US20190046619A1 - Brachyury protein, non-poxvirus non-yeast vectors encoding brachyury protein, and their use - Google Patents
Brachyury protein, non-poxvirus non-yeast vectors encoding brachyury protein, and their use Download PDFInfo
- Publication number
- US20190046619A1 US20190046619A1 US16/107,559 US201816107559A US2019046619A1 US 20190046619 A1 US20190046619 A1 US 20190046619A1 US 201816107559 A US201816107559 A US 201816107559A US 2019046619 A1 US2019046619 A1 US 2019046619A1
- Authority
- US
- United States
- Prior art keywords
- brachyury
- protein
- cancer
- cells
- cell
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 239000013598 vector Substances 0.000 title claims abstract description 225
- 101710086566 T-box transcription factor T Proteins 0.000 title abstract description 194
- 102100033130 T-box transcription factor T Human genes 0.000 title abstract description 194
- 240000004808 Saccharomyces cerevisiae Species 0.000 title abstract description 46
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 133
- 238000000034 method Methods 0.000 claims abstract description 130
- 201000011510 cancer Diseases 0.000 claims abstract description 92
- 210000001744 T-lymphocyte Anatomy 0.000 claims abstract description 63
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 claims abstract description 8
- 108090000623 proteins and genes Proteins 0.000 claims description 235
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 211
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 183
- 229920001184 polypeptide Polymers 0.000 claims description 169
- 102000004169 proteins and genes Human genes 0.000 claims description 119
- 150000001413 amino acids Chemical class 0.000 claims description 76
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 48
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 47
- 241000282414 Homo sapiens Species 0.000 claims description 42
- 208000026310 Breast neoplasm Diseases 0.000 claims description 39
- 230000028993 immune response Effects 0.000 claims description 36
- 206010006187 Breast cancer Diseases 0.000 claims description 35
- 239000003795 chemical substances by application Substances 0.000 claims description 34
- 230000005867 T cell response Effects 0.000 claims description 32
- 239000002671 adjuvant Substances 0.000 claims description 29
- 108060008682 Tumor Necrosis Factor Proteins 0.000 claims description 18
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 claims description 18
- 230000001939 inductive effect Effects 0.000 claims description 18
- 108010074328 Interferon-gamma Proteins 0.000 claims description 16
- 102100037850 Interferon gamma Human genes 0.000 claims description 15
- 230000003308 immunostimulating effect Effects 0.000 claims description 15
- 238000012360 testing method Methods 0.000 claims description 15
- 230000001225 therapeutic effect Effects 0.000 claims description 14
- 108010084313 CD58 Antigens Proteins 0.000 claims description 13
- 230000000139 costimulatory effect Effects 0.000 claims description 13
- 229920001661 Chitosan Polymers 0.000 claims description 12
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 claims description 12
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 claims description 11
- 210000001550 testis Anatomy 0.000 claims description 11
- 102100025218 B-cell differentiation antigen CD72 Human genes 0.000 claims description 10
- 101000934359 Homo sapiens B-cell differentiation antigen CD72 Proteins 0.000 claims description 10
- 208000000236 Prostatic Neoplasms Diseases 0.000 claims description 10
- 206010060862 Prostate cancer Diseases 0.000 claims description 9
- 239000002246 antineoplastic agent Substances 0.000 claims description 9
- 238000002512 chemotherapy Methods 0.000 claims description 9
- 229940127089 cytotoxic agent Drugs 0.000 claims description 9
- 108090001005 Interleukin-6 Proteins 0.000 claims description 7
- 102000004889 Interleukin-6 Human genes 0.000 claims description 7
- 230000005855 radiation Effects 0.000 claims description 7
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 claims description 6
- 102000013462 Interleukin-12 Human genes 0.000 claims description 6
- 108010065805 Interleukin-12 Proteins 0.000 claims description 6
- 102000043131 MHC class II family Human genes 0.000 claims description 6
- 108091054438 MHC class II family Proteins 0.000 claims description 6
- 239000003112 inhibitor Substances 0.000 claims description 5
- 206010009944 Colon cancer Diseases 0.000 claims description 4
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims description 4
- 108010009583 Transforming Growth Factors Proteins 0.000 claims description 4
- 102000009618 Transforming Growth Factors Human genes 0.000 claims description 4
- 201000005202 lung cancer Diseases 0.000 claims description 4
- 208000020816 lung neoplasm Diseases 0.000 claims description 4
- 150000003384 small molecules Chemical class 0.000 claims description 4
- 208000003950 B-cell lymphoma Diseases 0.000 claims description 3
- 208000011691 Burkitt lymphomas Diseases 0.000 claims description 3
- 102000009465 Growth Factor Receptors Human genes 0.000 claims description 3
- 108010009202 Growth Factor Receptors Proteins 0.000 claims description 3
- 208000017604 Hodgkin disease Diseases 0.000 claims description 3
- 208000021519 Hodgkin lymphoma Diseases 0.000 claims description 3
- 208000010747 Hodgkins lymphoma Diseases 0.000 claims description 3
- 102000043129 MHC class I family Human genes 0.000 claims description 3
- 108091054437 MHC class I family Proteins 0.000 claims description 3
- 206010033128 Ovarian cancer Diseases 0.000 claims description 3
- 206010061535 Ovarian neoplasm Diseases 0.000 claims description 3
- 208000002495 Uterine Neoplasms Diseases 0.000 claims description 3
- 208000029742 colonic neoplasm Diseases 0.000 claims description 3
- 230000008472 epithelial growth Effects 0.000 claims description 3
- 229940121358 tyrosine kinase inhibitor Drugs 0.000 claims description 3
- 239000005483 tyrosine kinase inhibitor Substances 0.000 claims description 3
- 150000004917 tyrosine kinase inhibitor derivatives Chemical class 0.000 claims description 3
- 206010046766 uterine cancer Diseases 0.000 claims description 3
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 claims description 2
- 108010002350 Interleukin-2 Proteins 0.000 claims description 2
- 208000005718 Stomach Neoplasms Diseases 0.000 claims description 2
- 206010017758 gastric cancer Diseases 0.000 claims description 2
- 201000011549 stomach cancer Diseases 0.000 claims description 2
- 102000015271 Intercellular Adhesion Molecule-1 Human genes 0.000 claims 2
- 208000016691 refractory malignant neoplasm Diseases 0.000 claims 2
- 206010005003 Bladder cancer Diseases 0.000 claims 1
- 102000004457 Granulocyte-Macrophage Colony-Stimulating Factor Human genes 0.000 claims 1
- 208000008839 Kidney Neoplasms Diseases 0.000 claims 1
- 206010038389 Renal cancer Diseases 0.000 claims 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 claims 1
- 230000014102 antigen processing and presentation of exogenous peptide antigen via MHC class I Effects 0.000 claims 1
- 201000010982 kidney cancer Diseases 0.000 claims 1
- 201000002314 small intestine cancer Diseases 0.000 claims 1
- 201000005112 urinary bladder cancer Diseases 0.000 claims 1
- 210000004027 cell Anatomy 0.000 abstract description 231
- 150000007523 nucleic acids Chemical class 0.000 abstract description 143
- 102000039446 nucleic acids Human genes 0.000 abstract description 107
- 108020004707 nucleic acids Proteins 0.000 abstract description 107
- 238000001727 in vivo Methods 0.000 abstract description 15
- 238000004519 manufacturing process Methods 0.000 abstract description 15
- 235000018102 proteins Nutrition 0.000 description 113
- 230000014509 gene expression Effects 0.000 description 85
- 241000700605 Viruses Species 0.000 description 80
- 235000001014 amino acid Nutrition 0.000 description 74
- 229940024606 amino acid Drugs 0.000 description 73
- 102000053602 DNA Human genes 0.000 description 60
- 108020004414 DNA Proteins 0.000 description 60
- 108091007433 antigens Proteins 0.000 description 60
- 239000000427 antigen Substances 0.000 description 59
- 102000036639 antigens Human genes 0.000 description 59
- 241000710929 Alphavirus Species 0.000 description 45
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 44
- 239000000203 mixture Substances 0.000 description 42
- 238000004806 packaging method and process Methods 0.000 description 41
- 210000001519 tissue Anatomy 0.000 description 41
- 239000002773 nucleotide Substances 0.000 description 37
- 125000003729 nucleotide group Chemical group 0.000 description 37
- 239000013612 plasmid Substances 0.000 description 34
- 241000894006 Bacteria Species 0.000 description 32
- 230000000670 limiting effect Effects 0.000 description 32
- 229920002477 rna polymer Polymers 0.000 description 32
- 241000991587 Enterovirus C Species 0.000 description 31
- 230000002238 attenuated effect Effects 0.000 description 30
- 210000004443 dendritic cell Anatomy 0.000 description 30
- 230000002163 immunogen Effects 0.000 description 30
- 210000000481 breast Anatomy 0.000 description 29
- -1 dendritic cells Proteins 0.000 description 29
- 230000003612 virological effect Effects 0.000 description 29
- 241000712079 Measles morbillivirus Species 0.000 description 27
- 241000607142 Salmonella Species 0.000 description 25
- 239000002245 particle Substances 0.000 description 25
- 241000701161 unidentified adenovirus Species 0.000 description 25
- 210000000612 antigen-presenting cell Anatomy 0.000 description 24
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 24
- 239000013603 viral vector Substances 0.000 description 24
- 201000010099 disease Diseases 0.000 description 23
- 208000015181 infectious disease Diseases 0.000 description 22
- 239000002299 complementary DNA Substances 0.000 description 21
- 238000000338 in vitro Methods 0.000 description 20
- 241000713666 Lentivirus Species 0.000 description 19
- 102000015694 estrogen receptors Human genes 0.000 description 19
- 108010038795 estrogen receptors Proteins 0.000 description 19
- 239000012634 fragment Substances 0.000 description 19
- 102000040430 polynucleotide Human genes 0.000 description 19
- 108091033319 polynucleotide Proteins 0.000 description 19
- 239000002157 polynucleotide Substances 0.000 description 19
- 230000004044 response Effects 0.000 description 19
- 241000186781 Listeria Species 0.000 description 18
- 230000035772 mutation Effects 0.000 description 18
- 230000010076 replication Effects 0.000 description 18
- 230000001177 retroviral effect Effects 0.000 description 18
- 238000013518 transcription Methods 0.000 description 18
- 230000035897 transcription Effects 0.000 description 18
- 241001430294 unidentified retrovirus Species 0.000 description 18
- 241000186779 Listeria monocytogenes Species 0.000 description 17
- 229960005486 vaccine Drugs 0.000 description 17
- 210000003719 b-lymphocyte Anatomy 0.000 description 16
- 230000006870 function Effects 0.000 description 16
- 238000003199 nucleic acid amplification method Methods 0.000 description 16
- 102000003998 progesterone receptors Human genes 0.000 description 16
- 108090000468 progesterone receptors Proteins 0.000 description 16
- 230000003321 amplification Effects 0.000 description 15
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 15
- 238000012384 transportation and delivery Methods 0.000 description 15
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 13
- 230000000694 effects Effects 0.000 description 13
- 230000012010 growth Effects 0.000 description 13
- 238000003780 insertion Methods 0.000 description 13
- 230000037431 insertion Effects 0.000 description 13
- 238000011282 treatment Methods 0.000 description 13
- 230000027455 binding Effects 0.000 description 12
- 210000000234 capsid Anatomy 0.000 description 12
- 238000012217 deletion Methods 0.000 description 12
- 230000037430 deletion Effects 0.000 description 12
- 239000013615 primer Substances 0.000 description 12
- 241001529936 Murinae Species 0.000 description 11
- 210000001165 lymph node Anatomy 0.000 description 11
- 239000003550 marker Substances 0.000 description 11
- 238000006467 substitution reaction Methods 0.000 description 11
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 11
- 210000002845 virion Anatomy 0.000 description 11
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 10
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 description 10
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 10
- 102100034349 Integrase Human genes 0.000 description 10
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 description 10
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 10
- 241000710960 Sindbis virus Species 0.000 description 10
- 101710172711 Structural protein Proteins 0.000 description 10
- 239000003814 drug Substances 0.000 description 10
- 206010073095 invasive ductal breast carcinoma Diseases 0.000 description 10
- 210000003734 kidney Anatomy 0.000 description 10
- 239000002502 liposome Substances 0.000 description 10
- 239000003921 oil Substances 0.000 description 10
- 235000019198 oils Nutrition 0.000 description 10
- 208000024891 symptom Diseases 0.000 description 10
- 238000001890 transfection Methods 0.000 description 10
- 238000013519 translation Methods 0.000 description 10
- 108010055166 Chemokine CCL5 Proteins 0.000 description 9
- 102000001327 Chemokine CCL5 Human genes 0.000 description 9
- 101000764263 Homo sapiens Tumor necrosis factor ligand superfamily member 4 Proteins 0.000 description 9
- 102000003812 Interleukin-15 Human genes 0.000 description 9
- 241000124008 Mammalia Species 0.000 description 9
- 102100026890 Tumor necrosis factor ligand superfamily member 4 Human genes 0.000 description 9
- 241000700618 Vaccinia virus Species 0.000 description 9
- 230000003834 intracellular effect Effects 0.000 description 9
- 230000001717 pathogenic effect Effects 0.000 description 9
- 239000000047 product Substances 0.000 description 9
- 210000002307 prostate Anatomy 0.000 description 9
- 239000003981 vehicle Substances 0.000 description 9
- 101710132601 Capsid protein Proteins 0.000 description 8
- 101710081079 Minor spike protein H Proteins 0.000 description 8
- 102000040945 Transcription factor Human genes 0.000 description 8
- 108091023040 Transcription factor Proteins 0.000 description 8
- 230000000890 antigenic effect Effects 0.000 description 8
- 201000008275 breast carcinoma Diseases 0.000 description 8
- 239000000969 carrier Substances 0.000 description 8
- 210000001072 colon Anatomy 0.000 description 8
- 210000000172 cytosol Anatomy 0.000 description 8
- 230000018109 developmental process Effects 0.000 description 8
- 230000002401 inhibitory effect Effects 0.000 description 8
- 238000002347 injection Methods 0.000 description 8
- 239000007924 injection Substances 0.000 description 8
- 210000004072 lung Anatomy 0.000 description 8
- 230000001404 mediated effect Effects 0.000 description 8
- 210000003716 mesoderm Anatomy 0.000 description 8
- 238000003752 polymerase chain reaction Methods 0.000 description 8
- 239000000523 sample Substances 0.000 description 8
- 101000805768 Banna virus (strain Indonesia/JKT-6423/1980) mRNA (guanine-N(7))-methyltransferase Proteins 0.000 description 7
- 101710197658 Capsid protein VP1 Proteins 0.000 description 7
- 201000009030 Carcinoma Diseases 0.000 description 7
- 101000686790 Chaetoceros protobacilladnavirus 2 Replication-associated protein Proteins 0.000 description 7
- 101000864475 Chlamydia phage 1 Internal scaffolding protein VP3 Proteins 0.000 description 7
- 108091026890 Coding region Proteins 0.000 description 7
- 101000803553 Eumenes pomiformis Venom peptide 3 Proteins 0.000 description 7
- 101000583961 Halorubrum pleomorphic virus 1 Matrix protein Proteins 0.000 description 7
- 241000725303 Human immunodeficiency virus Species 0.000 description 7
- 108060003951 Immunoglobulin Proteins 0.000 description 7
- 108090000172 Interleukin-15 Proteins 0.000 description 7
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 7
- 206010027476 Metastases Diseases 0.000 description 7
- 108700026244 Open Reading Frames Proteins 0.000 description 7
- 101710118046 RNA-directed RNA polymerase Proteins 0.000 description 7
- 101710108545 Viral protein 1 Proteins 0.000 description 7
- 238000003556 assay Methods 0.000 description 7
- 230000015572 biosynthetic process Effects 0.000 description 7
- 230000002950 deficient Effects 0.000 description 7
- 239000003599 detergent Substances 0.000 description 7
- 229940079593 drug Drugs 0.000 description 7
- 239000003623 enhancer Substances 0.000 description 7
- 230000007705 epithelial mesenchymal transition Effects 0.000 description 7
- 230000002068 genetic effect Effects 0.000 description 7
- 238000009396 hybridization Methods 0.000 description 7
- 102000018358 immunoglobulin Human genes 0.000 description 7
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 7
- 210000001672 ovary Anatomy 0.000 description 7
- 210000000813 small intestine Anatomy 0.000 description 7
- 210000002784 stomach Anatomy 0.000 description 7
- 238000012546 transfer Methods 0.000 description 7
- 210000003932 urinary bladder Anatomy 0.000 description 7
- 210000004291 uterus Anatomy 0.000 description 7
- 230000001018 virulence Effects 0.000 description 7
- 101000742334 Bdellovibrio phage phiMH2K Replication-associated protein VP4 Proteins 0.000 description 6
- 102000004127 Cytokines Human genes 0.000 description 6
- 108090000695 Cytokines Proteins 0.000 description 6
- 230000004568 DNA-binding Effects 0.000 description 6
- 241000702421 Dependoparvovirus Species 0.000 description 6
- 102000001301 EGF receptor Human genes 0.000 description 6
- 108060006698 EGF receptor Proteins 0.000 description 6
- 101150029707 ERBB2 gene Proteins 0.000 description 6
- 101710091045 Envelope protein Proteins 0.000 description 6
- 102000004190 Enzymes Human genes 0.000 description 6
- 108090000790 Enzymes Proteins 0.000 description 6
- 241000588724 Escherichia coli Species 0.000 description 6
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 6
- 101000852023 Halorubrum pleomorphic virus 1 Envelope protein Proteins 0.000 description 6
- 108091006905 Human Serum Albumin Proteins 0.000 description 6
- 102000008100 Human Serum Albumin Human genes 0.000 description 6
- 241001465754 Metazoa Species 0.000 description 6
- 108010072866 Prostate-Specific Antigen Proteins 0.000 description 6
- 102100038358 Prostate-specific antigen Human genes 0.000 description 6
- 101710188315 Protein X Proteins 0.000 description 6
- 241000714474 Rous sarcoma virus Species 0.000 description 6
- 108091027544 Subgenomic mRNA Proteins 0.000 description 6
- 206010046865 Vaccinia virus infection Diseases 0.000 description 6
- 238000004113 cell culture Methods 0.000 description 6
- 230000001413 cellular effect Effects 0.000 description 6
- 230000036755 cellular response Effects 0.000 description 6
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 6
- 238000011161 development Methods 0.000 description 6
- 230000004069 differentiation Effects 0.000 description 6
- 239000012636 effector Substances 0.000 description 6
- 229940088598 enzyme Drugs 0.000 description 6
- 238000009472 formulation Methods 0.000 description 6
- 230000002458 infectious effect Effects 0.000 description 6
- 230000003902 lesion Effects 0.000 description 6
- 210000004962 mammalian cell Anatomy 0.000 description 6
- 230000001394 metastastic effect Effects 0.000 description 6
- 206010061289 metastatic neoplasm Diseases 0.000 description 6
- 239000013600 plasmid vector Substances 0.000 description 6
- 239000002243 precursor Substances 0.000 description 6
- 102000005962 receptors Human genes 0.000 description 6
- 108020003175 receptors Proteins 0.000 description 6
- 230000000087 stabilizing effect Effects 0.000 description 6
- 238000010186 staining Methods 0.000 description 6
- 210000000130 stem cell Anatomy 0.000 description 6
- 230000000638 stimulation Effects 0.000 description 6
- 239000000126 substance Substances 0.000 description 6
- 210000004881 tumor cell Anatomy 0.000 description 6
- 208000007089 vaccinia Diseases 0.000 description 6
- 210000005253 yeast cell Anatomy 0.000 description 6
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 5
- 108020004705 Codon Proteins 0.000 description 5
- 241000701022 Cytomegalovirus Species 0.000 description 5
- 208000000666 Fowlpox Diseases 0.000 description 5
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 5
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 5
- 102100025390 Integrin beta-2 Human genes 0.000 description 5
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 5
- 108010064548 Lymphocyte Function-Associated Antigen-1 Proteins 0.000 description 5
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 5
- 201000005505 Measles Diseases 0.000 description 5
- 241000713311 Simian immunodeficiency virus Species 0.000 description 5
- 102100025237 T-cell surface antigen CD2 Human genes 0.000 description 5
- 101710165202 T-cell surface antigen CD2 Proteins 0.000 description 5
- 125000000539 amino acid group Chemical group 0.000 description 5
- 230000008901 benefit Effects 0.000 description 5
- 238000006243 chemical reaction Methods 0.000 description 5
- 150000001875 compounds Chemical class 0.000 description 5
- 238000010276 construction Methods 0.000 description 5
- 238000013270 controlled release Methods 0.000 description 5
- 238000004520 electroporation Methods 0.000 description 5
- 239000000839 emulsion Substances 0.000 description 5
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 5
- 210000000987 immune system Anatomy 0.000 description 5
- 230000005847 immunogenicity Effects 0.000 description 5
- 238000003364 immunohistochemistry Methods 0.000 description 5
- 230000002779 inactivation Effects 0.000 description 5
- 230000001965 increasing effect Effects 0.000 description 5
- 230000006698 induction Effects 0.000 description 5
- 125000005647 linker group Chemical group 0.000 description 5
- 108020004999 messenger RNA Proteins 0.000 description 5
- 230000009401 metastasis Effects 0.000 description 5
- 229930182817 methionine Natural products 0.000 description 5
- 239000004005 microsphere Substances 0.000 description 5
- 230000002018 overexpression Effects 0.000 description 5
- 229920000136 polysorbate Polymers 0.000 description 5
- 238000002360 preparation method Methods 0.000 description 5
- 238000000746 purification Methods 0.000 description 5
- 230000028327 secretion Effects 0.000 description 5
- 241000894007 species Species 0.000 description 5
- 238000010561 standard procedure Methods 0.000 description 5
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 4
- 241000713756 Caprine arthritis encephalitis virus Species 0.000 description 4
- 108090000565 Capsid Proteins Proteins 0.000 description 4
- 241000282693 Cercopithecidae Species 0.000 description 4
- 102100023321 Ceruloplasmin Human genes 0.000 description 4
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 4
- 241000713800 Feline immunodeficiency virus Species 0.000 description 4
- 208000031886 HIV Infections Diseases 0.000 description 4
- 102000004388 Interleukin-4 Human genes 0.000 description 4
- 108090000978 Interleukin-4 Proteins 0.000 description 4
- 241000713869 Moloney murine leukemia virus Species 0.000 description 4
- OVRNDRQMDRJTHS-UHFFFAOYSA-N N-acelyl-D-glucosamine Natural products CC(=O)NC1C(O)OC(CO)C(O)C1O OVRNDRQMDRJTHS-UHFFFAOYSA-N 0.000 description 4
- 108091005461 Nucleic proteins Proteins 0.000 description 4
- 108091034117 Oligonucleotide Proteins 0.000 description 4
- 108010076039 Polyproteins Proteins 0.000 description 4
- 108020004511 Recombinant DNA Proteins 0.000 description 4
- 229940124842 Salmonella vaccine Drugs 0.000 description 4
- 108091027967 Small hairpin RNA Proteins 0.000 description 4
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 4
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 4
- 108020005202 Viral DNA Proteins 0.000 description 4
- 230000001580 bacterial effect Effects 0.000 description 4
- 239000011324 bead Substances 0.000 description 4
- 230000003115 biocidal effect Effects 0.000 description 4
- 230000010261 cell growth Effects 0.000 description 4
- 210000000170 cell membrane Anatomy 0.000 description 4
- 210000002421 cell wall Anatomy 0.000 description 4
- 238000010367 cloning Methods 0.000 description 4
- 230000000295 complement effect Effects 0.000 description 4
- 230000001419 dependent effect Effects 0.000 description 4
- 239000003937 drug carrier Substances 0.000 description 4
- 238000012377 drug delivery Methods 0.000 description 4
- 206010014599 encephalitis Diseases 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 201000007280 estrogen-receptor negative breast cancer Diseases 0.000 description 4
- 239000013604 expression vector Substances 0.000 description 4
- 108020001507 fusion proteins Proteins 0.000 description 4
- 102000037865 fusion proteins Human genes 0.000 description 4
- 238000001415 gene therapy Methods 0.000 description 4
- 208000002672 hepatitis B Diseases 0.000 description 4
- 230000036039 immunity Effects 0.000 description 4
- 230000003053 immunization Effects 0.000 description 4
- 230000000977 initiatory effect Effects 0.000 description 4
- 230000003993 interaction Effects 0.000 description 4
- 229940028885 interleukin-4 Drugs 0.000 description 4
- 210000000265 leukocyte Anatomy 0.000 description 4
- 238000007834 ligase chain reaction Methods 0.000 description 4
- 230000033001 locomotion Effects 0.000 description 4
- 230000003211 malignant effect Effects 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 210000004379 membrane Anatomy 0.000 description 4
- 239000003094 microcapsule Substances 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- 238000012986 modification Methods 0.000 description 4
- 239000008194 pharmaceutical composition Substances 0.000 description 4
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Chemical compound [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 4
- 238000012545 processing Methods 0.000 description 4
- 201000007282 progesterone-receptor negative breast cancer Diseases 0.000 description 4
- 230000002285 radioactive effect Effects 0.000 description 4
- 238000003753 real-time PCR Methods 0.000 description 4
- 230000001105 regulatory effect Effects 0.000 description 4
- 230000003362 replicative effect Effects 0.000 description 4
- 239000004055 small Interfering RNA Substances 0.000 description 4
- 239000002904 solvent Substances 0.000 description 4
- 230000002103 transcriptional effect Effects 0.000 description 4
- 238000010361 transduction Methods 0.000 description 4
- 230000026683 transduction Effects 0.000 description 4
- 241001529453 unidentified herpesvirus Species 0.000 description 4
- 238000011144 upstream manufacturing Methods 0.000 description 4
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
- 239000013607 AAV vector Substances 0.000 description 3
- 229920000936 Agarose Polymers 0.000 description 3
- 108700028369 Alleles Proteins 0.000 description 3
- 241000271566 Aves Species 0.000 description 3
- 101100534299 Bacillus subtilis (strain 168) sscB gene Proteins 0.000 description 3
- 102100026189 Beta-galactosidase Human genes 0.000 description 3
- 102100032912 CD44 antigen Human genes 0.000 description 3
- 241000222120 Candida <Saccharomycetales> Species 0.000 description 3
- 108090000538 Caspase-8 Proteins 0.000 description 3
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 3
- 101710121417 Envelope glycoprotein Proteins 0.000 description 3
- 101000823089 Equus caballus Alpha-1-antiproteinase 1 Proteins 0.000 description 3
- 201000006107 Familial adenomatous polyposis Diseases 0.000 description 3
- 102100037362 Fibronectin Human genes 0.000 description 3
- 108010067306 Fibronectins Proteins 0.000 description 3
- 102100031181 Glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- 101000651211 Homo sapiens Transcription factor PU.1 Proteins 0.000 description 3
- 241000713340 Human immunodeficiency virus 2 Species 0.000 description 3
- 108091092195 Intron Proteins 0.000 description 3
- 102100025756 Keratin, type II cytoskeletal 5 Human genes 0.000 description 3
- 108010070553 Keratin-5 Proteins 0.000 description 3
- 241001138401 Kluyveromyces lactis Species 0.000 description 3
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 3
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 3
- 241000186806 Listeria grayi Species 0.000 description 3
- 101710126949 Lysin Proteins 0.000 description 3
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 3
- 102100028389 Melanoma antigen recognized by T-cells 1 Human genes 0.000 description 3
- 102100039373 Membrane cofactor protein Human genes 0.000 description 3
- OVRNDRQMDRJTHS-FMDGEEDCSA-N N-acetyl-beta-D-glucosamine Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-FMDGEEDCSA-N 0.000 description 3
- 241000235648 Pichia Species 0.000 description 3
- 206010071019 Prostatic dysplasia Diseases 0.000 description 3
- 101710149951 Protein Tat Proteins 0.000 description 3
- 101100311043 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) sseC gene Proteins 0.000 description 3
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 3
- YXFVVABEGXRONW-UHFFFAOYSA-N Toluene Chemical compound CC1=CC=CC=C1 YXFVVABEGXRONW-UHFFFAOYSA-N 0.000 description 3
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 3
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 3
- 241000710959 Venezuelan equine encephalitis virus Species 0.000 description 3
- 108010067390 Viral Proteins Proteins 0.000 description 3
- 108020000999 Viral RNA Proteins 0.000 description 3
- 241000713325 Visna/maedi virus Species 0.000 description 3
- 125000000217 alkyl group Chemical group 0.000 description 3
- 150000001408 amides Chemical class 0.000 description 3
- 239000005557 antagonist Substances 0.000 description 3
- 239000003242 anti bacterial agent Substances 0.000 description 3
- 229940088710 antibiotic agent Drugs 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- MSWZFWKMSRAUBD-QZABAPFNSA-N beta-D-glucosamine Chemical group N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O MSWZFWKMSRAUBD-QZABAPFNSA-N 0.000 description 3
- 108010005774 beta-Galactosidase Proteins 0.000 description 3
- 239000011230 binding agent Substances 0.000 description 3
- 210000000988 bone and bone Anatomy 0.000 description 3
- 239000001506 calcium phosphate Substances 0.000 description 3
- 229910000389 calcium phosphate Inorganic materials 0.000 description 3
- 235000011010 calcium phosphates Nutrition 0.000 description 3
- 230000007910 cell fusion Effects 0.000 description 3
- 208000029664 classic familial adenomatous polyposis Diseases 0.000 description 3
- 230000000875 corresponding effect Effects 0.000 description 3
- 230000006196 deacetylation Effects 0.000 description 3
- 238000003381 deacetylation reaction Methods 0.000 description 3
- 230000003247 decreasing effect Effects 0.000 description 3
- PRAKJMSDJKAYCZ-UHFFFAOYSA-N dodecahydrosqualene Natural products CC(C)CCCC(C)CCCC(C)CCCCC(C)CCCC(C)CCCC(C)C PRAKJMSDJKAYCZ-UHFFFAOYSA-N 0.000 description 3
- 210000002919 epithelial cell Anatomy 0.000 description 3
- 150000002148 esters Chemical class 0.000 description 3
- 229940011871 estrogen Drugs 0.000 description 3
- 239000000262 estrogen Substances 0.000 description 3
- 210000003527 eukaryotic cell Anatomy 0.000 description 3
- 210000002950 fibroblast Anatomy 0.000 description 3
- 229940088597 hormone Drugs 0.000 description 3
- 239000005556 hormone Substances 0.000 description 3
- 210000005260 human cell Anatomy 0.000 description 3
- 101150100002 iap gene Proteins 0.000 description 3
- 238000002649 immunization Methods 0.000 description 3
- 238000009169 immunotherapy Methods 0.000 description 3
- 238000010348 incorporation Methods 0.000 description 3
- 230000009545 invasion Effects 0.000 description 3
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 3
- 101150066555 lacZ gene Proteins 0.000 description 3
- 150000002632 lipids Chemical class 0.000 description 3
- 210000004698 lymphocyte Anatomy 0.000 description 3
- 238000012423 maintenance Methods 0.000 description 3
- 230000036210 malignancy Effects 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 244000005700 microbiome Species 0.000 description 3
- 239000011859 microparticle Substances 0.000 description 3
- 229950006780 n-acetylglucosamine Drugs 0.000 description 3
- 239000002088 nanocapsule Substances 0.000 description 3
- 239000002105 nanoparticle Substances 0.000 description 3
- 210000004940 nucleus Anatomy 0.000 description 3
- 230000007918 pathogenicity Effects 0.000 description 3
- 230000001575 pathological effect Effects 0.000 description 3
- 101150050662 plcB gene Proteins 0.000 description 3
- 239000002987 primer (paints) Substances 0.000 description 3
- 230000006798 recombination Effects 0.000 description 3
- 238000005215 recombination Methods 0.000 description 3
- 238000006722 reduction reaction Methods 0.000 description 3
- 150000003839 salts Chemical class 0.000 description 3
- 230000035945 sensitivity Effects 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 230000009870 specific binding Effects 0.000 description 3
- 208000001608 teratocarcinoma Diseases 0.000 description 3
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 3
- 230000009466 transformation Effects 0.000 description 3
- 230000001052 transient effect Effects 0.000 description 3
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 3
- 241000701447 unidentified baculovirus Species 0.000 description 3
- 230000035899 viability Effects 0.000 description 3
- FDKXTQMXEQVLRF-ZHACJKMWSA-N (E)-dacarbazine Chemical compound CN(C)\N=N\c1[nH]cnc1C(N)=O FDKXTQMXEQVLRF-ZHACJKMWSA-N 0.000 description 2
- VOXZDWNPVJITMN-ZBRFXRBCSA-N 17β-estradiol Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 VOXZDWNPVJITMN-ZBRFXRBCSA-N 0.000 description 2
- FWBHETKCLVMNFS-UHFFFAOYSA-N 4',6-Diamino-2-phenylindol Chemical compound C1=CC(C(=N)N)=CC=C1C1=CC2=CC=C(C(N)=N)C=C2N1 FWBHETKCLVMNFS-UHFFFAOYSA-N 0.000 description 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 2
- 241000714175 Abelson murine leukemia virus Species 0.000 description 2
- 102000007469 Actins Human genes 0.000 description 2
- 108010085238 Actins Proteins 0.000 description 2
- 102000009027 Albumins Human genes 0.000 description 2
- 108010088751 Albumins Proteins 0.000 description 2
- 101710187578 Alcohol dehydrogenase 1 Proteins 0.000 description 2
- 102100034035 Alcohol dehydrogenase 1A Human genes 0.000 description 2
- 102100023635 Alpha-fetoprotein Human genes 0.000 description 2
- 241001167018 Aroa Species 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 241000713840 Avian erythroblastosis virus Species 0.000 description 2
- 241000700663 Avipoxvirus Species 0.000 description 2
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 2
- FRPHFZCDPYBUAU-UHFFFAOYSA-N Bromocresolgreen Chemical group CC1=C(Br)C(O)=C(Br)C=C1C1(C=2C(=C(Br)C(O)=C(Br)C=2)C)C2=CC=CC=C2S(=O)(=O)O1 FRPHFZCDPYBUAU-UHFFFAOYSA-N 0.000 description 2
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 2
- 108010029697 CD40 Ligand Proteins 0.000 description 2
- 102100032937 CD40 ligand Human genes 0.000 description 2
- 102100022002 CD59 glycoprotein Human genes 0.000 description 2
- GAGWJHPBXLXJQN-UORFTKCHSA-N Capecitabine Chemical compound C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](C)O1 GAGWJHPBXLXJQN-UORFTKCHSA-N 0.000 description 2
- 102100025475 Carcinoembryonic antigen-related cell adhesion molecule 5 Human genes 0.000 description 2
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 2
- 102000004091 Caspase-8 Human genes 0.000 description 2
- 102000000844 Cell Surface Receptors Human genes 0.000 description 2
- 108010001857 Cell Surface Receptors Proteins 0.000 description 2
- 229920002101 Chitin Polymers 0.000 description 2
- 101000741396 Chlamydia muridarum (strain MoPn / Nigg) Probable oxidoreductase TC_0900 Proteins 0.000 description 2
- 101000741399 Chlamydia pneumoniae Probable oxidoreductase CPn_0761/CP_1111/CPj0761/CpB0789 Proteins 0.000 description 2
- 101000741400 Chlamydia trachomatis (strain D/UW-3/Cx) Probable oxidoreductase CT_610 Proteins 0.000 description 2
- 201000009047 Chordoma Diseases 0.000 description 2
- 206010061764 Chromosomal deletion Diseases 0.000 description 2
- 101710094648 Coat protein Proteins 0.000 description 2
- 102100030886 Complement receptor type 1 Human genes 0.000 description 2
- 102100032768 Complement receptor type 2 Human genes 0.000 description 2
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 2
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 2
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 2
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 2
- 208000006402 Ductal Carcinoma Diseases 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- 101100491986 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) aromA gene Proteins 0.000 description 2
- 206010066919 Epidemic polyarthritis Diseases 0.000 description 2
- 241000283073 Equus caballus Species 0.000 description 2
- 241000701959 Escherichia virus Lambda Species 0.000 description 2
- 108700039887 Essential Genes Proteins 0.000 description 2
- 241000206602 Eukaryota Species 0.000 description 2
- 208000000571 Fibrocystic breast disease Diseases 0.000 description 2
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 2
- 241000714475 Fujinami sarcoma virus Species 0.000 description 2
- 102400000921 Gastrin Human genes 0.000 description 2
- 241000237858 Gastropoda Species 0.000 description 2
- 206010064571 Gene mutation Diseases 0.000 description 2
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 description 2
- 102100028976 HLA class I histocompatibility antigen, B alpha chain Human genes 0.000 description 2
- 102100036242 HLA class II histocompatibility antigen, DQ alpha 2 chain Human genes 0.000 description 2
- 102000025850 HLA-A2 Antigen Human genes 0.000 description 2
- 108010074032 HLA-A2 Antigen Proteins 0.000 description 2
- 101000868273 Homo sapiens CD44 antigen Proteins 0.000 description 2
- 101000727061 Homo sapiens Complement receptor type 1 Proteins 0.000 description 2
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 description 2
- 101001055157 Homo sapiens Interleukin-15 Proteins 0.000 description 2
- 101001043807 Homo sapiens Interleukin-7 Proteins 0.000 description 2
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 2
- 101000800571 Homo sapiens T-box transcription factor T Proteins 0.000 description 2
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 2
- 241000701024 Human betaherpesvirus 5 Species 0.000 description 2
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 2
- 241000681881 Human mammary tumor virus Species 0.000 description 2
- 101100321817 Human parvovirus B19 (strain HV) 7.5K gene Proteins 0.000 description 2
- VSNHCAURESNICA-UHFFFAOYSA-N Hydroxyurea Chemical compound NC(=O)NO VSNHCAURESNICA-UHFFFAOYSA-N 0.000 description 2
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 2
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 2
- 102000014150 Interferons Human genes 0.000 description 2
- 108010050904 Interferons Proteins 0.000 description 2
- 102000004556 Interleukin-15 Receptors Human genes 0.000 description 2
- 108010017535 Interleukin-15 Receptors Proteins 0.000 description 2
- 102000015696 Interleukins Human genes 0.000 description 2
- 108010063738 Interleukins Proteins 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- 239000005551 L01XE03 - Erlotinib Substances 0.000 description 2
- GQYIWUVLTXOXAJ-UHFFFAOYSA-N Lomustine Chemical compound ClCCN(N=O)C(=O)NC1CCCCC1 GQYIWUVLTXOXAJ-UHFFFAOYSA-N 0.000 description 2
- 108010010995 MART-1 Antigen Proteins 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- 102000018697 Membrane Proteins Human genes 0.000 description 2
- 108010052285 Membrane Proteins Proteins 0.000 description 2
- 108010006519 Molecular Chaperones Proteins 0.000 description 2
- 241000700560 Molluscum contagiosum virus Species 0.000 description 2
- 241000713862 Moloney murine sarcoma virus Species 0.000 description 2
- 241000713333 Mouse mammary tumor virus Species 0.000 description 2
- 241000714177 Murine leukemia virus Species 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- 241001467552 Mycobacterium bovis BCG Species 0.000 description 2
