed 3 times, onday Fc 20 mol/mol SA i.v. dosed at 0.3 mg/kg. The third group was injected with anti-CTLA4 antibody clone 9D9 (IgG2b) i.p. dosed at 1.5 mg/kg. The fourth group was injected with anti-CTLA4 antibody clone 9D9 (IgG2b) i.p. dosed at 10 mg/kg. Tumors were measured onday - At day 21 (when all the controls were still in the study), treatment with murine CD80 ECD-Fc at 20 mol/mol SA dosed at 0.3 mg/kg resulted in 90% inhibition of tumor growth compared to the control (P<0.001). Treatment with anti-CTLA4 antibody at 10 mg/kg resulted in 75% inhibition of tumor growth compared to the control (P<0.001). By comparison, treatment with anti-CTLA4 antibody at 1.5 mg/kg only induced 53% inhibition of tumor growth (P<0.001) (
FIG. 7 ). Atday 21, the impact of treatment with murine CD80 ECD-Fc at 20 mol/mol SA dosed at 0.3 mg/kg on tumor growth was significantly greater than anti-CTLA4 antibody dosed at 1.5 mg/kg (P<0.001) or at 10 mg/kg (P=0.009). - The incidence of tumor-free mice was analyzed at day 37. Treatment with murine CD80 ECD-Fc at 20 mol/mol SA dosed at 0.3 mg/kg led to complete tumor regression in 7/15 (47%) of the mice. Treatment with anti-CTLA4 antibody at 10 mg/kg led to complete tumor regression in 3/15 (20%) of the mice. None of the mice treated with anti-CTLA4 antibody at 1.5 mg/kg had complete tumor regression.
- MC38 Tumor Model
- Seven week old female C57Bl/6 mice were purchased from Charles River Laboratories (Hollister, Calif.) and were acclimated for one week before the study was initiated. The murine colorectal carcinoma cell line MC38 was implanted subcutaneously over the right flank of the mice at 0.5×106 cells/100 μl/mouse. Prior to inoculation, the cells were cultured for no more than three passages in RPMI 1640 medium supplemented with 10% heat-inactivated Fetal Bovine Serum (FBS), 2 mM L-Glutamine. Cells were grown at 37° C. in a humidified atmosphere with 5% CO2. Upon reaching 80-85% confluence, cells were harvested and resuspended in a 1:1 mixture of serum-free RPMI 1640 and matrigel.
- Mice were monitored twice weekly following cell implantation for tumor growth. For tumor measurements, the length and width of each tumor was measured using calipers and volume was calculated according to the formula: tumor volume (mm3)=(width (mm)×length (mm)) 2/2. On
Day 7, all tumors were measured, and mice were randomly assigned to seven treatment groups (n=15 mice per experimental group). The mean tumor volume for all animals enrolled was 78 mm3. Mice were dosed 3 times, onday Fc 20 mol/mol SA i.v. dosed at 3 mg/kg. The third group was injected with anti-CTLA4 antibody clone 9D9 (IgG2b) i.p. dosed at 1.5 mg/kg. The fourth group was injected with anti-CTLA4 antibody clone 9D9 (IgG2b) i.p. dosed at 10 mg/kg. Tumors were measured onday - At day 19 (when all the controls were still in the study), treatment with murine CD80 ECD-Fc at 20 mol/mol SA dosed at 3 mg/kg resulted in 79% inhibition of tumor growth compared to the control (P<0.001). Moreover, murine CD80 ECD-Fc at 20 mol/mol SA had a greater impact on tumor growth compared to anti-CTLA4 antibody (P<0.001). Treatment with anti-CTLA4 antibody at 10 mg/kg reduced tumor growth by 21% compared to the control (P=0.05) while at 1.5 mg/kg did not significantly affect tumor size (
FIG. 8 ). Atday 21, the impact of treatment with murine CD80 ECD-Fc at 20 mol/mol SA dosed at 3 mg/kg on tumor growth was significantly greater than anti-CTLA4 antibody dosed at 1.5 mg/kg (P<0.001) or at 10 mg/kg (P=0.009). - While a 3 mg/kg dose of CD80 ECD-Fc was used for these experiments, a 0.3 mg/kg dose of CD80 ECD-Fc also reduced tumor cell growth in the MC38 tumor model (data not shown).
- B16 Tumor Model
- Seven week old female C57Bl/6 mice were purchased from Charles River Laboratories (Hollister, Calif.) and were acclimated for one week before the study was initiated. The murine melanoma cell line B16-F10 was implanted subcutaneously over the right flank of the mice at 0.5×106 cells/100 μl/mouse. Prior to inoculation, the cells were cultured for no more than three passages in DMEM medium supplemented with 10% heat-inactivated Fetal Bovine Serum (FBS), 2 mM L-Glutamine. Cells were grown at 37° C. in a humidified atmosphere with 5% CO2. Upon reaching 80-85% confluence, cells were harvested and resuspended in a 1:1 mixture of serum-free DMEM and matrigel.