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 2
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 2
- 238000005481 NMR spectroscopy Methods 0.000 description 2
- 206010061309 Neoplasm progression Diseases 0.000 description 2
- 101710138767 Non-structural glycoprotein 4 Proteins 0.000 description 2
- 101710144127 Non-structural protein 1 Proteins 0.000 description 2
- 101710144128 Non-structural protein 2 Proteins 0.000 description 2
- 101710144111 Non-structural protein 3 Proteins 0.000 description 2
- 241000700629 Orthopoxvirus Species 0.000 description 2
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 2
- 102000035195 Peptidases Human genes 0.000 description 2
- 108091005804 Peptidases Proteins 0.000 description 2
- 102100028251 Phosphoglycerate kinase 1 Human genes 0.000 description 2
- 101710139464 Phosphoglycerate kinase 1 Proteins 0.000 description 2
- 108010064785 Phospholipases Proteins 0.000 description 2
- 102000015439 Phospholipases Human genes 0.000 description 2
- RJKFOVLPORLFTN-LEKSSAKUSA-N Progesterone Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H](C(=O)C)[C@@]1(C)CC2 RJKFOVLPORLFTN-LEKSSAKUSA-N 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- 241000700638 Raccoonpox virus Species 0.000 description 2
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 2
- 102100022648 Reticulon-2 Human genes 0.000 description 2
- 241000710942 Ross River virus Species 0.000 description 2
- 102100031776 SH2 domain-containing protein 3A Human genes 0.000 description 2
- 102100021798 SH2 domain-containing protein 3C Human genes 0.000 description 2
- 241000235070 Saccharomyces Species 0.000 description 2
- 241000235346 Schizosaccharomyces Species 0.000 description 2
- 241000710961 Semliki Forest virus Species 0.000 description 2
- 102100031056 Serine protease 57 Human genes 0.000 description 2
- 101710197596 Serine protease 57 Proteins 0.000 description 2
- 241000713675 Spumavirus Species 0.000 description 2
- 101000857870 Squalus acanthias Gonadoliberin Proteins 0.000 description 2
- 108091081024 Start codon Proteins 0.000 description 2
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 2
- 108020005038 Terminator Codon Proteins 0.000 description 2
- MUMGGOZAMZWBJJ-DYKIIFRCSA-N Testostosterone Chemical compound O=C1CC[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 MUMGGOZAMZWBJJ-DYKIIFRCSA-N 0.000 description 2
- 102100027654 Transcription factor PU.1 Human genes 0.000 description 2
- 102400001320 Transforming growth factor alpha Human genes 0.000 description 2
- 101800004564 Transforming growth factor alpha Proteins 0.000 description 2
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 2
- 108010053099 Vascular Endothelial Growth Factor Receptor-2 Proteins 0.000 description 2
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 2
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 2
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 description 2
- 102000013127 Vimentin Human genes 0.000 description 2
- 108010065472 Vimentin Proteins 0.000 description 2
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 2
- 230000002159 abnormal effect Effects 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 2
- 239000012190 activator Substances 0.000 description 2
- 125000003545 alkoxy group Chemical group 0.000 description 2
- 229940100198 alkylating agent Drugs 0.000 description 2
- 239000002168 alkylating agent Substances 0.000 description 2
- 125000003277 amino group Chemical group 0.000 description 2
- 208000007502 anemia Diseases 0.000 description 2
- 230000000340 anti-metabolite Effects 0.000 description 2
- 230000030741 antigen processing and presentation Effects 0.000 description 2
- 229940100197 antimetabolite Drugs 0.000 description 2
- 239000002256 antimetabolite Substances 0.000 description 2
- 101150037081 aroA gene Proteins 0.000 description 2
- 239000003886 aromatase inhibitor Substances 0.000 description 2
- 229940046844 aromatase inhibitors Drugs 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- 230000003190 augmentative effect Effects 0.000 description 2
- 229960000190 bacillus calmette–guérin vaccine Drugs 0.000 description 2
- 210000002469 basement membrane Anatomy 0.000 description 2
- 238000002869 basic local alignment search tool Methods 0.000 description 2
- 230000031018 biological processes and functions Effects 0.000 description 2
- 210000004556 brain Anatomy 0.000 description 2
- 208000011803 breast fibrocystic disease Diseases 0.000 description 2
- 201000003714 breast lobular carcinoma Diseases 0.000 description 2
- 229960002092 busulfan Drugs 0.000 description 2
- 230000005907 cancer growth Effects 0.000 description 2
- 150000001735 carboxylic acids Chemical class 0.000 description 2
- 239000006143 cell culture medium Substances 0.000 description 2
- 239000013553 cell monolayer Substances 0.000 description 2
- 210000003855 cell nucleus Anatomy 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 239000013611 chromosomal DNA Substances 0.000 description 2
- 210000000349 chromosome Anatomy 0.000 description 2
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 2
- 230000004186 co-expression Effects 0.000 description 2
- 238000002648 combination therapy Methods 0.000 description 2
- 210000002808 connective tissue Anatomy 0.000 description 2
- 201000005332 contagious pustular dermatitis Diseases 0.000 description 2
- 239000000599 controlled substance Substances 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 239000012228 culture supernatant Substances 0.000 description 2
- 230000009089 cytolysis Effects 0.000 description 2
- 210000000805 cytoplasm Anatomy 0.000 description 2
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 2
- 229960000975 daunorubicin Drugs 0.000 description 2
- 230000002074 deregulated effect Effects 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 238000003745 diagnosis Methods 0.000 description 2
- 238000002405 diagnostic procedure Methods 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 241001493065 dsRNA viruses Species 0.000 description 2
- 239000002158 endotoxin Substances 0.000 description 2
- AAKJLRGGTJKAMG-UHFFFAOYSA-N erlotinib Chemical compound C=12C=C(OCCOC)C(OCCOC)=CC2=NC=NC=1NC1=CC=CC(C#C)=C1 AAKJLRGGTJKAMG-UHFFFAOYSA-N 0.000 description 2
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 2
- 229960005420 etoposide Drugs 0.000 description 2
- 238000000855 fermentation Methods 0.000 description 2
- 230000004151 fermentation Effects 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 229960002949 fluorouracil Drugs 0.000 description 2
- 108700004026 gag Genes Proteins 0.000 description 2
- 108010027225 gag-pol Fusion Proteins Proteins 0.000 description 2
- 150000002270 gangliosides Chemical class 0.000 description 2
- 230000007045 gastrulation Effects 0.000 description 2
- 238000010353 genetic engineering Methods 0.000 description 2
- 230000000762 glandular Effects 0.000 description 2
- 150000004676 glycans Chemical class 0.000 description 2
- 102000006602 glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 2
- 230000013595 glycosylation Effects 0.000 description 2
- 238000006206 glycosylation reaction Methods 0.000 description 2
- 210000002443 helper t lymphocyte Anatomy 0.000 description 2
- 230000006801 homologous recombination Effects 0.000 description 2
- 238000002744 homologous recombination Methods 0.000 description 2
- 102000052622 human IL7 Human genes 0.000 description 2
- 210000002865 immune cell Anatomy 0.000 description 2
- 238000003018 immunoassay Methods 0.000 description 2
- 229940072221 immunoglobulins Drugs 0.000 description 2
- 239000007943 implant Substances 0.000 description 2
- 238000011065 in-situ storage Methods 0.000 description 2
- 239000000411 inducer Substances 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 239000000543 intermediate Substances 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 238000007912 intraperitoneal administration Methods 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 206010073096 invasive lobular breast carcinoma Diseases 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 2
- 231100000518 lethal Toxicity 0.000 description 2
- 230000001665 lethal effect Effects 0.000 description 2
- 238000001638 lipofection Methods 0.000 description 2
- 229920006008 lipopolysaccharide Polymers 0.000 description 2
- 210000002540 macrophage Anatomy 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 2
- 239000011159 matrix material Substances 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical compound ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 2
- 229960004961 mechlorethamine Drugs 0.000 description 2
- 201000001441 melanoma Diseases 0.000 description 2
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 2
- 230000003847 mesoderm development Effects 0.000 description 2
- 208000037819 metastatic cancer Diseases 0.000 description 2
- 208000011575 metastatic malignant neoplasm Diseases 0.000 description 2
- 229960000485 methotrexate Drugs 0.000 description 2
- CFCUWKMKBJTWLW-BKHRDMLASA-N mithramycin Chemical compound O([C@@H]1C[C@@H](O[C@H](C)[C@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1C)O[C@@H]1O[C@H](C)[C@@H](O)[C@H](O[C@@H]2O[C@H](C)[C@H](O)[C@H](O[C@@H]3O[C@H](C)[C@@H](O)[C@@](C)(O)C3)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@@H](O)[C@H](O)[C@@H](C)O1 CFCUWKMKBJTWLW-BKHRDMLASA-N 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 239000002077 nanosphere Substances 0.000 description 2
- 229930014626 natural product Natural products 0.000 description 2
- 108700004028 nef Genes Proteins 0.000 description 2
- 230000001613 neoplastic effect Effects 0.000 description 2
- 230000003472 neutralizing effect Effects 0.000 description 2
- 231100000252 nontoxic Toxicity 0.000 description 2
- 230000003000 nontoxic effect Effects 0.000 description 2
- 238000007899 nucleic acid hybridization Methods 0.000 description 2
- 238000011275 oncology therapy Methods 0.000 description 2
- 210000003463 organelle Anatomy 0.000 description 2
- 230000008520 organization Effects 0.000 description 2
- 201000002528 pancreatic cancer Diseases 0.000 description 2
- 208000008443 pancreatic carcinoma Diseases 0.000 description 2
- 230000008506 pathogenesis Effects 0.000 description 2
- 229960003171 plicamycin Drugs 0.000 description 2
- 108700004029 pol Genes Proteins 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 229920001282 polysaccharide Polymers 0.000 description 2
- 239000005017 polysaccharide Substances 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- 238000001742 protein purification Methods 0.000 description 2
- 238000003156 radioimmunoprecipitation Methods 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 108091008146 restriction endonucleases Proteins 0.000 description 2
- 230000000717 retained effect Effects 0.000 description 2
- 238000010839 reverse transcription Methods 0.000 description 2
- FGDZQCVHDSGLHJ-UHFFFAOYSA-M rubidium chloride Chemical compound [Cl-].[Rb+] FGDZQCVHDSGLHJ-UHFFFAOYSA-M 0.000 description 2
- 238000007790 scraping Methods 0.000 description 2
- 239000000333 selective estrogen receptor modulator Substances 0.000 description 2
- 229940095743 selective estrogen receptor modulator Drugs 0.000 description 2
- 230000000405 serological effect Effects 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 238000001179 sorption measurement Methods 0.000 description 2
- 101150116294 ssaJ gene Proteins 0.000 description 2
- 238000007619 statistical method Methods 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 230000009885 systemic effect Effects 0.000 description 2
- 229960001603 tamoxifen Drugs 0.000 description 2
- 238000002626 targeted therapy Methods 0.000 description 2
- 108700004027 tat Genes Proteins 0.000 description 2
- 101150098170 tat gene Proteins 0.000 description 2
- KMXFZRSJMDYPPG-UHFFFAOYSA-N tetratetracontane Chemical compound CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC KMXFZRSJMDYPPG-UHFFFAOYSA-N 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 2
- 230000007704 transition Effects 0.000 description 2
- 230000005751 tumor progression Effects 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 238000002255 vaccination Methods 0.000 description 2
- 210000005048 vimentin Anatomy 0.000 description 2
- JXLYSJRDGCGARV-CFWMRBGOSA-N vinblastine Chemical compound C([C@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-CFWMRBGOSA-N 0.000 description 2
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 2
- 229960004528 vincristine Drugs 0.000 description 2
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 2
- 230000029812 viral genome replication Effects 0.000 description 2
- 230000006490 viral transcription Effects 0.000 description 2
- 238000002424 x-ray crystallography Methods 0.000 description 2
- DIGQNXIGRZPYDK-WKSCXVIASA-N (2R)-6-amino-2-[[2-[[(2S)-2-[[2-[[(2R)-2-[[(2S)-2-[[(2R,3S)-2-[[2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2R)-2-[[(2S,3S)-2-[[(2R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2R)-2-[[2-[[2-[[2-[(2-amino-1-hydroxyethylidene)amino]-3-carboxy-1-hydroxypropylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxybutylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1,5-dihydroxy-5-iminopentylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxybutylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxyethylidene]amino]hexanoic acid Chemical compound C[C@@H]([C@@H](C(=N[C@@H](CS)C(=N[C@@H](C)C(=N[C@@H](CO)C(=NCC(=N[C@@H](CCC(=N)O)C(=NC(CS)C(=N[C@H]([C@H](C)O)C(=N[C@H](CS)C(=N[C@H](CO)C(=NCC(=N[C@H](CS)C(=NCC(=N[C@H](CCCCN)C(=O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)N=C([C@H](CS)N=C([C@H](CO)N=C([C@H](CO)N=C([C@H](C)N=C(CN=C([C@H](CO)N=C([C@H](CS)N=C(CN=C(C(CS)N=C(C(CC(=O)O)N=C(CN)O)O)O)O)O)O)O)O)O)O)O)O DIGQNXIGRZPYDK-WKSCXVIASA-N 0.000 description 1
- NMWKYTGJWUAZPZ-WWHBDHEGSA-N (4S)-4-[[(4R,7S,10S,16S,19S,25S,28S,31R)-31-[[(2S)-2-[[(1R,6R,9S,12S,18S,21S,24S,27S,30S,33S,36S,39S,42R,47R,53S,56S,59S,62S,65S,68S,71S,76S,79S,85S)-47-[[(2S)-2-[[(2S)-4-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-amino-3-methylbutanoyl]amino]-3-methylbutanoyl]amino]-3-hydroxypropanoyl]amino]-3-(1H-imidazol-4-yl)propanoyl]amino]-3-phenylpropanoyl]amino]-4-oxobutanoyl]amino]-3-carboxypropanoyl]amino]-18-(4-aminobutyl)-27,68-bis(3-amino-3-oxopropyl)-36,71,76-tribenzyl-39-(3-carbamimidamidopropyl)-24-(2-carboxyethyl)-21,56-bis(carboxymethyl)-65,85-bis[(1R)-1-hydroxyethyl]-59-(hydroxymethyl)-62,79-bis(1H-imidazol-4-ylmethyl)-9-methyl-33-(2-methylpropyl)-8,11,17,20,23,26,29,32,35,38,41,48,54,57,60,63,66,69,72,74,77,80,83,86-tetracosaoxo-30-propan-2-yl-3,4,44,45-tetrathia-7,10,16,19,22,25,28,31,34,37,40,49,55,58,61,64,67,70,73,75,78,81,84,87-tetracosazatetracyclo[40.31.14.012,16.049,53]heptaoctacontane-6-carbonyl]amino]-3-methylbutanoyl]amino]-7-(3-carbamimidamidopropyl)-25-(hydroxymethyl)-19-[(4-hydroxyphenyl)methyl]-28-(1H-imidazol-4-ylmethyl)-10-methyl-6,9,12,15,18,21,24,27,30-nonaoxo-16-propan-2-yl-1,2-dithia-5,8,11,14,17,20,23,26,29-nonazacyclodotriacontane-4-carbonyl]amino]-5-[[(2S)-1-[[(2S)-1-[[(2S)-3-carboxy-1-[[(2S)-1-[[(2S)-1-[[(1S)-1-carboxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-3-(1H-imidazol-4-yl)-1-oxopropan-2-yl]amino]-5-oxopentanoic acid Chemical compound CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]1CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@@H]2CSSC[C@@H]3NC(=O)[C@H](Cc4ccccc4)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](Cc4c[nH]cn4)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H]4CCCN4C(=O)[C@H](CSSC[C@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](Cc4c[nH]cn4)NC(=O)[C@H](Cc4ccccc4)NC3=O)[C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc3ccccc3)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N3CCC[C@H]3C(=O)N[C@@H](C)C(=O)N2)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](Cc2c[nH]cn2)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@@H](N)C(C)C)C(C)C)[C@@H](C)O)C(C)C)C(=O)N[C@@H](Cc2c[nH]cn2)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](Cc2ccc(O)cc2)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1)C(=O)N[C@@H](C)C(O)=O NMWKYTGJWUAZPZ-WWHBDHEGSA-N 0.000 description 1
- YYGNTYWPHWGJRM-UHFFFAOYSA-N (6E,10E,14E,18E)-2,6,10,15,19,23-hexamethyltetracosa-2,6,10,14,18,22-hexaene Chemical compound CC(C)=CCCC(C)=CCCC(C)=CCCC=C(C)CCC=C(C)CCC=C(C)C YYGNTYWPHWGJRM-UHFFFAOYSA-N 0.000 description 1
- 102100025573 1-alkyl-2-acetylglycerophosphocholine esterase Human genes 0.000 description 1
- BFPYWIDHMRZLRN-UHFFFAOYSA-N 17alpha-ethynyl estradiol Natural products OC1=CC=C2C3CCC(C)(C(CC4)(O)C#C)C4C3CCC2=C1 BFPYWIDHMRZLRN-UHFFFAOYSA-N 0.000 description 1
- KRQUFUKTQHISJB-YYADALCUSA-N 2-[(E)-N-[2-(4-chlorophenoxy)propoxy]-C-propylcarbonimidoyl]-3-hydroxy-5-(thian-3-yl)cyclohex-2-en-1-one Chemical compound CCC\C(=N/OCC(C)OC1=CC=C(Cl)C=C1)C1=C(O)CC(CC1=O)C1CCCSC1 KRQUFUKTQHISJB-YYADALCUSA-N 0.000 description 1
- NDMPLJNOPCLANR-UHFFFAOYSA-N 3,4-dihydroxy-15-(4-hydroxy-18-methoxycarbonyl-5,18-seco-ibogamin-18-yl)-16-methoxy-1-methyl-6,7-didehydro-aspidospermidine-3-carboxylic acid methyl ester Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 NDMPLJNOPCLANR-UHFFFAOYSA-N 0.000 description 1
- LKKMLIBUAXYLOY-UHFFFAOYSA-N 3-Amino-1-methyl-5H-pyrido[4,3-b]indole Chemical compound N1C2=CC=CC=C2C2=C1C=C(N)N=C2C LKKMLIBUAXYLOY-UHFFFAOYSA-N 0.000 description 1
- WEVYNIUIFUYDGI-UHFFFAOYSA-N 3-[6-[4-(trifluoromethoxy)anilino]-4-pyrimidinyl]benzamide Chemical compound NC(=O)C1=CC=CC(C=2N=CN=C(NC=3C=CC(OC(F)(F)F)=CC=3)C=2)=C1 WEVYNIUIFUYDGI-UHFFFAOYSA-N 0.000 description 1
- 101800000504 3C-like protease Proteins 0.000 description 1
- 102100030310 5,6-dihydroxyindole-2-carboxylic acid oxidase Human genes 0.000 description 1
- 101710163881 5,6-dihydroxyindole-2-carboxylic acid oxidase Proteins 0.000 description 1
- IDPUKCWIGUEADI-UHFFFAOYSA-N 5-[bis(2-chloroethyl)amino]uracil Chemical compound ClCCN(CCCl)C1=CNC(=O)NC1=O IDPUKCWIGUEADI-UHFFFAOYSA-N 0.000 description 1
- HLXHCNWEVQNNKA-UHFFFAOYSA-N 5-methoxy-2,3-dihydro-1h-inden-2-amine Chemical compound COC1=CC=C2CC(N)CC2=C1 HLXHCNWEVQNNKA-UHFFFAOYSA-N 0.000 description 1
- WYWHKKSPHMUBEB-UHFFFAOYSA-N 6-Mercaptoguanine Natural products N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 1
- XZIIFPSPUDAGJM-UHFFFAOYSA-N 6-chloro-2-n,2-n-diethylpyrimidine-2,4-diamine Chemical compound CCN(CC)C1=NC(N)=CC(Cl)=N1 XZIIFPSPUDAGJM-UHFFFAOYSA-N 0.000 description 1
- DLFVBJFMPXGRIB-UHFFFAOYSA-N Acetamide Chemical group CC(N)=O DLFVBJFMPXGRIB-UHFFFAOYSA-N 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 102100036464 Activated RNA polymerase II transcriptional coactivator p15 Human genes 0.000 description 1
- 108010059616 Activins Proteins 0.000 description 1
- 102000005606 Activins Human genes 0.000 description 1
- 102100021305 Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 Human genes 0.000 description 1
- 241000580270 Adeno-associated virus - 4 Species 0.000 description 1
- 241000701242 Adenoviridae Species 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 241001664176 Alpharetrovirus Species 0.000 description 1
- 102000052587 Anaphase-Promoting Complex-Cyclosome Apc3 Subunit Human genes 0.000 description 1
- 108700004606 Anaphase-Promoting Complex-Cyclosome Apc3 Subunit Proteins 0.000 description 1
- 208000000058 Anaplasia Diseases 0.000 description 1
- 241000235349 Ascomycota Species 0.000 description 1
- HCAUEJAQCXVQQM-ACZMJKKPSA-N Asn-Glu-Asp Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O HCAUEJAQCXVQQM-ACZMJKKPSA-N 0.000 description 1
- 108010024976 Asparaginase Proteins 0.000 description 1
- 241001203868 Autographa californica Species 0.000 description 1
- 241000201370 Autographa californica nucleopolyhedrovirus Species 0.000 description 1
- 241000713826 Avian leukosis virus Species 0.000 description 1
- 241000713834 Avian myelocytomatosis virus 29 Species 0.000 description 1
- 101710131520 B melanoma antigen 1 Proteins 0.000 description 1
- 102100035526 B melanoma antigen 1 Human genes 0.000 description 1
- 101710187595 B-cell receptor CD22 Proteins 0.000 description 1
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 1
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 1
- 101150089247 B7 gene Proteins 0.000 description 1
- 241000304886 Bacilli Species 0.000 description 1
- 241000193830 Bacillus <bacterium> Species 0.000 description 1
- 108700003860 Bacterial Genes Proteins 0.000 description 1
- 241000221198 Basidiomycota Species 0.000 description 1
- 241000608319 Bebaru virus Species 0.000 description 1
- 102000015735 Beta-catenin Human genes 0.000 description 1
- 108060000903 Beta-catenin Proteins 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 241000713686 Bovine lentivirus group Species 0.000 description 1
- 241000714266 Bovine leukemia virus Species 0.000 description 1
- 241000621124 Bovine papular stomatitis virus Species 0.000 description 1
- 206010055113 Breast cancer metastatic Diseases 0.000 description 1
- WKBOTKDWSSQWDR-UHFFFAOYSA-N Bromine atom Chemical compound [Br] WKBOTKDWSSQWDR-UHFFFAOYSA-N 0.000 description 1
- CIUUIPMOFZIWIZ-UHFFFAOYSA-N Bropirimine Chemical compound NC1=NC(O)=C(Br)C(C=2C=CC=CC=2)=N1 CIUUIPMOFZIWIZ-UHFFFAOYSA-N 0.000 description 1
- 101710117545 C protein Proteins 0.000 description 1
- 102100024217 CAMPATH-1 antigen Human genes 0.000 description 1
- 108091016585 CD44 antigen Proteins 0.000 description 1
- 108010065524 CD52 Antigen Proteins 0.000 description 1
- 108010009575 CD55 Antigens Proteins 0.000 description 1
- 108010055167 CD59 Antigens Proteins 0.000 description 1
- 210000001239 CD8-positive, alpha-beta cytotoxic T lymphocyte Anatomy 0.000 description 1
- 101150108242 CDC27 gene Proteins 0.000 description 1
- MUJJVOYNTCTXIC-UHFFFAOYSA-N CNC(=O)c1ccc2-c3c(C)c(nn3CCOc2c1)-c1ncnn1-c1ccc(F)cc1F Chemical compound CNC(=O)c1ccc2-c3c(C)c(nn3CCOc2c1)-c1ncnn1-c1ccc(F)cc1F MUJJVOYNTCTXIC-UHFFFAOYSA-N 0.000 description 1
- 101150071146 COX2 gene Proteins 0.000 description 1
- 229940045513 CTLA4 antagonist Drugs 0.000 description 1
- FVLVBPDQNARYJU-XAHDHGMMSA-N C[C@H]1CCC(CC1)NC(=O)N(CCCl)N=O Chemical compound C[C@H]1CCC(CC1)NC(=O)N(CCCl)N=O FVLVBPDQNARYJU-XAHDHGMMSA-N 0.000 description 1
- 241000232908 Cabassous Species 0.000 description 1
- 102000000905 Cadherin Human genes 0.000 description 1
- 108050007957 Cadherin Proteins 0.000 description 1
- 101100327917 Caenorhabditis elegans chup-1 gene Proteins 0.000 description 1
- 101100114534 Caenorhabditis elegans ctc-2 gene Proteins 0.000 description 1
- 101100314454 Caenorhabditis elegans tra-1 gene Proteins 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 241000178270 Canarypox virus Species 0.000 description 1
- 102100025570 Cancer/testis antigen 1 Human genes 0.000 description 1
- 241000222122 Candida albicans Species 0.000 description 1
- 241000222178 Candida tropicalis Species 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 108700000434 Cannabis sativa edestin Proteins 0.000 description 1
- GAGWJHPBXLXJQN-UHFFFAOYSA-N Capecitabine Natural products C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1C1C(O)C(O)C(C)O1 GAGWJHPBXLXJQN-UHFFFAOYSA-N 0.000 description 1
- 241000700664 Capripoxvirus Species 0.000 description 1
- 102100024423 Carbonic anhydrase 9 Human genes 0.000 description 1
- 108010022366 Carcinoembryonic Antigen Proteins 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- 102100026548 Caspase-8 Human genes 0.000 description 1
- 102000005600 Cathepsins Human genes 0.000 description 1
- 108010084457 Cathepsins Proteins 0.000 description 1
- 241001529572 Chaceon affinis Species 0.000 description 1
- 101710163595 Chaperone protein DnaK Proteins 0.000 description 1
- 102000019034 Chemokines Human genes 0.000 description 1
- 108010012236 Chemokines Proteins 0.000 description 1
- 241001502567 Chikungunya virus Species 0.000 description 1
- JWBOIMRXGHLCPP-UHFFFAOYSA-N Chloditan Chemical compound C=1C=CC=C(Cl)C=1C(C(Cl)Cl)C1=CC=C(Cl)C=C1 JWBOIMRXGHLCPP-UHFFFAOYSA-N 0.000 description 1
- ZAMOUSCENKQFHK-UHFFFAOYSA-N Chlorine atom Chemical compound [Cl] ZAMOUSCENKQFHK-UHFFFAOYSA-N 0.000 description 1
- 108010066551 Cholestenone 5 alpha-Reductase Proteins 0.000 description 1
- 102000011022 Chorionic Gonadotropin Human genes 0.000 description 1
- 108010062540 Chorionic Gonadotropin Proteins 0.000 description 1
- PTOAARAWEBMLNO-KVQBGUIXSA-N Cladribine Chemical compound C1=NC=2C(N)=NC(Cl)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)O1 PTOAARAWEBMLNO-KVQBGUIXSA-N 0.000 description 1
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 1
- 241000272201 Columbiformes Species 0.000 description 1
- 108010023729 Complement 3d Receptors Proteins 0.000 description 1
- 102000011412 Complement 3d Receptors Human genes 0.000 description 1
- 102100025680 Complement decay-accelerating factor Human genes 0.000 description 1
- 108020004635 Complementary DNA Proteins 0.000 description 1
- 108020004394 Complementary RNA Proteins 0.000 description 1
- RYGMFSIKBFXOCR-UHFFFAOYSA-N Copper Chemical compound [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 description 1
- 241000700626 Cowpox virus Species 0.000 description 1
- 241000238424 Crustacea Species 0.000 description 1
- 201000007336 Cryptococcosis Diseases 0.000 description 1
- 241001337994 Cryptococcus <scale insect> Species 0.000 description 1
- 241000221204 Cryptococcus neoformans Species 0.000 description 1
- 108010025464 Cyclin-Dependent Kinase 4 Proteins 0.000 description 1
- 102100021906 Cyclin-O Human genes 0.000 description 1
- 102100036252 Cyclin-dependent kinase 4 Human genes 0.000 description 1
- 108010037462 Cyclooxygenase 2 Proteins 0.000 description 1
- ZGERHCJBLPQPGV-ACZMJKKPSA-N Cys-Ser-Gln Chemical compound C(CC(=O)N)[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CS)N ZGERHCJBLPQPGV-ACZMJKKPSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- 150000008574 D-amino acids Chemical class 0.000 description 1
- 108010041986 DNA Vaccines Proteins 0.000 description 1
- 239000003155 DNA primer Substances 0.000 description 1
- 229940021995 DNA vaccine Drugs 0.000 description 1
- 241000450599 DNA viruses Species 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 108010092160 Dactinomycin Proteins 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 101100216227 Dictyostelium discoideum anapc3 gene Proteins 0.000 description 1
- 102100024746 Dihydrofolate reductase Human genes 0.000 description 1
- 206010061819 Disease recurrence Diseases 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- 101150005585 E3 gene Proteins 0.000 description 1
- 101150049307 EEF1A2 gene Proteins 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 241000710945 Eastern equine encephalitis virus Species 0.000 description 1
- 208000006586 Ectromelia Diseases 0.000 description 1
- 238000011510 Elispot assay Methods 0.000 description 1
- 201000009051 Embryonal Carcinoma Diseases 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 241000305071 Enterobacterales Species 0.000 description 1
- 102400000102 Eosinophil granule major basic protein Human genes 0.000 description 1
- 241000713730 Equine infectious anemia virus Species 0.000 description 1
- BFPYWIDHMRZLRN-SLHNCBLASA-N Ethinyl estradiol Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@](CC4)(O)C#C)[C@@H]4[C@@H]3CCC2=C1 BFPYWIDHMRZLRN-SLHNCBLASA-N 0.000 description 1
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 1
- 108091092566 Extrachromosomal DNA Proteins 0.000 description 1
- 101150073066 F13L gene Proteins 0.000 description 1
- 241000713859 FBR murine osteosarcoma virus Species 0.000 description 1
- 102000001690 Factor VIII Human genes 0.000 description 1
- 108010054218 Factor VIII Proteins 0.000 description 1
- 102000007317 Farnesyltranstransferase Human genes 0.000 description 1
- 108010007508 Farnesyltranstransferase Proteins 0.000 description 1
- 108090000368 Fibroblast growth factor 8 Proteins 0.000 description 1
- 102000003956 Fibroblast growth factor 8 Human genes 0.000 description 1
- PXGOKWXKJXAPGV-UHFFFAOYSA-N Fluorine Chemical compound FF PXGOKWXKJXAPGV-UHFFFAOYSA-N 0.000 description 1
- 241000700662 Fowlpox virus Species 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 108091072337 GAGE family Proteins 0.000 description 1
- 102000040452 GAGE family Human genes 0.000 description 1
- 101710113436 GTPase KRas Proteins 0.000 description 1
- 102100039788 GTPase NRas Human genes 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 241001663880 Gammaretrovirus Species 0.000 description 1
- 108010052343 Gastrins Proteins 0.000 description 1
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 1
- 241000608297 Getah virus Species 0.000 description 1
- FTIJVMLAGRAYMJ-MNXVOIDGSA-N Gln-Ile-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H](N)CCC(N)=O FTIJVMLAGRAYMJ-MNXVOIDGSA-N 0.000 description 1
- CBEUFCJRFNZMCU-SRVKXCTJSA-N Glu-Met-Leu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(C)C)C(O)=O CBEUFCJRFNZMCU-SRVKXCTJSA-N 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 102000005720 Glutathione transferase Human genes 0.000 description 1
- 108010070675 Glutathione transferase Proteins 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- NMJREATYWWNIKX-UHFFFAOYSA-N GnRH Chemical compound C1CCC(C(=O)NCC(N)=O)N1C(=O)C(CC(C)C)NC(=O)C(CC=1C2=CC=CC=C2NC=1)NC(=O)CNC(=O)C(NC(=O)C(CO)NC(=O)C(CC=1C2=CC=CC=C2NC=1)NC(=O)C(CC=1NC=NC=1)NC(=O)C1NC(=O)CC1)CC1=CC=C(O)C=C1 NMJREATYWWNIKX-UHFFFAOYSA-N 0.000 description 1
- 239000000579 Gonadotropin-Releasing Hormone Substances 0.000 description 1
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 1
- 206010018691 Granuloma Diseases 0.000 description 1
- 101150054472 HER2 gene Proteins 0.000 description 1
- 208000037357 HIV infectious disease Diseases 0.000 description 1
- 102100028972 HLA class I histocompatibility antigen, A alpha chain Human genes 0.000 description 1
- 102100036241 HLA class II histocompatibility antigen, DQ beta 1 chain Human genes 0.000 description 1
- 108010075704 HLA-A Antigens Proteins 0.000 description 1
- 108010058607 HLA-B Antigens Proteins 0.000 description 1
- 102000015789 HLA-DP Antigens Human genes 0.000 description 1
- 108010010378 HLA-DP Antigens Proteins 0.000 description 1
- 108010086786 HLA-DQA1 antigen Proteins 0.000 description 1
- 108010065026 HLA-DQB1 antigen Proteins 0.000 description 1
- 102000006354 HLA-DR Antigens Human genes 0.000 description 1
- 108010058597 HLA-DR Antigens Proteins 0.000 description 1
- 244000286779 Hansenula anomala Species 0.000 description 1
- 235000014683 Hansenula anomala Nutrition 0.000 description 1
- 241000713858 Harvey murine sarcoma virus Species 0.000 description 1
- 101710178376 Heat shock 70 kDa protein Proteins 0.000 description 1
- 101710152018 Heat shock cognate 70 kDa protein Proteins 0.000 description 1
- 102000002812 Heat-Shock Proteins Human genes 0.000 description 1
- 108010004889 Heat-Shock Proteins Proteins 0.000 description 1
- 102100024025 Heparanase Human genes 0.000 description 1
- 208000009889 Herpes Simplex Diseases 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- RXVOMIADLXPJGW-GUBZILKMSA-N His-Asp-Glu Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O RXVOMIADLXPJGW-GUBZILKMSA-N 0.000 description 1
- 102100030483 Histatin-1 Human genes 0.000 description 1
- 108010088652 Histocompatibility Antigens Class I Proteins 0.000 description 1
- 108010027412 Histocompatibility Antigens Class II Proteins 0.000 description 1
- 102000018713 Histocompatibility Antigens Class II Human genes 0.000 description 1
- 101001042227 Homo sapiens Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 Proteins 0.000 description 1
- 101000874316 Homo sapiens B melanoma antigen 1 Proteins 0.000 description 1
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 1
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 1
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 1
- 101100165850 Homo sapiens CA9 gene Proteins 0.000 description 1
- 101000897400 Homo sapiens CD59 glycoprotein Proteins 0.000 description 1
- 101000856237 Homo sapiens Cancer/testis antigen 1 Proteins 0.000 description 1
- 101000856022 Homo sapiens Complement decay-accelerating factor Proteins 0.000 description 1
- 101000941929 Homo sapiens Complement receptor type 2 Proteins 0.000 description 1
- 101000897441 Homo sapiens Cyclin-O Proteins 0.000 description 1
- 101000744505 Homo sapiens GTPase NRas Proteins 0.000 description 1
- 101000930801 Homo sapiens HLA class II histocompatibility antigen, DQ alpha 2 chain Proteins 0.000 description 1
- 101001082500 Homo sapiens Histatin-1 Proteins 0.000 description 1
- 101000878605 Homo sapiens Low affinity immunoglobulin epsilon Fc receptor Proteins 0.000 description 1
- 101001014223 Homo sapiens MAPK/MAK/MRK overlapping kinase Proteins 0.000 description 1
- 101000578784 Homo sapiens Melanoma antigen recognized by T-cells 1 Proteins 0.000 description 1
- 101000961414 Homo sapiens Membrane cofactor protein Proteins 0.000 description 1
- 101000623901 Homo sapiens Mucin-16 Proteins 0.000 description 1
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 description 1
- 101000693231 Homo sapiens PDZK1-interacting protein 1 Proteins 0.000 description 1
- 101001021281 Homo sapiens Protein HEXIM1 Proteins 0.000 description 1
- 101001100327 Homo sapiens RNA-binding protein 45 Proteins 0.000 description 1
- 101001062222 Homo sapiens Receptor-binding cancer antigen expressed on SiSo cells Proteins 0.000 description 1
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 1
- 101100152582 Homo sapiens TBX2 gene Proteins 0.000 description 1
- 101000626112 Homo sapiens Telomerase protein component 1 Proteins 0.000 description 1
- 101000655352 Homo sapiens Telomerase reverse transcriptase Proteins 0.000 description 1
- 101000597785 Homo sapiens Tumor necrosis factor receptor superfamily member 6B Proteins 0.000 description 1
- 241000701109 Human adenovirus 2 Species 0.000 description 1
- 241000598171 Human adenovirus sp. Species 0.000 description 1
- 241000701041 Human betaherpesvirus 7 Species 0.000 description 1
- 241001207270 Human enterovirus Species 0.000 description 1
- 241000713673 Human foamy virus Species 0.000 description 1
- 241000701027 Human herpesvirus 6 Species 0.000 description 1
- 241000701806 Human papillomavirus Species 0.000 description 1
- 241000709701 Human poliovirus 1 Species 0.000 description 1
- 241000709704 Human poliovirus 2 Species 0.000 description 1
- 241000709727 Human poliovirus 3 Species 0.000 description 1
- 241001135958 Human type D retrovirus Species 0.000 description 1
- DOMWKUIIPQCAJU-LJHIYBGHSA-N Hydroxyprogesterone caproate Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(C)=O)(OC(=O)CCCCC)[C@@]1(C)CC2 DOMWKUIIPQCAJU-LJHIYBGHSA-N 0.000 description 1
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 1
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 1
- RENBRDSDKPSRIH-HJWJTTGWSA-N Ile-Phe-Met Chemical compound N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCSC)C(=O)O RENBRDSDKPSRIH-HJWJTTGWSA-N 0.000 description 1
- 108700002232 Immediate-Early Genes Proteins 0.000 description 1
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 101000668058 Infectious salmon anemia virus (isolate Atlantic salmon/Norway/810/9/99) RNA-directed RNA polymerase catalytic subunit Proteins 0.000 description 1
- 102100023915 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 description 1
- 102000014429 Insulin-like growth factor Human genes 0.000 description 1
- 108010061833 Integrases Proteins 0.000 description 1
- 102100037872 Intercellular adhesion molecule 2 Human genes 0.000 description 1
- 101710148794 Intercellular adhesion molecule 2 Proteins 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- 108090000174 Interleukin-10 Proteins 0.000 description 1
- 108010017511 Interleukin-13 Receptors Proteins 0.000 description 1
- 102100020793 Interleukin-13 receptor subunit alpha-2 Human genes 0.000 description 1
- 102000000588 Interleukin-2 Human genes 0.000 description 1
- 108010002386 Interleukin-3 Proteins 0.000 description 1
- 102100039078 Interleukin-4 receptor subunit alpha Human genes 0.000 description 1
- 108010002586 Interleukin-7 Proteins 0.000 description 1
- 102000000704 Interleukin-7 Human genes 0.000 description 1
- 208000037396 Intraductal Noninfiltrating Carcinoma Diseases 0.000 description 1
- 206010073094 Intraductal proliferative breast lesion Diseases 0.000 description 1
- 241000235649 Kluyveromyces Species 0.000 description 1
- 244000285963 Kluyveromyces fragilis Species 0.000 description 1
- 235000014663 Kluyveromyces fragilis Nutrition 0.000 description 1
- 241000235058 Komagataella pastoris Species 0.000 description 1
- 101150062031 L gene Proteins 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- 102100031413 L-dopachrome tautomerase Human genes 0.000 description 1
- 101710093778 L-dopachrome tautomerase Proteins 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- TYYLDKGBCJGJGW-UHFFFAOYSA-N L-tryptophan-L-tyrosine Natural products C=1NC2=CC=CC=C2C=1CC(N)C(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 TYYLDKGBCJGJGW-UHFFFAOYSA-N 0.000 description 1
- 239000002136 L01XE07 - Lapatinib Substances 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- HLFSDGLLUJUHTE-SNVBAGLBSA-N Levamisole Chemical compound C1([C@H]2CN3CCSC3=N2)=CC=CC=C1 HLFSDGLLUJUHTE-SNVBAGLBSA-N 0.000 description 1
- 102000003960 Ligases Human genes 0.000 description 1
- 108090000364 Ligases Proteins 0.000 description 1
- 206010024503 Limb reduction defect Diseases 0.000 description 1
- 108090001030 Lipoproteins Proteins 0.000 description 1
- 102000004895 Lipoproteins Human genes 0.000 description 1
- 241000186805 Listeria innocua Species 0.000 description 1
- 241000186780 Listeria ivanovii Species 0.000 description 1
- 101100452614 Listeria monocytogenes serotype 1/2a (strain EGD / Mackaness) inlC gene Proteins 0.000 description 1
- 241000123765 Listeria phage A118 Species 0.000 description 1
- 241000186807 Listeria seeligeri Species 0.000 description 1
- 241000186814 Listeria welshimeri Species 0.000 description 1
- 208000000265 Lobular Carcinoma Diseases 0.000 description 1
- 102100038007 Low affinity immunoglobulin epsilon Fc receptor Human genes 0.000 description 1
- 208000007433 Lymphatic Metastasis Diseases 0.000 description 1
- 102100031520 MAPK/MAK/MRK overlapping kinase Human genes 0.000 description 1
- 101150068888 MET3 gene Proteins 0.000 description 1
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102000007651 Macrophage Colony-Stimulating Factor Human genes 0.000 description 1
- 206010064912 Malignant transformation Diseases 0.000 description 1
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 241000608292 Mayaro virus Species 0.000 description 1
- 229940124862 Measles virus vaccine Drugs 0.000 description 1
- 108700038051 Melanotransferrin Proteins 0.000 description 1
- 102000051089 Melanotransferrin Human genes 0.000 description 1
- 108010047230 Member 1 Subfamily B ATP Binding Cassette Transporter Proteins 0.000 description 1
- 101710146216 Membrane cofactor protein Proteins 0.000 description 1
- 102000003735 Mesothelin Human genes 0.000 description 1
- 108090000015 Mesothelin Proteins 0.000 description 1
- 102000003792 Metallothionein Human genes 0.000 description 1
- 108090000157 Metallothionein Proteins 0.000 description 1
- 108060004795 Methyltransferase Proteins 0.000 description 1
- 102000036436 Metzincins Human genes 0.000 description 1
- 108091007161 Metzincins Proteins 0.000 description 1
- 102000029749 Microtubule Human genes 0.000 description 1
- 108091022875 Microtubule Proteins 0.000 description 1
- 101710169105 Minor spike protein Proteins 0.000 description 1
- 229930192392 Mitomycin Natural products 0.000 description 1
- 102000005431 Molecular Chaperones Human genes 0.000 description 1
- 241000700627 Monkeypox virus Species 0.000 description 1
- 241000868135 Mucambo virus Species 0.000 description 1
- 102100023123 Mucin-16 Human genes 0.000 description 1
- 101710150912 Myc protein Proteins 0.000 description 1
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 1
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 1
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 description 1
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 1
- OVRNDRQMDRJTHS-RTRLPJTCSA-N N-acetyl-D-glucosamine Chemical compound CC(=O)N[C@H]1C(O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-RTRLPJTCSA-N 0.000 description 1
- MBLBDJOUHNCFQT-LXGUWJNJSA-N N-acetylglucosamine Natural products CC(=O)N[C@@H](C=O)[C@@H](O)[C@H](O)[C@H](O)CO MBLBDJOUHNCFQT-LXGUWJNJSA-N 0.000 description 1
- 108020000002 NR3 subfamily Proteins 0.000 description 1
- 108091061960 Naked DNA Proteins 0.000 description 1
- 241001045988 Neogene Species 0.000 description 1
- 102000048850 Neoplasm Genes Human genes 0.000 description 1
- 108700019961 Neoplasm Genes Proteins 0.000 description 1
- 208000034176 Neoplasms, Germ Cell and Embryonal Diseases 0.000 description 1
- 101100022915 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) cys-11 gene Proteins 0.000 description 1
- 108010076864 Nitric Oxide Synthase Type II Proteins 0.000 description 1
- 102000011779 Nitric Oxide Synthase Type II Human genes 0.000 description 1
- 102100029438 Nitric oxide synthase, inducible Human genes 0.000 description 1
- 101710089543 Nitric oxide synthase, inducible Proteins 0.000 description 1
- 108090001074 Nucleocapsid Proteins Proteins 0.000 description 1
- 241000320412 Ogataea angusta Species 0.000 description 1
- 239000012124 Opti-MEM Substances 0.000 description 1
- 241000700635 Orf virus Species 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 108010077077 Osteonectin Proteins 0.000 description 1
- 102000009890 Osteonectin Human genes 0.000 description 1
- 108700005081 Overlapping Genes Proteins 0.000 description 1
- 102100025648 PDZK1-interacting protein 1 Human genes 0.000 description 1
- 101150012394 PHO5 gene Proteins 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 108060006580 PRAME Proteins 0.000 description 1
- 102000036673 PRAME Human genes 0.000 description 1
- 101150000187 PTGS2 gene Proteins 0.000 description 1
- 229930012538 Paclitaxel Natural products 0.000 description 1
- 241000282577 Pan troglodytes Species 0.000 description 1
- 241000222051 Papiliotrema laurentii Species 0.000 description 1
- 206010033976 Paravaccinia Diseases 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- BQMFWUKNOCJDNV-HJWJTTGWSA-N Phe-Val-Ile Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O BQMFWUKNOCJDNV-HJWJTTGWSA-N 0.000 description 1
- 241000709664 Picornaviridae Species 0.000 description 1
- 241000868134 Pixuna virus Species 0.000 description 1
- 108010022233 Plasminogen Activator Inhibitor 1 Proteins 0.000 description 1
- 102100039418 Plasminogen activator inhibitor 1 Human genes 0.000 description 1
- 108010038512 Platelet-Derived Growth Factor Proteins 0.000 description 1
- 102000010780 Platelet-Derived Growth Factor Human genes 0.000 description 1
- 208000000474 Poliomyelitis Diseases 0.000 description 1
- 102100029740 Poliovirus receptor Human genes 0.000 description 1
- 241000700625 Poxviridae Species 0.000 description 1
- 108010035004 Prephenate Dehydrogenase Proteins 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 102100038280 Prostaglandin G/H synthase 2 Human genes 0.000 description 1
- 241000621172 Pseudocowpox virus Species 0.000 description 1
- 101100408135 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) phnA gene Proteins 0.000 description 1
- 201000004681 Psoriasis Diseases 0.000 description 1
- 102220465562 Putative uncharacterized protein OBSCN-AS1_F13L_mutation Human genes 0.000 description 1
- 108010066717 Q beta Replicase Proteins 0.000 description 1
- 102100038823 RNA-binding protein 45 Human genes 0.000 description 1
- 241000700157 Rattus norvegicus Species 0.000 description 1
- 102100029165 Receptor-binding cancer antigen expressed on SiSo cells Human genes 0.000 description 1
- 108700005075 Regulator Genes Proteins 0.000 description 1
- 241000186813 Renibacterium Species 0.000 description 1
- 108020005091 Replication Origin Proteins 0.000 description 1
- 208000007660 Residual Neoplasm Diseases 0.000 description 1
- 241000223252 Rhodotorula Species 0.000 description 1
- 241000223254 Rhodotorula mucilaginosa Species 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- 108091077753 SSX family Proteins 0.000 description 1
- 102000042330 SSX family Human genes 0.000 description 1
- 108010017324 STAT3 Transcription Factor Proteins 0.000 description 1
- 235000003534 Saccharomyces carlsbergensis Nutrition 0.000 description 1
- 101100386089 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) MET17 gene Proteins 0.000 description 1
- 241001123227 Saccharomyces pastorianus Species 0.000 description 1
- 241000293869 Salmonella enterica subsp. enterica serovar Typhimurium Species 0.000 description 1
- 101100476896 Salmonella typhimurium (strain 14028s / SGSC 2262) sctC2 gene Proteins 0.000 description 1
- 101100532775 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) sctL2 gene Proteins 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- 241000235347 Schizosaccharomyces pombe Species 0.000 description 1
- 101100022918 Schizosaccharomyces pombe (strain 972 / ATCC 24843) sua1 gene Proteins 0.000 description 1
- 108091081021 Sense strand Proteins 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- QFBNNYNWKYKVJO-DCAQKATOSA-N Ser-Arg-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CO)CCCN=C(N)N QFBNNYNWKYKVJO-DCAQKATOSA-N 0.000 description 1
- 241000287219 Serinus canaria Species 0.000 description 1
- 101710173693 Short transient receptor potential channel 1 Proteins 0.000 description 1
- 101710173694 Short transient receptor potential channel 2 Proteins 0.000 description 1
- 102100024040 Signal transducer and activator of transcription 3 Human genes 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 101710147732 Small envelope protein Proteins 0.000 description 1
- 208000001203 Smallpox Diseases 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 108010085012 Steroid Receptors Proteins 0.000 description 1
- 241000700568 Suipoxvirus Species 0.000 description 1
- 101800001271 Surface protein Proteins 0.000 description 1
- 108010008038 Synthetic Vaccines Proteins 0.000 description 1
- 206010042971 T-cell lymphoma Diseases 0.000 description 1
- 208000027585 T-cell non-Hodgkin lymphoma Diseases 0.000 description 1
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 1
- 102100030306 TBC1 domain family member 9 Human genes 0.000 description 1
- 101710109927 Tail assembly protein GT Proteins 0.000 description 1
- 241000404000 Tanapox virus Species 0.000 description 1
- 229940123237 Taxane Drugs 0.000 description 1
- 101150111019 Tbx3 gene Proteins 0.000 description 1
- 102100024553 Telomerase protein component 1 Human genes 0.000 description 1
- 208000024313 Testicular Neoplasms Diseases 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- BHEOSNUKNHRBNM-UHFFFAOYSA-N Tetramethylsqualene Natural products CC(=C)C(C)CCC(=C)C(C)CCC(C)=CCCC=C(C)CCC(C)C(=C)CCC(C)C(C)=C BHEOSNUKNHRBNM-UHFFFAOYSA-N 0.000 description 1
- GQPQJNMVELPZNQ-GBALPHGKSA-N Thr-Ser-Trp Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)N)O GQPQJNMVELPZNQ-GBALPHGKSA-N 0.000 description 1
- 108020004440 Thymidine kinase Proteins 0.000 description 1
- 241000710924 Togaviridae Species 0.000 description 1
- 201000005485 Toxoplasmosis Diseases 0.000 description 1
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 1
- 108700019146 Transgenes Proteins 0.000 description 1
- 101800001690 Transmembrane protein gp41 Proteins 0.000 description 1
- 101000980463 Treponema pallidum (strain Nichols) Chaperonin GroEL Proteins 0.000 description 1
- 208000003721 Triple Negative Breast Neoplasms Diseases 0.000 description 1
- LVTKHGUGBGNBPL-UHFFFAOYSA-N Trp-P-1 Chemical compound N1C2=CC=CC=C2C2=C1C(C)=C(N)N=C2C LVTKHGUGBGNBPL-UHFFFAOYSA-N 0.000 description 1
- 102100035284 Tumor necrosis factor receptor superfamily member 6B Human genes 0.000 description 1
- 206010064390 Tumour invasion Diseases 0.000 description 1
- 108010069584 Type III Secretion Systems Proteins 0.000 description 1
- LUMQYLVYUIRHHU-YJRXYDGGSA-N Tyr-Ser-Thr Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(O)=O LUMQYLVYUIRHHU-YJRXYDGGSA-N 0.000 description 1
- FZADUTOCSFDBRV-RNXOBYDBSA-N Tyr-Tyr-Trp Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(O)=O)C1=CC=C(O)C=C1 FZADUTOCSFDBRV-RNXOBYDBSA-N 0.000 description 1
- 108060008724 Tyrosinase Proteins 0.000 description 1
- 102000003425 Tyrosinase Human genes 0.000 description 1
- 102100027244 U4/U6.U5 tri-snRNP-associated protein 1 Human genes 0.000 description 1
- 101710155955 U4/U6.U5 tri-snRNP-associated protein 1 Proteins 0.000 description 1
- LFTYTUAZOPRMMI-CFRASDGPSA-N UDP-N-acetyl-alpha-D-glucosamine Chemical compound O1[C@H](CO)[C@@H](O)[C@H](O)[C@@H](NC(=O)C)[C@H]1OP(O)(=O)OP(O)(=O)OC[C@@H]1[C@@H](O)[C@@H](O)[C@H](N2C(NC(=O)C=C2)=O)O1 LFTYTUAZOPRMMI-CFRASDGPSA-N 0.000 description 1
- LFTYTUAZOPRMMI-UHFFFAOYSA-N UNPD164450 Natural products O1C(CO)C(O)C(O)C(NC(=O)C)C1OP(O)(=O)OP(O)(=O)OCC1C(O)C(O)C(N2C(NC(=O)C=C2)=O)O1 LFTYTUAZOPRMMI-UHFFFAOYSA-N 0.000 description 1
- 108010046334 Urease Proteins 0.000 description 1
- 101100502046 Vaccinia virus (strain Western Reserve) VACWR052 gene Proteins 0.000 description 1
- GVJUTBOZZBTBIG-AVGNSLFASA-N Val-Lys-Arg Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N GVJUTBOZZBTBIG-AVGNSLFASA-N 0.000 description 1
- 241000870995 Variola Species 0.000 description 1
- 241000700647 Variola virus Species 0.000 description 1
- 101100502047 Variola virus (isolate Human/India/Ind3/1967) C17L gene Proteins 0.000 description 1
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 description 1
- 208000002687 Venezuelan Equine Encephalomyelitis Diseases 0.000 description 1
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 1
- 229940122803 Vinca alkaloid Drugs 0.000 description 1
- 206010058874 Viraemia Diseases 0.000 description 1
- 108700005077 Viral Genes Proteins 0.000 description 1
- 108700010756 Viral Polyproteins Proteins 0.000 description 1
- 208000005466 Western Equine Encephalomyelitis Diseases 0.000 description 1
- 201000005806 Western equine encephalitis Diseases 0.000 description 1
- 241000269370 Xenopus <genus> Species 0.000 description 1
- 241001536558 Yaba monkey tumor virus Species 0.000 description 1
- 241000235013 Yarrowia Species 0.000 description 1
- 241000235015 Yarrowia lipolytica Species 0.000 description 1
- 241000607734 Yersinia <bacteria> Species 0.000 description 1
- 230000001133 acceleration Effects 0.000 description 1
- 125000000218 acetic acid group Chemical group C(C)(=O)* 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000000488 activin Substances 0.000 description 1
- 208000009956 adenocarcinoma Diseases 0.000 description 1
- 108700010877 adenoviridae proteins Proteins 0.000 description 1
- 230000001464 adherent effect Effects 0.000 description 1
- 229940009456 adriamycin Drugs 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 229960001686 afatinib Drugs 0.000 description 1
- ULXXDDBFHOBEHA-CWDCEQMOSA-N afatinib Chemical compound N1=CN=C2C=C(O[C@@H]3COCC3)C(NC(=O)/C=C/CN(C)C)=CC2=C1NC1=CC=C(F)C(Cl)=C1 ULXXDDBFHOBEHA-CWDCEQMOSA-N 0.000 description 1
- 239000000556 agonist Substances 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 238000005904 alkaline hydrolysis reaction Methods 0.000 description 1
- 229940098174 alkeran Drugs 0.000 description 1
- 229940045714 alkyl sulfonate alkylating agent Drugs 0.000 description 1
- 150000008052 alkyl sulfonates Chemical class 0.000 description 1
- 125000002947 alkylene group Chemical group 0.000 description 1
- 108010026331 alpha-Fetoproteins Proteins 0.000 description 1
- 229940037003 alum Drugs 0.000 description 1
- AZDRQVAHHNSJOQ-UHFFFAOYSA-N alumane Chemical class [AlH3] AZDRQVAHHNSJOQ-UHFFFAOYSA-N 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- 229960003437 aminoglutethimide Drugs 0.000 description 1
- ROBVIMPUHSLWNV-UHFFFAOYSA-N aminoglutethimide Chemical compound C=1C=C(N)C=CC=1C1(CC)CCC(=O)NC1=O ROBVIMPUHSLWNV-UHFFFAOYSA-N 0.000 description 1
- 230000003698 anagen phase Effects 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 230000019552 anatomical structure morphogenesis Effects 0.000 description 1
- 239000003098 androgen Substances 0.000 description 1
- 229940030486 androgens Drugs 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 229940046836 anti-estrogen Drugs 0.000 description 1
- 230000001833 anti-estrogenic effect Effects 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 230000006023 anti-tumor response Effects 0.000 description 1
- 230000005875 antibody response Effects 0.000 description 1
- 229940045687 antimetabolites folic acid analogs Drugs 0.000 description 1
- 229940045719 antineoplastic alkylating agent nitrosoureas Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 239000012298 atmosphere Substances 0.000 description 1
- 230000003416 augmentation Effects 0.000 description 1
- 229940120638 avastin Drugs 0.000 description 1
- VSRXQHXAPYXROS-UHFFFAOYSA-N azanide;cyclobutane-1,1-dicarboxylic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1 VSRXQHXAPYXROS-UHFFFAOYSA-N 0.000 description 1
- 210000003578 bacterial chromosome Anatomy 0.000 description 1
- 230000008952 bacterial invasion Effects 0.000 description 1
- 244000052616 bacterial pathogen Species 0.000 description 1
- 239000003855 balanced salt solution Substances 0.000 description 1
- 210000000270 basal cell Anatomy 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid group Chemical group C(C1=CC=CC=C1)(=O)O WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 229940108502 bicnu Drugs 0.000 description 1
- 238000004166 bioassay Methods 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 239000012472 biological sample Substances 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 229920001400 block copolymer Polymers 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 230000036760 body temperature Effects 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 229940098773 bovine serum albumin Drugs 0.000 description 1
- GDTBXPJZTBHREO-UHFFFAOYSA-N bromine Substances BrBr GDTBXPJZTBHREO-UHFFFAOYSA-N 0.000 description 1
- 229910052794 bromium Inorganic materials 0.000 description 1
- 229950009494 bropirimine Drugs 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 238000010804 cDNA synthesis Methods 0.000 description 1
- GMRQFYUYWCNGIN-NKMMMXOESA-N calcitriol Chemical compound C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@@H](CCCC(C)(C)O)C)=C\C=C1\C[C@@H](O)C[C@H](O)C1=C GMRQFYUYWCNGIN-NKMMMXOESA-N 0.000 description 1
- 229960005084 calcitriol Drugs 0.000 description 1
- 235000020964 calcitriol Nutrition 0.000 description 1
- 239000011612 calcitriol Substances 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 229940088954 camptosar Drugs 0.000 description 1
- 229940023860 canarypox virus HIV vaccine Drugs 0.000 description 1
- 230000009400 cancer invasion Effects 0.000 description 1
- 208000035269 cancer or benign tumor Diseases 0.000 description 1
- 239000012830 cancer therapeutic Substances 0.000 description 1
- 229940095731 candida albicans Drugs 0.000 description 1
- 229960004117 capecitabine Drugs 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 235000013877 carbamide Nutrition 0.000 description 1
- 125000002843 carboxylic acid group Chemical group 0.000 description 1
- 229960005243 carmustine Drugs 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 210000004970 cd4 cell Anatomy 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 230000032823 cell division Effects 0.000 description 1
- 239000002771 cell marker Substances 0.000 description 1
- 230000012292 cell migration Effects 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 230000007969 cellular immunity Effects 0.000 description 1
- 229960005395 cetuximab Drugs 0.000 description 1
- AOXOCDRNSPFDPE-UKEONUMOSA-N chembl413654 Chemical compound C([C@H](C(=O)NCC(=O)N[C@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@H](CCSC)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CC=1C=CC=CC=1)C(N)=O)NC(=O)[C@@H](C)NC(=O)[C@@H](CCC(O)=O)NC(=O)[C@@H](CCC(O)=O)NC(=O)[C@@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H]1N(CCC1)C(=O)CNC(=O)[C@@H](N)CCC(O)=O)C1=CC=C(O)C=C1 AOXOCDRNSPFDPE-UKEONUMOSA-N 0.000 description 1
- 239000013043 chemical agent Substances 0.000 description 1
- 125000003636 chemical group Chemical group 0.000 description 1
- 238000001311 chemical methods and process Methods 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 229940044683 chemotherapy drug Drugs 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 229960004630 chlorambucil Drugs 0.000 description 1
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 1
- 239000000460 chlorine Substances 0.000 description 1
- 229910052801 chlorine Inorganic materials 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 239000003593 chromogenic compound Substances 0.000 description 1
- 230000002759 chromosomal effect Effects 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- 229960002436 cladribine Drugs 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000011260 co-administration Methods 0.000 description 1
- 238000012761 co-transfection Methods 0.000 description 1
- 238000007398 colorimetric assay Methods 0.000 description 1
- 238000009096 combination chemotherapy Methods 0.000 description 1
- 102000006834 complement receptors Human genes 0.000 description 1
- 108010047295 complement receptors Proteins 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 238000005094 computer simulation Methods 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 229910052802 copper Inorganic materials 0.000 description 1
- 239000010949 copper Substances 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- GICLSALZHXCILJ-UHFFFAOYSA-N ctk5a5089 Chemical compound NCC(O)=O.NCC(O)=O GICLSALZHXCILJ-UHFFFAOYSA-N 0.000 description 1
- 125000004122 cyclic group Chemical group 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- 230000001461 cytolytic effect Effects 0.000 description 1
- 230000000120 cytopathologic effect Effects 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 238000002784 cytotoxicity assay Methods 0.000 description 1
- 231100000263 cytotoxicity test Toxicity 0.000 description 1
- 229960003901 dacarbazine Drugs 0.000 description 1
- 229960000640 dactinomycin Drugs 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000004041 dendritic cell maturation Effects 0.000 description 1
- CFCUWKMKBJTWLW-UHFFFAOYSA-N deoliosyl-3C-alpha-L-digitoxosyl-MTM Natural products CC=1C(O)=C2C(O)=C3C(=O)C(OC4OC(C)C(O)C(OC5OC(C)C(O)C(OC6OC(C)C(O)C(C)(O)C6)C5)C4)C(C(OC)C(=O)C(O)C(C)O)CC3=CC2=CC=1OC(OC(C)C1O)CC1OC1CC(O)C(O)C(C)O1 CFCUWKMKBJTWLW-UHFFFAOYSA-N 0.000 description 1
- 239000005547 deoxyribonucleotide Substances 0.000 description 1
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 125000004663 dialkyl amino group Chemical group 0.000 description 1
- RGLYKWWBQGJZGM-ISLYRVAYSA-N diethylstilbestrol Chemical compound C=1C=C(O)C=CC=1C(/CC)=C(\CC)C1=CC=C(O)C=C1 RGLYKWWBQGJZGM-ISLYRVAYSA-N 0.000 description 1
- 229960000452 diethylstilbestrol Drugs 0.000 description 1
- 108020001096 dihydrofolate reductase Proteins 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 238000006073 displacement reaction Methods 0.000 description 1
- 229960003668 docetaxel Drugs 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- 238000009510 drug design Methods 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 208000028715 ductal breast carcinoma in situ Diseases 0.000 description 1
- 201000007273 ductal carcinoma in situ Diseases 0.000 description 1
- 230000002500 effect on skin Effects 0.000 description 1
- 229940121647 egfr inhibitor Drugs 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 210000002257 embryonic structure Anatomy 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 201000003914 endometrial carcinoma Diseases 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 108700004025 env Genes Proteins 0.000 description 1
- 101150030339 env gene Proteins 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 210000000981 epithelium Anatomy 0.000 description 1
- 108700020302 erbB-2 Genes Proteins 0.000 description 1
- 229960001433 erlotinib Drugs 0.000 description 1
- 229960005309 estradiol Drugs 0.000 description 1
- 108010048134 estramustine-binding protein Proteins 0.000 description 1
- 239000000328 estrogen antagonist Substances 0.000 description 1
- 229960002568 ethinylestradiol Drugs 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 238000011049 filling Methods 0.000 description 1
- 210000003495 flagella Anatomy 0.000 description 1
- 108700014844 flt3 ligand Proteins 0.000 description 1
- 229960000390 fludarabine Drugs 0.000 description 1
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 1
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 1
- 229910052731 fluorine Inorganic materials 0.000 description 1
- 239000011737 fluorine Substances 0.000 description 1
- 229960001751 fluoxymesterone Drugs 0.000 description 1
- YLRFCQOZQXIBAB-RBZZARIASA-N fluoxymesterone Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1CC[C@](C)(O)[C@@]1(C)C[C@@H]2O YLRFCQOZQXIBAB-RBZZARIASA-N 0.000 description 1
- 108020005243 folate receptor Proteins 0.000 description 1
- 102000006815 folate receptor Human genes 0.000 description 1
- 150000002224 folic acids Chemical class 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 101150098622 gag gene Proteins 0.000 description 1
- 229930182830 galactose Natural products 0.000 description 1
- 229940044627 gamma-interferon Drugs 0.000 description 1
- 108010066264 gastrin 17 Proteins 0.000 description 1
- GKDWRERMBNGKCZ-RNXBIMIWSA-N gastrin-17 Chemical compound C([C@@H](C(=O)NCC(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H]1N(CCC1)C(=O)CNC(=O)[C@H]1NC(=O)CC1)C1=CC=C(O)C=C1 GKDWRERMBNGKCZ-RNXBIMIWSA-N 0.000 description 1
- XGALLCVXEZPNRQ-UHFFFAOYSA-N gefitinib Chemical compound C=12C=C(OCCCN3CCOCC3)C(OC)=CC2=NC=NC=1NC1=CC=C(F)C(Cl)=C1 XGALLCVXEZPNRQ-UHFFFAOYSA-N 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 108091008053 gene clusters Proteins 0.000 description 1
- 102000034356 gene-regulatory proteins Human genes 0.000 description 1
- 108091006104 gene-regulatory proteins Proteins 0.000 description 1
- 238000009650 gentamicin protection assay Methods 0.000 description 1
- 210000004907 gland Anatomy 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 150000002333 glycines Chemical class 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- XLXSAKCOAKORKW-AQJXLSMYSA-N gonadorelin Chemical compound C([C@@H](C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1[C@@H](CCC1)C(=O)NCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)C1=CC=C(O)C=C1 XLXSAKCOAKORKW-AQJXLSMYSA-N 0.000 description 1
- 229940035638 gonadotropin-releasing hormone Drugs 0.000 description 1
- 210000005256 gram-negative cell Anatomy 0.000 description 1
- 210000003714 granulocyte Anatomy 0.000 description 1
- 125000005843 halogen group Chemical group 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 238000010211 hemagglutination inhibition (HI) assay Methods 0.000 description 1
- 108060003552 hemocyanin Proteins 0.000 description 1
- 108010037536 heparanase Proteins 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- 229940022353 herceptin Drugs 0.000 description 1
- 125000000623 heterocyclic group Chemical group 0.000 description 1
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 1
- 108091008039 hormone receptors Proteins 0.000 description 1
- 230000005745 host immune response Effects 0.000 description 1
- 229940084986 human chorionic gonadotropin Drugs 0.000 description 1
- 208000033519 human immunodeficiency virus infectious disease Diseases 0.000 description 1
- 230000004727 humoral immunity Effects 0.000 description 1
- 230000008348 humoral response Effects 0.000 description 1
- 229940088013 hycamtin Drugs 0.000 description 1
- 229940096120 hydrea Drugs 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 229960001330 hydroxycarbamide Drugs 0.000 description 1
- 229910052588 hydroxylapatite Inorganic materials 0.000 description 1
- 229950000801 hydroxyprogesterone caproate Drugs 0.000 description 1
- 206010020718 hyperplasia Diseases 0.000 description 1
- 230000002390 hyperplastic effect Effects 0.000 description 1
- 229960000908 idarubicin Drugs 0.000 description 1
- 229960001101 ifosfamide Drugs 0.000 description 1
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 1
- 229960002411 imatinib Drugs 0.000 description 1
- KTUFNOKKBVMGRW-UHFFFAOYSA-N imatinib Chemical compound C1CN(C)CCN1CC1=CC=C(C(=O)NC=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)C=C1 KTUFNOKKBVMGRW-UHFFFAOYSA-N 0.000 description 1
- 230000002519 immonomodulatory effect Effects 0.000 description 1
- 230000007124 immune defense Effects 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 description 1
- 238000010185 immunofluorescence analysis Methods 0.000 description 1
- 230000016784 immunoglobulin production Effects 0.000 description 1
- 238000013115 immunohistochemical detection Methods 0.000 description 1
- 239000002955 immunomodulating agent Substances 0.000 description 1
- 229940121354 immunomodulator Drugs 0.000 description 1
- 230000001024 immunotherapeutic effect Effects 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000028709 inflammatory response Effects 0.000 description 1
- 230000004941 influx Effects 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 239000002054 inoculum Substances 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 229910052816 inorganic phosphate Inorganic materials 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 108010044426 integrins Proteins 0.000 description 1
- 102000006495 integrins Human genes 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 229940047124 interferons Drugs 0.000 description 1
- 108040003607 interleukin-13 receptor activity proteins Proteins 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- PNDPGZBMCMUPRI-UHFFFAOYSA-N iodine Chemical compound II PNDPGZBMCMUPRI-UHFFFAOYSA-N 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 229940084651 iressa Drugs 0.000 description 1
- 229960004768 irinotecan Drugs 0.000 description 1
- 230000007794 irritation Effects 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 238000011901 isothermal amplification Methods 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 229960004891 lapatinib Drugs 0.000 description 1
- BCFGMOOMADDAQU-UHFFFAOYSA-N lapatinib Chemical compound O1C(CNCCS(=O)(=O)C)=CC=C1C1=CC=C(N=CN=C2NC=3C=C(Cl)C(OCC=4C=C(F)C=CC=4)=CC=3)C2=C1 BCFGMOOMADDAQU-UHFFFAOYSA-N 0.000 description 1
- 230000002045 lasting effect Effects 0.000 description 1
- 239000010410 layer Substances 0.000 description 1
- 229960001614 levamisole Drugs 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 229960002247 lomustine Drugs 0.000 description 1
- 210000002751 lymph Anatomy 0.000 description 1
- 210000001365 lymphatic vessel Anatomy 0.000 description 1
- 210000005210 lymphoid organ Anatomy 0.000 description 1
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 230000002101 lytic effect Effects 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 230000036212 malign transformation Effects 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 238000013507 mapping Methods 0.000 description 1
- 241001515942 marmosets Species 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 229960002985 medroxyprogesterone acetate Drugs 0.000 description 1
- PSGAAPLEWMOORI-PEINSRQWSA-N medroxyprogesterone acetate Chemical compound C([C@@]12C)CC(=O)C=C1[C@@H](C)C[C@@H]1[C@@H]2CC[C@]2(C)[C@@](OC(C)=O)(C(C)=O)CC[C@H]21 PSGAAPLEWMOORI-PEINSRQWSA-N 0.000 description 1
- 229960001924 melphalan Drugs 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 1
- 229960001428 mercaptopurine Drugs 0.000 description 1
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 125000001570 methylene group Chemical group [H]C([H])([*:1])[*:2] 0.000 description 1
- 239000000693 micelle Substances 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 210000004688 microtubule Anatomy 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 229960004857 mitomycin Drugs 0.000 description 1
- 229960000350 mitotane Drugs 0.000 description 1
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 1
- 229960001156 mitoxantrone Drugs 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- HDZGCSFEDULWCS-UHFFFAOYSA-N monomethylhydrazine Chemical class CNN HDZGCSFEDULWCS-UHFFFAOYSA-N 0.000 description 1
- 210000005088 multinucleated cell Anatomy 0.000 description 1
- 229940031348 multivalent vaccine Drugs 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 210000000663 muscle cell Anatomy 0.000 description 1
- JXTPJDDICSTXJX-UHFFFAOYSA-N n-Triacontane Natural products CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC JXTPJDDICSTXJX-UHFFFAOYSA-N 0.000 description 1
- 229940086322 navelbine Drugs 0.000 description 1
- 101150091879 neo gene Proteins 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 229950010203 nimotuzumab Drugs 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 235000016709 nutrition Nutrition 0.000 description 1
- 239000007764 o/w emulsion Substances 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 101800000607 p15 Proteins 0.000 description 1
- 239000006179 pH buffering agent Substances 0.000 description 1
- 238000012536 packaging technology Methods 0.000 description 1
- 229960001592 paclitaxel Drugs 0.000 description 1
- 230000000242 pagocytic effect Effects 0.000 description 1
- IPCSVZSSVZVIGE-UHFFFAOYSA-N palmitic acid group Chemical group C(CCCCCCCCCCCCCCC)(=O)O IPCSVZSSVZVIGE-UHFFFAOYSA-N 0.000 description 1
- 229960001972 panitumumab Drugs 0.000 description 1
- 208000012111 paraneoplastic syndrome Diseases 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- XYJRXVWERLGGKC-UHFFFAOYSA-D pentacalcium;hydroxide;triphosphate Chemical compound [OH-].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O XYJRXVWERLGGKC-UHFFFAOYSA-D 0.000 description 1
- 239000000816 peptidomimetic Substances 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 229960002087 pertuzumab Drugs 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N phenol group Chemical group C1(=CC=CC=C1)O ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 1
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 230000035479 physiological effects, processes and functions Effects 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 210000005134 plasmacytoid dendritic cell Anatomy 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229910052697 platinum Inorganic materials 0.000 description 1
- 230000004983 pleiotropic effect Effects 0.000 description 1
- 210000004224 pleura Anatomy 0.000 description 1
- 101150088264 pol gene Proteins 0.000 description 1
- 108010048507 poliovirus receptor Proteins 0.000 description 1
- 229920001481 poly(stearyl methacrylate) Polymers 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920002523 polyethylene Glycol 1000 Polymers 0.000 description 1
- 229950008882 polysorbate Drugs 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 238000011533 pre-incubation Methods 0.000 description 1
- XOFYZVNMUHMLCC-ZPOLXVRWSA-N prednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 XOFYZVNMUHMLCC-ZPOLXVRWSA-N 0.000 description 1
- 229960004618 prednisone Drugs 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000037452 priming Effects 0.000 description 1
- 108010042121 probasin Proteins 0.000 description 1
- CPTBDICYNRMXFX-UHFFFAOYSA-N procarbazine Chemical compound CNNCC1=CC=C(C(=O)NC(C)C)C=C1 CPTBDICYNRMXFX-UHFFFAOYSA-N 0.000 description 1
- 229960000624 procarbazine Drugs 0.000 description 1
- 229960003387 progesterone Drugs 0.000 description 1
- 239000000186 progesterone Substances 0.000 description 1
- 239000000583 progesterone congener Substances 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- 125000006239 protecting group Chemical group 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 210000001938 protoplast Anatomy 0.000 description 1
- 150000003212 purines Chemical class 0.000 description 1
- 150000003230 pyrimidines Chemical class 0.000 description 1
- 239000001397 quillaja saponaria molina bark Substances 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 239000000376 reactant Substances 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 102000027426 receptor tyrosine kinases Human genes 0.000 description 1
- 108091008598 receptor tyrosine kinases Proteins 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 108010043277 recombinant soluble CD4 Proteins 0.000 description 1
- 229940124551 recombinant vaccine Drugs 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 230000025078 regulation of biosynthetic process Effects 0.000 description 1
- 230000037425 regulation of transcription Effects 0.000 description 1
- 239000003488 releasing hormone Substances 0.000 description 1
- 230000008439 repair process Effects 0.000 description 1
- 230000001850 reproductive effect Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 108700004030 rev Genes Proteins 0.000 description 1
- 101150098213 rev gene Proteins 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 229960004641 rituximab Drugs 0.000 description 1
- 229930182490 saponin Natural products 0.000 description 1
- 150000007949 saponins Chemical class 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 229960003440 semustine Drugs 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 230000037432 silent mutation Effects 0.000 description 1
- 229910052709 silver Inorganic materials 0.000 description 1
- 239000004332 silver Substances 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 208000000649 small cell carcinoma Diseases 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 239000008247 solid mixture Substances 0.000 description 1
- 229940035044 sorbitan monolaurate Drugs 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 229940032094 squalane Drugs 0.000 description 1
- 229940031439 squalene Drugs 0.000 description 1
- TUHBEKDERLKLEC-UHFFFAOYSA-N squalene Natural products CC(=CCCC(=CCCC(=CCCC=C(/C)CCC=C(/C)CC=C(C)C)C)C)C TUHBEKDERLKLEC-UHFFFAOYSA-N 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 102000005969 steroid hormone receptors Human genes 0.000 description 1
- 101150050955 stn gene Proteins 0.000 description 1
- 229960001052 streptozocin Drugs 0.000 description 1
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000000153 supplemental effect Effects 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 229920002994 synthetic fiber Polymers 0.000 description 1
- 229920001059 synthetic polymer Polymers 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 101150047061 tag-72 gene Proteins 0.000 description 1
- 229940120982 tarceva Drugs 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 1
- 229940063683 taxotere Drugs 0.000 description 1
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 1
- 229960001278 teniposide Drugs 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- 229960003604 testosterone Drugs 0.000 description 1
- 238000010257 thawing Methods 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 150000003573 thiols Chemical class 0.000 description 1
- 229960003087 tioguanine Drugs 0.000 description 1
- MNRILEROXIRVNJ-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=NC=N[C]21 MNRILEROXIRVNJ-UHFFFAOYSA-N 0.000 description 1
- 229960000303 topotecan Drugs 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 230000005026 transcription initiation Effects 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- 101150044170 trpE gene Proteins 0.000 description 1
- 108010044292 tryptophyltyrosine Proteins 0.000 description 1
- 230000005740 tumor formation Effects 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- 231100000402 unacceptable toxicity Toxicity 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- 229960001055 uracil mustard Drugs 0.000 description 1
- 150000003672 ureas Chemical class 0.000 description 1
- 210000004509 vascular smooth muscle cell Anatomy 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 210000003501 vero cell Anatomy 0.000 description 1
- 108700026220 vif Genes Proteins 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- UGGWPQSBPIFKDZ-KOTLKJBCSA-N vindesine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(N)=O)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1N=C1[C]2C=CC=C1 UGGWPQSBPIFKDZ-KOTLKJBCSA-N 0.000 description 1
- 229960004355 vindesine Drugs 0.000 description 1
- CILBMBUYJCWATM-PYGJLNRPSA-N vinorelbine ditartrate Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O.OC(=O)[C@H](O)[C@@H](O)C(O)=O.C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC CILBMBUYJCWATM-PYGJLNRPSA-N 0.000 description 1
- 230000017613 viral reproduction Effects 0.000 description 1
- 230000007923 virulence factor Effects 0.000 description 1
- 239000000304 virulence factor Substances 0.000 description 1
- 108700026215 vpr Genes Proteins 0.000 description 1
- 108700026222 vpu Genes Proteins 0.000 description 1
- 239000007762 w/o emulsion Substances 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 229940053867 xeloda Drugs 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61N—ELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
- A61N5/00—Radiation therapy
- A61N5/10—X-ray therapy; Gamma-ray therapy; Particle-irradiation therapy
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/82—Translation products from oncogenes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57407—Specifically defined cancers
- G01N33/57415—Specifically defined cancers of breast
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55583—Polysaccharides
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/16011—Herpesviridae
- C12N2710/16211—Lymphocryptovirus, e.g. human herpesvirus 4, Epstein-Barr Virus
- C12N2710/16234—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- nucleic and amino acid sequences listed in the accompanying sequence listing are shown using standard letter abbreviations for nucleotide bases, and three letter code for amino acids, as defined in 37 C.F.R. 1.822. Only one strand of each nucleic acid sequence is shown, but the complementary strand is understood as included by any reference to the displayed strand.
- SEQ ID NO: 1 is an amino acid sequence of a human Brachyury protein.
- SEQ ID NO: 2 is a nucleic acid sequence encoding a human Brachyury protein.
- SEQ ID NO: 3 is an amino acid sequence of a murine Brachyury protein.
- SEQ ID NO: 4 is a nucleic acid sequence encoding a murine Brachyury protein.
- SEQ ID NO: 5 is a Brachyury class IIA epitope.
- SEQ ID NO: 6 is a Brachyury class IIB epitope.
- This application relates to the field of cancer therapeutics, specifically to the use of a Brachyury protein and non-poxvirus, non-yeast vectors encoding a Brachyury protein for the treatment of cancer.
- Brachyury was initially cloned from mouse developmental mutants characterized by an arrest in mesoderm formation (Hermann et al, Nature 1990; 343:617-22) has been recognized as gene that is important in mesoderm development during gastrulation.
- Brachyury is a member of a family of transcription factors, designated T-box transcription factors, these factors are characterized by a conserved DNA-binding domain (Papaioannou et al., Bioessays 1998; 20:9-19). These transcription factors play an essential role in the formation and organization of mesoderm in vertebrates (see, for example, Edwards et al., Genome Res 1996; 6:226-33).
- Tbx2 In addition to the important role of the T-box proteins in the control of developmental processes, several members of this family are deregulated in cancer.
- the human Tbx2 gene has been reported to be amplified in pancreatic cancer cell lines (Mahlamaki et al., Genes Chromosomes Cancer 2002, 35:353-8) and is overexpressed in BRCA-1- and BRCA-2-mutated breast tumors (Sinclair et al., Cancer Res 2002; 62:3587-91).
- Tbx3 expression has been shown to be augmented in certain human breast cancer cell lines (Fan et al., Cancer Res 2004; 64:5132-9).
- teratocarcinoma lines a subset of germ cell tumors, teratocarcinomas are embryonal carcinoma cells with competence for mesoderm differentiation (Gokhale et al., Cell Growth Differ 2000; 11:157-62) and in chordomas (see, for example, Vojovic et al., J Pathol 2006; 209:157-65).
- Immunotherapeutic interventions against cancer depend on the identification of tumor antigens able to elicit a host immune response against the tumor cells.
- Good targets are molecules that are selectively expressed by malignant cells and that are also essential for malignant transformation and/or tumor progression.