- Mice were monitored twice weekly following cell implantation for tumor growth. For tumor measurements, the length and width of each tumor was measured using calipers and volume was calculated according to the formula: tumor volume (mm3)=(width (mm)×length (mm)) 2/2. On
Day 7, all tumors were measured, and mice were randomly assigned to seven treatment groups (n=15 mice per experimental group). The mean tumor volume for all animals enrolled was 70 mm3. Mice were dosed 3 times, onday Fc 20 mol/mol SA i.v. dosed at 3 mg/kg. The third group was injected with anti-CTLA4 antibody clone 9D9 (IgG2b) i.p. dosed at 1.5 mg/kg. The fourth group was injected with anti-CTLA4 antibody clone 9D9 (IgG2b) i.p. dosed at 10 mg/kg. Tumors were measured onday - At day 13 (when all the controls were still in the study) treatment with murine CD80 ECD-Fc at 20 mol/mol SA dosed at 3 mg/kg resulted in 41% inhibition of tumor growth compared to the control (P<0.001). Treatment with anti-CTLA4 antibody at 10 mg/kg or 1.5 mg/kg did not significantly affect tumor growth compared to the control (
FIG. 9 ). -
TABLE OF SEQUENCES SEQ. ID. NO. Description Sequence 1 Human CD80 MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKE precursor VATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYK (with signal NRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLA sequence) EVTLSVKADEPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWL amino acid ENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKY sequence GHLRVNQTENWNTTKQEHFPDNLLPSWAITLISVNGIFVICCLT YCFAPRCRERRRNERLRRESVRPV 2 Mouse CD80 MACNCQLMQDTPLLKFPCPRLILLFVLLIRLSQVSSDVDEQLSK precursor SVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKVW (with signal PEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKERGTYEVK sequence) HLALVKLSIKADFSTPNITESGNPSADTKRITCFASGGFPKPRF amino acid SWLENGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIKCL sequence IKYGDAHVSEDFTWEKPPEDPPDSKNTLVLFGAGFGAVITVVVI VVIIKCFCKHRSCFRRNEASRETNNSLTFGPEEALAEQTVFL 3 Human CD80 VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMS Isoform 2 GDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE (without KDAFKREHLAEVTLSVKADEPTPSISDFEIPTSNIRRIICSTSG signal GFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTT sequence) NHSFMCLIKYGHLRVNQTFNWNTSFAPRCRERRRNERLRRESVR PV 4 Human CD80 VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMS Isoform 3 GDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE (without KDAFKREHLAEVTLSVKGFAPRCRERRRNERLRRESVRPV signal sequence) 5 Human CD80 VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMS ECD sequence GDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE (without KDAFKREHLAEVTLSVKADEPTPSISDFEIPTSNIRRIICSTSG signal GFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTT sequence) NHSFMCLIKYGHLRVNQTENWNTTKQEHFPDN 6 Mouse CD80 VDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVI ECD sequence AGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKE (without RGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASG signal GFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTR sequence) NHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSKN 7 Human CD80 MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSG signal sequence 8 Mouse CD80 MACNCQLMQDTPLLKFPCPRLILLFVLLIRLSQVSSD signal sequence 9 Fc C237S EPKSSDKTHT CPPCPAPELL GGPSVFLFPP KPKDTLMISR TPEVTCVVVD VSHEDPEVKF NWYVDGVEVH NAKTKPREEQ YNSTYRVVSV LTVLHQDWLN GKEYKCKVSN KALPAPIEKT ISKAKGQPRE PQVYTLPPSRD ELTKNQVSLT CLVKGFYPSD IAVEWESNGQ PENNYKTTPP VLDSDGSFFL YSKLTVDKSR WQQGNVFSCS VMHEALHNHYTQKSLSLSPGK 10 Fc ERKCCVECPP CPAPPVAGPS VFLFPPKPKD TLMISRTPEV TCVVVDVSHE DPEVQFNWYV DGVEVHNAKT KPREEQFNST FRVVSVLTVV HQDWLNGKEY KCKVSNKGLP APIEKTISKT KGQPREPQVY TLPPSREEMT KNQVSLTCLV KGFYPSDIAV EWESNGQPEN NYKTTPPMLD SDGSFFLYSK LTVDKSRWQQ GNVFSCSVMH EALHNHYTQK SLSLSPGK 11 Fc ESKYGPPCPS CPAPEFLGGP SVFLFPPKPK DTLMISRTPE VTCVVVDVSQ EDPEVQFNWY VDGVEVHNAK TKPREEQFNS TYRVVSVLTV LHQDWLNGKE YKCKVSNKGL PSSIEKTISK AKGQPREPQV YTLPPSQEEM TKNQVSLTCL VKGFYPSDIA VEWESNGQPE NNYKTTPPVL DSDGSFFLYS RLTVDKSRWQ EGNVFSCSVM HEALHNHYTQ KSLSLSLGK 12 Human IgG1 EPKSSDKTHTCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEV Fc L234F, TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV L235E, P331S SVLTVLHQDWLNGKEYKCKVSNKALPASIEKTISKAKGQPREPQ mutant VYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVESCSVMHEALHNH YTQKSLSLSPGK 13 Human IgG1 EPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV Fc N297 TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVV mutant SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ VYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVESCSVMHEALHNH YTQKSLSLSPGK 14 Fc human EPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV IgG1 TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ VYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVESCSVMHEALHNH YTQKSLSLSPGK 15 Fc human ELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCP IgG3 RCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPREEQYNSTF RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPR EPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPE NNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEAL HNRFTQKSLSLSPGK 16 Fc human ESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCV IgG4 VVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYT LPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT PPVLDSDGSFFLYSRLTVDKSRWQEGNVESCSVMHEALHNHYTQ KSLSLSLGK 17 Mouse CD80 VDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVI ECD mouse Fc AGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKE IgG (Fc RGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASG portion GFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTR underlined) NHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSKNEPRGPTIKPCP PCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSED DPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDW MSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEE MTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSD GSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTP GK 18 Mouse CD80 VDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVI ECD Human Fc AGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKE IgG1 WT (Fc RGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASG portion GFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTR underlined) NHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSKNEPKSSDKTHTC PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K 19 Mouse CD80 VDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVI ECD Fc IgG1 AGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKE MT (234, RGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASG 235, 331) GFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTR (Fc portion NHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSKNEPKSSDKTHTC underlined; PPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED mutants PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL shown in NGKEYKCKVSNKALPASIEKTISKAKGQPREPQVYTLPPSRDEL bold) TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K 20 Human CD80 VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMS ECD Human Fc GDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE IgG WT (Fc KDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSG portion GFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTT underlined) NHSFMCLIKYGHLRVNQTENWNTTKQEHFPDNEPKSSDKTHTCP PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 21 Human CD80 VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMS ECD Human Fc GDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYE IgG L234F, KDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSG L235E, P331S GFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTT MT (Fc NHSFMCLIKYGHLRVNQTENWNTTKQEHFPDNEPKSSDKTHTCP portion PCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP underlined; EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN mutants in GKEYKCKVSNKALPASIEKTISKAKGQPREPQVYTLPPSRDELT bold) KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 22 human PD-1 MQIPQAPWPV VWAVLQLGWR PGWFLDSPDR PWNPPTFSPA precursor LLVVTEGDNA TFTCSFSNTS ESFVLNWYRM SPSNQTDKLA (with signal AFPEDRSQPG QDCRFRVTQL PNGRDFHMSV VRARRNDSGT sequence) YLCGAISLAP KAQIKESLRA ELRVTERRAE VPTAHPSPSP UniProtKB/ RPAGQFQTLV VGVVGGLLGS LVLLVWVLAV ICSRAARGTI Swiss-Prot: GARRTGQPLK EDPSAVPVFS VDYGELDFQW REKTPEPPVP Q15116.3, CVPEQTEYAT IVFPSGMGTS SPARRGSADG PRSAQPLRPE 01-OCT-2014 DGHCSWPL 23 human PD-1 PGWFLDSPDR PWNPPTFSPA LLVVTEGDNA TFTCSFSNTS (mature, ESFVLNWYRM SPSNQTDKLA AFPEDRSQPG QDCRFRVTQL without PNGRDFHMSV VRARRNDSGT YLCGAISLAP KAQIKESLRA signal ELRVTERRAE VPTAHPSPSP RPAGQFQTLV VGVVGGLLGS sequence) LVLLVWVLAV ICSRAARGTI GARRTGQPLK EDPSAVPVFS VDYGELDFQW REKTPEPPVP CVPEQTEYAT IVFPSGMGTS SPARRGSADG PRSAQPLRPE DGHCSWPL 24 human PD-L1 MRIFAVFIFM TYWHLLNAFT VTVPKDLYVV EYGSNMTIEC precursor KFPVEKQLDL AALIVYWEME DKNIIQFVHG EEDLKVQHSS (with signal YRQRARLLKD QLSLGNAALQ ITDVKLQDAG VYRCMISYGG sequence) ADYKRITVKV NAPYNKINQR ILVVDPVTSE HELTCQAEGY UniProtKB/ PKAEVIWTSS DHQVLSGKTT TTNSKREEKL FNVTSTLRIN Swiss-Prot: TTTNEIFYCT FRRLDPEENH TAELVIPELP LAHPPNERTH Q9NZQ7.1, LVILGAILLC LGVALTFIFR LRKGRMMDVK KCGIQDTNSK 01-OCT-2014 KQSDTHLEET 25 human PD-L1 FT VTVPKDLYVV EYGSNMTIEC KFPVEKQLDL (mature, AALIVYWEME DKNIIQFVHG EEDLKVQHSS YRQRARLLKD without QLSLGNAALQ ITDVKLQDAG VYRCMISYGG ADYKRITVKV signal NAPYNKINQR ILVVDPVTSE HELTCQAEGY PKAEVIWTSS sequence) DHQVLSGKTT TTNSKREEKL FNVTSTLRIN TTTNEIFYCT FRRLDPEENH TAELVIPELP LAHPPNERTH LVILGAILLC LGVALTFIFR LRKGRMMDVK KCGIQDTNSK KQSDTHLEET - The table below provides a listing of certain sequences referenced herein.
Claims (45)
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US16/295,978 US20190194288A1 (en) | 2015-11-02 | 2019-03-07 | Cd80 extracellular domain polypeptides and their use in cancer treatment |
US17/742,189 US20240041979A1 (en) | 2015-11-02 | 2022-05-11 | Cd80 extracellular domain polypeptides and their use in cancer treatment |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201562249836P | 2015-11-02 | 2015-11-02 | |
US201662373654P | 2016-08-11 | 2016-08-11 | |
US15/340,238 US10273281B2 (en) | 2015-11-02 | 2016-11-01 | CD80 extracellular domain polypeptides and their use in cancer treatment |