- the epithelial-mesenchymal transition (EMT) has been recognized as a key step during the progression of primary tumors into metastases (Thiery et al., Nat Rev Cancer 2002; 2:442-54).
- Brachyury protein or a Brachyury polypeptide can be used to induce Brachyury-specific CD4+ T cells in vivo and ex vivo. It is also disclosed that Brachyury protein and Brachyury polypeptides can be used to stimulate the production of both Brachyury-specific CD4+ T cells and Brachyury-specific CD8+ T cells.
- Brachyury is expressed in numerous human cancers, such as in cancer of the small intestine, stomach, kidney bladder, uterus, ovary, testes, lung, colon, prostate, bronchial tube, chronic lymphocytic leukemia (CLL), other B cell-based malignancies, and breast cancer, such as infiltrating ductal carcinomas of the breast.
- CLL chronic lymphocytic leukemia
- Brachyury protein, Brachyury polypeptides, and nucleic acids encoding Brachyury protein and/or polypeptides can be used to produce Brachyury specific CD4+ T cells, and CD8+ T cells, that can be used for the treatment or prevention of cancer.
- methods for inducing CD4+ Brachyury-specific T cells and/or CD8+ Brachyury specific T cells.
- the methods include the use of a Brachyury protein, a Brachyury polypeptide, nucleic acids encoding the Brachyury protein and/or Brachyury polypeptides, or host cells expressing the Brachyury protein or polypeptide, such as such as a Salmonella or Lisleria host cells.
- These agents can be administered either alone or in conjunction with another agent, such as a cytokine and/or another cancer therapy.
- methods are disclosed for treating a subject with a cancer, such as a breast cancer, cancer of the small intestine, stomach, kidney, bladder, uterus, ovaries, testes lung, colon or prostate, or a tumor of B cell origin, or for preventing these cancers in a subject.
- the methods include measuring Brachyury-specific CD4+ T cells.
- the methods also induce CD8+ Brachyury specific T cells.
- Non-pox non-yeast vectors encoding a Brachyury protein are disclosed that can be used to induce CD4+ Brachyury-specific T cells and/or CD8+ Brachyury-specific T cells.
- the vector is an alphavirus, a lentiviurs, an adenovirus, a measles virus or a poliovirus vector.
- host cells transformed with these vectors such as Salmonella and Listeria host cells are provided.
- methods for inhibiting the growth of a cancer cell in a subject. These methods include contacting a dendritic cell with a protein comprising an amino acid sequence at least 90% identical to the amino acid sequence set forth as SEQ ID NO: 1, a polypeptide comprising at least 15 consecutive amino acids of the amino acid sequence set forth at SEQ ID NO: 1 that specifically binds a Major Histocompatibility Class (MHC class II) molecule, or a Listeria or Salmonella host cell expressing the protein or the polypeptide thereby preparing a specific antigen presenting cell. These methods also include administering the antigen presenting cell to the subject, thereby inducing an immune response and inhibiting the growth of the cancer cell.
- MHC class II Major Histocompatibility Class
- FIG. 1 Brachyury-specific CD4+ T cells can be expanded from PBMCs of normal donors by culture in the presence of purified recombinant Brachyury protein.
- Dendritic cells (DCs) from 2 normal donors were prepared by culture in the presence of GM-CSF and IL-4.
- GM-CSF GM-CSF
- IL-4 IL-4-derived recombinant Brachyury protein
- HSA human serum albumin
- FIG. 2 A Brachyury-specific CD4 T cell line releases cytokines and chemokines when stimulated with a class-II DRB1*0401 binding Brachyury peptide.
- Brachyury class IIA epitope SEQ ID NO: 5
- Brachyury class IIB epitope SEQ ID NO: 6
- FIG. 3A-3E Brachyury induces an epithelial-to-mesenchymal transition (EMT) in breast carcinoma cells.
- EMT epithelial-to-mesenchymal transition
- A MCF7-pcDNA and MCF7-phBrachyury stable transfectants grown on plastic surface for bright field images (top panels) and grown immunofluorescence analysis of E-cadherin expression (green signal); blue signal represents DAPI-stained nuclei (bottom panels).
- B Membrane images from in vitro cell migration (top panels) and ECM invasion assays (bottom panels) for MCF7-pcDNA and MCF7-pBrachyury cells. Results are representative of three experiments.
- C, D Real-time PCR was performed on indicated cell pairs for Brachyury, Fibronectin, and Vimentin. Values (mean ⁇ SEM) are expressed as a ratio to the endogenous control GAPDH.
- E Immunofluoresent analysis of Fibronectin expression in MDA-MB-436-con.shRNA and MDA-MB-436-Br.shRNA stable transfectants (original magnification 20 ⁇ ). The green signal represents staining for Fibronectin; the blue signal represents the DAPI-stained nuclei.
- FIGS. 4A-4D Effect of Brachyury expression on stem cell marker expression and mammosphere growth of tumor cells.
- Real-time PCR was performed for indicated genes on cDNA from (A) MCF7-pcDNA and MCF7-phBrachyury cells and (C) MDA-MB-436-con.shRNA and MDA-MB-436-Br.shRNA cells. Values (mean ⁇ SEM) are expressed as a ratio to the endogenous control GAPDH.
- Mammospheres were grown from the MCF7 (B) or the MDA-MB-436 (D) tumor cell pairs on ultra-low-attachment plates. Primary mammospheres were dissociated and re-plated for secondary cultures. Bright field images of mammospheres at 10 ⁇ magnification and mean number of mammospheres per 10 ⁇ microscope field are shown for secondary cultures in the left and right panels, respectively. Error bars indicate SEM of 8-10 measurements.
- FIGS. 5A-5D Expression of Brachyury mRNA in breast carcinoma tissues.
- A Real-time PCR was performed for Brachyury, Twist, Snail, and Slug on human breast primary tumor tissue cDNA from 41 breast cancer patients. As controls, 7 samples of normal breast cDNA were also analyzed, each obtained from a histologically normal section of breast from a patient with cancer or fibrocystic disease.
- B Real-time PCR was performed for Brachyury on human primary breast tumor tissue cDNA from 107 invasive ductal adenocarcinomas, 6 invasive lobular adenocarcinomas, and 5 mixed ductal/lobular adenocarcinomas.
- FIGS. 6A-6F Immunohistochemical detection of Brachyury in primary breast carcinoma and metastatic tissues. Transmitted light photomicrographs of tissue sections stained for Brachyury expression in (A) a primary infiltrating ductal carcinoma, Grade 3 (patient 11); (B) a primary infiltrating ductal carcinoma, Grade 3 and (C) corresponding lymph node metastasis from the same patient (patient 6); (D, E) bone metastatic lesions from two different breast cancer patients (patients 22 and 23); (F) brain metastatic lesion from a breast cancer patient (patient 24). The brown signal represents staining for Brachyury. Magnification 20 ⁇ (A-F).
- FIG. 7A-7C Immunogenicity of Brachyury.
- A Detection of IgG antibodies against Brachyury in the serum of normal donors and metastatic breast cancer patients. Shown is the number of positive cases in each group, stratified by titer of IgG as determined by ELISA assay. Statistical analysis was performed, comparing breast vs. normal donors. Brachyury-specific CTLs were generated from the peripheral blood of a prostate cancer patient via stimulation with a Brachyury-derived peptide.
- Cytotoxic activity was assessed in a 16-h assay against (B) HLA-A2 + /Brachyury + MCF7 cells or HLA-A2 ⁇ /Brachyury + MDA-MB-436 cells, and (C) HLA-A2 + /Brachyury + MDA-MB-231 cells.
- the effector-to-target (E:T) ratios are indicated; major histocompatibility complex (MHC)-restriction was analyzed by pre-incubation of the targets with control IgG or a HLA-A specific antibody.
- Brachyury protein and Brachyury polypeptides of greater than 15 amino acids in length can be used to induce Brachyury-specific CD4+ T cells in vivo and ex vivo. It is also disclosed that Brachyury protein and Brachyury polypeptides can be used to stimulate the production of both Brachyury-specific CD4+ T cells and Brachyury-specific CD8+ T cells.
- Brachyury protein is expressed in numerous human cancers, such as cancer of the small intestine, stomach, kidney bladder, uterus, ovary, testes, lung, colon, prostate, bronchial tube, chronic lymphocytic leukemia (CLL), other B cell-based malignancies and breast cancer, such as infiltrating ductal carcinomas of the breast and thus the method disclosed herein can be used to treat or prevent these cancers.
- the breast cancer is an estrogen receptor negative and progesterone receptor negative breast cancer.
- the cancer is any cancer that is radiation resistant and/or chemotherapy resistant.
- the cancer can express Brachyury or have the potential to express Brachyury.
- Non-pox non-yeast vectors encoding a Brachyury protein or a Brachyury polypeptide, and host cells expressing Brachyury are disclosed, these vectors and host cells can be used to induce CD4+ Brachyury-specific T cells and/or CD8+ T cells.
- these vectors are adenovirus vectors, alphavirus vectors, lentivirus vectors, poliovirus vectors, Listeria vectors, Salmonella vectors or measles virus vectors.
- host cells transformed with these vectors, and methods of using these proteins, polynucleotides, vectors, and host cells are provided.
- the host cells are Salmonella or Listeria host cells.
- methods are provided for inducing CD4+ Brachyury-specific T cells and/or CD8+ T cells.
- the methods include the use of a Brachyury protein, Brachyury polypeptide, dendritic cells expressing Brachyury epitopes, nucleic acids encoding Brachyury protein and/or polyhpeptides, including non-pox non-yeast vectors encoding the Brachyury protein and/or the Brachyury polypeptide to induce the production of CD4+ Brachyury specific T cells.
- methods are disclosed for treating a subject having cancer, such as, but not limited to, a cancer of the small intestine, stomach, kidney bladder, uterus, ovary, testes, lung, colon, prostate, bronchial tube, chronic lymphocytic leukemia (CLL), other B cell-based malignancies, or breast cancer, such as an infiltrating ductal carcinoma or estrogen receptor negative and progesterone receptor negative breast cancers.
- cancers can be chemotherapy resistant and/or radiation resistant.
- the cancer can express Brachyury or have the potential to express Brachyury. Methods are also disclosed for preventing these cancers.
- These methods include inducing CD4+ Brachyury-specific T cells; the method can also include inducing CD8+ Brachyury-specific T cells.
- the Brachyury protein, Brachyury polypeptide, dendritic cells, nucleic acid, or non-pox non-yeast vector encoding the Brachyury protein can be administered to the subject either alone or in conjunction with a second agent, such as radiation therapy and/or chemotherapy.
- the Brachyury protein comprises an amino acid sequence at least 90% identical, or at least 95% identical, to the amino acid sequence set forth as SEQ ID NO: 1.
- the Brachyury protein comprises, or consists of, the amino acid sequence set forth as SEQ ID NO: 1, the amino acid sequence set forth as SEQ ID NO: 1 without the N-terminal methionine, or the amino acid sequence set forth as SEQ ID NO: 1, with substitutions at position 177 (Asp vs. Gly, respectively), position 368 (Thr vs. Ser, respectively) and position 409 (Asn vs. Asp, respectively).
- a Brachyury polypeptide comprises at least 15 amino acids of the amino acid sequence set forth as SEQ ID NO: 1, such as at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 200 amino acids of the amino acid sequence set forth as SEQ ID NO: 1, wherein the entirety of SEQ ID NO: 1 is not included in the polypeptide.
- a Brachyury polpeptide is 15 to 100 amino acids of SEQ ID NO: 1, such as 15 to 200 amino acids, 15 to 300 amino acids, 15 to 400 amino acids, or 15 to 435 amino acids of SEQ ID NO: 1.
- methods for inhibiting the growth of a cancer cell in a subject. These methods include contacting a dendritic cell with a protein comprising an amino acid sequence at least 90% identical to the amino acid sequence set forth as SEQ ID NO: 1, a polypeptide comprising at least 15 consecutive amino acids of the amino acid sequence set forth at SEQ ID NO: 1 that specifically binds a Major Histocompatibility Class (MHC class II) molecule, or a Listeria or Salmonella host cell expressing the protein, thereby preparing a specific antigen presenting cell. These methods also include administering the antigen presenting cell to the subject, thereby inducing an immune response and inhibiting the growth of the cancer cell.
- MHC class II Major Histocompatibility Class
- Adenovirus A virus of the family Adenoviridae, which are medium-sized (90-100 nm), nonenveloped icosahedral viruses composed of a nucleocapsid and a double-stranded linear DNA genome.
- the adenovirus genome is linear, non-segmented double-stranded (ds) DNA that is between 26 and 45 kb. This allows the virus to theoretically carry 22 to 40 genes.
- the linear dsDNA genome is able to replicate in the nucleus of mammalian cells using the host's replication machinery. However, adenoviral DNA does not integrate into the genome and is not replicated during cell division.
- Adeno-associated virus is a small virus that infects humans and some other primate species. AAV is not currently known to cause disease and consequently the virus causes a very mild immune response. AAV can infect both dividing and non-dividing cells and may incorporate its genome into that of the host cell.
- the AAV genome is built of single-stranded deoxyribonucleic acid (ssDNA), either positive- or negative-sensed, which is about 4.7 kilobase long.
- the genome comprises inverted terminal repeats (ITRs) at both ends of the DNA strand, and two open reading frames (ORFs): rep and cap.
- Rep is composed of four overlapping genes encoding Rep proteins required for the AAV life cycle, and Cap contains overlapping nucleotide sequences of capsid proteins: VP1, VP2 and VP3, which interact together to form a capsid of an icosahedral symmetry.
- ITRs seem to be the only sequences required in cis next to the therapeutic gene: structural (cap) and packaging (rep) genes can be delivered in trans.
- Adjuvant A vehicle used to enhance antigenicity.
- Adjuvants include a suspension of minerals (alum, aluminum hydroxide, or phosphate) on which antigen is adsorbed; or water-in-oil emulsion in which antigen solution is emulsified in mineral oil (Freund incomplete adjuvant), sometimes with the inclusion of killed mycobacteria (Freund's complete adjuvant) to further enhance antigenicity (inhibits degradation of antigen and/or causes influx of macrophages).
- Immunstimulatory oligonucleotides (such as those including a CpG motif) can also be used as adjuvants (for example see U.S. Pat. Nos.
- Adjuvants include biological molecules (a “biological adjuvant”), such as costimulatory molecules.
- biological adjuvants include IL-2, RANTES, GM-CSF, TNF- ⁇ , IFN- ⁇ , G-CSF, LFA-3, CD72, B7-1, B7-2, OX-40L and 4-1 BBL.
- Another exemplary adjuvant is chitosan.
- Another adjuvant is Bacillus -Calmette-Guerin adjvant.
- Alphavirus A virus that belongs to the group IV Togaviridae family of viruses.
- the alphaviruses are small, spherical, enveloped viruses with a genome of a single positive sense strand RNA.
- the total genome length ranges between 11,000 and 12,000 nucleotides, and has a 5′ cap, and 3′ poly-A tail.
- the four non-structural protein genes are encoded in the 5′ two-thirds of the genome, while the three structural proteins are translated from a subgenomic mRNA colinear with the 3′ one-third of the genome.
- the alphavirusus include the Ross River virus, Sindbis virus, Semliki Forest virus, and Venezuelan equine encephalitis virus.
- Antigen A compound, composition, or substance that can stimulate the production of antibodies or a T cell response in an animal, including compositions that are injected or absorbed into an animal.
- An antigen reacts with the products of specific humoral or cellular immunity, including those induced by heterologous immunogens.
- the term “antigen” includes all related antigenic epitopes. “Epitope” or “antigenic determinant” refers to a site on an antigen to which B and/or T cells respond. In one embodiment, T cells respond to the epitope, when the epitope is presented in conjunction with an MHC molecule. Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein.
- Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents.
- An epitope typically includes at least 3, and more usually, at least 5, about 9, or about 8-10 amino acids in a unique spatial conformation, but is generally not more than 20 amino acids in length.
- Methods of determining spatial conformation of epitopes include, for example, x-ray crystallography and 2-dimensional nuclear magnetic resonance.
- An antigen can be a tissue-specific antigen, or a disease-specific antigen. These terms are not exclusive, as a tissue-specific antigen can also be a disease specific antigen.
- a tissue-specific antigen is expressed in a limited number of tissues, such as a single tissue. Specific, non-limiting examples of a tissue specific antigen are a prostate specific antigen, a uterine specific antigen, and/or a testes specific antigen.
- a tissue specific antigen may be expressed by more than one tissue, such as, but not limited to, an antigen that is expressed in more than one reproductive tissue, such as in both prostate and uterine tissue.
- a disease-specific antigen is expressed coincidentally with a disease process.
- a disease-specific antigen are an antigen whose expression correlates with, or is predictive of, tumor formation, such as prostate cancer and/or uterine cancer and/or testicular cancer.
- a disease-specific antigen can be an antigen recognized by T cells or B cells.
- Amplification Of a nucleic acid molecule (e.g., a DNA or RNA molecule) refers to use of a technique that increases the number of copies of a nucleic acid molecule in a specimen.
- An example of amplification is the polymerase chain reaction, in which a biological sample collected from a subject is contacted with a pair of oligonucleotide primers, under conditions that allow for the hybridization of the primers to a nucleic acid template in the sample.
- the primers are extended under suitable conditions, dissociated from the template, and then re-annealed, extended, and dissociated to amplify the number of copies of the nucleic acid.
- the product of amplification can be characterized by electrophoresis, restriction endonuclease cleavage patterns, oligonucleotide hybridization or ligation, and/or nucleic acid sequencing using standard techniques.
- Other examples of amplification include strand displacement amplification, as disclosed in U.S. Pat. No. 5,744,311; transcription-free isothermal amplification, as disclosed in U.S. Pat. No. 6,033,881; repair chain reaction amplification, as disclosed in WO 90/01069; ligase chain reaction amplification, as disclosed in EP-A-320 308; gap filling ligase chain reaction amplification, as disclosed in U.S. Pat. No. 5,427,930; and NASBATM RNA transcription-free amplification, as disclosed in U.S. Pat. No. 6,025,134.
- Immunoglobulin molecules and immunologically active portions of immunoglobulin molecules i.e., molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen, such as Brachyury protein.
- a naturally occurring antibody e.g., IgG, IgM, IgD
- IgG, IgM, IgD includes four polypeptide chains, two heavy (H) chains and two light (L) chains interconnected by disulfide bonds.
- H heavy
- L light
- the antigen-binding function of an antibody can be performed by fragments of a naturally occurring antibody.
- binding fragments encompassed within the term antibody include (i) a Fab fragment consisting of the V L , V H , C L and C H1 domains; (ii) an F d fragment consisting of the V H and C H1 domains; (iii) an Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (iv) a dAb fragment (Ward et al., Nature 341:544-546, 1989) which consists of a V H domain; (v) an isolated complementarity determining region (CDR); and (vi) a F(ab′)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region.
- a Fab fragment consisting of the V L , V H , C L and C H1 domains
- an F d fragment consisting of the V H and C H1 domains
- an Fv fragment consisting of the VL and VH domains of a single arm
- Immunoglobulins and certain variants thereof are known and many have been prepared in recombinant cell culture (e.g., see U.S. Pat. Nos. 4,745,055; 4,444,487; WO 88/03565; EP 256,654; EP 120,694; EP 125,023; Faoulkner et al., Nature 298:286, 1982; Morrison, J. Immunol. 123:793, 1979; Morrison et al., Ann Rev. Immunol 2:239, 1984). Humanized antibodies and fully human antibodies are also known in the art.
- Animal Living multi-cellular vertebrate organisms, a category that includes, for example, mammals and birds.
- mammal includes both human and non-human mammals.
- subject includes both human and veterinary subjects.
- Brachyury The Brachyury gene is known to be important for the development of mesoderm during gastrulation. Brachyury is the founding member of a family of transcription factors, designated T-box transcription factors, characterized by a conserved DNA-binding domain (Papaioannou and Silver, Bioessays 20(1):9-19, 1998), that has an essential role in the formation and organization of mesoderm in vertebrates (see, for example, Kispert and Herrmann, Embo J 12(8):3211-20, 1993).
- Brachyury is an early-immediate response gene of mesoderm inducers, such as activin or TGF- ⁇ , and injection of Brachyury mRNA in embryos is sufficient to induce ectopic mesoderm development (Smith et al., Cell 67(1):79-87, 1991).
- mesoderm inducers such as activin or TGF- ⁇
- injection of Brachyury mRNA in embryos is sufficient to induce ectopic mesoderm development (Smith et al., Cell 67(1):79-87, 1991).
- T-box proteins In addition to the fundamental role of the T-box proteins in the control of developmental processes, several members of this family appear to be deregulated in cancer.
- the human Thx2 gene has been reported to be amplified in pancreatic cancer cell lines (Mahlamaki et al., Genes Chromosomes Cancer 35(4):353-8, 2002) and over-expressed in BRCA-1- and BRCA-2-mutated breast tumors (Sinclair et al., Cancer Res 62(13):3587-9, 2002). Brachyury expression has been reported in human teratocarcinoma lines and chordomas (Vujovic et al, J Pathol 209(2): 157-65, 2006). Exemplary human brachyury amino acid and nucleic acid sequences are set forth in GENBANK® Accession No NP_003172 and GENBANK® Accession No. NM_003181, as available on Feb. 23, 2007, incorporated herein by reference, and are provided below.
- Breast cancer A neoplastic condition of breast tissue that can be benign or malignant.
- the most common type of breast cancer is ductal carcinoma.
- Ductal carcinoma in situ is a non-invasive neoplastic condition of the ducts.
- Lobular carcinoma is not an invasive disease but is an indicator that a carcinoma may develop.
- Infiltrating (malignant) carcinoma of the breast can be divided into stages (I IIA, IIB, IIIA, IIIB, and IV). Tumor size staging and node involvement staging can be combined into a single clinical staging number, as exemplified below.
- carcinomas lose the typical histology and architecture of normal breast glands. Generally, carcinoma cells overgrow the normal cells and lose their ability to differentiate into glandular like structures. The degree of loss of differentiation in general is related to the aggressiveness of the tumor. For example, “in situ” carcinoma by definition retains the basement membrane intact, whereas as it progresses to “invasive”, the tumor shows breakout of basement membranes. Thus one would not expect to see, within breast carcinomas, staining of a discrete layer of basal cells as seen in normal breast tissue. For a discussion of the physiology and histology of normal breast and breast carcinoma, see Ronnov-Jessen, L., Petersen, O. W. & Bissell, M. J. Cellular changes involved in conversion of normal to malignant breast: importance of the stromal reaction. Physiol Rev 76, 69-125 (1996).
- Breast cancers can be divided into groups based on their expression profiles. Basal-type carcinomas usually are negative for expression of estrogen receptor (ER) and negative for expression of HER2 (erbB2) and progesterone receptor (PR), and thus are referred to as “triple-negative breast cancers” or “TNBC.” This type of breast cancer is also denoted ER ⁇ /HER2 ⁇ /PR ⁇ and represents about 15-20% of all breast cancer, and generally cannot be treated using Her2 targeted or estrogen targeted therapies. It is believed that the aggressive nature of this cancer is correlated with an enrichment for cancer stem cells (CSC) with a CD44 + CD24 ⁇ /lo phenotype.
- CSC cancer stem cells
- basal carcinomas are negative for expression of progesterone receptor (PR), positive for expression of epidermal growth factor receptor (EGFR), and positive for expression of cytokeratin 5 (CK5).
- PR progesterone receptor
- EGFR epidermal growth factor receptor
- CK5 cytokeratin 5
- Cancer or Tumor A malignant neoplasm that has undergone characteristic anaplasia with loss of differentiation, increased rate of growth, invasion of surrounding tissue, and is capable of metastasis.
- prostate cancer is a malignant neoplasm that arises in or from prostate tissue
- ovarian cancer is a malignant neoplasm that arises in or from ovarian tissue
- colon cancer is a malignant neoplasm that arises in or from colon tissue
- lung cancer is a malignant neoplasm that arises in the lungs.
- Residual cancer is cancer that remains in a subject after any form of treatment given to the subject to reduce or eradicate the cancer.
- Metastatic cancer is a cancer at one or more sites in the body other than the site of origin of the original (primary) cancer from which the metastatic cancer is derived. Cancer includes, but is not limited to, sarcomas and carcinomas. Prostate cancer is a malignant tumor, generally of glandular origin, of the prostate. Prostate cancers include adenocarcinomas and small cell carcinomas.
- cDNA complementary DNA: A piece of DNA lacking internal, non-coding segments (introns) and regulatory sequences that determine transcription. cDNA is synthesized in the laboratory by reverse transcription from messenger RNA extracted from cells.
- Chemotherapeutic agents Any chemical agent with therapeutic usefulness in the treatment of diseases characterized by abnormal cell growth. Such diseases include tumors, neoplasms, and cancer as well as diseases characterized by hyperplastic growth such as psoriasis.
- a chemotherapeutic agent is an agent of use in treating breast and/or prostate cancer.
- a chemotherapeutic agent is radioactive compound.
- a chemotherapeutic agent of use e.g. see Slapak and Kufe, Principles of Cancer Therapy , Chapter 86 in Harrison's Principles of Internal Medicine, 14th edition, Perry et al., Chemotherapy , Ch.
- Combination chemotherapy is the administration of more than one agent to treat cancer, such as the administration of a non-pox non-yeast vector encoding Brachyury in combination with a radioactive or chemical compound to a subject.
- Constant amino acid substitutions are those substitutions that do not substantially affect or decrease an activity or antigenicity of an antigenic epitope of Brachyury. Specific, non-limiting examples of a conservative substitution include the following examples:
- conservative variant also includes the use of a substituted amino acid in place of an unsubstituted parent amino acid, provided that antibodies raised to the substituted polypeptide also immunoreact with the unsubstituted polypeptide, and/or that the substituted polypeptide retains the function of the unstubstituted polypeptide.
- Non-conservative substitutions are those that reduce an activity or antigenicity.
- CD4 Cluster of differentiation factor 4, a T cell surface protein that mediates interaction with the MHC Class II molecule. CD4 also serves as the primary receptor site for HIV on T cells during HIV infection. Cells that express CD4 are often helper T cells.
- CD8 Cluster of differentiation factor 8, a T cell surface protein that mediates interaction with the MHC Class I molecule. Cells that express CD8 are often cytotoxic T cells.
- a polypeptide or protein that consists essentially of a specified amino acid sequence if it does not include any additional amino acid residues.
- the polypeptide (or protein) can include additional non-peptide components, such as labels (for example, fluorescent, radioactive, or solid particle labels), sugars or lipids.
- additional non-peptide components such as lipids, sugars or labels.
- Costimulatory molecule Although engagement of the TCR with peptide-MHC delivers one signal to the T cell, this signal alone can be insufficient to activate the T cell. Costimulatory molecules are molecules that, when bound to their ligand, deliver a second signal required for the T cell to become activated.
- the most well-known costimulatory molecule on the T cell is CD28, which binds to either B7-1 (also called CD80) or B7-2 (also known as CD86).
- An additional costimulatory molecule is B7-3.
- Accessory molecules that also provide a second signal for the activation of T cells include intracellular adhesion molecule (ICAM-1 and ICAM-2), leukocyte function associated antigen (LFA-1, LFA-2 and LFA-3). Integrins and tumor necrosis factor (TNF) superfamily members can also serve as co-stimulatory molecules.
- ICAM-1 and ICAM-2 intracellular adhesion molecule
- LFA-1, LFA-2 and LFA-3 leukocyte function associated antigen
- Degenerate variant A polynucleotide encoding an epitope of Brachyury that includes a sequence that is degenerate as a result of the genetic code. There are 20 natural amino acids, most of which are specified by more than one codon. Therefore, all degenerate nucleotide sequences are included in this disclosure as long as the amino acid sequence of the Brachyury protein encoded by the nucleotide sequence is unchanged.
- Dendritic cell are the principle antigen presenting cells (APCs) involved in primary immune responses. Dendritic cells include plasmacytoid dendritic cells and myeloid dendritic cells. Their major function is to obtain antigen in tissues, migrate to lymphoid organs and present the antigen in order to activate T cells. Immature dendritic cells originate in the bone marrow and reside in the periphery as immature cells.
- Diagnostic Identifying the presence or nature of a pathologic condition, such as, but not limited to, a cancer, such as small intestine, stomach, kidney, bladder, uterus, ovary, testes, lung, colon or prostate cancer. Diagnostic methods differ in their sensitivity and specificity.
- the “sensitivity” of a diagnostic assay is the percentage of diseased individuals who test positive (percent of true positives).
- the “specificity” of a diagnostic assay is 1 minus the false positive rate, where the false positive rate is defined as the proportion of those without the disease who test positive. While a particular diagnostic method may not provide a definitive diagnosis of a condition, it suffices if the method provides a positive indication that aids in diagnosis.
- “Prognostic” means predicting the probability of development (for example, severity) of a pathologic condition, such as prostate cancer, or metastasis.
- Epithelial-to-Mesenchymal Transition The epithelium is the covering of internal and external surfaces of the body, including the lining of vessels and other small cavities, that consists of cells joined by biological cementing substances. Generally, fully differentiated epithelial cells express proteins characteristic of a differentiated phenotype, such as insulin, and have a limited capacity to proliferate.
- the mesenchyme is the meshwork of loosely organized embryonic connective tissue in the mesoderm from which are formed the connective tissues of the body, along with the blood vessels and lymphatic vessels. Vimentin is one marker of mesenchymal cells. Mesenchymal cells generally have a greater capacity to proliferate in vitro than epithelial cells and are not fully differentiated.
- An “epithelial-to-mesenchymal” transition is a biological process wherein a cell, or a population of cells, from an epithelial phenotype convert to a less differentiated mesenchymal phenotype.
- a “mesenchymal-to-epithelial” transition is a biological process wherein a cell, or a population of cells, convert from a less differentiated mesenchymal phenotype to a more differentiated epithelial phenotype.
- Epitope An antigenic determinant. These are particular chemical groups or peptide sequences on a molecule that are antigenic (that elicit a specific immune response). An antibody specifically binds a particular antigenic epitope on a polypeptide. Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents. An epitope typically includes at least 3, and more usually, at least 5, about 9, or 8 to 10 amino acids, and generally not more than 20 amino acids, in a unique spatial conformation.
- an epitope binds an MHC molecule, such as an HLA molecule or a DR molecule. These molecules bind polypeptides having the correct anchor amino acids separated by about eight to about ten amino acids, such as nine amino acids.
- Estrogen Receptor A receptor that is activated by the hormone 17 ⁇ -estradiol (estrogen). The main function of the estrogen receptor is as a DNA binding transcription factor that regulates gene expression. Estrogen receptors are over-expressed in around 70% of breast cancer cases, referred to as “ER positive” or “ER + .” Therapy for ER + breast cancer involves selective estrogen receptor modulators (SERMS) which behave as ER antagonists in breast tissue or aromatase inhibitors. ER status is also used to determine sensitivity of breast cancer lesions to tamoxifen and aromatase inhibitors.
- SERMS selective estrogen receptor modulators
- Expression Control Sequences Nucleic acid sequences that regulate the expression of a heterologous nucleic acid sequence to which they are operatively linked. Expression control sequences are operatively linked to a nucleic acid sequence when the expression control sequences control and regulate the transcription and, as appropriate, translation of the nucleic acid sequence.
- expression control sequences can include appropriate promoters, enhancers, transcription terminators, a start codon (i.e., ATG) in front of a protein-encoding gene, splicing signal for introns, maintenance of the correct reading frame of that gene to permit proper translation of mRNA, and stop codons.
- control sequences is intended to include, at a minimum, components whose presence can influence expression, and can also include additional components whose presence is advantageous, for example, leader sequences and fusion partner sequences. Expression control sequences can include a promoter.
- a promoter is a minimal sequence sufficient to direct transcription. Also included are those promoter elements which are sufficient to render promoter-dependent gene expression controllable for cell-type specific, tissue-specific, or inducible by external signals or agents; such elements may be located in the 5′ or 3′ regions of the gene. Both constitutive and inducible promoters are included (see e.g., Bitter et al., Methods in Enzymology 153:516-544, 1987). For example, when cloning in bacterial systems, inducible promoters such as pL of bacteriophage lambda, plac, ptrp, ptac (ptrp-lac hybrid promoter) and the like can be used.
- promoters derived from the genome of mammalian cells such as the metallothionein promoter
- mammalian viruses such as the retrovirus long terminal repeat; the adenovirus late promoter; the vaccinia virus 7.5K promoter
- Promoters are also disclosed herein that are effective when included in a poxviral vector. Promoters produced by recombinant DNA or synthetic techniques can also be used to provide for transcription of the nucleic acid sequences.
- HER2 Human Epidermal growth factor Receptor 2 (Her2) is also known as Her 2/neu (or ErbB-2, ERBB2). It is a member of the ErbB protein family (also known as the epidermal growth factor receptor family). HER2 has also been designated as CD340 (cluster of differentiation 340) and p185. HER2 is notable for its role in the pathogenesis of breast cancer and as a target of treatment. It is a cell membrane surface-bound receptor tyrosine kinase and is normally involved in the signal transduction pathways leading to cell growth and differentiation.
- breast cancers Approximately 15-20 percent have an amplification of the HER2 gene or overexpression of its protein product. Overexpression of this receptor in breast cancer has been associated with increased disease recurrence and worse prognosis. Because of its prognostic role, breast tumors are routinely checked for overexpression of HER2. Overexpression also occurs in other cancer such as ovarian cancer, stomach cancer, and biologically aggressive forms of uterine cancer, such as uterine serous endometrial carcinoma.
- Heterologous Originating from separate genetic sources or species.
- a polypeptide that is heterologous to Brachyury originates from a nucleic acid that does not encode Brachyury.
- a heterologous amino acid sequence includes a 3-galactosidase, a maltose binding protein, and albumin, hepatitis B surface antigen, or an immunoglobulin amino acid sequence.
- an antibody that specifically binds to a protein of interest, such as Brachyury will not specifically bind to a heterologous protein.
- Host cells Cells in which a vector can be propagated and its DNA expressed.
- the cell may be prokaryotic or eukaryotic.
- the cell can be mammalian, such as a human cell.
- the term also includes any progeny of the subject host cell. It is understood that all progeny may not be identical to the parental cell since there may be mutations that occur during replication. However, such progeny are included when the term “host cell” is used.
- Immune response A response of a cell of the immune system, such as a B cell, T cell, or monocyte, to a stimulus.
- the response is specific for a particular antigen (an “antigen-specific response”).
- an immune response is a T cell response, such as a CD4+ response or a CD8+ response.
- the response is a B cell response, and results in the production of specific antibodies.
- Immunogenic polypeptide and Immnogenic Protein A protein or peptide which comprises an allele-specific motif or other sequence such that the peptide will bind an MHC molecule and induce a T cell response, or a B cell response (e.g. antibody production) against the antigen.
- Immunogenic peptides are generally 7 to 20 amino acids in length, such as 9 to 12 amino acids in length.
- an immunogenic polypeptide includes an allele-specific motif or other sequence such that the peptide will bind an MHC molecule and induce a T cell response against the antigen (protein) from which the immunogenic polypeptide is derived.
- immunogenic peptides are identified using sequence motifs or other methods, such as neural net or polynomial determinations, known in the art. Typically, algorithms are used to determine the “binding threshold” of peptides to select those with scores that give them a high probability of binding at a certain affinity and will be immunogenic.
- the algorithms are based either on the effects on MHC binding of a particular amino acid at a particular position, the effects on antibody binding of a particular amino acid at a particular position, or the effects on binding of a particular substitution in a motif-containing peptide.
- a “conserved residue” is one which appears in a significantly higher frequency than would be expected by random distribution at a particular position in a peptide.
- a conserved residue is one where the MHC structure may provide a contact point with the immunogenic peptide.
- an immunogenic “Brachyury polypeptide” is a series of contiguous amino acid residues from the Brachyury protein generally between 7 and 20 amino acids in length, such as about 8 to 11 residues in length. Specific immunogenic Brachyury polypeptides are 9 or 10 amino acid residues in length, or at most 12 amino acids in length.
- Immunogenic peptides and proteins can also be identified by measuring their binding to a specific MHC protein (Class I or Class II) and by their ability to stimulate CD4 and/or CD8 when presented in the context of the MHC protein.
- MHC protein Class I or Class II
- the characteristics of immunogenic polypeptides are disclosed, for example, in PCT Publication No. WO 00/12706, which is incorporated herein by reference.
- an immunogenic Brachyury protein includes a number of immunogenic polypeptides, and can be used to induce an immune response in a subject, such as a CD4+ T cell response.
- an immunogenic Brachyury protein when bound to a Major Histocompatibility Complex Class II molecule, activates CD4+ T cells against cells expressing wild-type Brachyury protein, and/or when bound to a Major Histocompatibility Complex Class I molecule, activates cytotoxic T lymphocytes (CTLs) against cells expressing wild-type Brachyury protein. Induction of CTLs using synthetic peptides and CTL cytotoxicity assays are known in the art, see U.S. Pat. No. 5,662,907, which is incorporated herein by reference.
- Immunogenic composition A composition, such as a composition comprising a Brachyury protein or a nucleic acid encoding the Brachyury protein, that induces a measurable T cell response against cells expressing Brachyury protein, or induces a measurable B cell response (such as production of antibodies that specifically bind Brachyury) against a Brachyury protein.
- the immunogenic composition can consist of the isolated nucleic acid, vector including the nucleic acid/or immunogenic protein.
- the immunogenic composition will typically comprise the nucleic acid, vector including the nucleic acid, and or immunogenic protein, in pharmaceutically acceptable carriers, and/or other agents.
- An immunogenic composition can optionally include an adjuvant, a costimulatory molecule, or a nucleic acid encoding a costimulatory molecule.
- Immunostimulatory molecule Molecules that stimulate the cells of the immune system including costimulatory molecules, cytokines and immunostimulatory nucleic acids, such as those that include a CpG motif.
- Inhibiting or treating a disease refers to inhibiting the full development of a disease.
- inhibiting a disease refers to lessening symptoms of a cancer, such as preventing the development of paraneoplastic syndrome in a person who is known to have a cancer, or lessening a sign or symptom of the cancer or reducing cancer volume.
- Treatment refers to a therapeutic intervention that ameliorates a sign or symptom of a disease or pathological condition related to the disease, such as the cancer.
- Isolated An “isolated” biological component (such as a nucleic acid or protein or organelle) has been substantially separated or purified away from other biological components in the cell of the organism in which the component naturally occurs, i.e., other chromosomal and extra-chromosomal DNA and RNA, proteins and organelles.
- Nucleic acids and proteins that have been “isolated” include nucleic acids and proteins purified by standard purification methods. The term also embraces nucleic acids and proteins prepared by recombinant expression in a host cell as well as chemically synthesized nucleic acids.
- Label A detectable compound or composition that is conjugated directly or indirectly to another molecule to facilitate detection of that molecule.
- Specific, non-limiting examples of labels include fluorescent tags, enzymatic linkages, and radioactive isotopes.
- Lentiviral vector Lentiviruses are a subclass of Retroviruses. Lentiviral vectors can integrate into the genome of non-dividing cells. This feature of Lentiviruses is unique, as other Retroviruses can infect only dividing cells.
- the viral genome in the form of RNA is reverse-transcribed when the virus enters the cell to produce DNA, which is then inserted into the genome at a random position by the viral integrase enzyme.
- the vector now called a provirus, remains in the genome and is passed on to the progeny of the cell when it divides.
- Lentiviral vectors include HIV-1, HIV-2, SIV (simian immunodeficiency virus), EIAV (equine infectious anaemia virus), FIV (feline immunodeficiency virus), CAEV (Caprine arthritis encephalitis virus), and VMV (Visna/maedi virus) vectors.
- Lentiviral vectors also encompass chimeric lentiviruses derived from at least two different lentiviruses.
- Linker sequence is an amino acid sequence that covalently links two polypeptide domains.
- Linker sequences can be included in the between the Brachyury proteins disclosed herein to provide rotational freedom to the linked polypeptide domains.
- linker sequences can be provided between them, so that the proteins comprises Brachyury protein-linker-Brachyury protein.
- Linker sequences which are generally between 2 and 25 amino acids in length, are well known in the art and include, but are not limited to, four glycines and a serine spacer described by Chaudhary et al., Nature 339:394-397, 1989.
- Listeria A Gram-positive bacilli.
- the genus Listeria currently contains seven species: L. grayi. L. innocua, L. ivanovii, L. monocytogenes, L. murrayi, L. seeligeri , and L. welshimeri.
- L. monocytogenes is an intracellular bacterium that has been used as a vector to deliver genes in vitro.
- Lymphocytes A type of white blood cell that is involved in the immune defenses of the body. There are two main types of lymphocytes: B cells and T cells.
- MHC Major Histocompatibility Complex
- Mammal This term includes both human and non-human mammals. Similarly, the term “subject” includes both human and veterinary subjects.
- Neoplasm An abnormal cellular proliferation, which includes benign and malignant tumors, as well as other proliferative disorders.
- Oligonucleotide A linear polynucleotide sequence of up to about 100 nucleotide bases in length.
- ORF Open reading frame
- a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence.
- a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence, such as a sequence that encodes a Brachyury protein.
- operably linked DNA sequences are contiguous and, where necessary to join two protein-coding regions, in the same reading frame.
- Brachyury proteins include synthetic embodiments of peptides described herein.
- analogs non-peptide organic molecules
- derivatives chemically functionalized peptide molecules obtained starting with the disclosed peptide sequences
- variants homologs
- Each protein or polypeptide of this disclosure is comprised of a sequence of amino acids, which may be either L- and/or D-amino acids, naturally occurring and otherwise.
- Protein and polypeptides can be modified by a variety of chemical techniques to produce derivatives having essentially the same activity as the unmodified peptides, and optionally having other desirable properties.
- carboxylic acid groups of the protein can be provided in the form of a salt of a pharmaceutically-acceptable cation or esterified to form a C 1 -C 16 ester, or converted to an amide of formula NR 1 R 2 wherein R 1 and R 2 are each independently H or C 1 -C 16 alkyl, or combined to form a heterocyclic ring, such as a 5- or 6-membered ring.
- Amino groups of the peptide can be in the form of a pharmaceutically-acceptable acid addition salt, such as the HCl, HBr, acetic, benzoic, toluene sulfonic, maleic, tartaric and other organic salts, or can be modified to C 1 -C 16 alkyl or dialkyl amino or further converted to an amide.
- a pharmaceutically-acceptable acid addition salt such as the HCl, HBr, acetic, benzoic, toluene sulfonic, maleic, tartaric and other organic salts
- Hydroxyl groups of the peptide side chains may be converted to C 1 -C 16 alkoxy or to a C 1 -C 16 ester using well-recognized techniques.
- Phenyl and phenolic rings of the peptide side chains may be substituted with one or more halogen atoms, such as fluorine, chlorine, bromine or iodine, or with C 1 -C 16 alkyl, C 1 -C 16 alkoxy, carboxylic acids and esters thereof, or amides of such carboxylic acids.
- Methylene groups of the peptide side chains can be extended to homologous C 2 -C 4 alkylenes.
- Thiols can be protected with any one of a number of well-recognized protecting groups, such as acetamide groups.
- protecting groups such as acetamide groups.
- Peptidomimetic and organomimetic embodiments are envisioned, whereby the three-dimensional arrangement of the chemical constituents of such peptido- and organomimetics mimic the three-dimensional arrangement of the peptide backbone and component amino acid side chains, resulting in such peptido- and organomimetics of a Brachyury protein having measurable or enhanced ability to generate an immune response.
- a pharmacophore is an idealized three-dimensional definition of the structural requirements for biological activity.
- Peptido- and organomimetics can be designed to fit each pharmacophore with current computer modeling software (using computer assisted drug design or CADD).
- compositions and formulations suitable for pharmaceutical delivery of the fusion proteins herein disclosed are conventional. Remington's Pharmaceutical Sciences , by E. W. Martin, Mack Publishing Co., Easton, Pa., 15th Edition (1975), describes compositions and formulations suitable for pharmaceutical delivery of the fusion proteins herein disclosed.
- parenteral formulations usually comprise injectable fluids that include pharmaceutically and physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like as a vehicle.
- pharmaceutically and physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like as a vehicle.
- physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like
- solid compositions such as powder, pill, tablet, or capsule forms
- conventional non-toxic solid carriers can include, for example, pharmaceutical grades of mannitol, lactose, starch, or magnesium stearate.
- compositions to be administered can contain minor amounts of non-toxic auxiliary substances, such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like, for example sodium acetate or sorbitan monolaurate.
- non-toxic auxiliary substances such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like, for example sodium acetate or sorbitan monolaurate.
- a “therapeutically effective amount” is a quantity of a composition or a cell to achieve a desired effect in a subject being treated. For instance, this can be the amount of Brachyury protein or a vector encoding a Brachyury protein necessary to induce an immune response, inhibit cancer growth, reduce cancer volume, prevent cancer, or to measurably alter outward symptoms of the cancer.
- a dosage When administered to a subject, a dosage will generally be used that will achieve target tissue concentrations (for example, in lymphocytes) that has been shown to achieve an in vitro effect.
- Plasmid A DNA molecule that is separate from, and can replicate independently of, the chromosomal DNA. They are double-stranded and, in many cases, circular. Generally, a gene to be replicated is inserted into copies of a plasmid containing genes that make cells resistant to particular antibiotics and a multiple cloning site (MCS, or polylinker), which is a short region containing several commonly used restriction sites allowing the easy insertion of DNA fragments at this location.
- MCS multiple cloning site
- Poliovirus A human enterovirus and member of the family of Picornaviridae; the wild-type poliovirus causes poliomyelitis. Poliovirus is composed of an RNA genome and a protein capsid. The wild-type genome is a single-stranded positive-sense RNA genome that is about 7500 nucleotides long. The viral particle is about 30 nanometres in diameter with icosahedral symmetry.
- Polynucleotide refers to a polymeric form of nucleotide at least 10 bases in length.
- a recombinant polynucleotide includes a polynucleotide that is not immediately contiguous with both of the coding sequences with which it is immediately contiguous (one on the 5′ end and one on the 3′ end) in the naturally occurring genome of the organism from which it is derived.
- the term therefore includes, for example, a recombinant DNA which is incorporated into a vector; into an autonomously replicating plasmid or virus; or into the genomic DNA of a prokaryote or eukaryote, or which exists as a separate molecule (e.g., a cDNA) independent of other sequences.
- the nucleotides can be ribonucleotides, deoxyribonucleotides, or modified forms of either nucleotide.
- the term includes single- and double-stranded forms of DNA.
- Polypeptide A chain of amino acids, generally greater than eight amino acids in length, such as greater than fifteen amino acids in length, which can be post-translationally modified (e.g., glycosylation or phosphorylation) that is not the complete wild-type protein.
- a polypeptide can be at least 15, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 200 amino acids in length.
- a polypeptide can be, for example, 20-300, 30-300, 40-300, 50-300, 60-300, 70-300, 80-300, 90-300, 100-300, or 200-300 amino acids in length.
- a polypeptide is 15 to 10-, 20-100, 25-100, 30-100, 35-100, 40-100, 45-100, 50-100, 55-100, 60-100, 65-100, 70-100, 75-100, 80-100, 85-100, 90-100 or 95-100 amino acids in length. In further embodiments a polypeptide is up to 433, 434 or 435 amino acids in length.
- Protein A chain of amino acids, generally greater than 100 amino acids in length, that has a specific function in a cell and is a complete wild-type protein or the complete wild type protein without the N-terminal methionine.
- a protein can be post-translationally modified.
- the protein is a Brachyury protein.
- Measles virus A negative strand RNA virus belonging the Parmyoviridiae family that causes measles. Heterologous genes can be inserted into the viral genome. The non segmented genome of measles virus has an anti-message polarity which results in a genomic RNA which, when purified, is not translated either in vivo or in vitro and is not infectious.
- Poxvirus Four genera of poxviruses infect humans: orthopox, parapox, yatapox, molluscipox.
- Orthopox includes smallpox virus (variola), vaccinia virus, cowpox virus, and monkeypox virus.
- Parapox includes the orf virus, pseudocowpox, and bovine papular stomatitis virus.
- Molluscipox includes molluscum contagiosum virus (MCV).
- Poxviridae viral particles (virions) are generally enveloped (external enveloped virion—EEV), though the intracellular mature virion (IMV) form of the virus, which contains different envelope, is also infectious.
- Vaccinia virus is used as an effective tool for heterologous protein expression.
- Vaccinia virus enters cells mainly by cell fusion. This virus contains three classes of genes, early, intermediate and late, that are transcribed by viral RNA polymerase and associated transcription factors.
- Vaccinia virus replicates its genome in cytoplasm of the infected cells and after late gene expression virion morphogenesis produces intracellular mature virion (IMV) that contains envelope, although the origin of the envelope membrane is still unknown. IMV is transported to Golgi, wherein the intracellular enveloped virus (IEV) is formed.
- IMV intracellular mature virion
- IEV transports along microtubules to reach cell periphery and fuse with plasma membrane to become cell-associated enveloped virus (CEV) that triggers actin tails on cell surfaces or forms the extracellular enveloped virion (EEV), which is believed to be important for long range dissemination within the host organism.
- CEV cell-associated enveloped virus
- EEV extracellular enveloped virion
- non-poxviral vector is a vector that is not included in the four genera of poxviruses.
- Progesterone receptor A receptor, also known as NR3C3 (nuclear receptor subfamily 3, group C, member 3), that is a steroid receptor that specifically binds progesterone.
- the progesterone receptor is not expressed on triple negative basal breast cancer cells.
- a probe comprises an isolated nucleic acid attached to a detectable label or reporter molecule.
- Primers are short nucleic acids, preferably DNA oligonucleotides, of about 15 nucleotides or more in length. Primers may be annealed to a complementary target DNA strand by nucleic acid hybridization to form a hybrid between the primer and the target DNA strand, and then extended along the target DNA strand by a DNA polymerase enzyme. Primer pairs can be used for amplification of a nucleic acid sequence, for example by polymerase chain reaction (PCR) or other nucleic-acid amplification methods known in the art.
- PCR polymerase chain reaction
- a primer comprising 20 consecutive nucleotides will anneal to a target with a higher specificity than a corresponding primer of only 15 nucleotides.
- probes and primers can be selected that comprise about 20, 25, 30, 35, 40, 50 or more consecutive nucleotides.
- Brachyury proteins and nucleic acids as disclosed herein can be purified (and/or synthesized) by any of the means known in the art (see, e.g., Guide to Protein Purification , ed. Guide to Protein Purification , ed. Manual Press, San Diego, 1990; and Scopes, Protein Purification: Principles and Practice , Springer Verlag, New York, 1982).
- Substantial purification denotes purification from other proteins, nucleic acids, or cellular components.
- the term purified does not require absolute purity; rather, it is intended as a relative term.
- a substantially purified protein is at least about 60%, 70%, 80%, 90%, 95%, 98% or 99% pure.
- a substantially purified protein is at least 90% free of other proteins or cellular components.
- a nucleic acid or cell preparation is purified such that the nucleic acid or cell represents at least about 60% (such as, but not limited to, 70%, 80%, 90%, 95%, 98% or 99%) of the total nucleic acid or cell content of the preparation, respectively.
- a substantially purified nucleic acid is at least 90% free of other nucleic acids or cellular components.
- a recombinant nucleic acid is one that has a sequence that is not naturally occurring or has a sequence that is made by an artificial combination of two otherwise separated segments of sequence. This artificial combination is often accomplished by chemical synthesis or, more commonly, by the artificial manipulation of isolated segments of nucleic acids, e.g., by genetic engineering techniques.
- Replication defective A viral vector that cannot further replicate and package its genomes.
- a heterologous in the vector is expressed in the subject's cells, however, due to the fact that the patient's cells lack essential genes. Examples are the rev and cap genes for AAV, or gag, pol and env for a lentivirus. Generally, the genes necessary to replicate and package are not present, such that and wild-type virus cannot be formed in the subject's cells.
- Salmonella A genus of rod-shaped, Gram-negative, non-spore-forming, predominantly motile enterobacteria with diameters around 0.7 to 1.5 ⁇ m, lengths from 2 to 5 ⁇ m, and flagella which grade in all directions (i.e. peritrichous). They are chemoorganotrophs, obtaining their energy from oxidation and reduction reactions using organic sources, and are facultative anaerobes. Salmonella can be used as delivery vector for therapeutic proteins, by including plasmids, such as those with truncated tetA genes in the host cell. Attenuated S. typhimirium can be transformed with DNA plasmids, such as, but not limited to, pIRES (Invitrogen) and used as a carrier for delivery of polypeptides and proteins.
- pIRES Invitrogen
- nucleic acid hybridization reactions the conditions used to achieve a particular level of stringency will vary, depending on the nature of the nucleic acids being hybridized. For example, the length, degree of complementarity, nucleotide sequence composition (for example, GC v. AT content), and nucleic acid type (for example, RNA versus DNA) of the hybridizing regions of the nucleic acids can be considered in selecting hybridization conditions. An additional consideration is whether one of the nucleic acids is immobilized, for example, on a filter.
- a specific example of progressively higher stringency conditions is as follows: 2 ⁇ SSC/0.1% SDS at about room temperature (hybridization conditions); 0.2 ⁇ SSC/0.1%/SDS at about room temperature (low stringency conditions); 0.2 ⁇ SSC/0.1% SDS at about 42° C. (moderate stringency conditions); and 0.1 ⁇ SSC at about 68° C. (high stringency conditions).
- Hybridization conditions 2 ⁇ SSC/0.1% SDS at about room temperature
- low stringency conditions low stringency conditions
- 0.2 ⁇ SSC/0.1% SDS at about 42° C. moderate stringency conditions
- 0.1 ⁇ SSC at about 68° C. high stringency conditions.
- One of skill in the art can readily determine variations on these conditions (e.g., Molecular Cloning: A Laboratory Manual, 2nd ed., vol. 1-3, ed. Sambrook et al., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989).
- Washing can be carried out using only one of these conditions, e.g., high stringency conditions, or each of the conditions can be used, e.g., for 10-15 minutes each, in the order listed above, repeating any or all of the steps listed.
- optimal conditions will vary, depending on the particular hybridization reaction involved, and can be determined empirically.
- Sequence identity The similarity between amino acid sequences is expressed in terms of the similarity between the sequences, otherwise referred to as sequence identity. Sequence identity is frequently measured in terms of percentage identity (or similarity or homology); the higher the percentage, the more similar the two sequences are. Homologs or variants of a Brachyury protein will possess a relatively high degree of sequence identity when aligned using standard methods.
- NCBI Basic Local Alignment Search Tool (BLAST) (Altschul et al., J. Mol. Biol. 215:403, 1990) is available from several sources, including the National Center for Biotechnology Information (NCBI, Bethesda, Md.) and on the internet, for use in connection with the sequence analysis programs blastp, blastn, blastx, tblastn and tblastx. A description of how to determine sequence identity using this program is available on the NCBI website on the internet.
- Homologs and variants of a Brachyury protein are typically characterized by possession of at least 75%, for example at least 80%, sequence identity, or at least 90% i sequence identity, counted over the full length alignment with the amino acid sequence of Brachyury using the NCBI Blast 2.0, gapped blastp set to default parameters.
- the Blast 2 sequences function is employed using the default BLOSUM62 matrix set to default parameters, (gap existence cost of 11, and a per residue gap cost of 1).
- the alignment should be performed using the Blast 2 sequences function, employing the PAM30 matrix set to default parameters (open gap 9, extension gap 1 penalties).
- Proteins with even greater similarity to the reference sequences will show increasing percentage identities when assessed by this method, such as at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99% sequence identity.
- homologs and variants When less than the entire sequence is being compared for sequence identity, homologs and variants will typically possess at least 80% sequence identity over short windows of 10-20 amino acids, and can possess sequence identities of at least 85% or at least 90% or 95% depending on their similarity to the reference sequence. Methods for determining sequence identity over such short windows are available at the NCBI website on the internet. One of skill in the art will appreciate that these sequence identity ranges are provided for guidance only; it is entirely possible that strongly significant homologs could be obtained that fall outside of the ranges provided.
- Specific binding agent An agent that binds substantially only to a defined target.
- a Brachyury specific binding agent is an agent that binds substantially to a Brachyury protein.
- the specific binding agent is a monoclonal or polyclonal antibody that specifically binds Brachyury protein.
- T Cell A white blood cell critical to the immune response.
- T cells include, but are not limited to, CD4+ T cells and CD8 + T cells.
- a CD4+ T lymphocyte is an immune cell that carries a marker on its surface known as “cluster of differentiation 4” (CD4) and is MHC Class II restricted. These cells, often called helper T cells, help orchestrate the immune response, including antibody responses as well as killer T cell responses.
- CD8 + T cells carry the “cluster of differentiation 8” (CD8) marker and are MHC Class I restricted.
- a CD8 T cell is a cytotoxic T lymphocyte.
- a CD8 cell is a suppressor T cell.
- Therapeutically active protein An agent composed of amino acids, such as a Brachyury protein, that causes induction of an immune response, as measured by clinical response (for example increase in a population of immune cells, increased cytolytic activity against cells that express Brachyury, or measurable reduction of tumor burden).
- Therapeutically active molecules can also be made from nucleic acids. Examples of a nucleic acid based therapeutically active molecule is a nucleic acid sequence that encodes a Brachyury protein, wherein the nucleic acid sequence is operably linked to a control element such as a promoter.
- a therapeutically effective amount of a composition such as a Brachyury protein or a vector encoding the Brachyury protein, is an amount used to generate an immune response, or to treat or prevent cancer in a subject.
- treatment refers to a therapeutic intervention that ameliorates a sign or symptom of a cancer, or a reduction in tumor burden.
- transduced A transduced cell is a cell into which has been introduced a nucleic acid molecule by molecular biology techniques.
- transduction encompasses all techniques by which a nucleic acid molecule might be introduced into such a cell, including transfection with viral vectors, transformation with plasmid vectors, and introduction of naked DNA by electroporation, lipofection, and particle gun acceleration.
- Vector A nucleic acid molecule as introduced into a host cell, thereby producing a transformed host cell.
- a vector may include nucleic acid sequences that permit it to replicate in a host cell, such as an origin of replication.
- a vector may also include one or more selectable marker gene and other genetic elements known in the art.
- Vectors include plasmid vectors, including plasmids for expression in gram negative and gram positive bacterial cell. Exemplary vectors include those for expression in E. coli and Salmonella .
- Vectors also include poxviral vectors, such as, but are not limited to, retrovirus, orthopox, avipox, fowlpox, capripox, suipox, adenoviral, herpes virus, alpha virus, baculovirus, Sindbis virus, vaccinia virus and poliovirus vectors. Vectors also include vectors for expression in yeast cells.
- Yeast Unicellular microorganisms that belong to one of three classes: Ascomycetes, Basidiomycetes and Fungi Imperfecti.
- a yeast can be a non-pathogenic strain such as Saccharomyces cerevisiae .
- Yeawst strains include Saccharomyces, Candida (which can be pathogenic), Cryptococcus, Hansemdla, Kluyveromyces, Pichia, Rhodotorula, Schizosaccharomyces and Yarrowia .
- Yeast genera include Saccharomyces, Candida, Hansenula. Pichia or Schizosaccharomyces .
- yeast strains include Saccharomyces cerevisiae, Saccharomyces carlsbergensis, Candida albicans, Candida kefvr, Candida tropicalis, Cryptococcus laurentii. Cryptococcus neoformans, Hansenula anomala, Hansenula polymorpha, Kluyveromyces fragilis, Kluyveromyces lactis, Kluyveromyces marxianus var. lactis, Pichia pastoris. Rhodotorula rubra, Schizosaccharomyces pombe , and Yarrowia lipolytica.
- Yeast vehicles include, but are not limited to, a live intact (whole) yeast microorganism (i.e., a yeast cell having all its components including a cell wall), a killed (dead) or inactivated intact yeast microorganism, or derivatives of intact yeast including: a yeast spheroplast (i.e., a yeast cell lacking a cell wall), a yeast cytoplast (i.e., a yeast cell lacking a cell wall and nucleus), a yeast ghost (i.e., a yeast cell lacking a cell wall, nucleus and cytoplasm), a subcellular yeast membrane extract or fraction thereof (also referred to as a yeast membrane particle or a subcellular yeast particle), any other yeast particle, or a yeast cell wall preparation.
- a “non-yeast vector” is a composition that does not include yeast vehicles.
- Brachyury (also known as “T-protein”) is a protein which is transcribed in the mesoderm.
- the Brachyury protein has a sequence set forth as:
- Brachyury protein is encoded by a nucleic acid having a sequence set forth as:
- Brachyury protein has an amino acid sequence at least 90% identical to SEQ ID NO: 1, for example a polypeptide that is at least or about 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%0 or 99% identical to SEQ ID NO: 1.
- Brachyury proteins are disclosed herein that can be used to induce an immune response (are immunogenic), wherein the Brachyury protein can produce a Brachyury-specific CD4+ T cell response.
- the Brachyury protein produces a Brachyury specific CD4+ T cell response and a Brachyury Specific CD8+ T cell response.
- SEQ ID NO: 1 provides an exemplary sequence for the full-length Brachyury; another full length Brachyury is this amino acid sequence with the N-terminal methionine removed.
- the Brachyury protein includes the amino acid sequence set forth as SEQ ID NO: 1, with substitutions at position 177 (Asp vs. Gly, respectively), position 368 (Thr vs. Ser, respectively) and position 409 (Asn vs. Asp, respectively).
- these sequences can be used to induce a Brachyury specific CD4+ T cell response.
- Positions 41 to 223 of the amino acid sequence set forth as SEQ ID NO: 1 represents the T-box DNA binding domain of human Brachyury, and the T-box domain in other Brachyury sequences, including Brachyury sequences from other species, can be readily identified by comparison to these sequences.
- T-box domain of a Brachyury protein can include an additional 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 or 40 consecutive amino acids of the Brachyury sequence on the N-terminal and/or the C-terminal end of the defined T-box domain (e.g., on either side of positions 41-223 of SEQ ID NO: 1).
- the Brachyury protein comprises the T-box domain of SEQ ID NO: 1 and induces a Brachyury specific CD4+ T cell response.
- the polypeptide includes the T-box DNA binding domain or a portion thereof.
- Human Brachyury has very high homology with Brachyury from other animal species and therefore, the sequences of Brachyury from other organisms can be utilized, particularly where these sequences are identical, substantially homologous, and elicit an effective immune response against the target antigen (e.g., native Brachyury expressed by a tumor cell).
- target antigen e.g., native Brachyury expressed by a tumor cell.
- murine Brachyury which was cloned by Hermann and colleagues in 1990 (Hermann et al., supra), and is approximately 85% identical to human Brachyury at the nucleotide level.
- Murine Brachyury is approximately 91% identical to human Brachyury at the amino acid level.
- human Brachyury is 99.5% identical to Brachyury from Pan troglodytes, 90.1% identical to Brachyury from Canis lupus familiaris, 88.5% identical to Brachyury from Bos Taurus, 92.2% identical to Brachyury from Rattus norvegicus , and 80.9% identical to Brachyury from Gallus gallus .
- Nucleic acids encoding these Brachyury proteins can be used in the poxviral vectors and methods disclosed herein.
- the T-box domain of these Brachyury proteins is included in the region of amino acids 1-223. These polypeptides can be used to induce a Brachyury specific CD4+ T cell response.
- Mouse and human Brachyury differ by two amino acids (at positions 26 and 96) in the T-box region.
- the murine Brachyury has the amino acid sequence set forth as:
- NM_009309 (GI: 118130357), Oct. 29, 2011, incorporated herein by reference.
- Positions 41 to 223 of SEQ ID NO:4 represent the T-box DNA binding domain of murine Brachyury. These Brachyury proteins can also be used to induce a Brachyury specific T cell response.
- the Brachyury protein includes, consists essentially of, or consists of, an amino acid sequence at least at least 90% identical to SEQ ID NO: 1, for example a polypeptide that is about 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1.
- the Brachyury proteins do not include the first amino acid of SEQ ID NO: 1 (methionine).
- the Brachyury protein includes, or consists of, amino acids 2-435 of SEQ ID NO: 1.
- the Brachyury protein includes, or consists of, the amino acid sequence set forth as SEQ ID NO:1, with substitutions at position 177 (Asp vs. Gly, respectively), position 368 (Thr vs. Ser, respectively) and position 409 (Asn vs. Asp, respectively).
- the Brachyury protein includes amino acids 1-15 of SEQ ID NO: 1. In yet another embodiment, the Brachyury protein includes, consists essentially of, or consists of, the amino acid sequence set forth as SEQ ID NO: 3.
- Brachyury polypeptides are also of use in the methods disclosed herein.
- the These Brachyury polypeptides include at least 15, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 200, or at least 300, or at least 400 amino acids of a Brachyury protein, such as 435 amino acids of a Brachyury protein.
- the Brachyury protein can include 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300 or 400 amino acids of a Brachyury protein.
- a Brachyury polypeptide is 15-400, 20-400, 30-400, 40-400, 50-400, 60-400, 70-400, 80-400, 90-400, 100-400, or 200-400 amino acids of a Brachyury protein. In other embodiments, a Brachyury polypeptide is 15-300, 20-300, 30-300, 40-300, 50-300, 60-300, 70-300, 80-300, 90-300, 100-300, or 200-300 amino acids of a Brachyury protein.
- the Brachyury polypeptide is 15 to 10-, 20-100, 25-100, 30-100, 35-100, 40-100, 45-100, 50-100, 55-100, 60-100, 65-100, 70-100, 75-100, 80-100, 85-100, 90-100 or 95-100 amino acids of any of the Brachyury proteins disclosed herein.
- the Brachyury polypeptide can be 15, 50, 100, 150, 250, 300, 350, 400, 430, 431, 432, 433 or 434 amino acids in length.
- the Brachyury polypeptide can be 15-430, 15-431, 15-432, 15-433, 15-434 or 15-435 amino acids in length.
- An exemplary polypeptide is shown in FIG. 2 .
- a Brachyury polypeptide is 15-20 amino acids in length, such as 15-17 amino acids in length, such as 15, 16, 17, 17, 19 or 20 amino acids in length and binds MHC Class II.
- the MHC Class II antigen can be encoded by a HLA-DP, HLA-DR, HLA-B, HLA-DQA1 or HLA-DQB1 allele.
- Brachyury protein can be used to induce Brachyury specific CD4+ T cells in a subject.
- the Brachyury protein, Brachyury polypeptide, polynucleotide encoding a Brachyury protein or polypeptide, or non-pox non-yeast vector include the polynucleotide induce a Brachyury specific CD8+ T cell response, or both a Brachyury specific CD4+ T cell response and a CD8+ T cell response.
- the isolated Brachyury protein or polypeptide is included in a fusion protein.
- the fusion protein can include the Brachyury protein or Brachyury polypeptide (see above) and a second heterologous moiety, such as a myc protein, an enzyme or a carrier (such as a hepatitis carrier protein or bovine serum albumin) covalently linked to the Brachyury protein or polypeptide.
- the fusion protein includes a Brachyury protein (or Brachyury polypeptide) and six sequential histidine residues, a ⁇ -galactosidase amino acid sequence, and/or an immunoglobulin amino acid sequence.
- Brachyury proteins or polypeptides that are linked to a carrier are also of use in the disclosed methods.
- a carrier is an immunogenic macromolecule to which an antigenic molecule can be bound. When bound to a carrier, the bound Brachyury protein or Brachyury polypeptide becomes more immunogenic.
- Carriers are chosen to increase the immunogenicity of the bound molecule and/or to elicit higher titers of antibodies against the carrier which are diagnostically, analytically, and/or therapeutically beneficial.
- Covalent linking of a molecule to a carrier can confer enhanced immunogenicity and T cell dependence (see Pozsgay et al., PNAS 96:5194-97, 1999; Lee et al., J. Immunol.
- Useful carriers include polymeric carriers, which can be natural (for example, polysaccharides, polypeptides or proteins from bacteria or viruses), semi-synthetic or synthetic materials containing one or more functional groups to which a reactant moiety can be attached.
- Bacterial products and viral proteins can also be used as carriers, as well as proteins from higher organisms such as keyhole limpet hemocyanin, horseshoe crab hemocyanin, edestin, mammalian serum albumins, and mammalian immunoglobulins.
- Suitable carriers include, but are not limited to, a hepatitis B small envelope protein HBsAg.
- This protein has the capacity to self-assemble into aggregates and can form viral-like particles.
- the preparation of HBsAg is well documented, see for example European Patent Application Publication No. EP-A-0 226 846, European Patent Application Publication No. EP-A-0 299 108 and PCT Publication No. WO 01/117554, and the amino acid sequence disclosed, for example, in Tiollais et al., Nature, 317: 489, 1985, and European Patent Publication No. EP-A-0 278 940, and PCT Publication No. WO 91/14703, all of which are incorporated herein by reference.
- Brachyury protein or polypeptide only the Brachyury protein or polypeptide is utilized.
- a second heterologous moiety is non-covalently linked to the Brachyury protein or polypeptide.
- Nucleic acids that encode a Brachyury protein and/or polypeptide can readily be produced. These nucleic acids include DNA, cDNA and RNA sequences which encode the Brachyury polypeptide of interest. Silent mutations in the coding sequence result from the degeneracy (i.e., redundancy) of the genetic code, whereby more than one codon can encode the same amino acid residue.
- leucine can be encoded by CTT, CTC, CTA, CTG, TTA, or TTG; serine can be encoded by TCT, TCC, TCA, TCG, AGT, or AGC; asparagine can be encoded by AAT or AAC; aspartic acid can be encoded by GAT or GAC; cysteine can be encoded by TGT or TGC; alanine can be encoded by GCT, GCC, GCA, or GCG; glutamine can be encoded by CAA or CAG; tyrosine can be encoded by TAT or TAC; and isoleucine can be encoded by ATT, ATC, or ATA. Tables showing the standard genetic code can be found in various sources (e.g., L. Stryer, 1988, Biochemistry, 3.sup.rd Edition, W.H. 5 Freeman and Co., NY).
- a nucleic acid encoding a Brachyury protein can be cloned or amplified by in vitro methods, such as the polymerase chain reaction (PCR), the ligase chain reaction (LCR), the transcription-based amplification system (TAS), the self-sustained sequence replication system (3SR) and the Q ⁇ replicase amplification system (QB).
- PCR polymerase chain reaction
- LCR ligase chain reaction
- TAS transcription-based amplification system
- 3SR self-sustained sequence replication system
- QB Q ⁇ replicase amplification system
- a polynucleotide encoding the Brachyury protein can be isolated by polymerase chain reaction of cDNA using primers based on the DNA sequence of the molecule.
- a wide variety of cloning and in vitro amplification methodologies are well known to persons skilled in the art. PCR methods are described in, for example, U.S. Pat. No.
- Polynucleotides also can be isolated by screening genomic or cDNA libraries with probes selected from the sequences of the desired polynucleotide under stringent hybridization conditions.
- a polynucleotide sequence encoding a Brachyury protein or polypeptide can be operatively linked to expression control sequences.
- An expression control sequence operatively linked to a coding sequence is ligated such that expression of the coding sequence is achieved under conditions compatible with the expression control sequences.
- the expression control sequences include, but are not limited to, appropriate promoters, enhancers, transcription terminators, a start codon (i.e., ATG) in front of a protein-encoding gene, splicing signal for introns, maintenance of the correct reading frame of that gene to permit proper translation of mRNA, and stop codons.
- Suitable promoters include, but are not limited to, an SV40 early promoter, RSV promoter, adenovirus major late promoter, human CMV immediate early I promoter, poxvirus promoter, 30K promoter, I3 promoter, sE/L promoter, 7.5K promoter, 40K promoter, and C1 promoter.
- T DNA vaccines are described in U.S. Pat. Nos. 5,589,466; 5,973,972, which are each incorporated herein by reference.
- alternative methods of delivering DNA are described in U.S. Pat. Nos. 4,945,050 and 5,036,006, which are both incorporated herein by reference.
- Plasmids have been designed with a number of goals in mind, such as achieving regulated high copy number and avoiding potential causes of plasmid instability in bacteria, and providing means for plasmid selection that are compatible with human therapeutic use. Particular attention has been paid to the dual requirements of gene therapy plasmids. First, they are suitable for maintenance and fermentation in E. coli , so that large amounts of DNA can be produced and purified. Second, they are safe and suitable for use in human patients and animals. The first requirement calls for high copy number plasmids that can be selected for and stably maintained relatively easily during bacterial fermentation. The second requirement calls for attention to elements such as selectable markers and other coding sequences.
- plasmids that encode a Brachyury protein or polypeptide are composed of: (1) a high copy number replication origin, (2) a selectable marker, such as, but not limited to, the neo gene for antibiotic selection with kanamycin, (3) transcription termination sequences, and (4) a multicloning site for incorporation of various nucleic acid cassettes; and (5) a nucleic acid sequence encoding a Brachyury protein and/or a Brachyury polypeptide.
- plasmid vectors that are known in the art for inducing a nucleic acid encoding a protein. These include, but are not limited to, the vectors disclosed in U.S. Pat. Nos. 6,103,470; 7,598,364; 7,989,425; and U.S. Pat. No. 6,416,998, which are incorporated herein by reference.
- Non-poxviral non-yeast vectors can be used to express the Brachyury proteins and/or polypeptides disclosed herein. These vectors are not poxvirus vectors, and thus are not an orthopox, suipox, avipox, or capripox virus vector.
- Orthopox include vaccinia, ectromelia, and raccoon pox.
- One example of an orthopox is vaccinia.
- Avipox includes fowlpox, canary pox and pigeon pox.
- Capripox include goatpox and sheeppox.
- An example of a suipox is swinepox vector.
- pox viral vectors for expression as described for example, in U.S. Pat. No. 6,165,460, which is incorporated herein by reference.
- the vaccinia virus genome is known in the art. It is composed of a HIND F13L region, TK region, and an HA region. Recombinant vaccinia virus has been used to incorporate an exogenous gene for expression of the exogenous gene product (see, for example, Perkus et al. Science 229:981-984, 1985; Kaufman et al. Inti J. Cancer 48:900-907, 1991; Moss Science 252:1662, 1991).
- Baxby and Paoletti disclose the construction and use as a vector, of the non-replicating poxvirus, including canarypox virus, fowlpox virus and other avian species.
- Sutter and Moss Proc. Nat'l. Acad. Sci U.S.A. 89:10847-10851, 1992) and Sutter et al. ( Virology 1994) disclose the construction and use as a vector, the non-replicating recombinant Ankara virus (MVA, modified vaccinia Ankara) in the construction and use of a vector. These vectors are not used in the present methods.
- the vectors disclosed herein are also non-yeast vectors.
- the disclosed vectors are not used for expression in yeast such as S. cerevisiae or Kluyveromyces lactis .
- the disclosed vectors generally do not include all the required elements for expression in yeast.
- promoters are known to be of use in yeast expression systems such as the constitutive promoters plasma membrane H + -ATPase (PMA1), glyceraldehyde-3-phosphate dehydrogenase (GPD), phosphoglycerate kinase-1 (PGK1), alcohol dehydrogenase-1 (ADH1), and pleiotropic drug-resistant pump (PDR5).
- the promoters are not utilized in the presently disclosed vectors.
- inducible promoters such as GAL1-10 (induced by galactose), PHO5 (induced by low extracellular inorganic phosphate), and tandem heat shock HSE elements (induced by temperature elevation to 37° C.) are not used in the present vectors.
- Promoters that direct variable expression in response to a titratable inducer include the methionine-responsive MET3 and MET25 promoters and copper-dependent CUP1 promoters; these promoters are not utilized.
- the vectors do not include yeast nutritional markers (such as URA3, ADE3, HIS1, and others) for selection in yeast.
- non-pox non-yeast viral vectors can be utilized, including polyoma, SV40 (Madzak et al., 1992, J. Gen. Virol., 73:15331536), adenovirus (Berkner, 1992, Cur. Top. Microbiol. Immunol., 158:39-6; Hopkins et al., 1988, Bio Techniques, 6:616-629; Gorziglia et al., 1992, J. Virol., 66:4407-4412; Quantin et al., 1992, Proc. Nad. Acad. Sci.
- HHV human herpesvirus vectors
- retroviruses of avian Brandyopadhyay et al., 1984, Mol. Cell Biol., 4:749-754; Petropouplos et al., 1992, J. Virol., 66:3391-3397
- murine Mol. Top. Microbiol. Immunol., 158:1-24; Miller et al., 1985, Mol. Cell Biol., 5:431-437; Sorge et al., 1984, Mol.
- Baculovirus Autographa californica multinuclear polyhedrosis virus; AcMNPV
- Vectors can be obtained from commercial sources (such as PharMingen, San Diego, Calif.; Protein Sciences Corp., Meriden, Conn.; Stratagene, La Jolla, Calif.). Suitable vectors are disclosed, for example, in U.S. Published Patent Application No.
- the vectors are retrovirus vectors (for example, lentivirus vectors), measles virus vectors, alphavirus vectors, baculovirus vectors, Sindbis virus vectors, adenovirus and poliovirus vectors.
- retrovirus vectors for example, lentivirus vectors
- measles virus vectors for example, alphavirus vectors
- baculovirus vectors for example, Sindbis virus vectors
- Sindbis virus vectors Sindbis virus vectors
- adenovirus and poliovirus vectors retrovirus vectors
- These vectors include a polynucleotide that encodes a Brachyury protein or Brachyury polypeptide.
- Non-pox non-yeast vectors that encode a Brachyury protein or Brachyury polypeptide include at least one expression control element operationally linked to the nucleic acid sequence encoding the Brachyury protein or polypeptide.
- the expression control elements are inserted in the vector to control and regulate the expression of the nucleic acid sequence. Examples of expression control elements of use in these vectors includes, but is not limited to, lac system, operator and promoter regions of phage lambda, promoters derived from polyoma, adenovirus, retrovirus or SV40.
- Additional operational elements include, but are not limited to, leader sequence, termination codons, polyadenylation signals and any other sequences necessary for the appropriate transcription and subsequent translation of the nucleic acid sequence encoding the Brachyury protein or the Brachyury polypeptide in the host system.
- the expression vector can contain additional elements necessary for the transfer and subsequent replication of the expression vector containing the nucleic acid sequence in the host system. Examples of such elements include, but are not limited to, origins of replication and selectable markers. It will further be understood by one skilled in the art that such vectors can be constructed using conventional methods (Ausubel et al., (1987) in “Current Protocols in Molecular Biology,” John Wiley and Sons, New York, N.Y.) and are commercially available.
- the vector can encode one or more immunostimulatory molecules, such as IL-2, IL-6, IL-12, LFA (for example, LFA-1, LFA-2 and/or LFA-3), CD72, RANTES, G-CSF, GM-CSF, TNF- ⁇ , IFN- ⁇ , ICAM-1, B7-1, B7-2, other B7 related molecules, OX-40L or 41 BBL, or combinations of these molecules.
- immunostimulatory molecules such as IL-2, IL-6, IL-12, LFA (for example, LFA-1, LFA-2 and/or LFA-3), CD72, RANTES, G-CSF, GM-CSF, TNF- ⁇ , IFN- ⁇ , ICAM-1, B7-1, B7-2, other B7 related molecules, OX-40L or 41 BBL, or combinations of these molecules.
- immuostimulatory molecules can be used as biological adjuvants (see, for example, Salgaller et al., 1998, J. Surg. Oncol.
- the vector can encode IL-2, RANTES, GM-CSF, TNF- ⁇ , IFN- ⁇ , G-CSF, LFA-3, CD72, B7-1, B7-2, B7-1, B7-2, OX-40L, 41 BBL and/or ICAM-1.
- Basic techniques for preparing recombinant DNA viruses containing a heterologous DNA sequence encoding a Brachyury protein or Brachyury polypeptide are known in the art. Such techniques involve, for example, homologous recombination between the DNA sequences flanking the DNA sequence in a donor plasmid and homologous sequences present in a parental virus (Mackett et al., 1982 , Proc. Natl. Acad. Sci. USA 79:7415-7419).
- recombinant viral vectors can be used in delivering the gene.
- the vector can be constructed, for example, by steps known in the art, including using a unique restriction endonuclease site that is naturally present or artificially inserted in the parental viral vector to insert the heterologous DNA encoding the Brachyury protein or Brachyury polypeptide.
- a DNA donor vector contains the following elements: (i) a prokaryotic origin of replication, so that the vector may be amplified in a prokaryotic host; (ii) a gene encoding a marker which allows selection of prokaryotic host cells that contain the vector (e.g., a gene encoding antibiotic resistance); (iii) at least one DNA sequence encoding the Brachyury protein or Brachyury polypeptide located adjacent to a transcriptional promoter capable of directing the expression of the sequence; and (iv) DNA sequences homologous to the region of the parent virus genome where the foreign gene(s) will be inserted, flanking the construct of element (iii).