US16/295,978 US20190194288A1 (en) | 2015-11-02 | 2019-03-07 | Cd80 extracellular domain polypeptides and their use in cancer treatment |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/340,238 Division US10273281B2 (en) | 2015-11-02 | 2016-11-01 | CD80 extracellular domain polypeptides and their use in cancer treatment |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US17/742,189 Division US20240041979A1 (en) | 2015-11-02 | 2022-05-11 | Cd80 extracellular domain polypeptides and their use in cancer treatment |
Publications (1)
Publication Number | Publication Date |
---|---|
US20190194288A1 true US20190194288A1 (en) | 2019-06-27 |
Family
ID=57286882
Family Applications (4)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/340,238 Active US10273281B2 (en) | 2015-11-02 | 2016-11-01 | CD80 extracellular domain polypeptides and their use in cancer treatment |
US16/295,978 Abandoned US20190194288A1 (en) | 2015-11-02 | 2019-03-07 | Cd80 extracellular domain polypeptides and their use in cancer treatment |
US16/354,689 Active 2037-09-16 US11098103B2 (en) | 2015-11-02 | 2019-03-15 | CD80 extracellular domain polypeptides and their use in cancer treatment |
US17/742,189 Pending US20240041979A1 (en) | 2015-11-02 | 2022-05-11 | Cd80 extracellular domain polypeptides and their use in cancer treatment |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/340,238 Active US10273281B2 (en) | 2015-11-02 | 2016-11-01 | CD80 extracellular domain polypeptides and their use in cancer treatment |
Family Applications After (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/354,689 Active 2037-09-16 US11098103B2 (en) | 2015-11-02 | 2019-03-15 | CD80 extracellular domain polypeptides and their use in cancer treatment |
US17/742,189 Pending US20240041979A1 (en) | 2015-11-02 | 2022-05-11 | Cd80 extracellular domain polypeptides and their use in cancer treatment |
Country Status (21)
Country | Link |
---|---|
US (4) | US10273281B2 (en) |
EP (1) | EP3371208B1 (en) |
JP (1) | JP6936221B2 (en) |
KR (1) | KR20180069903A (en) |
CN (1) | CN108884139A (en) |
AU (1) | AU2016350701B2 (en) |
BR (1) | BR112018008865A8 (en) |
CA (1) | CA3001131A1 (en) |
CL (2) | CL2018001172A1 (en) |
CO (1) | CO2018004132A2 (en) |
CR (1) | CR20180306A (en) |
EA (1) | EA201891106A1 (en) |
EC (1) | ECSP18041501A (en) |
IL (1) | IL258725A (en) |
MA (1) | MA43163A (en) |
MX (1) | MX2018005517A (en) |
PE (1) | PE20181300A1 (en) |
PH (1) | PH12018500933A1 (en) |
SG (1) | SG11201803009VA (en) |
TW (1) | TW201722985A (en) |
WO (1) | WO2017079117A1 (en) |
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11098103B2 (en) | 2015-11-02 | 2021-08-24 | Five Prime Therapeutics, Inc. | CD80 extracellular domain polypeptides and their use in cancer treatment |
US11789010B2 (en) | 2017-04-28 | 2023-10-17 | Five Prime Therapeutics, Inc. | Methods of treatment with CD80 extracellular domain polypeptides |
Families Citing this family (31)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2016127074A1 (en) | 2015-02-06 | 2016-08-11 | Blueprint Medicines Corporation | 2-(pyridin-3-yl)-pyrimidine derivatives as ret inhibitors |
EP3283508B1 (en) | 2015-04-17 | 2021-03-17 | Alpine Immune Sciences, Inc. | Immunomodulatory proteins with tunable affinities |
MY194262A (en) | 2015-11-02 | 2022-11-25 | Blueprint Medicines Corp | Inhibitors of ret |
JP7527758B2 (en) | 2016-04-15 | 2024-08-05 | アルパイン イミューン サイエンシズ インコーポレイテッド | CD80 variant immunomodulatory proteins and uses thereof |
US11834490B2 (en) | 2016-07-28 | 2023-12-05 | Alpine Immune Sciences, Inc. | CD112 variant immunomodulatory proteins and uses thereof |
EP3596114A2 (en) | 2017-03-16 | 2020-01-22 | Alpine Immune Sciences, Inc. | Cd80 variant immunomodulatory proteins and uses thereof |
US11732022B2 (en) | 2017-03-16 | 2023-08-22 | Alpine Immune Sciences, Inc. | PD-L2 variant immunomodulatory proteins and uses thereof |
MX2019012198A (en) | 2017-04-11 | 2020-01-21 | Inhibrx Inc | Multispecific polypeptide constructs having constrained cd3 binding and methods of using the same. |
CN111094352A (en) | 2017-08-25 | 2020-05-01 | 戊瑞治疗有限公司 | B7-H4 antibodies and methods of use thereof |
US11713356B2 (en) * | 2017-10-13 | 2023-08-01 | Ose Immunotherapeutics | Modified bifunctional anti-human signal regulatory protein alpha (SIRPa) antibody and method of use thereof for treating cancer |
AU2019228600A1 (en) | 2018-03-02 | 2020-09-24 | Five Prime Therapeutics, Inc. | B7-H4 antibodies and methods of use thereof |
JP7422084B2 (en) | 2018-04-03 | 2024-01-25 | ブループリント メディシンズ コーポレイション | RET inhibitors for use in the treatment of cancers with RET alterations |
CN110437339B (en) * | 2018-05-04 | 2021-08-13 | 免疫靶向有限公司 | Fusion protein type prodrug with interleukin 15 as active component |
WO2020047087A1 (en) * | 2018-08-29 | 2020-03-05 | Five Prime Therapeutics, Inc. | Cd80 extracellular domain fc fusion protein dosing regimens |
US11492384B2 (en) * | 2018-09-17 | 2022-11-08 | Gi Innovation, Inc. | Fusion protein comprising IL-2 protein and CD80 protein, and use thereof |