- Methods for constructing donor plasmids for the introduction of multiple foreign genes into viral virus are described in PCT Publication no WO 91/19803, incorporated herein by reference.
- DNA fragments for construction of the donor vector can be obtained from genomic DNA or cloned DNA fragments.
- the donor plasmids can be mono, di-, or multivalent (i.e., can contain one or more inserted foreign DNA sequences).
- the donor vector can contain an additional gene that encodes a marker that will allow identification of recombinant viruses containing inserted foreign DNA.
- marker genes can be used to permit the identification and isolation of recombinant viruses. These include genes that encode antibiotic or chemical resistance (e.g., see Spyropoulos et al., 1988, J.
- the DNA gene sequence to be inserted into the virus can be placed into a donor plasmid into which DNA homologous to a section of DNA such as that of the insertion site of the virus where the DNA is to be inserted has been inserted. Separately the DNA gene sequence to be inserted is ligated to a promoter.
- the promoter-gene linkage is positioned in the plasmid construct so that the promoter-gene linkage is flanked on both ends by DNA homologous to a DNA sequence flanking a region of viral DNA that is the desired insertion region.
- an adenoviral promoter is used.
- a lentiviral vector a lentivirus promoter is used.
- the resulting plasmid construct is then amplified by growth within E. coli bacteria and isolated.
- the isolated plasmid containing the DNA gene sequence to be inserted is transfected into a cell culture, along with the parental virus. Recombination between homologous viral DNA in the plasmid and the viral genome respectively results in a recombinant virus modified by the presence of the promoter-gene construct in its genome, at a site that does not affect virus viability.
- the DNA sequence is inserted into a region (insertion region) in the virus that does not affect virus viability of the resultant recombinant virus.
- a region insertion region
- One of skill in the art can readily identify such regions in a virus by, for example, randomly testing segments of virus DNA for regions that allow recombinant formation without seriously affecting virus viability of the recombinant.
- Homologous recombination between donor plasmid DNA and viral DNA in an infected cell can result in the formation of recombinant viruses that incorporate the desired elements.
- Appropriate host cells for in vivo recombination are generally eukaryotic cells that can be infected by the virus and transfected by the plasmid vector. Examples of such cells suitable for use with viral vectors are fibroblasts, HuTK143 (human) cells, and CV-1 and BSC-40 (both monkey kidney) cells. Infection of cells with a virus and transfection of these cells with plasmid vectors is accomplished by techniques standard in the art (see U.S. Pat. No. 4,603,112 and PCT Publication No. WO 89/03429).
- recombinant viral progeny can be identified. For example, co-integration of a gene encoding a marker or indicator gene with the foreign gene(s) of interest, as described above, can be used to identify recombinant progeny.
- an indicator gene is the E. coli lacZ gene.
- Recombinant viruses expressing beta-galactosidase can be selected using a chromogenic substrate for the enzyme (Panicali et al., 1986, Gene 47:193).
- a variety of well-known methods can be used to assay the expression of the Brachyury protein or Brachyury polypeptide encoded by the inserted DNA fragment. These methods include black plaque assay (an in situ enzyme immunoassay performed on viral plaques), Western blot analysis, radioimmunoprecipitation (RIPA), and enzyme immunoassay (EIA).
- black plaque assay an in situ enzyme immunoassay performed on viral plaques
- Western blot analysis Western blot analysis
- radioimmunoprecipitation (RIPA) radioimmunoprecipitation
- EIA enzyme immunoassay
- the recombinant vectors can comprise the virus genome or portions thereof, the nucleic acid sequence encoding the Brachyury protein or Brachyury polypeptide and a nucleic acid sequence encoding a carrier, such as, but not limited to, hepatitis B surface antigen.
- the vectors of use in the methods disclosed herein are non-yeast, non-poxviral vectors.
- Vectors that are useful include adenovirus, alphavirus, lentivirus, measles virus and poliovirus vectors.
- this disclosure is not limited to these types of non-yeast non-poxviral vectors.
- Additional vectors herpes simplex viruses, human papilloma virus, Simian immunodeficiency viruses, human T cell lymphoma virus (HTLV), human foamy virus, spumaviruses, mammalian type B retroviruses, mammalian type C retroviruses, avian type C retroviruses, mammalian type D retroviruses.
- Vectors also include Epstein-Barr virus vectors, Moloney murine leukemia virus vectors, Harvey murine sarcoma virus vectors, murine mammary tumor virus vectors, Rous sarcoma virus vectors and nonviral plasmid vectors.
- Epstein-Barr virus vectors Moloney murine leukemia virus vectors
- Harvey murine sarcoma virus vectors murine mammary tumor virus vectors
- Rous sarcoma virus vectors Rous sarcoma virus vectors and nonviral plasmid vectors.
- Compositions including these vectors are of use in inducing a CD4+ T cell response to Brachyury and for the treatment of cancer. These compositions also can be used to induce a CD8+ T cell response to Brachyury.
- Adenovirus vectors can be produced that encode a Brachyury protein or a Brachyury polypeptide and are of use in the methods disclosed herein. These vectors are of use in the methods disclosed herein, including replication competent, replication deficient, gutless forms thereof, and adeno-associated virus (AAV) vectors.
- AAV adeno-associated virus
- adenovirus vectors are known to exhibit strong expression in vitro, excellent titer, and the ability to transduce dividing and non-dividing cells in vivo (Hitt et al., Adv in Virus Res 55:479-505, 2000). When used in vivo these vectors lead to strong but transient gene expression due to immune responses elicited to the vector backbone.
- Adenoviral vectors are often constructed by insertion of a nucleic acid encoding a Brachyury protein in place of, or in the middle of, essential viral sequences such as those found at the E1 region of adenovirus (Berkner, BioTechniques, 6:616-629, 1988; Graham et al., Methods in Molecular Biology, 7:109-128, Ed: Murcy, The Human Press Inc., 1991).
- Inactivation of essential viral genes by, for example, deletion or insertion, disables the adenovirus' ability to replicate.
- the deleted genes must be provided in trans (for example, the E1A and E1B proteins in the case of an E1 delete vector).
- replication-defective adenoviruses are produced in packaging cells engineered to complement the replication-incompetent virus by expressing the subset of genetic elements deleted from their viral genome.
- Potential sites for the insertion of a nucleic acid of interest, such as a nucleic acid encoding a Brachyury protein, in recombinant adenoviral vectors include, without limitation, the E1, E2, E3 and the E4 region.
- a recombinant adenoviral vector is produced from a human adenovirus that has the E1 region deleted and replaced with a nucleic acid encoding a Brachyury protein or Brachyury polypeptide.
- the resulting viral vector, with one or more of its essential genes inactivated, is replication defective (Statford-Perricaudet et al., Human Gene Therapy, 1:241-256, 1990).
- the recombinant adenovirus vectors can include: (1) a packaging site enabling the vector to be incorporated into replication-defective Ad virions; and (2) the nucleic acid encoding the Brachyury protein or Brachyury polypeptide.
- Other elements of use for incorporation into infectious virions include the 5′ and 3′ Ad ITRs; the E2 and E3 genes can be included in the vector.
- a nucleic acid encoding a Brachyury protein or Brachyury polypeptide is inserted into adenovirus in the deleted E1A, E1B or E3 region of the virus genome.
- the adenovirus vectors do not express one or more wild-type adenovirus gene products, such as E1a, E1b, E2, E3, E4.
- virions are typically used together with packaging cell lines that complement the functions of E1, E2A, E4 and optionally the E3 gene regions (see, for example, U.S. Pat. Nos. 5,872,005, 5,994,106, 6,133,028 and 6,127,175, incorporated by reference herein in their entirety).
- Adenovirus vectors can be purified and formulated using techniques known in the art.
- packaging cell lines such as the human embryonic kidney 293 (“HEK-293” or “293”) cell line (Graham et al., J. Gen. Virol., 36:59-72, 1977) or human embryonic retinoblast (“HER-911” or “911”) cell line (Fallaux et al., Hum. Gene Ther., 7:215-222, 1996), provide in trans the missing region, such as the E1 region, so that the deleted or modified adenoviral vector can replicate in such cells.
- HEK-293 human embryonic kidney 293
- HER-911 human embryonic retinoblast
- Suitable adenoviral vectors are disclosed, for example, in U.S. Patent Publication No. 20080193484, which is incorporated herein by reference.
- Replication-defective adenovirus virions encapsulating the recombinant adenovirus vectors can be made by standard techniques known in the art using packaging cells and packaging technology. Examples of these methods can be found, for example, in U.S. Pat. No. 5,872,005, incorporated herein by reference in its entirety.
- Recombinant AAV vectors are characterized in that they are capable of directing the expression and the production of the selected transgenic products in targeted cells.
- the recombinant vectors comprise at least all of the sequences of AAV essential for encapsidation and the physical structures for infection of target cells.
- Recombinant AAV (rAAV) virions can be constructed such that they include, as operatively linked components in the direction of transcription, control sequences including transcriptional initiation and termination sequences, and the nucleic acid encoding the Brachyury protein or Brachyury polypeptide. These components are bounded on the 5′ and 3′ end by functional AAV inverted terminal repeat (ITR) sequences.
- ITR inverted terminal repeat
- AAV ITRs for use in the vectors need not have a wild-type nucleotide sequence, and can be altered by the insertion, deletion or substitution of nucleotides, or the AAV ITRs can be derived from any of several AAV serotypes, provided they are functional.
- An AAV vector is a vector derived from an adeno-associated virus serotype, including without limitation, AAV-1, AAV-2, AAV-3, AAV-4, AAV-5, AAV-6, AAV-7, AAV-8, etc.
- the AAV vectors have the wild type REP and CAP genes deleted in whole or part, but retain functional flanking ITR sequences. These vectors can all be used, without limitation, for the expression of a Brachyury protein.
- Alphaviruses encoding a Brachyury protein or Brachyury polypeptide are provided and are of use in the methods disclosed herein.
- Alphaviruses are a set of serologically related arthropod-borne viruses of the Togavirus family. Twenty-six known viruses and virus subtypes have been classified within the alphavirus genus utilizing the hemagglutination inhibition (HI) assay. Briefly, the HI test segregates the 26 alphaviruses into three major complexes: the Venezuelan encephalitis (VE) complex, the Semliki Forest (SF) complex, and the western encephalitis (WE) complex.
- VE Venezuelan encephalitis
- SF Semliki Forest
- WE western encephalitis
- alphaviruses include Aura (American Type Culture Collection (ATCC) VR-368), Bebaru virus (ATCC VR-600, ATCC VR-1240), Cabassou (ATCC VR-922), Chikungunya virus (ATCC VR-64, ATCC VR-1241), Eastern equine encephalomyelitis virus (ATCC VR-65, ATCC VR-1242), Fort Morgan (ATCC VR-924), Getah virus (ATCC VR-369, ATCC VR-1243), Kyzylagach (ATCC VR-927), Mayaro (ATCC VR-66), Mayaro virus (ATCC VR-1277), Middleburg (ATCC VR-370), Mucambo virus (ATCC VR-580, ATCC VR-1244), Ndumu (ATCC VR-371), Pixuna virus (ATCC VR-372, ATCC VR
- alphavirus vector is a Sinbis virus.
- recombinant alphavirus vector constructs are utilized that include a 5′ sequence which is capable of initiating transcription of an alphavirus, a nucleotide sequence encoding alphavirus nonstructural proteins, a viral junction region which has been inactivated such that viral transcription of the subgenomic fragment is prevented, an alphavirus RNA polymerase recognition sequence, and a nucleic acid sequence encoding a Brachyury protein.
- Alphavirus vector constructs which have inactivated viral junction regions do not transcribe the subgenomic fragment, making them suitable for a wide variety of applications.
- the alphavirus such as Sinbis virus constructs which contain a 5′ promoter which is capable of initiating the synthesis of viral RNA in vitro from cDNA.
- the 5′ promoters include both eukaryotic and prokaryotic promoters, such as, for example, the ⁇ -galactosidase promoter, trpE promoter, lacZ promoter, T7 promoter, T3 promoter, SP6 promoter, SV40 promoter, CMV promoter, and MoMLV LTR.
- sequences include nucleotides 1-60, and to a lesser extent nucleotides 150-210, of the wild-type Sindbis virus, nucleotides 10-75 for tRNA Asparagine (Schlesinger et al., U.S. Pat. No. 5,091,309, incorporated herein by refernece), and 5′ sequences from other Togaviruses which initiate transcription.
- Alphavirus vectors can contain sequences which encode alphavirus nonstructural proteins (NSPs).
- NSPs alphavirus nonstructural proteins
- NSP1-NSP3 Nonstructural proteins 1 through 3
- NSP4 Nonstructural proteins 1 through 3
- NSP4 The alphavirus vector constructs can also include a viral junction region which has been inactivated, such that viral transcription of the subgenomic fragment is prevented.
- the alphavirus viral junction region normally controls transcription initiation of the subgenomic mRNA.
- the normal viral junction region typically begins at approximately nucleotide number 7579 and continues through at least nucleotide number 7612 (and possibly beyond), see U.S. Pat. No. 5,843,723 for the complete sequence, incorporated herein by reference.
- Replicon vectors may be utilized in any of several formats, including DNA vector constructs, RNA replicon vectors, and recombinant replicon particles (see below). These include, for example, SIN (Xiong et al., Science 243:1188-1191, 1989; Dubensky et al., J. Virol. 70:508-519, 1996; Hariharan et al., J. Virol.
- Alphavirus vector constructs are also disclosed in U.S. Pat. Nos. 5,789,245; 5,843,723; 5,814,482, and U.S. Pat. No. 6,015,694; PCT Publication No. WO 00/61772; and PCT Publication No. WO 02/99035.
- these vectors include a 5′ sequence which initiates transcription of alphavirus RNA, a nucleotide sequence encoding alphavirus nonstructural proteins, a viral subgenomic junction region promoter which directs the expression of an adjacent heterologous nucleic acid sequence, an RNA polymerase recognition sequence and a polyadenylate tract.
- An alphavirus can be used as a replicon (a recombinant alphavirus particle) that is a virus-like particle containing a self-replicating alphavirus vector or “replicon” nucleic acid.
- the replicon particle itself is generally considered to be replication incompetent or “defective,” that is no progeny replicon particles will result when a host cell is infected with a replicon particle, because genes encoding one or more structural proteins necessary for packaging are deleted.
- alphavirus vectors can be used directly for administration in vivo as RNA, or delivered as a plasmid-based cDNA (e.g., Eukaryotic Layered Vector Initiation System), often, for in vivo vaccine and therapeutic applications, the alphavirus RNA replicon vector or replicon RNA is first packaged into a virus-like particle, comprising alphavirus structural proteins (e.g., capsid protein and envelope glycoproteins).
- alphavirus structural proteins e.g., capsid protein and envelope glycoproteins.
- Alphavirus and replicons of use are disclosed, for example, in Published U.S. Patent Application No. 20110002958, which is incorporated herein by reference. Because of their configuration, vector replicons do not express these alphavirus structural proteins necessary for packaging into recombinant alphavirus replicon particles. Thus, to generate replicon particles, the structural proteins must be provided in trans.
- Packaging can be accomplished by a variety of methods, including transient approaches such as co-transfection of in vitro transcribed replicon and defective helper RNA(s) (Liljestrom, Bio/Technology 9:1356-1361, 1991; Bredenbeek et al., I Virol. 67:6439-6446, 1993; Frolov et al., J. Virol. 71:2819-2829, 1997; Pushko et al., Virology 239:389-401, 1997; U.S. Pat. No. 5,789,245 and U.S. Pat. No. 5,842,723) or plasmid DNA-based replicon and defective helper constructs (Dubensky et al., J.
- trans packaging methodologies permit the modification of one or more structural protein genes (for example, to incorporate sequences of alphavirus variants such as the attenuated mutants, see U.S. Pat. Nos. 5,789,245; 5,842,723; 6,015,694), followed by the subsequent incorporation of the modified structural protein into the final replicon particles.
- such packaging permits the overall modification of alphavirus replicon particles by packaging of a vector construct or RNA replicon derived from a first alphavirus using structural proteins derived from a second alphavirus different from that of the vector construct.
- Measles viruses encoding a Brachyury protein or Brachyury polypeptide are provided and are of use in the methods disclosed herein.
- the nucleic acid sequences of Measles Viruses are disclosed in PCT Publication No. WO 98/13501, which provides the sequence of a DNA copy of the positive strand (antigenomic) message sense RNA of various wild-type of vaccine measles strains, including Edmonston Wild-type strain, Moraten strain and Schwarz strain.
- PCT Publication No. WO 97/06270 incorporated herein by reference, discloses the production of recombinant measles vectors.
- An attenuated strain of measles virus can also be used to deliver a Brachyury protein or Brachyury polypeptide.
- the Moraten attenuated form of the virus has been used world-wide as a vaccine and has an excellent safety record (Hilleman, et al., J. Am. Med. Assoc. 206: 587-590, 1968). Accordingly, in one embodiment, the Moraten strain is used.
- the Moraten vaccine is commercially available from MERCK® and is provided lyophilized in a vial which when reconstituted to 0.5 ml comprises 10 3 pfu/ml.
- the Edmonston-B vaccine strain of measles virus is used (MV-Edm) (Enders and Peebles, Proc. Soc. Exp. Biol. Med. 86: 277-286, 1954).
- MV-Edm grows efficiently in tumor cells but its growth is severely restricted in primary cultures of human peripheral blood mononuclear cells, normal dermal fibroblasts, and vascular smooth muscle cells.
- a form of the Enders attenuated Edmonston strain is available commercially from Merck (ATTENUVAX®).
- Other attenuated measles virus strains can also be utilized, such as Leningrad-16, and Moscow-5 strains (Sinitsyna, et al., Res. Virol.
- the recombinant measles virus nucleotide sequence comprises a replicon having a total number of nucleotides which is a multiple of six.
- the “rule of six” is expressed in the fact that the total number of nucleotides present in the recombinant cDNA finally amount to a total number of nucleotides which is a multiple of six, a rule which allows efficient replication of genome RNA of the measles virus.
- heterologous DNA such as a nucleic acid encoding Brachyury protein
- ATU Additional Transcription Unit
- the location of the ATU can vary along the cDNA: it is however located in such a site that it will benefit from the expression gradient of the measles virus. Therefore, the ATU can be spread along the cDNA.
- the ATU is inserted in the N-terminal portion of the sequence and especially within the region upstream from the L-gene of the measles virus and upstream from the M gene of the virus.
- the ATU is inserted upstream from the N gene of the virus, see U.S. Published Patent Application No. 2011/0129493, incorporated herein by reference.
- Particular cistrons in the measles virus genome can targeted to modify genes whose expression is associated with attenuation (Schneider-Shaulies et at. PNAS 92(2): 3943-7, 1995, Takeda, et al. J. Virol. 72/11: 8690-8696, 1998).
- a recombinant measles virus strain is generated encoding a Brachyury protein or Brachyury polypeptide in any of an H protein, a V protein, a C protein, and combinations thereof.
- Recombinant measles virus vectors include the plasmid pTM-MVSchw which contains the cDNA resulting from reverse transcription of the antigenomic RNA of measles virus and an adapted expression control sequence including a promoter and terminator for the T7 polymerase.
- Vectors are also disclosed, for example, in U.S. Published Patent Application No. 2006/0013826, which is incorporated herein by reference. These vectors are of use in the methods disclosed herein.
- Attenuated strains of measles virus can be produced that express a Brachyury protein or Brachyury polypeptide.
- Attenuated strains of viruses are obtained by serial passage of the virus in cell culture (e.g., in non-human cells), until a virus is identified which is immunogenic but not pathogenic. While wild type virus will cause fatal infection in marmosets, vaccine strains do not. Individuals receiving an attenuated measles virus vaccine do not display classical measles symptoms. Attenuation is associated with decreased viral replication (as measured in vivo by inability to cause measles in monkeys), diminished viremia, and failure to induce cytopathological effects in tissues (e.g., cell-cell fusion, multinucleated cells). See U.S. Pat. No. 7,393,527, which is incorporated herein by reference.
- an effective dose of an attenuated measles virus encoding a Brachyury protein or Brachyury polypeptide is produced by infecting a primary cell or a continuous cell line with a starting innoculum of a stock comprising an attenuated Moraten strain of measles virus (or an innoculum of an MMR stock) or the MV-Edm strain or any of the other strains described above and expanding the virus after serial passage.
- Cells or cell lines include, but are not limited to, monkey kidney or testes cells or monkey cell lines (e.g., Vero, KB, CV-1, BSC-1, and the like). Viral replication in cells is observed as cell-cell fusion and syncytia formation.
- the attenuated measles virus is expanded until a desired dose concentration is obtained in standard cell culture media.
- the therapeutically effective dose concentration is about 10 3 to 10 12 pfu. In another embodiment of the invention, the concentration is about 10 5 to 10 8 pfu.
- Viral titer can be assayed by inoculating cells (e.g., Vero cells) in culture dishes (e.g., such as 35 mm dishes). After 2-3 hours of viral adsorption, the inoculum is removed and cells are overlaid with a mixture of cell culture medium and agarose or methylcellulose (e.g., 2 ml DMEM containing 5% FCS and 1% SeaPlaque agarose).
- Virus is harvested from cell syncytia by scraping cells from the dishes, subjecting them to freeze/thawing (e.g., approximately two rounds), and centrifuging. The cleared supernatants represent “plaque purified” virus.
- Viral stocks are produced by infection of cell monolayers (e.g., adsorption for about 1.5 hours at 37° C.), followed by scraping of infected cells into a suitable medium (e.g., Opti-MEM, Gibco-BRL) and freeze/thaw lysis (for example, 2 rounds). Viral stocks are aliquoted, frozen and stored at 70° C.-80° C. and can be stored at concentrations higher than the therapeutically effective dose. In one embodiment, viral stock is stored in a stabilizing solution. Stabilizing solutions are known in the art, see for example, U.S. Pat. No. 4,985,244, and U.S. Pat. No. 4,500,512.
- Polioviruses encoding a Brachyury protein or a Brachyury polypeptide are provided and are of use in the methods disclosed herein. The entire poliovirus genome has been cloned and sequenced and the viral proteins identified. An infectious poliovirus cDNA is also available which has allowed further genetic manipulation of the virus (Racaniello V R et al., Science 214(4542) 916-919, 1981).
- the wild-type genomic RNA molecule is 7433 nucleotides long, polyadenylated at the 3′ end and has a small covalently attached viral protein (VPg) at the 5′ terminus (Kitamura N et al., Nature 291:547-553; 1981 Racaniello V R et al., Proc. Natl. Acad. Sci. USA 78:4887-4891, 1981).
- VPg viral protein
- poliovirus genome occurs via the translation of a single protein (polyprotein) which is subsequently processed by virus encoded proteases (2A and 3C) to give the mature structural (capsid) and nonstructural proteins (Kitamura N et al., Nature 291:547-553, 1981; Koch F et al., The Molecular Biology of Poliovirus, Springer-Verlag, Vienna, 1985).
- Poliovirus replication is catalyzed by the virus-encoded RNA-dependent RNA polymerase, which copies the genomic RNA to give a complementary RNA molecule, which then serves as a template for further RNA production (Koch F et al., supra; Kuhn R J et al., in D J Rowlands et al. (ed.) Molecular Biology of Positive Strand RNA viruses, Academic Press Ltd., London, 1987).
- the translation and proteolytic processing of the poliovirus polyprotein is described in Nicklin M J H et al., Bio/Technology 4:33-42, 1986.
- the viral RNA genome encodes the necessary proteins required for generation of new progeny RNA, as well as encapsidation of the new RNA genomes.
- poliovirus is lytic, resulting in the complete destruction of permissive cells. Since the viral replication cycle does not include any DNA intermediates, there is no possibility of integration of viral DNA into the host chromosomal DNA.
- Replicons can comprise deoxyribonucleic acid (DNA) or ribonucleic acid (RNA).
- Replicons are poliovirus-based polynucleotides that lack a wild type poliovirus nucleic acid necessary for encapsidation of the virus. Consequently, newly encapsidated replicons cannot be produced following initial cell entry in the absence of the missing nucleic acid.
- Replicons can lack this nucleic acid as a result of any modification of the wildtype poliovirus nucleic acid including, but not limited to, deletions, insertions, and substitutions, including an insertion of a nucleic acid encoding a Brachyury protein.
- poliovirus replicons lack a wild type poliovirus nucleic acid that encodes at least a portion of a protein that is required for encapsidation.
- Proteins necessary for replicon encapsidation include proteins that are part of the capsid structure. Examples of such proteins are those encoded by the VP1, VP2, VP3, and VP4 genes of the poliovirus P1 capsid precursor region, the Vpg protein, and those proteins that are necessary for proper processing of structural proteins of the capsid structure, such as the proteases responsible for cleaving the viral polyprotein.
- the poliovirus vector lacks nucleic acid sequences encoding one or more of VP1, VP2, VP3, and VP4, genes of the poliovirus P1 capsid precursor region, the Vpg protein, and encodes a Brachyury protein or Brachyury polypeptide.
- Replicons are typically introduced into a cell in an RNA form. Encapsidated replicons are able to enter cells via interaction of the capsid proteins with poliovirus receptor. Replicons are fully capable of RNA replication (amplification) upon introduction into cells and translation, in the correct reading frame, of the single polyprotein through which expression of the entire replicon genome occurs. Translation of replicon sequences may be transient, usually lasting only about 24-48 hours. High levels of replicon-encoded proteins can accumulate during the translation period. Encapsidated replicons are able to enter cells via interaction of the capsid proteins with the hPVR protein.
- replicons comprise RNA, including sequences encoding Brachyury protein, and are encapsidated.
- the replicons have a deletion of the capsid (P1) gene and are derived from the RNA genome of poliovirus type 1, type 2, type 3 or combinations thereof.
- a nucleic acid encoding a Brachyury protein or Brachyury polypeptide can be substituted for part or all of the capsid (P1) gene such that the portion of the capsid (P1) gene which remains, if any, is insufficient to support encapsidation in vivo.
- P1 replicons refers to replicons in which the entire nucleic acid encoding the P1 capsid precursor protein has been deleted or altered such that the proteins which are normally encoded by this nucleic acid are not expressed or are expressed in a non-functional form.
- the proteins that are normally encoded by the P capsid precursor region of the poliovirus genome include the proteins encoded by the VP1, VP2, VP3, and VP4 genes.
- P1 replicons therefore, lack the VP1, VP2, VP3, and VP4 genes or comprise unexpressible or non-functional forms of the VP1, VP2, VP3, and VP4 genes.
- P1 replicons can include a nucleic acid encoding a Brachyury protein or Brachyury polypeptide substituted for the VP1, VP2, VP3, and VP4 genes.
- encapsidated replicons may be produced by introducing both a replicon and a complementing expression vector that provides the missing nucleic acid necessary for encapsidation in trans to a host cell.
- a “replicon encapsidation vector” refers to a non-poliovirus-based vector that comprises a nucleic acid required for replicon encapsidation and provides the required nucleic acid (or encoded protein) in trans.
- Replicon encapsidation vectors can be introduced into a host cell prior to, concurrently with, or subsequent to replicon introduction. Suitable methods for encapsidation are disclosed in U.S. Pat. No.
- Nonencapsidated replicons can be delivered directly to target cells, for example by direct injection into, for example, muscle cells (see, for example, Acsadi G et al., Nature 352(6338):815-818, 1991; Wolff J A et al., Science 247:1465-1468, 1990), or by electroporation, transfection mediated by calcium phosphate, transfection mediated by DEAE-dextran, liposome-mediated transfection or receptor-mediated nucleic acid uptake (see for example Wu G et al., J. Biol. Chem. 263:14621-14624, 1988; Wilson J M et al., J. Biol. Chem. 267:963-967, 1992; and U.S. Pat. No. 5,166,320), or other methods of delivering naked nucleic acids to target cells.
- Retroviral vectors including lentiviral vectors encoding a Brachyury protein and/or Brachyury polypeptide are provided and are of use in the methods disclosed herein. Retroviral vectors have been tested and found to be suitable delivery vehicles for the stable introduction of a variety of genes of interest into the genomic DNA of a broad range of target cells. Without being bound by theory, the ability of retroviral vectors to deliver unrearranged, single copy transgenes into cells makes retroviral vectors well suited for transferring genes into cells. Further, retroviruses enter host cells by the binding of retroviral envelope glycoproteins to specific cell surface receptors on the host cells.
- pseudotyped retroviral vectors in which the encoded native envelope protein is replaced by a heterologous envelope protein that has a different cellular specificity than the native envelope protein (e.g., binds to a different cell-surface receptor as compared to the native envelope protein) can also be used.
- retroviruses contain three major coding domains, gag, pol, env, which code for essential virion proteins. Retroviral vectors are of use wherein gag, pol and/or env are absent or not functional. Retroviral vectors are disclosed, for example, in U.S. Published Patent Application No. 20060286634, which is incorporated herein by reference herein.
- retroviral vectors include, for example, retroviral transfer vectors comprising a nucleic acid encoding a Brachyury protein and retroviral packaging vectors comprising one or more packaging elements.
- retroviral transfer vectors comprising a nucleic acid encoding a Brachyury protein
- retroviral packaging vectors comprising one or more packaging elements.
- pseudotyped retroviral vectors are provided encoding a heterologous or functionally modified envelope protein for producing pseudotyped retrovirus.
- retroviruses include: murine leukemia virus (MLV), lentivirus such as human immunodeficiency virus (HIV), equine infectious anaemia virus (EIAV), mouse mammary tumor virus (MMTV), Rous sarcoma virus (RSV), Fujinami sarcoma virus (FuSV), Moloney murine leukemia virus (Mo-MLV), FBR murine osteosarcoma virus (FBR MSV), Moloney murine sarcoma virus (Mo-MSV), Abelson murine leukemia virus (A-MLV), Avian myelocytomatosis virus-29 (MC29), and Avian erythroblastosis virus (AEV).
- MMV murine leukemia virus
- HMV human immunodeficiency virus
- EIAV equine infectious anaemia virus
- MMTV mouse mammary tumor virus
- RSV Rous sarcoma virus
- Fujinami sarcoma virus FuSV
- retroviruses suitable for use include, but are not limited to, Avian Leukosis Virus, Bovine Leukemia Virus, Mink-Cell Focus-Inducing Virus.
- the core sequence of the retroviral vectors can be derived from a wide variety of retroviruses, including for example, B, C, and D type retroviruses as well as spumaviruses and lentiviruses (see RNA Tumor Viruses, Second Edition, Cold Spring Harbor Laboratory, 1985).
- An example of a retrovirus suitable for use in the compositions and methods disclosed herein includes, but is not limited to, lentivirus.
- HIV human immunodeficiency virus
- type 1 or 2 i.e., HIV-1 or HIV-2
- Other lentivirus vectors include sheep Visna/maedi virus, feline immunodeficiency virus (FIV), bovine lentivirus, simian immunodeficiency virus (SIV), an equine infectious anemia virus (EIAV), and a caprine arthritis-encephalitis virus (CAEV).
- HIV human immunodeficiency virus
- FMV feline immunodeficiency virus
- SIV bovine lentivirus
- SIV simian immunodeficiency virus
- EIAV equine infectious anemia virus
- CAEV caprine arthritis-encephalitis virus
- Lentiviruses share several structural virion proteins in common, including the envelope glycoproteins SU (gp120) and TM (gp41), which are encoded by the env gene; CA (p24), MA (p117) and NC (p7-11), which are encoded by the gag gene; and RT, PR and IN encoded by the pol gene.
- HIV-1 and HIV-2 contain accessory and other proteins involved in regulation of synthesis and processing virus RNA and other replicative functions.
- the accessory proteins, encoded by the vif, vpr, vpu/vpx, and nef genes, can be omitted (or inactivated) from the recombinant system.
- tat and rev can be omitted or inactivated, such as by mutation or deletion.
- lentivirus-based gene transfer techniques generally relies on the in vitro production of recombinant lentiviral particles carrying a highly deleted viral genome in which a gene of interest, such as a nucleic acid encoding a Brachyury protein or Brachyury polypeptide, is accommodated.
- the recombinant lentivirus are recovered through the in trans co-expression in a permissive cell line of (1) the packaging constructs, i.e., a vector expressing the Gag-Pol precursors together with Rev (alternatively expressed in trans); (2) a vector expressing an envelope receptor, generally of an heterologous nature, and (3) the transfer vector, consisting in the viral cDNA deprived of all open reading frames, but maintaining the sequences required for replication, incapsidation, and expression, in which the sequences to be expressed are inserted.
- the packaging constructs i.e., a vector expressing the Gag-Pol precursors together with Rev (alternatively expressed in trans
- Rev alternatively expressed in trans
- the transfer vector consisting in the viral cDNA deprived of all open reading frames, but maintaining the sequences required for replication, incapsidation, and expression, in which the sequences to be expressed are inserted.
- the lentigen lentiviral vector described in Lu, X. et al.
- lentiviral vectors are also disclosed, for example, in U.S. Published Patent Application No. 20100062524, which is incorporated herein by reference.
- Retroviral packaging systems for generating producer cells and producer cell lines that produce retroviruses, and methods of making such packaging systems are known in the art.
- the retroviral packaging systems include at least two packaging vectors: a first packaging vector which includes a first nucleotide sequence comprising a gag, a pol, or gag and pol genes; and a second packaging vector which includes a second nucleotide sequence comprising a heterologous or functionally modified envelope gene.
- the retroviral elements are derived from a lentivirus, such as HIV. These vectors can lack a functional tat gene and/or functional accessory genes (vif, vpr, vpu, vpx, nef).
- the system further comprises a third packaging vector that comprises a nucleotide sequence comprising a rev gene.
- the packaging system can be provided in the form of a packaging cell that contains the first, second, and, optionally, third nucleotide sequences.
- First generation lentiviral vector packaging systems provide separate packaging constructs for gag/pol and env, and typically employ a heterologous or functionally modified envelope protein for safety reasons.
- the accessory genes, vif, vpr, vpu and nef are deleted or inactivated.
- Third generation lentiviral vector systems are those from which the tat gene has been deleted or otherwise inactivated (e.g., via mutation). Compensation for the regulation of transcription normally provided by tat can be provided by the use of a strong constitutive promoter, such as the human cytomegalovirus immediate early (HCMV-IE) enhancer/promoter.
- HCMV-IE human cytomegalovirus immediate early
- promoters/enhancers can be selected based on strength of constitutive promoter activity, specificity for target tissue (e.g., liver-specific promoter), or other factors relating to desired control over expression, as is understood in the art.
- an inducible promoter such as tet can be used to achieve controlled expression.
- the gene encoding rev can be provided on a separate expression construct, such that a typical third generation lentiviral vector system will involve four plasmids: one each for gagpol, rev, envelope and the transfer vector. Regardless of the generation of packaging system employed, gag and pol can be provided on a single construct or on separate constructs.
- the packaging vectors are included in a packaging cell, and are introduced into the cell via transfection, transduction or infection. Methods for transfection, transduction or infection are well known by those of skill in the art.
- a retroviral vector of the present invention can be introduced into a packaging cell line, via transfection, transduction or infection, to generate a producer cell or cell line.
- the packaging vectors can be introduced into human cells or cell lines by standard methods including, for example, calcium phosphate transfection, lipofection or electroporation.
- the packaging vectors are introduced into the cells together with a dominant selectable marker, such as neo, DHFR, Gin synthetase or ADA, followed by selection in the presence of the appropriate drug and isolation of clones.
- a selectable marker gene can be linked physically to genes encoding by the packaging vector.
- Stable cell lines wherein the packaging functions are configured to be expressed by a suitable packaging cell
- a suitable packaging cell For example, see U.S. Pat. No. 5,686,279; and Ory et al., Proc. Natl. Acad. Sci. 93:11400-11406, 1996, which describe packaging cells. Zufferey et al., Nature Biotechnology 15:871-875, 1997 disclose a lentiviral packaging plasmid wherein sequences 3′ of pol including the HIV-1 envelope gene are deleted. The construct contains tat and rev sequences and the 3′ LTR is replaced with poly A sequences. The 5′ LTR and psi sequences are replaced by another promoter, such as one which is inducible. For example, a CMV promoter can be used.
- the packaging vectors can include additional changes to the packaging functions to enhance lentiviral protein expression and to enhance safety. For example, all of the HIV sequences upstream of gag can be removed. Also, sequences downstream of envelope can be removed. Moreover, steps can be taken to modify the vector to enhance the splicing and translation of the RNA.
- a self-inactivating vector can be used, which improves the biosafety of the vector by deletion of the HIV-1 long terminal repeat (LTR) as described, for example, by Zufferey et al., J. Virology 72(12):9873-9880, 1998.
- Inducible vectors can also be used, such as through a tet-inducible LTR.
- DNA sequences encoding a Brachyury protein and/or Brachyury polypeptide can be expressed from a vector in vitro by DNA transfer into a suitable host cell.
- host cell also includes any progeny of the subject host cell. It is understood that all progeny may not be identical to the parental cell since there may be mutations that occur during replication. Methods of stable transfer, meaning that the foreign DNA is continuously maintained in the host, are known in the art.
- Hosts cells can include microbial, insect and mammalian host cells. Methods of expressing DNA sequences having eukaryotic or viral sequences in prokaryotes are well known in the art.
- suitable host cells include animal cells (for example, mammalian cells, such as human). Techniques for the propagation of mammalian cells in culture are well-known (see, Jakoby and Pastan (eds), 1979, Cell Culture. Methods in Enzymology, volume 58, Academic Press, Inc., Harcourt Brace Jovanovich, N.Y.). Examples of commonly used mammalian host cell lines are VERO and HeLa cells, CHO cells, and WI38, BHK, and COS cell lines, although cell lines may be used, such as cells designed to provide higher expression desirable glycosylation patterns, or other features.
- Transformation of a host cell with recombinant DNA can be carried out by conventional techniques as are well known to those skilled in the art.
- the host is prokaryotic, such as, but not limited to, E coli
- competent cells which are capable of DNA uptake can be prepared from cells harvested after exponential growth phase and subsequently treated by the CaCl 2 ) method using procedures well known in the art.
- CaCl 2 or RbCl can be used. Transformation can also be performed after forming a protoplast of the host cell if desired, or by electroporation.
- Eukaryotic cells can also be co-transformed with polynucleotide sequences encoding a Brachyury protein or Brachyury polypeptide, and a second foreign DNA molecule encoding a selectable phenotype, such as the herpes simplex thymidine kinase gene.
- Methods for using viral vectors to transform eukaryotic cells are known, (see for example, Eukaryotic Viral Vectors , Cold Spring Harbor Laboratory, Gluzman ed., 1982).
- a nucleic acid encoding a Brachyury protein is expressed in the host cell, such as a Salmonella host cell, for example S typhimurium host cell, or a Listeria , such as a L. monocytogenes host cell.
- a host cell-compatible promoter is any promoter or promoter/enhancer that is able to initiate sufficient transcription of the Brachyury protein or Brachyury polypeptide, such as in amounts sufficient to induce a Brachyury specific CD4+ T cell response when the host cell is introduced into the subject.
- Some examples of expression control sequences are a promoter/enhancer from the cytomegalovirus (CMV) immediate early gene 1 or the Rous sarcoma virus (RSV) long terminal repeat or the simian virus 40 promoter or the adenovirus 2 major late promoter or the mouse mammary tumor virus promoter (MMTV).
- CMV cytomegalovirus
- RSV Rous sarcoma virus
- MMTV mouse mammary tumor virus promoter
- the host cell are utilized with an adjuvant.
- adjuvants of use are GM-CSF, Bacillus -Calmette-Guerin adjvant or CD40 ligand (CD40L).
- Attenuated Bacteria Listeria and Salmonella
- Prokaryotic host cells include Listeria and Salmonella , which can be used directly to provide a Brachyury protein and/or Brachyury polypeptide, such as for use in the methods disclosed herein.
- an attenuated invasive intracellular bacterium capable of infecting a mammalian host or cell thereof, but having a decreased ability in intra- and intercellular movement in the host as compared to a wild type bacterium is utilized.
- the bactium is transformed with (a) a promoter activated when said bacterium is present in the cytosol of a host cell, operably linked to a structural gene or fragment thereof, encoding a polypeptide which is lethal to the bacterium, (b) a host cell-compatible promoter, operably linked to a structural gene or fragment thereof, encoding a Brachyury protein, wherein (a) and (b) can be on the same plasmid or different plasmids or (a) can be integrated into the bacterial chromosome.
- the attenuated bacteria include a number of intracellular bacteria, such as Salmonella, Yersinia, Renibacterium and Listeria capable of intracellular growth (Coynault et al., Molecular Microbiology 22, 149-160, 1996; Hohmann et al., Vaccine 14, 19-14, 1996; Karem et al., Infection and Immuity 63, 4557-4563, 1995; O'Callaghan et al., Infection and Immunity 56, 419-423, 1988; Sigwart et al., Infection and Immunity 57, 1858-61, 1989; and Sinha et al., Infection and Immunity 65, 1566-1569, 1997).
- Salmonella, Yersinia, Renibacterium and Listeria capable of intracellular growth
- the disclosed attenuated invasive bacteria can still invade a host, or cells thereof, but are not pathogenic.
- attenuation can be achieved by mutation (see T. Maniatis, et al. Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor, N.Y., 1989).
- attenuation can be caused by mutating the bacterial genes which encode for pathogenic and/or toxic polypeptides.
- Such a mutation can be achieved randomly, such as by chemical modification and selected later, for example, for loss of function, or it can be site directed.
- the bacterium is attenuated by deletion, insertion or point mutations, to eliminate the function of certain genes that encode polypeptides which lead to pathogenesis.
- the bacterium is attenuated by deletion of an entire operon by chromosomal deletion, such as the attenuated L. monocytogenes mutant strain DELTA2 that is a derivative of the fully virulent wild-type strain EGD, and lacks the entire lecithinase operon consisting of the genes mpl, actA and plcB due to a chromosomal deletion. Due to the deletion of this operon the inflammatory response caused by L. monocytogenes during infection of a mammalian host is significantly reduced. Suitable bacteria are disclosed for example, in U.S. Pat. No. 6,143,551, which is incorporated by reference herein.
- a variety of potential live Salmonella strains with different attenuation levels which subsequently serve as platforms for the development of recombinant live Salmonella carrier strains that express heterologous antigens.
- Such recombinant live Salmonella vaccine carriers are equipped with modules comprising variable gene cassettes that regulate the expression of heterologous antigens in Salmonella and determine presentation of the heterologous antigens to the host immune system.
- S. typhimurium contains two type III secretion systems for virulence determinants.
- the first controls bacterial invasion of epithelial cells, and is encoded by genes within a 40 kb pathogenicity island (SPI1).
- SPI2 40 kb pathogenicity island
- the genes located on pathogenicity island SPI1 are mainly responsible for early steps of the infection process, the invasion of non-phagocytic host cells by the bacterium.
- mutations result in a reduced invasiveness in vitro.
- mutants that are defective in invasion are not necessarily avirulent.
- virulence studies of SPI2 mutants have shown them to be attenuated by at least five orders of magnitude compared with the wild-type strain after both oral and intraperitoneal inoculation of mice.
- SPI2 contains genes for a type III secretion apparatus (ssa) and a two component regulatory system (ssr), as well as candidate genes for a set of secreted effectors (sse) and their specific chaperones (ssc).
- ssa type III secretion apparatus
- ssr two component regulatory system
- ssc secreted effectors
- the first 13 genes within the ssaK/U operon and ssaJ encode components of the secretion system apparatus.
- a number of additional genes, including ssaC, which encode a secretion system apparatus protein and a two component regulatory protein, respectively, are found in a region approximately 8 kb from ssaJ.
- an attenuated gram-negative cell can have inactivated at least one gene selected from effector (sse) gene secretion apparatus (ssa) genes, chaperon (ssc) genes and regulation (ssr) genes.
- the inactivated gene is preferably sseC, sseD, sseE or a combination thereof.
- the ssr genes are affected by the inactivation, preferably at least ssrB is inactivated.
- the ssc genes are affected by the inactivation, preferably at least sscB is inactivated.
- Attenuation can be the result of original mutations in SPI2 gene locus. Combination of the individual mutations in the SPI2 gene locus with each other, and with other known attenuating gene mutations, such as aroA, results in a broad repertoire of attenuation and immunogenicity. Different expression cassettes can be introduced on these platforms, allowing further modulation of the immune response directed against the heterologous antigens.
- Pathogenic Salmonella or Listeria serve as a basis for the construction of a panel of different live Salmonella vaccine prototypes generated by gradual attenuations accomplished through the introduction of defined SPI2 gene locus mutations.
- Each resulting individual live Salmonella vaccine prototype is further transformed into a multivalent recombinant vaccine by the introduction of exchangeable DNA modules carrying (1) a nucleic acid encoding a Brachyury protein or polypeptide and (2) adequate expression systems executing efficacious antigen presentation to the host immune system. In concert, these features elicit a specific immune response, such as a Brachyury specific T cell response.
- the inactivation of the gene of the SPI2 locus is effected by a mutation which may comprise deletion.
- the deletion is cause by insertion of a heterologous nucleic acid, such as a nucleic acid encoding Brachyury into the gene to be inactivated.
- Salmonella pathogenic Salmonella species are gradually attenuated by mutations in individual virulence genes that are part of the SPI2 gene locus, for example an sse gene coding for an effector protein, such as sseC, ssed or sseE, or an ssc gene, such as sscB, coding for a chaperone, or an ssr gene, such as ssrB, coding for a regulator.
- Individual mutation of each of these genes leads to a unique individual grade of attenuation, which, in turn, effects a characteristic immune response at the mucosal, humoral and cellular levels.
- the individual grade of attenuation can be moderately increased by combinations of at least two gene mutations within the SPI2 gene locus or by combination with a mutation in another Salmonella gene known to attenuate virulence, such as an aro gene, for eample aroA.
- a stronger grade of attenuation is achieved by mutation of a virulence gene that is part of a polycistronic gene cluster encoding several virulence factors, such as the transcriptional unit comprising the sseC, sseD, sseE and sscB genes, such that the mutation exerts a polar effect, disrupting expression of the following genes.
- the grade of attenuation may directly depend on the number of virulence genes that are affected by the polar mutation as well as their individual characteristics. Finally, the strongest attenuation is achieved when regulatory genes, such as ssrB, are mutated. Again, each mode of attenuation of Salmonella leads to the generation of a live Salmonella strain that evokes an immune response, see U.S. Pat. No. 7,700,104, which is incorporated herein by reference.
- L. monocytogenes is a Gram-positive, facultative intracellular bacterium that lacks lipopolysaccharide (LPS) and is also able to invade a wider range of mammalian cells where it replicates in the cytosol as well (Portnoy et al., Infect. Immun. 60, 1263, 1992). Since it invades its host through the intestinal mucosal surface, L. monocytogenes is also a candidate for oral vaccination. Shortly after infection, bacteria are found in the spleen where professional APC are abundant. Delivery of DNA to those cells is therefore significantly enhanced by the use of suitably constructed L. monocytogenes . Attenuated L.
- LPS lipopolysaccharide
- monocytogenes cells are lysed in the cytosol of the host cell by the production of a Pac-dependent phage lysin releasing plasmid DNA which carries a heterologous gene, such as a nucleic acid encoding Brachyury protein, under the control of a promoter, such as, but not limited to, the human cytomegalovirus major immediate-early promoter/enhancer region.
- a promoter such as, but not limited to, the human cytomegalovirus major immediate-early promoter/enhancer region.
- the attenuated bacterium can be a mutant of wild-type Listeria which invades host cells and is released into the cytosol of the infected cells with similar efficiencies as the wild-type strain, but is impaired in intra- and intercellular movement.
- the mutant L. monocytogenes strain DELTA2 is unable to polymerise host cell actin in the cytosol which L. monocytogenes wild type strain uses for its movement inside the host cell.
- plcB the bacterium is unable to lyse the host cell membranes which the wild type strain lyses upon entering neighboring cells. Mutant bacteria are therefore unable to move from one infected cell into a neighboring cell (cell-to-cell spread).
- the attenuated bacterium is a mutant of L. monocytogenes which invades the host and is released into the cytosol of the infected cells with similar efficiencies as the wild-type strain, but it is not pathogenic, i.e., it doesn't cause a disease.
- the bacterium is L. monocytogenes that lacks the entire lecithinase operon containing the genes mpl, actA and plcB, and encodes a Brachyury protein or a Brachyury polypeptide.
- a structural gene or fragment thereof is also included, such as encoding a polypeptide which is lethal to the bacterium is any polypeptide which when expressed in the bacterium will result in the release of plasmid DNA and death of the bacterium, for example by lysis of the bacterium.
- the polypeptide can be a bacteriophage lysin, preferable the gene product of ply 118 or other Listeria -phage-encoded lysins, for example the mureinhydrolase encoded by the iap gene of L. monocytogenes or other iap-related genes especially iap of L. grayi .
- the lysis protein PLY 118 is a late gene product of the Listeria bacteriophage A118 necessary for the release of progeny phages.
- PLY 118 is a highly active, cell wall-hydrolyzing enzyme specific for Listeria (Loessner et al., Mol. Microbiol. 16, 1231, 1995).
- a promoter activated when it is present in an invasive bacterium which is in the cytosol of a host cell it is meant any promoter which, when the bacteria is inside the infected cell, is (under the control of a transcription activator which is) preferentially turned on, driving its transcription.
- the L. monocytogenes promoter PactA can be used.
- the PactA promoter is controlled by the transcription activator PrfA which regulates most of the known virulence genes of L. monocytogenes and is specifically activated in the cytosol of the infected host cells to interact with the actA promoter.
- Other promoters which can be used are other promoters of L. monocytogenes , such as those controlling the expression of inlC and other genes for small internalins (Engelbrecht et al., Mol. Microbiol. 21:823-837, 1996).
- Brachyury proteins and Brachyury polypeptides disclosed herein, nucleic acids encoding the Brachyury proteins or Brachyury polypeptides, or host cells including these nucleic acids can be used to generate an immune response in a subject, such as, but not limited to, a Brachyury specific CD4+ T cell response and/or a Brachyury CD8+ T cells response.
- a subject has a cancer that expresses Brachyury.
- the method is a method for preventing cancer in the subject. The subject can be at risk of developing cancer.
- the subject has high grade prostatic intraepithelial neoplasia, familial adenomatous polyposis, or atypia of the breast.
- the the methods include administering to a subject a therapeutically effective amount of one or more of the Brachyury proteins and/or polypeptides disclosed herein, nucleic acids encoding these Brachyury proteins or Brachyury polypeptides, host cells, such as Listeria or Salmonella host cells, dendritic cells presenting epitopes of the protein or polypeptide, and/or vectors including these nucleic acids, in order to generate an immune response.
- the methods can include selecting a subject in need of treatment, such as a subject with a cancer that expresses Brachyury or a cancer with the potential to express Brachyury.
- the methods include selecting a subject with a cancer of the small intestine, stomach, kidney, bladder, uterus, ovaries, testes lung, colon, prostate, tumor of B cell origin (such as chronic lymphocytic leukemia (CLL), a B cell lymphoma, Burkitt's lymphoma or a Hodgkin's lymphoma) or breast cancer wherein the cancer expresses Brachyury or has the potential to express Brachyury.
- the cancer is radiation resistant and/or chemotherapy resistant.
- the subject has breast cancer, such as a ductal carcinoma, for example an infiltrating ductal carcinoma or an estrogen receptor negative and progesterone receptor negative breast cancer.
- breast cancer such as a ductal carcinoma, for example an infiltrating ductal carcinoma or an estrogen receptor negative and progesterone receptor negative breast cancer.
- the subject has high-grade prostatic intraepithelial neoplasia, familial adenomatous polyposis, or atypia of the breast.
- compositions are administered to a subject in an amount sufficient to raise an immune response to Brachyury-expressing cells, such as a CD4+ T cell response.
- a Brachyury specific CD8+ T cell response can also be induced using the methods disclosed herein.
- Administration induces a sufficient immune response to slow the proliferation of Brachyury-expressing cells, or to inhibit their growth, or to reduce a sign or a symptom of the cancer, or to prevent a cancer. Amounts effective for this use will depend upon the severity of the disease, the general state of the patient's health, and the robustness of the patient's immune system.
- a therapeutically effective amount of the composition is that which provides either subjective relief of a symptom(s) or an objectively identifiable improvement as noted by the clinician or other qualified observer.
- the composition can include a Brachyury protein and/or a Brachyury polypeptide, a nucleic acid encoding a Brachyury protein and/or a Brachyury polypeptide, a vector including the nucleic acid, or a host cell expressing the Brachyury protein and/or Brachyury polypeptide. It should be noted that these compositions can be used in combination.
- composition can be administered by any means known to one of skill in the art (see Banga, A., “Parenteral Controlled Delivery of Therapeutic Peptides and Proteins,” in Therapeutic Peptides and Proteins , Technomic Publishing Co., Inc., Lancaster, Pa., 1995).
- the composition can be administered either locally or systemically, such as by intramuscular, subcutaneous, intraperitoneal or intravenous injection, but even oral, nasal, transdermal or anal administration is contemplated.
- administration is by subcutaneous or intramuscular injection.
- the protein and/or polypeptide can be provided as an implant, an oily injection, in a liposome, or as a particulate system.
- the particulate system can be a microparticle, a microcapsule, a microsphere, a nanocapsule, or similar particle. (see, e.g., Banga, supra).
- a particulate carrier based on a synthetic polymer has been shown to act as an adjuvant to enhance the immune response, in addition to providing a controlled release.
- Adjuvants can also be used in combination with the protein, including, for example, chitosan, aluminum salts, an immunostimulatory oligodeoxynucletoide, liposomes and/or one or more cytokines.
- the Brachyury protein or polypeptide can be administered in a liposome.
- the Brachyury protein is administered in a manner to direct the immune response to a cellular response (that is, a Brachyury specific CD4+ response and/or CD8+ response), rather than a humoral (antibody) response.
- the Brachyury polypeptide can induce both a Brachyury specific CD4+ T cell response and a Brachyury specific CD8+ T cell response.
- Methods for measuring a CD4+ and CD8+ T cell response are known in the art, and include biological assays, ELISPOT assays, and fluorescence activated cell sorting.
- An exemplary assay for measuring Brachyury specific CD4+ T cells is disclosed in the examples below.
- a pharmaceutical composition for intravenous administration would include about 0.1 ⁇ g to 10 mg of immunogenic Brachyury protein and/or Brachyury polypeptide per patient per day. Dosages from 0.1 up to about 100 mg per patient per day can be used, particularly if the agent is administered to a secluded site and not into the circulatory or lymph system, such as into a body cavity or into a lumen of an organ. Actual methods for preparing administrable compositions will be known or apparent to those skilled in the art and are described in more detail in such publications as Remingtons Pharmaceutical Sciences, 19 th Ed., Mack Publishing Company, Easton, Pa., 1995.
- one or more immunostimulatory molecules such as IL-2, IL-6, IL-12, LFA (for example, LFA-1, LFA-2 and/or LFA-3), CD72, RANTES, G-CSF, GM-CSF, TNF- ⁇ , IFN- ⁇ , ICAM-1, B7-1, B7-2, other B7 related molecules, OX-40L and/or or 41 BBL, or combinations of these molecules, can be used as biological adjuvants (see, for example, Salgaller et al., 1998, J. Surg. Oncol. 68(2):122-38; Lotze et al., 2000, Cancer J Sci. Am.
- IL-2 IL-2, RANTES, GM-CSF, TNF- ⁇ , IFN- ⁇ , G-CSF, LFA-3, CD72, B7-1, B7-2, B7-1, B7-2, OX-40L, 41 BBL and/or ICAM-1 are administered.
- IL-15 or an IL-15/IL-15 receptor complex can be administered.
- Lipids have been identified as agents capable of assisting in priming T cells in vivo against various antigens.
- palmitic acid residues can be attached to the alpha and epsilon amino groups of a lysine residue and then linked (for example, via one or more linking residues, such as glycine, glycine-glycine, serine, serine-serine, or the like) to an immunogenic peptide or protein.
- the lipidated peptide can then be injected directly in a micellar form, incorporated in a liposome, or emulsified in an adjuvant.
- E. coli lipoproteins such as tripalmitoyl-S-glycerylcysteinlyseryl-serine can be used to prime tumor specific T cells when covalently attached to an appropriate peptide or protein (see, Deres et al., Nature 342:561, 1989).
- the induction of neutralizing antibodies can also be primed with the same molecule conjugated to a protein which displays an appropriate epitope, two compositions can be combined to elicit both humoral and cell-mediated responses where that is deemed desirable.
- a pharmaceutical composition including a Brachyury protein and/or Brachyury polypeptide is thus provided. These compositions are used to generate an immune response, such as for immunotherapy.
- the Brachyury protein and/or the Brachyury polypeptide is mixed with an adjuvant containing two or more of a stabilizing detergent, a micelle-forming agent, and an oil.
- a stabilizing detergent is any detergent that allows the components of the emulsion to remain as a stable emulsion.
- Such detergents include polysorbate, 80 (TWEEN) (Sorbitan-mono-9-octadecenoate-poly(oxy-1,2-ethanediyl; manufactured by ICI Americas, Wilmington, Del.), TWEEN 40TM, TWEEN 20TM, TWEEN 60TM, ZwittergentTM 3-12, TEEPOL HB7TM, and SPAN 85TM. These detergents are usually provided in an amount of approximately 0.05 to 0.5%, such as at about 0.2%.
- a micelle forming agent is an agent which is able to stabilize the emulsion formed with the other components such that a micelle-like structure is formed. Such agents generally cause some irritation at the site of injection in order to recruit macrophages to enhance the cellular response.
- agents examples include polymer surfactants described by BASF Wyandotte publications, e.g., Schmolka, J. Am. Oil. Chem. Soc. 54:110, 1977, and Hunter et al., J. Immunol 129:1244, 1981, PLURONICTM L62LF, L101, and L64, PEG1000, and TETRONICTM 1501, 150R1, 701, 901, 1301, and 130R1.
- the chemical structures of such agents are well known in the art.
- the agent is chosen to have a hydrophile-lipophile balance (HLB) of between 0 and 2, as defined by Hunter and Bennett, J. Immun. 133:3167, 1984.
- the agent can be provided in an effective amount, for example between 0.5 and 10%, or in an amount between 1.25 and 5%.
- the oil included in the composition is chosen to promote the retention of the antigen in oil-in-water emulsion, such as to provide a vehicle for the desired antigen, and preferably has a melting temperature of less than 65° C. such that emulsion is formed either at room temperature (about 20° C. to 25° C.), or once the temperature of the emulsion is brought down to room temperature.
- oils include squalene, Squalane, EICOSANETM, tetratetracontane, glycerol, and peanut oil or other vegetable oils.
- the oil is provided in an amount between 1 and 10%, or between 2.5 and 5%.
- the oil should be both biodegradable and biocompatible so that the body can break down the oil over time, and so that no adverse affects, such as granulomas, are evident upon use of the oil.
- the adjuvant is a mixture of stabilizing detergents, micelle-forming agent, and oil available under the name PROVAX® (IDEC Pharmaceuticals, San Diego, Calif.).
- the Brachyury protein and/or Brachyury polypeptide are included in a liposome.
- Adjuvants can also be administered with the Brachyury protein and/or Brachyury polypeptide.
- An adjuvant can be any immunostimulatory molecule, such as a cytokine, immunostimulatory nucleic acid, or a biological adjuvant (see above).
- the adjuvant can be chitosan. Chitosan is a linear polysaccharide formed from repeating beta (1-4 linked) N-acetyl-D-glucosamine and D-glucosamine units, and is derived from the partial deacetylation of chitin obtained from the shells of crustaceans.
- Chitosan can be made commercially by a heterogeneous alkaline hydrolysis of chitin to give a product which possesses a random distribution of remaining acetyl moieties.
- the properties of chitosans depend upon inter alia the degree of deacetylation, and the molecular weight. Most commercially available chitosans contain a population of chitosan molecules of varying molecular weights and varying concentrations of the component N-acetyl-D-glucosamine and D-glucosamine groups.
- the immunological properties of chitosans are known to be linked to the ratio between the N-acetyl-D-glucosamine and D-glucosamine groups.
- the efficacy of chitosans as adjuvants depends to a considerable extent on the extent of the level of deacetylation.
- the chitosan is at least 80% deacetylated, see U.S. Pat. No. 6,534,065, which is incorporated herein by reference.
- Controlled release parenteral formulations can be made as implants, oily injections, or as particulate systems.
- Particulate systems include microspheres, microparticles, microcapsules, nanocapsules, nanospheres, and nanoparticles.
- Microcapsules contain the therapeutic protein as a central core. In microspheres, the therapeutic agent is dispersed throughout the particle. Particles, microspheres, and microcapsules smaller than about 1 ⁇ m are generally referred to as nanoparticles, nanospheres, and nanocapsules, respectively.
- Capillaries have a diameter of approximately 5 ⁇ m so that only nanoparticles are administered intravenously. Microparticles are typically around 100 ⁇ m in diameter and are administered subcutaneously or intramuscularly (see Kreuter, Colloidal Drug Delivery Systems , J. Kreuter, ed., Marcel Dekker, Inc., New York, N.Y., pp. 219-342, 1994; Tice & Tabibi, Treatise on Controlled Drug Delivery , A. Kydonieus, ed., Marcel Dekker, Inc. New York, N.Y., pp. 315-339, 1992).
- Polymers can be used for ion-controlled release.
- Various degradable and nondegradable polymeric matrices for use in controlled drug delivery are known in the art (Langer, Accounts Chem. Res. 26:537, 1993).
- the block copolymer, polaxamer 407 exists as a viscous yet mobile liquid at low temperatures but forms a semisolid gel at body temperature. It has shown to be an effective vehicle for formulation and sustained delivery of recombinant interleukin-2 and urease (Johnston et al., Pharm. Res. 9:425, 1992; and Pec. J. Parent. Sci. Tech. 44(2):58, 1990).
- hydroxyapatite has been used as a microcarrier for controlled release of proteins (Ijntema et al., Int. J. Pharm. 112:215, 1994).
- liposomes are used for controlled release as well as drug targeting of the lipid-capsulated drug (Betageri et al., Liposome Drug Delivery Systems , Technomic Publishing Co., Inc., Lancaster, Pa., 1993).
- Numerous additional systems for controlled delivery of therapeutic proteins are known (e.g., U.S. Pat. Nos. 5,055,303; 5,188,837; 4,235,871; 4,501,728; 4,837,028; 4,957,735; and U.S. Pat. Nos.
- the composition includes a nucleic acid encoding a Brachyury protein and/or a Brachyury polypeptide.
- a therapeutically effective amount of the polynucleotide encoding the Brachyury protein and/or the Brachyury polypeptide can be administered to a subject in order to generate an immune response.
- a therapeutically effective amount of the polynucleotide encoding the Brachyury protein and/or Brachyury polypeptide is administered to a subject to treat or prevent cancer.
- one or more immunostimulatory molecules and/or costimulatory molecules such as IL-2, IL-6, IL-12, LFA (for example, LFA-1, LFA-2 and/or LFA-3), CD72, RANTES, G-CSF, GM-CSF, TNF- ⁇ , IFN- ⁇ ICAM-1, B7-1, B7-2, other B7 related molecules, OX-40L or 41 BBL, or combinations of these molecules, can be used as biological adjuvants (see, for example, Salgaller et al., 1998, J. Surg. Oncol. 68(2):122-38; Lotze et al., 2000. Cancer J Sci. Am.
- IL-2 IL-2, RANTES, GM-CSF, TNF- ⁇ , IFN- ⁇ , G-CSF, LFA-3, CD72, B7-1, B7-2, B7-1, B7-2, OX-40L, 41 BBL and/or ICAM-1 are administered.
- L-15 or an IL-15/IL-15 receptor complex can be administered.
- a non-pox non-yeast vector is administered that encodes one or more immunostimulatory or costimulatory molecules, such as IL-2, IL-6, IL-12, IL-15, LFA (for example, LFA-1, LFA-2 and/or LFA-3), CD72, RANTES, G-CSF, GM-CSF, TNF- ⁇ , IFN- ⁇ , ICAM-1, B7-1, B7-2, other B7 related molecules, OX-40L or 41 BBL, or combinations of these molecules (see, for example, Salgaller et al., 1998, J. Surg. Oncol. 68(2):122-38; Lotze et al., 2000, Cancer J Sci. Am.
- the vector can encode IL-2, RANTES, GM-CSF, TNF- ⁇ , IFN- ⁇ , G-CSF, LFA-3, CD72, B7-1, B7-2, B7-1, B7-2, OX-40L, 41 BBL and/or ICAM-1.
- the nucleic acid encoding the biological adjuvant can be cloned into same vector as the Brachyury protein or Brachyury polypeptide coding sequence, or the nucleic acid can be cloned into one or more separate vectors for co-administration.
- nonspecific immunomodulating factors such as Bacillus Cahnette-Guerin (BCG) and levamisole can be co-administered.
- nucleic acids are direct immunization with plasmid DNA, such as with a mammalian expression plasmid.
- plasmid DNA such as with a mammalian expression plasmid.
- the nucleotide sequence encoding a Brachyury protein or polypeptide can be placed under the control of a promoter to increase expression of the molecule.
- the methods include liposomal delivery of the nucleic acids (or of the synthetic peptides themselves), and immune-stimulating constructs, or ISCOMSTM, negatively charged cage-like structures of 30-40 nm in size formed spontaneously on mixing cholesterol and Quil ATM (saponin).
- ISCOMSTM immune-stimulating constructs
- Protective immunity has been generated in a variety of experimental models of infection, including toxoplasmosis and Epstein-Barr virus-induced tumors, using ISCOMSTM as the delivery vehicle for antigens (Mowat and Donachie, Immunol. Today 12:383, 1991).
- Doses of antigen as low as 1 ⁇ g encapsulated in ISCOMSTM have been found to produce Class I mediated CTL responses (Takahashi et al., Nature 344:873, 1990).
- the nucleic acid can be loaded onto gold microspheres by standard methods and introduced into the skin by a device such as Bio-Rad's HELIOSTM Gene Gun.
- the nucleic acids can be “naked,” consisting of plasmids under control of a strong promoter.
- the DNA is injected into muscle, although it can also be injected directly into other sites, including tissues in proximity to metastases. Dosages for injection are usually around 0.5 ⁇ g/kg to about 50 mg/kg, and typically are about 0.005 mg/kg to about 5 mg/kg (see, for example, U.S. Pat. No. 5,589,466).
- a Brachyury protein or Brachyury polypeptide can also be expressed by attenuated host cells or non-pox non-yeast viral vectors.
- Suitable non-pox non-yeast viral vector include an adenovirus, an alphvirus, a lentivirus, a measles virus or a poliovirus vector.
- Suitable host cell include an attenuated bacterium, such as Listeria or Salmonella host cells.
- a first recombinant non-pox virus encoding a Brachyury protein can be used in conjunction with a second recombinant non-pox virus which has incorporated into a viral genome or infectable portion thereof one or more genes or DNA sequences encoding B7-1, B7-2, or B7-1 and B7-2, wherein the composition is able to coinfect a host cell resulting in coexpression of the polypeptide and the B7-1, B7-2, or B7-1 and B7-2 encoding genes or DNA sequences (see U.S. Pat. No. 6,893,869, and U.S. Pat. No. 6,045,908, which are incorporated by reference herein).
- the expression of the B7 gene family has been shown to be an important mechanism of anti-tumor responses in both mice and humans.
- each recombinant virus in the composition in the range of from about 10′ to about 10 10 plaque forming units/mg mammal, although a lower or higher dose can be administered.
- the composition of recombinant viral vectors can be introduced into a mammal either prior to any evidence of a cancer, or to mediate regression of the disease in a mammal afflicted with the cancer. Examples of methods for administering the composition into mammals include, but are not limited to, exposure of cells to the recombinant virus ex vivo, or injection of the composition into the affected tissue or intravenous, subcutaneous, intradermal or intramuscular administration of the virus.
- the recombinant viral vector or combination of recombinant viral vectors may be administered locally by direct injection into the cancerous lesion in a pharmaceutically acceptable carrier.
- the quantity of recombinant non-pox viral vector, carrying the nucleic acid sequence of a Brachyury protein or Brachyury polypeptide to be administered is based on the titer of virus particles.
- An exemplary range of the immunogen to be administered is 10 5 to 10 10 virus particles per mammal, such as a human.
- the mammal can be immunized with different ratios of the first and second recombinant viral vector.
- the ratio of the first vector to the second vector is about 1:1, or about 1:3, or about 1:5.
- Optimal ratios of the first vector to the second vector may easily be titered using the methods known in the art (see, for example, U.S. Pat. No. 6,893,869, incorporated herein by reference).
- an immunostimulatory molecule and the Brachyury protein or Brachyury polypeptide enhances the generation of specific effectors.
- different mechanisms might be responsible for the enhanced immunogenicity: augmentation of help signal (IL-2), recruitment of professional APC (GM-CSF), increase in CTL frequency (IL-2), effect on antigen processing pathway and MHC expression (IFN ⁇ and TNF ⁇ ) and the like.
- IL-2, IL-6, IL-15, interferon, tumor necrosis factor, or a nucleic acid encoding these molecules can be administered in conjunction with a Brachyury protein, or a nucleic acid encoding a Brachyury protein or Brachyury polypeptide.
- the co-expression of a Brachyury protein or Brachyury polypeptide together with at least one immunostimulatory molecule can be effective in an animal model to show anti-tumor effects.
- compositions are administered depending on the dosage and frequency as required and tolerated by the subject.
- the dosage is administered once as a bolus, but in another embodiment can be applied periodically until a therapeutic result is achieved.
- the dose is sufficient to induce an immune response to Brachyury, to treat or ameliorate symptoms or signs of disease, without producing unacceptable toxicity to the subject.
- Systemic or local administration can be utilized.
- antigen presenting cells such as dendritic cells
- APCs are pulsed or co-incubated with a Brachyury protein and/or Brachyury polypeptide in vitro.
- the antigen presenting cells can be autologous cells.
- a therapeutically effective amount of the antigen presenting cells, such as dendritic cells presenting epitopes of the protein or polypeptide can then be administered to a subject.
- the method is a method of treating and/or preventing cancer in a subject.
- the Brachyury protein and/or Brachyury polypeptide can be delivered to the dendritic cells or to dendritic cell precursors via any method known in the art, including, but not limited to, pulsing dendritic cells directly with antigen, or utilizing a broad variety of antigen delivery vehicles, such as, for example, liposomes, or other vectors known to deliver antigen to cells.
- an antigenic formulation includes about 0.1 ⁇ g to about 1,000 ⁇ g, or about 1 to about 100 ⁇ g of a selected Brachyury protein.
- the Brachyury protein can also be administered with agents that promote dendritic cell maturation.
- agents of use are interleukin-4 (IL-4) and granulocyte/macrophage colony stimulating factor (GM-CSF), or flt-3 ligand (flt-3L).
- IL-4 interleukin-4
- GM-CSF granulocyte/macrophage colony stimulating factor
- flt-3L flt-3 ligand
- the preparation can also contain buffers, excipients, and preservatives, amongst other ingredients.
- mature antigen presenting cells are generated to present the Brachyury protein and/or Brachyury polypeptide epitopes. These dendritic cells are then administered alone (or in combination with another agent) to a subject with a cancer that expresses Brachyury, or has the potential to express Brachyury, such as a small intestine, stomach, kidney, bladder, uterus, ovary, testis, lung colon, prostate cancer, a tumor of B cell origin (such as chronic lymphocytic leukemia (CLL), a B cell lymphoma, Burkitt's lymphoma or a Hodgkin's lymphoma) or breast cancer, such as an infiltrating ductal carcinoma or an estrogen receptor negative and progesterone receptor negative breast cancer.
- a cancer that expresses Brachyury such as a small intestine, stomach, kidney, bladder, uterus, ovary, testis, lung colon, prostate cancer, a tumor of B cell origin (such as chronic lymphocy
- the cancer is radiation resistant and/or chemotherapy resistant.
- the antigen presenting cells can also be administered to prevent these cancers.
- the subject can have high grade prostatic intraepithelial neoplasia, familial adenomatous polyposis, or atypia of the breast.
- the cells can be administered to a subject to inhibit the growth of cells of Brachyury expressing cancer or a cancer that has the potential to express Brachyury.
- a therapeutically effective amount of activated antigen presenting cells are administered to a subject suffering from a disease, in an amount sufficient to raise an immune response to Brachyury-expressing cells.
- the resulting immune response is sufficient to slow the proliferation of such cells or to inhibit their growth, or to reduce a sign or a symptom of the tumor.
- any of these immunotherapies is augmented by administering a cytokine, such as interleukin (IL)-2, IL-3, IL-6, IL-10, IL-12, IL-15, GM-CSF, or interferons.
- a cytokine such as interleukin (IL)-2, IL-3, IL-6, IL-10, IL-12, IL-15, GM-CSF, or interferons.
- the mature dendritic cells are administered in conjunction with a chemotherapeutic agent.
- the subject is administered a Brachury protein, a Brachyury polypeptide, a nucleic acid encoding a Brachyury protein, a host cell expressing the Brachyury protein, and/or dendritic cells, and is administered an additional agent.
- this administration is sequential. However, the administration can be simultaneous.
- the subject has cancer.
- the cancer can express Brachyury or have the potential to express Brachyury.
- the additional agent can be a chemotherapeutic agent.
- Additional agents include radiation, small molecule targeted therapies, monoclonal antibodies, and/or checkpoint inhibitors, such as anti-PD-1, anti-PD-L1, anti-CTLA-4, and others.
- the subject is administered an epithelial growth factor receptor inhibitor, a transforming growth factor (TGF)-3 inhibitor, or a tyrosine kinase inhibitor.
- TGF transforming growth factor
- the additional chemotherapeutic agent is an epithelial growth factor receptor (EGFR) inhibitor.
- EGFR epithelial growth factor receptor
- Numerous compounds are known that inhibit EGFR, see for example, U.S. Pat. Nos. 5,196,446; 5,217,999; 5,459,061; 7,049,410; 6,355,678, which are incorporated herein by reference.
- a number of EGFR inhibitors are in clinical development, such as for the treatment of lung cancer.
- the additional chemotherapeutic agent is a tyrosine kinase inhibitor. These include, but are not limited to avastin and termsirolimus.
- alkylating agents examples include nitrogen mustards (such as mechlorethamine, cyclophosphamide, melphalan, uracil mustard or chlorambucil), alkyl sulfonates (such as busulfan), nitrosoureas (such as carmustine, lomustine, semustine, streptozocin, or dacarbazine).
- alkylating agents include nitrogen mustards (such as mechlorethamine, cyclophosphamide, melphalan, uracil mustard or chlorambucil), alkyl sulfonates (such as busulfan), nitrosoureas (such as carmustine, lomustine, semustine, streptozocin, or dacarbazine).
- antimetabolites include folic acid analogs (such as methotrexate), pyrimidine analogs (such as 5-FU or cytarabine), and purine analogs, such as mercaptopurine or thi
- Examples of natural products include vinca alkaloids (such as vinblastine, vincristine, or vindesine), epipodophyllotoxins (such as etoposide or teniposide), antibiotics (such as dactinomycin, daunorubicin, doxorubicin, bleomycin, plicamycin, or mitocycin C), and enzymes (such as L-asparaginase).
- vinca alkaloids such as vinblastine, vincristine, or vindesine
- epipodophyllotoxins such as etoposide or teniposide
- antibiotics such as dactinomycin, daunorubicin, doxorubicin, bleomycin, plicamycin, or mitocycin C
- enzymes such as L-asparaginase
- miscellaneous agents include platinum coordination complexes (such as cis-diamine-dichloroplatinum II also known as cisplatin), substituted ureas (such as hydroxyurea), methyl hydrazine derivatives (such as procarbazine), and adrenocrotical suppressants (such as mitotane and aminoglutethimide).
- platinum coordination complexes such as cis-diamine-dichloroplatinum II also known as cisplatin
- substituted ureas such as hydroxyurea
- methyl hydrazine derivatives such as procarbazine
- adrenocrotical suppressants such as mitotane and aminoglutethimide
- hormones and antagonists include adrenocorticosteroids (such as prednisone), progestins (such as hydroxyprogesterone caproate, medroxyprogesterone acetate, and magestrol acetate), estrogens (such as diethylstilbestrol and ethinyl estradiol), antiestrogens (such as tamoxifen), and androgens (such as testosterone proprionate and fluoxymesterone).
- adrenocorticosteroids such as prednisone
- progestins such as hydroxyprogesterone caproate, medroxyprogesterone acetate, and magestrol acetate
- estrogens such as diethylstilbestrol and ethinyl estradiol
- antiestrogens such as tamoxifen
- androgens such as testosterone proprionate and fluoxymesterone
- Examples of the most commonly used chemotherapy drugs that can be concurrently administered with the disclosed immunotherapy include Adriamycin, Alkeran, Ara-C, BiCNU, Busulfan, CCNU, Carboplatinum, Cisplatinum, Cytoxan, Daunorubicin, DTIC, 5-FU, Fludarabine, Hydrea, Idarubicin, Ifosfamide, Methotrexate, Mithramycin, Mitomycin, Mitoxantrone, Nitrogen Mustard, Taxol (or other taxanes, such as docetaxel), Velban, Vincristine, VP-16, while some more newer drugs include Gemcitabine (Gemzar), Herceptin, Irinotecan (Camptosar, CPT-11), Leustatin, Navelbine, Rituxan STI-571, Taxotere.
- Topotecan Hycamtin
- Xeloda Capecitabine
- Zevelin Zevelin
- immunomodulators include AS-101 (Wyeth-Ayerst Labs.), bropirimine (Upjohn), gamma interferon (Genentech), GM-CSF (granulocyte macrophage colony stimulating factor, Genetics Institute), IL-2 (Cetus or Hoffman-LaRoche), human immune globulin (Cutter Biological), IMREG (from Imreg of New La, La.), SK&F 106528, and TNF (tumor necrosis factor; Genentech).
- the additional agent can be a small molecule, a vaccine, or a biologic.
- the vaccine can be a yeast-based or viral-based (e.g., poxviral-based) vaccine.
- viral vectors include poxvirus, retrovirus, adenovirus, adeno-associated virus, herpes virus, polio virus, alphavirus, baculorvirus, and Sindbis virus.
- the viral vector is a poxvirus selected from the group consisting of orthopox, avipox, fowlpox, raccoon pox, rabbit pox, capripox (e.g., sheep pox), leporipox, and suipox (e.g., swinepox).
- avipox viruses include fowlpox, pigeonpox, and canarypox, such as ALVAC.
- orthopox viruses examples include vaccinia, modified vaccinia Ankara (MVA), Wyeth, NYVAC, TROYVAC, Dry-Vax, POXVAC-TC (Schering-Plough Corporation), and derivatives thereof.
- VVA modified vaccinia Ankara
- Wyeth NYVAC
- TROYVAC Dry-Vax
- POXVAC-TC Stchering-Plough Corporation
- derivatives of the Wyeth strain include, but are not limited to, derivatives which lack a functional K1L gene.
- the vaccine can encode any suitable antigen, such as the Brachyury protein or Brachyury polypeptide described herein, 5- ⁇ -reductase, ⁇ -fetoprotein (“AFP”), AM-1, APC, April, B melanoma antigen gene (“BAGE”), ⁇ -catenin, Bc112, bcr-abl, Brachyury, CA-125, caspase-8 (“CASP-8”, also known as “FLICE”), Cathepsins, CD19, CD20, CD21/complement receptor 2 (“CR2”), CD22/BL-CAM, CD23/F c ⁇ RII, CD33, CD35/complement receptor 1 (“CR1”), CD44/PGP-1, CD45/leucocyte common antigen (“LCA”), CD46/membrane cofactor protein (“MCP”), CD52/CAMPATH-1, CD55/decay accelerating factor (“DAF”), CD59/protectin, CDC27, CDK4, carcinoembryonic antigen (“
- the vaccine is PROSTVACTM, which is a sequentially dosed combination of two different poxviruses each encoding prostate specific antigen (PSA) plus three immune enhancing co-stimulatory molecules, B7.1, ICAM-1, and LFA-3 (TRICOM).
- the first poxvirus is Vaccinia-PSA-TRICOM
- the second poxvirus is Fowlpox-PSA-TRICOM.
- the invention provides a method for treating or preventing cancer in a subject comprising administering to the subject a combination therapy comprising:
- a protein comprising an amino acid sequence at least 90% identical to the amino acid sequence set forth as SEQ ID NO: 1;
- a polypeptide comprising at least 15 consecutive amino acids of the amino acid sequence set forth at SEQ ID NO: 1;
- a nucleic acid encoding the protein or the polypeptide;
- a host cell expressing the protein or the polypeptide; or
- a non-pox non-yeast vector encoding the protein or the polypeptide
- Example 1 Induction of CD4+ Cells Using Brachyury Protein or Brachyury Polypeptide
- FIGS. 1 and 2 show the induction of CD4+ cells using Brachyury protein and a Brachyury polypeptide.