WO2020061376A2 (en) * | 2018-09-19 | 2020-03-26 | Alpine Immune Sciences, Inc. | Methods and uses of variant cd80 fusion proteins and related constructs |
CN111423512B (en) * | 2019-01-10 | 2024-01-05 | 北京比洋生物技术有限公司 | Multi-targeting fusion protein for blocking vascular endothelial cell growth and activating T cells and pharmaceutical composition comprising same |
AU2020224137A1 (en) | 2019-02-22 | 2021-10-14 | Five Prime Therapeutics, Inc. | CD80 extracellular domain-Fc fusion proteins for treating PD-L1 negative tumors |
US20220348657A1 (en) | 2019-04-18 | 2022-11-03 | Five Prime Therapeutics, Inc. | Bioassay for t-cell co-stimulatory proteins containing fc domains |
US11788072B2 (en) * | 2019-04-30 | 2023-10-17 | Innovative Cellular Therapeutics Holdings, Ltd. | Activation of APC in immunotherapy |
AU2020270395A1 (en) | 2019-05-03 | 2021-12-23 | Five Prime Therapeutics, Inc. | Pharmaceutical formulations containing CD80 extracellular domain-Fc fusion proteins |
AU2020387479B2 (en) * | 2019-11-20 | 2024-06-06 | Gi Cell, Inc. | Composition for culturing regulatory T cells and use thereof |
BR112022009521A2 (en) * | 2019-11-20 | 2022-08-16 | Gi Cell Inc | COMPOSITION OF MEDIUM FOR T-CELL CULTURE AND METHOD FOR T-CELL CULTURE USING THE SAME |
CA3157592A1 (en) * | 2019-11-20 | 2021-05-27 | Myoung Ho Jang | Composition for culturing natural killer cells and method for preparing natural killer cells by using same |
CN110732021B (en) * | 2019-11-21 | 2020-08-25 | 北京启辰生生物科技有限公司 | Composition for relieving tumor immunosuppression and application thereof |
CN110743006B (en) * | 2019-11-22 | 2020-08-25 | 北京启辰生生物科技有限公司 | Composition for synergistically relieving immune cell failure and application |
IL292935A (en) * | 2019-11-27 | 2022-07-01 | Gi Cell Inc | Composition for anticancer treatment, comprising nk cells and fusion protein which comprises il-2 protein and cd80 protein |
TW202146437A (en) * | 2020-02-26 | 2021-12-16 | 美商戊瑞治療有限公司 | Cd80 extracellular domain fc fusion protein therapy |
IL298648A (en) | 2020-06-03 | 2023-01-01 | Boehringer Ingelheim Int | Recombinant rhabdovirus encoding for a cd80 extracellular domain fc-fusion protein |
KR102373965B1 (en) * | 2020-06-05 | 2022-03-15 | (주)지아이이노베이션 | Pharmaceutical composition for enhancing radiotherapy containing fusion protein comprising il-2 protein and cd80 protein |
WO2022226170A1 (en) * | 2021-04-22 | 2022-10-27 | Cornell University | The immunomodulatory ligand b7-1 mediates synaptic remodeling by p75ntr |
Family Cites Families (103)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7070776B1 (en) | 1990-03-26 | 2006-07-04 | Bristol-Myers Squibb Company | Methods for blocking binding of CD28 receptor to B7 |
US5521288A (en) | 1990-03-26 | 1996-05-28 | Bristol-Myers Squibb Company | CD28IG fusion protein |
US6071716A (en) | 1990-10-01 | 2000-06-06 | Dana-Farber Cancer Institute | DNA encoding, B7, a new member of the IG superfamily with unique expression on activated and neoplastic B cells |
US6887471B1 (en) | 1991-06-27 | 2005-05-03 | Bristol-Myers Squibb Company | Method to inhibit T cell interactions with soluble B7 |
US6824779B1 (en) | 1993-07-26 | 2004-11-30 | Dana-Farber Cancer Institute, Inc. | Methods for inhibiting the interaction of B7-2 with its natural ligand |
US5858776A (en) | 1993-11-03 | 1999-01-12 | Repligen Corporation | Tumor cells with increased immunogenicity and uses therefor |
US6130316A (en) | 1993-07-26 | 2000-10-10 | Dana Farber Cancer Institute | Fusion proteins of novel CTLA4/CD28 ligands and uses therefore |
US6218510B1 (en) | 1994-03-02 | 2001-04-17 | Brigham & Woman's Hospital | B7-1 and B7-2 polypeptides |
EP1025856A3 (en) | 1994-03-08 | 2002-10-16 | Dana-Farber Cancer Institute | Methods for modulating T Cell unresponsiveness |
US6051227A (en) | 1995-07-25 | 2000-04-18 | The Regents Of The University Of California, Office Of Technology Transfer | Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling |
US20020147326A1 (en) | 1996-06-14 | 2002-10-10 | Smithkline Beecham Corporation | Hexameric fusion proteins and uses therefor |
US6491925B2 (en) | 1996-08-15 | 2002-12-10 | Emory University | Compositions and methods for cancer prophylaxis and/or treatment |
WO1998058965A2 (en) | 1997-06-20 | 1998-12-30 | Innogenetics N.V. | B7-binding molecules for treating immune diseases |
AU6366999A (en) | 1998-10-30 | 2000-05-22 | Takeda Chemical Industries Ltd. | Betacellulin protein-containing preparations |
US7011833B1 (en) | 1999-05-06 | 2006-03-14 | Genetics Institute, Inc. | Enhancing immune responses with B7-1 or B7-2 in the absence of a crosslinking agent |
EP1210428B1 (en) | 1999-08-23 | 2015-03-18 | Dana-Farber Cancer Institute, Inc. | Pd-1, a receptor for b7-4, and uses therefor |
US6429303B1 (en) | 1999-09-03 | 2002-08-06 | Curagen Corporation | Nucleic acids encoding members of the human B lymphocyte activation antigen B7 family and methods of using the same |
US7064111B1 (en) | 1999-10-05 | 2006-06-20 | Georgetown University | Use of soluble costimulatory factor for tumor immuno-gene therapy |
US7183376B2 (en) | 2000-06-23 | 2007-02-27 | Maxygen, Inc. | Variant B7 co-stimulatory molecules |
WO2004029197A2 (en) | 2001-06-22 | 2004-04-08 | Maxygen, Inc. | Co-stimulatory molecules |
US20040236091A1 (en) | 2001-03-28 | 2004-11-25 | Chicz Roman M. | Translational profiling |
WO2003039486A2 (en) | 2001-11-09 | 2003-05-15 | Idec Pharmaceuticals Corporation | Anti-cd80 antibody having adcc activity for adcc mediated killing of b cell lymphoma cells alone or in combination with other therapies |
CA2508660C (en) | 2002-12-23 | 2013-08-20 | Wyeth | Antibodies against pd-1 and uses therefor |
WO2004060911A2 (en) | 2002-12-30 | 2004-07-22 | Amgen Inc. | Combination therapy with co-stimulatory factors |
DE602004027490D1 (en) | 2003-05-22 | 2010-07-15 | Abbott Lab | INDAZOL, BENZISOXAZOL AND BENZISOTHIAZOL KINASEINHIBITORS |
RU2353384C2 (en) | 2003-08-04 | 2009-04-27 | Бристол-Маерс Сквибб Компани | Cardiovascular disease therapy with using soluble ctla4 |
TWI309240B (en) | 2004-09-17 | 2009-05-01 | Hoffmann La Roche | Anti-ox40l antibodies |
CN101072578A (en) | 2004-10-29 | 2007-11-14 | 南加州大学 | Combination cancer immunotherapy with co-stimulatory molecules |
US7812135B2 (en) | 2005-03-25 | 2010-10-12 | Tolerrx, Inc. | GITR-binding antibodies |
NZ563193A (en) | 2005-05-09 | 2010-05-28 | Ono Pharmaceutical Co | Human monoclonal antibodies to programmed death 1(PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics |
RS54876B1 (en) | 2005-05-10 | 2016-10-31 | Incyte Holdings Corp | Modulators of indoleamine 2,3-dioxygenase and methods of using the same |
ES2336832T3 (en) * | 2005-07-22 | 2010-04-16 | Five Prime Therapeutics, Inc. | COMPOSITIONS AND PROCEDURES TO TREAT DISEASES WITH FGFR FUSION PROTEINS. |
JP5294874B2 (en) | 2005-12-20 | 2013-09-18 | インサイト・コーポレイション | N-hydroxyamidino heterocycle as modulator of indoleamine 2,3-dioxygenase |
CA2646671A1 (en) | 2006-03-30 | 2007-11-01 | University Of California | Methods and compositions for localized secretion of anti-ctla-4 antibodies |
CL2007002650A1 (en) | 2006-09-19 | 2008-02-08 | Incyte Corp | COMPOUNDS DERIVED FROM HETEROCICLO N-HIDROXIAMINO; PHARMACEUTICAL COMPOSITION, USEFUL TO TREAT CANCER, VIRAL INFECTIONS AND NEURODEGENERATIVE DISORDERS BETWEEN OTHERS. |
US20080125470A1 (en) | 2006-09-19 | 2008-05-29 | Incyte Corporation | N-hydroxyamidinoheterocycles as modulators of indoleamine 2,3-dioxygenase |
WO2008037080A1 (en) | 2006-09-29 | 2008-04-03 | Universite De Montreal | Methods and compositions for immune response modulation and uses thereof |
CA2682266A1 (en) | 2007-03-28 | 2008-10-09 | Biogen Idec Inc. | Treatment of hodgkins lymphoma |
BRPI0809386A2 (en) | 2007-03-28 | 2014-09-09 | Biogen Idec Inc | TUMOR MICRO ENVIRONMENT MODULATION |
EP2856876B1 (en) | 2007-03-30 | 2018-01-31 | Memorial Sloan-Kettering Cancer Center | Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes |
EP1987839A1 (en) | 2007-04-30 | 2008-11-05 | I.N.S.E.R.M. Institut National de la Sante et de la Recherche Medicale | Cytotoxic anti-LAG-3 monoclonal antibody and its use in the treatment or prevention of organ transplant rejection and autoimmune disease |
ES2437327T3 (en) | 2007-06-18 | 2014-01-10 | Merck Sharp & Dohme B.V. | Antibodies for the human programmed PD-1 receptor of programmed death |
EP3124046B1 (en) | 2007-07-12 | 2019-12-25 | GITR, Inc. | Combination therapies employing gitr binding molecules |
CN101358225B (en) * | 2007-07-30 | 2012-02-01 | 厦门大学 | Method for preparing high sialic acid content immune globulin antibody and application |
EP2044949A1 (en) | 2007-10-05 | 2009-04-08 | Immutep | Use of recombinant lag-3 or the derivatives thereof for eliciting monocyte immune response |
WO2009058564A2 (en) * | 2007-11-01 | 2009-05-07 | Maxygen, Inc. | Immunosuppressive polypeptides and nucleic acids |
CA2932121A1 (en) | 2007-11-30 | 2009-06-11 | Newlink Genetics Corporation | Ido inhibitors |
US20100285039A1 (en) | 2008-01-03 | 2010-11-11 | The Johns Hopkins University | B7-H1 (CD274) Antagonists Induce Apoptosis of Tumor Cells |
PL2250279T3 (en) * | 2008-02-08 | 2016-11-30 | Anti-ifnar1 antibodies with reduced fc ligand affinity | |
EP2262837A4 (en) | 2008-03-12 | 2011-04-06 | Merck Sharp & Dohme | Pd-1 binding proteins |
AR072999A1 (en) | 2008-08-11 | 2010-10-06 | Medarex Inc | HUMAN ANTIBODIES THAT JOIN GEN 3 OF LYMPHOCYTARY ACTIVATION (LAG-3) AND THE USES OF THESE |
US20110159023A1 (en) | 2008-08-25 | 2011-06-30 | Solomon Langermann | Pd-1 antagonists and methods for treating infectious disease |
AU2009288730B2 (en) | 2008-08-25 | 2013-06-20 | Amplimmune, Inc. | Compositions of PD-1 antagonists and methods of use |
RU2595409C2 (en) | 2009-09-03 | 2016-08-27 | Мерк Шарп И Доум Корп., | Anti-gitr antibodies |
EP2493862B1 (en) | 2009-10-28 | 2016-10-05 | Newlink Genetics Corporation | Imidazole derivatives as ido inhibitors |
JP2013512251A (en) | 2009-11-24 | 2013-04-11 | アンプリミューン、インコーポレーテッド | Simultaneous inhibition of PD-L1 / PD-L2 |
CN106279416B (en) | 2010-03-04 | 2019-08-30 | 宏观基因有限公司 | With the reactive antibody of B7-H3, its immunologic competence segment and application thereof |
CN105481983B (en) | 2010-09-09 | 2021-09-03 | 辉瑞公司 | 4-1BB binding molecules |
RU2607014C2 (en) | 2011-03-29 | 2017-01-10 | Рош Гликарт Аг | ANTIBODY Fc VARIANTS |
NO2694640T3 (en) | 2011-04-15 | 2018-03-17 | ||
RS57324B1 (en) | 2011-04-20 | 2018-08-31 | Medimmune Llc | Antibodies and other molecules that bind b7-h1 and pd-1 |
PT2726101T (en) | 2011-06-30 | 2018-11-21 | Genzyme Corp | Inhibitors of t-cell activation |
EP2734551B1 (en) | 2011-07-24 | 2018-01-10 | Cure Tech Ltd. | Variants of humanized immunomodulatory monoclonal antibodies |
BR112014002353B1 (en) | 2011-08-01 | 2022-09-27 | Genentech, Inc | USES OF PD-1 AXIS BINDING ANTAGONISTS AND MEK INHIBITORS, PHARMACEUTICAL COMPOSITIONS, AND KIT |
US8956619B2 (en) | 2011-10-25 | 2015-02-17 | University Of Maryland, Baltimore County | Soluble CD80 as a therapeutic to reverse immune supression in cancer patients |
WO2013116686A1 (en) | 2012-02-02 | 2013-08-08 | Massachusetts Institute Of Technology | Methods and products related to targeted cancer therapy |
CA2863658C (en) | 2012-02-03 | 2023-03-14 | Emory University | Immunostimulatory compositions, particles, and uses related thereto |
SG11201407190TA (en) | 2012-05-15 | 2014-12-30 | Bristol Myers Squibb Co | Cancer immunotherapy by disrupting pd-1/pd-l1 signaling |
UY34887A (en) | 2012-07-02 | 2013-12-31 | Bristol Myers Squibb Company Una Corporacion Del Estado De Delaware | OPTIMIZATION OF ANTIBODIES THAT FIX THE LYMPHOCYTE ACTIVATION GEN 3 (LAG-3) AND ITS USES |
EP2934589B1 (en) * | 2012-12-18 | 2021-01-13 | The Rockefeller University | Glycan-modified anti-cd4 antibodies for hiv prevention and therapy |
US9308236B2 (en) | 2013-03-15 | 2016-04-12 | Bristol-Myers Squibb Company | Macrocyclic inhibitors of the PD-1/PD-L1 and CD80(B7-1)/PD-L1 protein/protein interactions |
SG10201701380TA (en) | 2013-03-15 | 2017-04-27 | Genentech Inc | Biomarkers and methods of treating pd-1 and pd-l1 related conditions |
JP6449229B2 (en) | 2013-03-15 | 2019-01-09 | アッヴィ・バイオセラピューティクス・インコーポレイテッド | FC variant |
EP2969009B1 (en) | 2013-03-15 | 2018-11-28 | Pyranose Biotherapeutics, Inc. | Modified fc fusion proteins |
TW201605896A (en) | 2013-08-30 | 2016-02-16 | 安美基股份有限公司 | GITR antigen binding proteins |
WO2015050663A1 (en) | 2013-10-01 | 2015-04-09 | Mayo Foundation For Medical Education And Research | Methods for treating cancer in patients with elevated levels of bim |
WO2015100219A1 (en) | 2013-12-23 | 2015-07-02 | Oncomed Pharmaceuticals, Inc. | Immunotherapy with binding agents |
TWI693232B (en) | 2014-06-26 | 2020-05-11 | 美商宏觀基因股份有限公司 | Covalently bonded diabodies having immunoreactivity with pd-1 and lag-3, and methods of use thereof |
SG11201700207WA (en) | 2014-07-11 | 2017-02-27 | Genentech Inc | Anti-pd-l1 antibodies and diagnostic uses thereof |
JP2017534577A (en) | 2014-09-15 | 2017-11-24 | ジェネンテック, インコーポレイテッド | Method for treating cancer using PD-1 axis binding antagonist and IL-17 binding antagonist |
EP3270943A4 (en) | 2015-03-16 | 2018-10-17 | Yissum Research Development Company of the Hebrew University of Jerusalem Ltd. | Isolated peptides derived from the b7 ligand dimer interface and uses thereof |
US10478494B2 (en) | 2015-04-03 | 2019-11-19 | Astex Therapeutics Ltd | FGFR/PD-1 combination therapy for the treatment of cancer |
EP3283508B1 (en) | 2015-04-17 | 2021-03-17 | Alpine Immune Sciences, Inc. | Immunomodulatory proteins with tunable affinities |
AU2016256582B2 (en) | 2015-04-30 | 2020-10-29 | Akamis Bio Limited | Oncolytic adenovirus encoding a B7 protein |
MX2018001227A (en) | 2015-07-30 | 2018-03-26 | Macrogenics Inc | Pd-1-binding molecules and methods use thereof. |
CN106397592A (en) | 2015-07-31 | 2017-02-15 | 苏州康宁杰瑞生物科技有限公司 | Single-domain antibody directed at programmed death ligand (PD-L1) and derived protein thereof |
WO2017042816A1 (en) | 2015-09-10 | 2017-03-16 | Yeda Research And Development Co. Ltd. | Ablation of perforin positive dendritic cells in cancer treatment |
AU2016323069A1 (en) | 2015-09-14 | 2018-04-12 | Alpine Immune Sciences, Inc. | Tunable variant immunoglobulin superfamily domains and engineered cell therapy |
AU2016350701B2 (en) | 2015-11-02 | 2021-08-19 | Five Prime Therapeutics, Inc. | CD80 extracellular domain polypeptides and their use in cancer treatment |
EA201891021A1 (en) | 2015-12-17 | 2018-11-30 | Псайоксус Терапьютикс Лимитед | ADENOVIRUS GROUP B, ENCODING ANTIBODY TO THE TCR COMPLEX OR FRAGMENT OF THE INDICATED ANTIBODY |
CN108884164B (en) | 2016-02-25 | 2022-12-27 | 细胞医学瑞士公司 | Modified cells for immunotherapy |
EP3423108A4 (en) | 2016-03-02 | 2019-10-02 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
HUE064857T2 (en) | 2016-03-04 | 2024-04-28 | Io Biotech Aps | Combination therapy against cancer |
KR102536850B1 (en) | 2016-04-15 | 2023-05-26 | 알파인 이뮨 사이언시즈, 인코포레이티드 | ICOS Ligand Variant Immunomodulatory Proteins and Uses Thereof |
JP7527758B2 (en) | 2016-04-15 | 2024-08-05 | アルパイン イミューン サイエンシズ インコーポレイテッド | CD80 variant immunomodulatory proteins and uses thereof |
CA3024509A1 (en) | 2016-05-18 | 2017-11-23 | Modernatx, Inc. | Mrna combination therapy for the treatment of cancer |
EP3458096A4 (en) | 2016-05-18 | 2019-11-27 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
CN118307682A (en) | 2016-09-27 | 2024-07-09 | 埃皮辛特瑞柯斯公司 | Immunomodulatory fusion proteins |
JP2020500010A (en) | 2016-10-20 | 2020-01-09 | アルパイン イミューン サイエンシズ インコーポレイテッド | Secretory variant immunomodulatory proteins and modified cell therapy |
WO2018201014A1 (en) | 2017-04-28 | 2018-11-01 | Five Prime Therapeutics, Inc. | Methods of treatment with cd80 extracellular domain polypeptides |
WO2020047087A1 (en) | 2018-08-29 | 2020-03-05 | Five Prime Therapeutics, Inc. | Cd80 extracellular domain fc fusion protein dosing regimens |
AU2020224137A1 (en) | 2019-02-22 | 2021-10-14 | Five Prime Therapeutics, Inc. | CD80 extracellular domain-Fc fusion proteins for treating PD-L1 negative tumors |
AU2020270395A1 (en) | 2019-05-03 | 2021-12-23 | Five Prime Therapeutics, Inc. | Pharmaceutical formulations containing CD80 extracellular domain-Fc fusion proteins |
-
2016
- 2016-11-01 AU AU2016350701A patent/AU2016350701B2/en not_active Ceased
- 2016-11-01 MX MX2018005517A patent/MX2018005517A/en unknown
- 2016-11-01 CR CR20180306A patent/CR20180306A/en unknown
- 2016-11-01 PE PE2018000712A patent/PE20181300A1/en unknown
- 2016-11-01 JP JP2018520115A patent/JP6936221B2/en active Active
- 2016-11-01 BR BR112018008865A patent/BR112018008865A8/en not_active IP Right Cessation
- 2016-11-01 SG SG11201803009VA patent/SG11201803009VA/en unknown
- 2016-11-01 EP EP16794878.5A patent/EP3371208B1/en active Active
- 2016-11-01 US US15/340,238 patent/US10273281B2/en active Active
- 2016-11-01 EA EA201891106A patent/EA201891106A1/en unknown
- 2016-11-01 TW TW105135388A patent/TW201722985A/en unknown
- 2016-11-01 CA CA3001131A patent/CA3001131A1/en not_active Abandoned
- 2016-11-01 KR KR1020187014561A patent/KR20180069903A/en unknown
- 2016-11-01 MA MA043163A patent/MA43163A/en unknown
- 2016-11-01 WO PCT/US2016/059838 patent/WO2017079117A1/en active Application Filing
- 2016-11-01 CN CN201680065219.7A patent/CN108884139A/en active Pending
-
2018
- 2018-04-16 IL IL258725A patent/IL258725A/en unknown
- 2018-04-18 CO CONC2018/0004132A patent/CO2018004132A2/en unknown
- 2018-05-02 PH PH12018500933A patent/PH12018500933A1/en unknown
- 2018-05-02 CL CL2018001172A patent/CL2018001172A1/en unknown
- 2018-06-01 EC ECIEPI201841501A patent/ECSP18041501A/en unknown
-
2019
- 2019-03-07 US US16/295,978 patent/US20190194288A1/en not_active Abandoned
- 2019-03-15 US US16/354,689 patent/US11098103B2/en active Active
-
2020
- 2020-12-28 CL CL2020003392A patent/CL2020003392A1/en unknown
-
2022
- 2022-05-11 US US17/742,189 patent/US20240041979A1/en active Pending
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11098103B2 (en) | 2015-11-02 | 2021-08-24 | Five Prime Therapeutics, Inc. | CD80 extracellular domain polypeptides and their use in cancer treatment |
US11789010B2 (en) | 2017-04-28 | 2023-10-17 | Five Prime Therapeutics, Inc. | Methods of treatment with CD80 extracellular domain polypeptides |
Also Published As
Publication number | Publication date |
---|---|
PH12018500933A1 (en) | 2018-11-19 |
US20170145071A1 (en) | 2017-05-25 |
KR20180069903A (en) | 2018-06-25 |
TW201722985A (en) | 2017-07-01 |
MX2018005517A (en) | 2018-11-09 |
JP6936221B2 (en) | 2021-09-15 |
AU2016350701A1 (en) | 2018-05-31 |
CN108884139A (en) | 2018-11-23 |
PE20181300A1 (en) | 2018-08-09 |
US20190202889A1 (en) | 2019-07-04 |
EP3371208B1 (en) | 2024-09-18 |
US11098103B2 (en) | 2021-08-24 |
AU2016350701B2 (en) | 2021-08-19 |
BR112018008865A8 (en) | 2019-02-26 |
BR112018008865A2 (en) | 2018-11-06 |
CL2020003392A1 (en) | 2021-07-19 |
US10273281B2 (en) | 2019-04-30 |
WO2017079117A1 (en) | 2017-05-11 |
CA3001131A1 (en) | 2017-05-11 |
EP3371208A1 (en) | 2018-09-12 |
CO2018004132A2 (en) | 2018-11-30 |
EA201891106A1 (en) | 2018-12-28 |
CL2018001172A1 (en) | 2018-09-21 |
US20240041979A1 (en) | 2024-02-08 |
CR20180306A (en) | 2018-10-16 |
IL258725A (en) | 2018-06-28 |
ECSP18041501A (en) | 2018-06-30 |
SG11201803009VA (en) | 2018-05-30 |
MA43163A (en) | 2018-09-12 |
JP2018535204A (en) | 2018-11-29 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11098103B2 (en) | CD80 extracellular domain polypeptides and their use in cancer treatment | |
US11559583B2 (en) | Anti-CSF1R antibody and agonistic anti-CD40 antibody combination therapy for cancer | |
US20230052212A1 (en) | Fgfr2 inhibitors alone or in combination with immune stimulating agents in cancer treatment | |
US20240228653A1 (en) | PSGL-1 Antagonists and Uses Thereof | |
US11789010B2 (en) | Methods of treatment with CD80 extracellular domain polypeptides | |
WO2016065038A1 (en) | Slamf1 antagonists and uses thereof | |
JP2020512357A (en) | Combination therapy for cancer using anti-GITR antibody | |
EA039894B1 (en) | Method of treating cancer, composition for treating cancer, use of the composition for preparation of a medicament for treating cancer characterized with presence of macrophages expressing csf1r |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: FIVE PRIME THERAPEUTICS, INC., CALIFORNIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:BRENNAN, THOMAS;BELLOVIN, DAVID;BUSHA, DAVID;AND OTHERS;REEL/FRAME:048694/0024 Effective date: 20180403 |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO PAY ISSUE FEE |