- FIG. 1 I. FIG. 1
- DCs Dendritic cells from 2 normal donors were prepared from the adherent cell fraction of peripheral blood mononuclear cells (PBMCs) by culture in the presence of GM-CSF and IL-4. On day 5, a purified, recombinant full length Brachyury protein was added to the cultures (10 ⁇ g/ml) for 48 hours. For donor 2, an additional culture was set up using purified HSA (human serum albumin) control protein (10 ⁇ g/ml). On day 7, protein-pulsed DCs were harvested, irradiated (20 Gy) and used as antigen-presenting cells (APCs) to stimulate autologous PBMCs (ratio DC:PBMCs equal to 1:10).
- HSA human serum albumin
- IL-2 (20 U/ml) was added to the cultures.
- Cells were harvested on day 7 and CD4+ T cells were isolated by negative selection utilizing CD4 purification magnetic beads (Miltenyi Biotec). CD4+ T cells were subsequently stimulated in a similar manner for an additional 7-day cycle.
- CD4+ T cells were re-purified by using CD4 purification magnetic beads, and evaluated for IFN-gamma production in response to autologous, irradiated PBMCs (ratio PBMCs:CD4+ T cells equal to 3:1) alone or pulsed with control HSA protein vs. Brachyury protein (10 ⁇ g/ml). Culture supernatants were collected at 96 hours and evaluated for IFN-gamma by ELISA.
- Brachyury-specific CD4+ T cells can be expanded from the blood of normal donors by culture of PBMCs in the presence of autologous DCs pulsed with a purified, full length Brachyury protein. After 2 rounds of in vitro stimulation, Brachyury-specific CD4+ T cells specifically released IFN-gamma in response to stimulation with autologous PBMCs pulsed with purified Brachyury protein (full length, recombinant) but not with a control, irrelevant protein (HAS).
- HAS control, irrelevant protein
- a CD4+ Brachyury-specific T-cell line was generated from a prostate patient vaccinated with a PSA-based vaccine.
- CD40L-matured autologous DCs were used as antigen-presenting cells (APCs).
- PBMCs obtained on day 90 post-vaccination were added to the APCs and pulsed with 10 ⁇ g/mL of Brachyury 9-mer agonist peptide (WLLPGTSTV) at an effector:APC ratio of 10:1.
- WLLPGTSTV Brachyury 9-mer agonist peptide
- the culture was then supplemented with recombinant human IL-7 and IL-15 at a concentration of 10 ng/ml for 5 days.
- the 3-day incubation with peptide and 5-day IL-7 and IL-15 supplement constituted one in vitro stimulation (IVS) cycle.
- Autologous DCs were used as APCs for 3 in vitro stimulation (IVS) cycles.
- Irradiated (23,000 rads) autologous EBV-transformed B cells were used as APCs after the third IVS cycle.
- peptides at a concentration of 10 ⁇ g/mL were used to pulse the autologous EBV-transformed B cells at an effector:APC ratio of 1:3.
- CD4+ T cells were then isolated from the cell culture at the end of the 4th IVS and stimulated with a Brachyury class II 15-mer peptide (Brachyury class IIB)(QWGWLLPGTSTL). The cultures were then supplemented with recombinant human IL-7 and IL-15 at a concentration of 10 ng/mL for 5 days. The CD4+ T cell line was then assayed for specificity to the Brachyury class IIB epitope by stimulation with APCs pulsed with the Brachyury class IIB or a control Brachyury class IIA epitope.
- Brachyury class IIB Brachyury class II 15-mer peptide
- FIGS. 3-7 show the results achieved.
- the breast primary tumor tissue samples were from 30 infiltrating ductal adenocarcinomas. Brachyury expression for each sample is reported as staining in tumor cells (% positivity, intensity), staining in breast adjacent tissue, and staining in breast distal tissue.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- Microbiology (AREA)
- Genetics & Genomics (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Oncology (AREA)
- Biochemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Biophysics (AREA)
- Zoology (AREA)
- Biotechnology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Pathology (AREA)
- Physics & Mathematics (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Toxicology (AREA)
- Cell Biology (AREA)
- Food Science & Technology (AREA)
- Hospice & Palliative Care (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Radiology & Medical Imaging (AREA)
- Virology (AREA)
Abstract
Description
- This patent application is a divisional application of U.S. patent application Ser. No. 14/428,308, filed Mar. 13, 2015, now abandoned, which claims the benefit of U.S. national phase of International Patent Application No. PCT/US2013/059737, filed Sep. 13, 2013, which claims the benefit of U.S. Provisional Patent Application No. 61/701,525, filed Sep. 14, 2012, each of which is incorporated by reference in its entirety herein.
- Incorporated by reference in its entirety herein is a nucleotide/amino acid sequence listing submitted concurrently herewith and identified as follows: One 14,638 Byte ASCII (Text) file named “740352_ST25.TXT,” created on Aug. 21, 2018.
- The nucleic and amino acid sequences listed in the accompanying sequence listing are shown using standard letter abbreviations for nucleotide bases, and three letter code for amino acids, as defined in 37 C.F.R. 1.822. Only one strand of each nucleic acid sequence is shown, but the complementary strand is understood as included by any reference to the displayed strand. In the accompanying sequence listing:
- SEQ ID NO: 1 is an amino acid sequence of a human Brachyury protein.
- SEQ ID NO: 2 is a nucleic acid sequence encoding a human Brachyury protein.
- SEQ ID NO: 3 is an amino acid sequence of a murine Brachyury protein.
- SEQ ID NO: 4 is a nucleic acid sequence encoding a murine Brachyury protein.
- SEQ ID NO: 5 is a Brachyury class IIA epitope.
- SEQ ID NO: 6 is a Brachyury class IIB epitope.
- This application relates to the field of cancer therapeutics, specifically to the use of a Brachyury protein and non-poxvirus, non-yeast vectors encoding a Brachyury protein for the treatment of cancer.
- The Brachyury gene was initially cloned from mouse developmental mutants characterized by an arrest in mesoderm formation (Hermann et al, Nature 1990; 343:617-22) has been recognized as gene that is important in mesoderm development during gastrulation. Brachyury is a member of a family of transcription factors, designated T-box transcription factors, these factors are characterized by a conserved DNA-binding domain (Papaioannou et al., Bioessays 1998; 20:9-19). These transcription factors play an essential role in the formation and organization of mesoderm in vertebrates (see, for example, Edwards et al., Genome Res 1996; 6:226-33). In addition to the important role of the T-box proteins in the control of developmental processes, several members of this family are deregulated in cancer. For example, the human Tbx2 gene has been reported to be amplified in pancreatic cancer cell lines (Mahlamaki et al., Genes Chromosomes Cancer 2002, 35:353-8) and is overexpressed in BRCA-1- and BRCA-2-mutated breast tumors (Sinclair et al., Cancer Res 2002; 62:3587-91). In addition, Tbx3 expression has been shown to be augmented in certain human breast cancer cell lines (Fan et al., Cancer Res 2004; 64:5132-9). Expression of Brachyury has also been documented in human teratocarcinoma lines: a subset of germ cell tumors, teratocarcinomas are embryonal carcinoma cells with competence for mesoderm differentiation (Gokhale et al., Cell Growth Differ 2000; 11:157-62) and in chordomas (see, for example, Vojovic et al., J Pathol 2006; 209:157-65).
- Immunotherapeutic interventions against cancer depend on the identification of tumor antigens able to elicit a host immune response against the tumor cells. Good targets are molecules that are selectively expressed by malignant cells and that are also essential for malignant transformation and/or tumor progression. The epithelial-mesenchymal transition (EMT) has been recognized as a key step during the progression of primary tumors into metastases (Thiery et al., Nat Rev Cancer 2002; 2:442-54). Several molecules have been identified that play a key role in EMT during tumor progression (Huber et al., Curr Opin Cell Biol 2005; 17:548-58), among them the transcription factors Twist, Snail, and Slug (Yang et al., Cell 2004; 117:927-39; Cano et al., Nat Cell Biol 2000; 2: 76-83). Molecules that trigger EMT could function to prevent tumor invasion and metastasis. However, a need remains for reagents that induce an effective immune response to cancer, including a CD4 and a CD8 T cell response.
- It is disclosed herein that Brachyury protein or a Brachyury polypeptide can be used to induce Brachyury-specific CD4+ T cells in vivo and ex vivo. It is also disclosed that Brachyury protein and Brachyury polypeptides can be used to stimulate the production of both Brachyury-specific CD4+ T cells and Brachyury-specific CD8+ T cells. Brachyury is expressed in numerous human cancers, such as in cancer of the small intestine, stomach, kidney bladder, uterus, ovary, testes, lung, colon, prostate, bronchial tube, chronic lymphocytic leukemia (CLL), other B cell-based malignancies, and breast cancer, such as infiltrating ductal carcinomas of the breast. Thus, Brachyury protein, Brachyury polypeptides, and nucleic acids encoding Brachyury protein and/or polypeptides, can be used to produce Brachyury specific CD4+ T cells, and CD8+ T cells, that can be used for the treatment or prevention of cancer.
- In some embodiments, methods are disclosed for inducing CD4+ Brachyury-specific T cells and/or CD8+ Brachyury specific T cells. The methods include the use of a Brachyury protein, a Brachyury polypeptide, nucleic acids encoding the Brachyury protein and/or Brachyury polypeptides, or host cells expressing the Brachyury protein or polypeptide, such as such as a Salmonella or Lisleria host cells. These agents can be administered either alone or in conjunction with another agent, such as a cytokine and/or another cancer therapy. In some embodiments, methods are disclosed for treating a subject with a cancer, such as a breast cancer, cancer of the small intestine, stomach, kidney, bladder, uterus, ovaries, testes lung, colon or prostate, or a tumor of B cell origin, or for preventing these cancers in a subject. In some embodiments, the methods include measuring Brachyury-specific CD4+ T cells. In further embodiments, the methods also induce CD8+ Brachyury specific T cells.
- Non-pox non-yeast vectors encoding a Brachyury protein are disclosed that can be used to induce CD4+ Brachyury-specific T cells and/or CD8+ Brachyury-specific T cells. In some non-limiting examples, the vector is an alphavirus, a lentiviurs, an adenovirus, a measles virus or a poliovirus vector. In additional embodiments, host cells transformed with these vectors, such as Salmonella and Listeria host cells are provided.
- In additional embodiments, methods are provided for inhibiting the growth of a cancer cell in a subject. These methods include contacting a dendritic cell with a protein comprising an amino acid sequence at least 90% identical to the amino acid sequence set forth as SEQ ID NO: 1, a polypeptide comprising at least 15 consecutive amino acids of the amino acid sequence set forth at SEQ ID NO: 1 that specifically binds a Major Histocompatibility Class (MHC class II) molecule, or a Listeria or Salmonella host cell expressing the protein or the polypeptide thereby preparing a specific antigen presenting cell. These methods also include administering the antigen presenting cell to the subject, thereby inducing an immune response and inhibiting the growth of the cancer cell.
- The foregoing and other features and advantages will become more apparent from the following detailed description of several embodiments, which proceeds with reference to the accompanying figures.
-
FIG. 1 . Brachyury-specific CD4+ T cells can be expanded from PBMCs of normal donors by culture in the presence of purified recombinant Brachyury protein. Dendritic cells (DCs) from 2 normal donors were prepared by culture in the presence of GM-CSF and IL-4. On day 5, a purified recombinant Brachyury protein was added (10 g/ml) for 48 hours. Fordonor 2, an additional culture was set up using purified HSA (human serum albumin) control protein (10 μg/ml). On day 7, protein-pulsed DCs were harvested, irradiated (20 Gy) and used as antigen-presenting cells (APCs) to stimulate autologous PBMCs (ratio DC:PBMCs equal to 1:10). Ondays 3 and 5, IL-2 (20 U/ml) was added to the cultures. T cells were harvested on day 7 and CD4+ T cells were isolated by negative selection with magnetic beads. CD4+ T cells were stimulated in similar manner for an additional 7-day cycle. On day 7, CD4+ T cells were re-isolated by using magnetic beads and evaluated for IFN-gamma production in response to autologous, irradiated PBMCs (ratio PBMCs:T cells equal to 3:1) alone or pulsed with control HSA protein vs. Brachyury protein (10 μg/ml). Culture supernatants were collected at 96 hours and evaluated for IFN-gamma by ELISA. -
FIG. 2 . A Brachyury-specific CD4 T cell line releases cytokines and chemokines when stimulated with a class-II DRB1*0401 binding Brachyury peptide. Brachyury class IIA epitope (SEQ ID NO: 5) and Brachyury class IIB epitope (SEQ ID NO: 6). -
FIG. 3A-3E . Brachyury induces an epithelial-to-mesenchymal transition (EMT) in breast carcinoma cells. (A) MCF7-pcDNA and MCF7-phBrachyury stable transfectants grown on plastic surface for bright field images (top panels) and grown immunofluorescence analysis of E-cadherin expression (green signal); blue signal represents DAPI-stained nuclei (bottom panels). (B) Membrane images from in vitro cell migration (top panels) and ECM invasion assays (bottom panels) for MCF7-pcDNA and MCF7-pBrachyury cells. Results are representative of three experiments. (C, D) Real-time PCR was performed on indicated cell pairs for Brachyury, Fibronectin, and Vimentin. Values (mean±SEM) are expressed as a ratio to the endogenous control GAPDH. (E) Immunofluoresent analysis of Fibronectin expression in MDA-MB-436-con.shRNA and MDA-MB-436-Br.shRNA stable transfectants (original magnification 20×). The green signal represents staining for Fibronectin; the blue signal represents the DAPI-stained nuclei. -
FIGS. 4A-4D . Effect of Brachyury expression on stem cell marker expression and mammosphere growth of tumor cells. Real-time PCR was performed for indicated genes on cDNA from (A) MCF7-pcDNA and MCF7-phBrachyury cells and (C) MDA-MB-436-con.shRNA and MDA-MB-436-Br.shRNA cells. Values (mean±SEM) are expressed as a ratio to the endogenous control GAPDH. Mammospheres were grown from the MCF7 (B) or the MDA-MB-436 (D) tumor cell pairs on ultra-low-attachment plates. Primary mammospheres were dissociated and re-plated for secondary cultures. Bright field images of mammospheres at 10× magnification and mean number of mammospheres per 10× microscope field are shown for secondary cultures in the left and right panels, respectively. Error bars indicate SEM of 8-10 measurements. -
FIGS. 5A-5D . Expression of Brachyury mRNA in breast carcinoma tissues. (A) Real-time PCR was performed for Brachyury, Twist, Snail, and Slug on human breast primary tumor tissue cDNA from 41 breast cancer patients. As controls, 7 samples of normal breast cDNA were also analyzed, each obtained from a histologically normal section of breast from a patient with cancer or fibrocystic disease. (B) Real-time PCR was performed for Brachyury on human primary breast tumor tissue cDNA from 107 invasive ductal adenocarcinomas, 6 invasive lobular adenocarcinomas, and 5 mixed ductal/lobular adenocarcinomas. As controls, 7 samples of normal breast cDNA were also analyzed, each obtained from a histologically normal section of breast from a patient with cancer or fibrocystic disease. All values and the means for each group are expressed as a ratio to the endogenous control GAPDH. Brachyury expression is shown for (B) breast primary tumor tissues from stages I-III grouped together, (C) breast primary tumor tissues grouped by histological tumor grade (Nottingham grading), (D) breast primary tumor tissues grouped by ER and PR expression (ER+PR+ versus ER−PR−). -
FIGS. 6A-6F . Immunohistochemical detection of Brachyury in primary breast carcinoma and metastatic tissues. Transmitted light photomicrographs of tissue sections stained for Brachyury expression in (A) a primary infiltrating ductal carcinoma, Grade 3 (patient 11); (B) a primary infiltrating ductal carcinoma,Grade 3 and (C) corresponding lymph node metastasis from the same patient (patient 6); (D, E) bone metastatic lesions from two different breast cancer patients (patients 22 and 23); (F) brain metastatic lesion from a breast cancer patient (patient 24). The brown signal represents staining for Brachyury.Magnification 20× (A-F). -
FIG. 7A-7C . Immunogenicity of Brachyury. (A) Detection of IgG antibodies against Brachyury in the serum of normal donors and metastatic breast cancer patients. Shown is the number of positive cases in each group, stratified by titer of IgG as determined by ELISA assay. Statistical analysis was performed, comparing breast vs. normal donors. Brachyury-specific CTLs were generated from the peripheral blood of a prostate cancer patient via stimulation with a Brachyury-derived peptide. Cytotoxic activity was assessed in a 16-h assay against (B) HLA-A2+/Brachyury+ MCF7 cells or HLA-A2−/Brachyury+ MDA-MB-436 cells, and (C) HLA-A2+/Brachyury+ MDA-MB-231 cells. The effector-to-target (E:T) ratios are indicated; major histocompatibility complex (MHC)-restriction was analyzed by pre-incubation of the targets with control IgG or a HLA-A specific antibody. - It is disclosed herein that Brachyury protein and Brachyury polypeptides of greater than 15 amino acids in length can be used to induce Brachyury-specific CD4+ T cells in vivo and ex vivo. It is also disclosed that Brachyury protein and Brachyury polypeptides can be used to stimulate the production of both Brachyury-specific CD4+ T cells and Brachyury-specific CD8+ T cells. Brachyury protein is expressed in numerous human cancers, such as cancer of the small intestine, stomach, kidney bladder, uterus, ovary, testes, lung, colon, prostate, bronchial tube, chronic lymphocytic leukemia (CLL), other B cell-based malignancies and breast cancer, such as infiltrating ductal carcinomas of the breast and thus the method disclosed herein can be used to treat or prevent these cancers. In specific non-limiting examples, the breast cancer is an estrogen receptor negative and progesterone receptor negative breast cancer. In additional non-limiting examples, the cancer is any cancer that is radiation resistant and/or chemotherapy resistant. The cancer can express Brachyury or have the potential to express Brachyury.
- Non-pox non-yeast vectors encoding a Brachyury protein or a Brachyury polypeptide, and host cells expressing Brachyury are disclosed, these vectors and host cells can be used to induce CD4+ Brachyury-specific T cells and/or CD8+ T cells. In some non-limiting examples, these vectors are adenovirus vectors, alphavirus vectors, lentivirus vectors, poliovirus vectors, Listeria vectors, Salmonella vectors or measles virus vectors. In additional embodiments, host cells transformed with these vectors, and methods of using these proteins, polynucleotides, vectors, and host cells are provided. In some examples the host cells are Salmonella or Listeria host cells.
- Thus, methods are provided for inducing CD4+ Brachyury-specific T cells and/or CD8+ T cells. The methods include the use of a Brachyury protein, Brachyury polypeptide, dendritic cells expressing Brachyury epitopes, nucleic acids encoding Brachyury protein and/or polyhpeptides, including non-pox non-yeast vectors encoding the Brachyury protein and/or the Brachyury polypeptide to induce the production of CD4+ Brachyury specific T cells. In some embodiments, methods are disclosed for treating a subject having cancer, such as, but not limited to, a cancer of the small intestine, stomach, kidney bladder, uterus, ovary, testes, lung, colon, prostate, bronchial tube, chronic lymphocytic leukemia (CLL), other B cell-based malignancies, or breast cancer, such as an infiltrating ductal carcinoma or estrogen receptor negative and progesterone receptor negative breast cancers. Any of these cancers can be chemotherapy resistant and/or radiation resistant. The cancer can express Brachyury or have the potential to express Brachyury. Methods are also disclosed for preventing these cancers.
- These methods include inducing CD4+ Brachyury-specific T cells; the method can also include inducing CD8+ Brachyury-specific T cells. The Brachyury protein, Brachyury polypeptide, dendritic cells, nucleic acid, or non-pox non-yeast vector encoding the Brachyury protein can be administered to the subject either alone or in conjunction with a second agent, such as radiation therapy and/or chemotherapy.
- In some embodiments, the Brachyury protein comprises an amino acid sequence at least 90% identical, or at least 95% identical, to the amino acid sequence set forth as SEQ ID NO: 1. In other embodiments, the Brachyury protein comprises, or consists of, the amino acid sequence set forth as SEQ ID NO: 1, the amino acid sequence set forth as SEQ ID NO: 1 without the N-terminal methionine, or the amino acid sequence set forth as SEQ ID NO: 1, with substitutions at position 177 (Asp vs. Gly, respectively), position 368 (Thr vs. Ser, respectively) and position 409 (Asn vs. Asp, respectively).
- In further embodiments, a Brachyury polypeptide comprises at least 15 amino acids of the amino acid sequence set forth as SEQ ID NO: 1, such as at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 200 amino acids of the amino acid sequence set forth as SEQ ID NO: 1, wherein the entirety of SEQ ID NO: 1 is not included in the polypeptide. In additional embodiments, a Brachyury polpeptide is 15 to 100 amino acids of SEQ ID NO: 1, such as 15 to 200 amino acids, 15 to 300 amino acids, 15 to 400 amino acids, or 15 to 435 amino acids of SEQ ID NO: 1.
- In additional embodiments, methods are provided for inhibiting the growth of a cancer cell in a subject. These methods include contacting a dendritic cell with a protein comprising an amino acid sequence at least 90% identical to the amino acid sequence set forth as SEQ ID NO: 1, a polypeptide comprising at least 15 consecutive amino acids of the amino acid sequence set forth at SEQ ID NO: 1 that specifically binds a Major Histocompatibility Class (MHC class II) molecule, or a Listeria or Salmonella host cell expressing the protein, thereby preparing a specific antigen presenting cell. These methods also include administering the antigen presenting cell to the subject, thereby inducing an immune response and inhibiting the growth of the cancer cell.
- Unless otherwise noted, technical terms are used according to conventional usage. Definitions of common terms in molecular biology may be found in Benjamin Lewin, Genes V, published by Oxford University Press, 1994 (ISBN 0-19-854287-9); Kendrew et al. (eds.), The Encyclopedia of Molecular Biology, published by Blackwell Science Ltd., 1994 (ISBN 0-632-02182-9); and Robert A. Meyers (ed.), Molecular Biology and Biotechnology: a Comprehensive Desk Reference, published by VCH Publishers, Inc., 1995 (ISBN 1-56081-569-8).
- In order to facilitate review of the various embodiments of this disclosure, the following explanations of specific terms are provided:
- Adenovirus: A virus of the family Adenoviridae, which are medium-sized (90-100 nm), nonenveloped icosahedral viruses composed of a nucleocapsid and a double-stranded linear DNA genome. The adenovirus genome is linear, non-segmented double-stranded (ds) DNA that is between 26 and 45 kb. This allows the virus to theoretically carry 22 to 40 genes. The linear dsDNA genome is able to replicate in the nucleus of mammalian cells using the host's replication machinery. However, adenoviral DNA does not integrate into the genome and is not replicated during cell division.
- Adeno-associated Virus: Adeno-associated virus (AAV) is a small virus that infects humans and some other primate species. AAV is not currently known to cause disease and consequently the virus causes a very mild immune response. AAV can infect both dividing and non-dividing cells and may incorporate its genome into that of the host cell. The AAV genome is built of single-stranded deoxyribonucleic acid (ssDNA), either positive- or negative-sensed, which is about 4.7 kilobase long. The genome comprises inverted terminal repeats (ITRs) at both ends of the DNA strand, and two open reading frames (ORFs): rep and cap. Rep is composed of four overlapping genes encoding Rep proteins required for the AAV life cycle, and Cap contains overlapping nucleotide sequences of capsid proteins: VP1, VP2 and VP3, which interact together to form a capsid of an icosahedral symmetry. For gene therapy, ITRs seem to be the only sequences required in cis next to the therapeutic gene: structural (cap) and packaging (rep) genes can be delivered in trans.
- Adjuvant: A vehicle used to enhance antigenicity. Adjuvants include a suspension of minerals (alum, aluminum hydroxide, or phosphate) on which antigen is adsorbed; or water-in-oil emulsion in which antigen solution is emulsified in mineral oil (Freund incomplete adjuvant), sometimes with the inclusion of killed mycobacteria (Freund's complete adjuvant) to further enhance antigenicity (inhibits degradation of antigen and/or causes influx of macrophages). Immunstimulatory oligonucleotides (such as those including a CpG motif) can also be used as adjuvants (for example see U.S. Pat. Nos. 6,194,388; 6,207,646; 6,214,806; 6,218,371; 6,239,116; 6,339,068; 6,406,705; and U.S. Pat. No. 6,429,199). Adjuvants include biological molecules (a “biological adjuvant”), such as costimulatory molecules. Exemplary adjuvants include IL-2, RANTES, GM-CSF, TNF-α, IFN-γ, G-CSF, LFA-3, CD72, B7-1, B7-2, OX-40L and 4-1 BBL. Another exemplary adjuvant is chitosan. Another adjuvant is Bacillus-Calmette-Guerin adjvant.
- Alphavirus: A virus that belongs to the group IV Togaviridae family of viruses. The alphaviruses are small, spherical, enveloped viruses with a genome of a single positive sense strand RNA. The total genome length ranges between 11,000 and 12,000 nucleotides, and has a 5′ cap, and 3′ poly-A tail. The four non-structural protein genes are encoded in the 5′ two-thirds of the genome, while the three structural proteins are translated from a subgenomic mRNA colinear with the 3′ one-third of the genome. The alphavirusus include the Ross River virus, Sindbis virus, Semliki Forest virus, and Venezuelan equine encephalitis virus.
- Antigen: A compound, composition, or substance that can stimulate the production of antibodies or a T cell response in an animal, including compositions that are injected or absorbed into an animal. An antigen reacts with the products of specific humoral or cellular immunity, including those induced by heterologous immunogens. The term “antigen” includes all related antigenic epitopes. “Epitope” or “antigenic determinant” refers to a site on an antigen to which B and/or T cells respond. In one embodiment, T cells respond to the epitope, when the epitope is presented in conjunction with an MHC molecule. Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents. An epitope typically includes at least 3, and more usually, at least 5, about 9, or about 8-10 amino acids in a unique spatial conformation, but is generally not more than 20 amino acids in length. Methods of determining spatial conformation of epitopes include, for example, x-ray crystallography and 2-dimensional nuclear magnetic resonance.
- An antigen can be a tissue-specific antigen, or a disease-specific antigen. These terms are not exclusive, as a tissue-specific antigen can also be a disease specific antigen. A tissue-specific antigen is expressed in a limited number of tissues, such as a single tissue. Specific, non-limiting examples of a tissue specific antigen are a prostate specific antigen, a uterine specific antigen, and/or a testes specific antigen. A tissue specific antigen may be expressed by more than one tissue, such as, but not limited to, an antigen that is expressed in more than one reproductive tissue, such as in both prostate and uterine tissue. A disease-specific antigen is expressed coincidentally with a disease process. Specific non-limiting examples of a disease-specific antigen are an antigen whose expression correlates with, or is predictive of, tumor formation, such as prostate cancer and/or uterine cancer and/or testicular cancer. A disease-specific antigen can be an antigen recognized by T cells or B cells.
- Amplification: Of a nucleic acid molecule (e.g., a DNA or RNA molecule) refers to use of a technique that increases the number of copies of a nucleic acid molecule in a specimen. An example of amplification is the polymerase chain reaction, in which a biological sample collected from a subject is contacted with a pair of oligonucleotide primers, under conditions that allow for the hybridization of the primers to a nucleic acid template in the sample. The primers are extended under suitable conditions, dissociated from the template, and then re-annealed, extended, and dissociated to amplify the number of copies of the nucleic acid. The product of amplification can be characterized by electrophoresis, restriction endonuclease cleavage patterns, oligonucleotide hybridization or ligation, and/or nucleic acid sequencing using standard techniques. Other examples of amplification include strand displacement amplification, as disclosed in U.S. Pat. No. 5,744,311; transcription-free isothermal amplification, as disclosed in U.S. Pat. No. 6,033,881; repair chain reaction amplification, as disclosed in WO 90/01069; ligase chain reaction amplification, as disclosed in EP-A-320 308; gap filling ligase chain reaction amplification, as disclosed in U.S. Pat. No. 5,427,930; and NASBA™ RNA transcription-free amplification, as disclosed in U.S. Pat. No. 6,025,134.
- Antibody: Immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e., molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen, such as Brachyury protein.
- A naturally occurring antibody (e.g., IgG, IgM, IgD) includes four polypeptide chains, two heavy (H) chains and two light (L) chains interconnected by disulfide bonds. However, it has been shown that the antigen-binding function of an antibody can be performed by fragments of a naturally occurring antibody. Thus, these antigen-binding fragments are also intended to be designated by the term “antibody.” Specific, non-limiting examples of binding fragments encompassed within the term antibody include (i) a Fab fragment consisting of the VL, VH, CL and CH1 domains; (ii) an Fd fragment consisting of the VH and CH1 domains; (iii) an Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (iv) a dAb fragment (Ward et al., Nature 341:544-546, 1989) which consists of a VH domain; (v) an isolated complementarity determining region (CDR); and (vi) a F(ab′)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region.
- Immunoglobulins and certain variants thereof are known and many have been prepared in recombinant cell culture (e.g., see U.S. Pat. Nos. 4,745,055; 4,444,487; WO 88/03565; EP 256,654; EP 120,694; EP 125,023; Faoulkner et al., Nature 298:286, 1982; Morrison, J. Immunol. 123:793, 1979; Morrison et al., Ann Rev. Immunol 2:239, 1984). Humanized antibodies and fully human antibodies are also known in the art.
- Animal: Living multi-cellular vertebrate organisms, a category that includes, for example, mammals and birds. The term mammal includes both human and non-human mammals. Similarly, the term “subject” includes both human and veterinary subjects.
- Brachyury: The Brachyury gene is known to be important for the development of mesoderm during gastrulation. Brachyury is the founding member of a family of transcription factors, designated T-box transcription factors, characterized by a conserved DNA-binding domain (Papaioannou and Silver, Bioessays 20(1):9-19, 1998), that has an essential role in the formation and organization of mesoderm in vertebrates (see, for example, Kispert and Herrmann, Embo J 12(8):3211-20, 1993). For example, in Xenopus, Brachyury is an early-immediate response gene of mesoderm inducers, such as activin or TGF-β, and injection of Brachyury mRNA in embryos is sufficient to induce ectopic mesoderm development (Smith et al., Cell 67(1):79-87, 1991). In addition to the fundamental role of the T-box proteins in the control of developmental processes, several members of this family appear to be deregulated in cancer. The human Thx2 gene has been reported to be amplified in pancreatic cancer cell lines (Mahlamaki et al., Genes Chromosomes Cancer 35(4):353-8, 2002) and over-expressed in BRCA-1- and BRCA-2-mutated breast tumors (Sinclair et al., Cancer Res 62(13):3587-9, 2002). Brachyury expression has been reported in human teratocarcinoma lines and chordomas (Vujovic et al, J Pathol 209(2): 157-65, 2006). Exemplary human brachyury amino acid and nucleic acid sequences are set forth in GENBANK® Accession No NP_003172 and GENBANK® Accession No. NM_003181, as available on Feb. 23, 2007, incorporated herein by reference, and are provided below.
- Breast cancer: A neoplastic condition of breast tissue that can be benign or malignant. The most common type of breast cancer is ductal carcinoma. Ductal carcinoma in situ is a non-invasive neoplastic condition of the ducts. Lobular carcinoma is not an invasive disease but is an indicator that a carcinoma may develop. Infiltrating (malignant) carcinoma of the breast can be divided into stages (I IIA, IIB, IIIA, IIIB, and IV). Tumor size staging and node involvement staging can be combined into a single clinical staging number, as exemplified below.
-
Tumor size staging Node involvement staging Clinical stage T1 N0 I T1 N1 IIA T2 N0 IIA T2 N1 IIB T3 N0 IIB T1-T2 N2 IIIA T3 N1 IIIA T3 N2 IIIA T4 N0-N2 IIIB - Breast carcinomas lose the typical histology and architecture of normal breast glands. Generally, carcinoma cells overgrow the normal cells and lose their ability to differentiate into glandular like structures. The degree of loss of differentiation in general is related to the aggressiveness of the tumor. For example, “in situ” carcinoma by definition retains the basement membrane intact, whereas as it progresses to “invasive”, the tumor shows breakout of basement membranes. Thus one would not expect to see, within breast carcinomas, staining of a discrete layer of basal cells as seen in normal breast tissue. For a discussion of the physiology and histology of normal breast and breast carcinoma, see Ronnov-Jessen, L., Petersen, O. W. & Bissell, M. J. Cellular changes involved in conversion of normal to malignant breast: importance of the stromal reaction. Physiol Rev 76, 69-125 (1996).
- Breast cancers can be divided into groups based on their expression profiles. Basal-type carcinomas usually are negative for expression of estrogen receptor (ER) and negative for expression of HER2 (erbB2) and progesterone receptor (PR), and thus are referred to as “triple-negative breast cancers” or “TNBC.” This type of breast cancer is also denoted ER−/HER2−/PR− and represents about 15-20% of all breast cancer, and generally cannot be treated using Her2 targeted or estrogen targeted therapies. It is believed that the aggressive nature of this cancer is correlated with an enrichment for cancer stem cells (CSC) with a CD44+CD24−/lo phenotype. In some embodiments, basal carcinomas are negative for expression of progesterone receptor (PR), positive for expression of epidermal growth factor receptor (EGFR), and positive for expression of cytokeratin 5 (CK5). This phenotype is denoted as follows: ER−/PR−/HER2−/CK5+/EGFR+.
- Cancer or Tumor: A malignant neoplasm that has undergone characteristic anaplasia with loss of differentiation, increased rate of growth, invasion of surrounding tissue, and is capable of metastasis. For example, prostate cancer is a malignant neoplasm that arises in or from prostate tissue, ovarian cancer is a malignant neoplasm that arises in or from ovarian tissue, colon cancer is a malignant neoplasm that arises in or from colon tissue, and lung cancer is a malignant neoplasm that arises in the lungs. Residual cancer is cancer that remains in a subject after any form of treatment given to the subject to reduce or eradicate the cancer. Metastatic cancer is a cancer at one or more sites in the body other than the site of origin of the original (primary) cancer from which the metastatic cancer is derived. Cancer includes, but is not limited to, sarcomas and carcinomas. Prostate cancer is a malignant tumor, generally of glandular origin, of the prostate. Prostate cancers include adenocarcinomas and small cell carcinomas.
- cDNA (complementary DNA): A piece of DNA lacking internal, non-coding segments (introns) and regulatory sequences that determine transcription. cDNA is synthesized in the laboratory by reverse transcription from messenger RNA extracted from cells.
- Chemotherapeutic agents: Any chemical agent with therapeutic usefulness in the treatment of diseases characterized by abnormal cell growth. Such diseases include tumors, neoplasms, and cancer as well as diseases characterized by hyperplastic growth such as psoriasis. In one embodiment, a chemotherapeutic agent is an agent of use in treating breast and/or prostate cancer. In one embodiment, a chemotherapeutic agent is radioactive compound. One of skill in the art can readily identify a chemotherapeutic agent of use (e.g. see Slapak and Kufe, Principles of Cancer Therapy, Chapter 86 in Harrison's Principles of Internal Medicine, 14th edition, Perry et al., Chemotherapy, Ch. 17 in Abeloff,
Clinical Oncology 2nd ed., © 2000 Churchill Livingstone, Inc; Baltzer L, Berkery R (eds): Oncology Pocket Guide to Chemotherapy, 2nd ed. St. Louis, Mosby-Year Book, 1995; Fischer D S, Knobf M F, Durivage H J (eds): The Cancer Chemotherapy Handbook, 4th ed. St. Louis, Mosby-Year Book, 1993). Combination chemotherapy is the administration of more than one agent to treat cancer, such as the administration of a non-pox non-yeast vector encoding Brachyury in combination with a radioactive or chemical compound to a subject. - Conservative variants: “Conservative” amino acid substitutions are those substitutions that do not substantially affect or decrease an activity or antigenicity of an antigenic epitope of Brachyury. Specific, non-limiting examples of a conservative substitution include the following examples:
-
Original Residue Conservative Substitutions Al Ser Arg Lys Asn Gln, His Asp Glu Cys Ser Gln Asn Glu Asp His Asn; Gln Ile Leu, Val Leu Ile; Val Lys Arg; Gln; Glu Met Leu; Ile Phe Met; Leu; Tyr Ser Thr Thr Ser Trp Tyr Tyr Trp; Phe Val Ile; Leu - The term conservative variant also includes the use of a substituted amino acid in place of an unsubstituted parent amino acid, provided that antibodies raised to the substituted polypeptide also immunoreact with the unsubstituted polypeptide, and/or that the substituted polypeptide retains the function of the unstubstituted polypeptide. Non-conservative substitutions are those that reduce an activity or antigenicity.
- CD4: Cluster of
differentiation factor 4, a T cell surface protein that mediates interaction with the MHC Class II molecule. CD4 also serves as the primary receptor site for HIV on T cells during HIV infection. Cells that express CD4 are often helper T cells. - CD8: Cluster of
differentiation factor 8, a T cell surface protein that mediates interaction with the MHC Class I molecule. Cells that express CD8 are often cytotoxic T cells. - Consists Essentially Of/Consists Of: With regard to a polypeptide or protein, a polypeptide (or protein) that consists essentially of a specified amino acid sequence if it does not include any additional amino acid residues. However, the polypeptide (or protein) can include additional non-peptide components, such as labels (for example, fluorescent, radioactive, or solid particle labels), sugars or lipids. With regard to a polypeptide or protein, a polypeptide or protein that consists of a specified amino acid sequence does not include any additional amino acid residues, nor does it include additional non-peptide components, such as lipids, sugars or labels.
- Costimulatory molecule: Although engagement of the TCR with peptide-MHC delivers one signal to the T cell, this signal alone can be insufficient to activate the T cell. Costimulatory molecules are molecules that, when bound to their ligand, deliver a second signal required for the T cell to become activated. The most well-known costimulatory molecule on the T cell is CD28, which binds to either B7-1 (also called CD80) or B7-2 (also known as CD86). An additional costimulatory molecule is B7-3. Accessory molecules that also provide a second signal for the activation of T cells include intracellular adhesion molecule (ICAM-1 and ICAM-2), leukocyte function associated antigen (LFA-1, LFA-2 and LFA-3). Integrins and tumor necrosis factor (TNF) superfamily members can also serve as co-stimulatory molecules.
- Degenerate variant: A polynucleotide encoding an epitope of Brachyury that includes a sequence that is degenerate as a result of the genetic code. There are 20 natural amino acids, most of which are specified by more than one codon. Therefore, all degenerate nucleotide sequences are included in this disclosure as long as the amino acid sequence of the Brachyury protein encoded by the nucleotide sequence is unchanged.
- Dendritic cell (DC): Dendritic cells are the principle antigen presenting cells (APCs) involved in primary immune responses. Dendritic cells include plasmacytoid dendritic cells and myeloid dendritic cells. Their major function is to obtain antigen in tissues, migrate to lymphoid organs and present the antigen in order to activate T cells. Immature dendritic cells originate in the bone marrow and reside in the periphery as immature cells.
- Diagnostic: Identifying the presence or nature of a pathologic condition, such as, but not limited to, a cancer, such as small intestine, stomach, kidney, bladder, uterus, ovary, testes, lung, colon or prostate cancer. Diagnostic methods differ in their sensitivity and specificity. The “sensitivity” of a diagnostic assay is the percentage of diseased individuals who test positive (percent of true positives). The “specificity” of a diagnostic assay is 1 minus the false positive rate, where the false positive rate is defined as the proportion of those without the disease who test positive. While a particular diagnostic method may not provide a definitive diagnosis of a condition, it suffices if the method provides a positive indication that aids in diagnosis. “Prognostic” means predicting the probability of development (for example, severity) of a pathologic condition, such as prostate cancer, or metastasis.
- Epithelial-to-Mesenchymal Transition: The epithelium is the covering of internal and external surfaces of the body, including the lining of vessels and other small cavities, that consists of cells joined by biological cementing substances. Generally, fully differentiated epithelial cells express proteins characteristic of a differentiated phenotype, such as insulin, and have a limited capacity to proliferate. The mesenchyme is the meshwork of loosely organized embryonic connective tissue in the mesoderm from which are formed the connective tissues of the body, along with the blood vessels and lymphatic vessels. Vimentin is one marker of mesenchymal cells. Mesenchymal cells generally have a greater capacity to proliferate in vitro than epithelial cells and are not fully differentiated. An “epithelial-to-mesenchymal” transition is a biological process wherein a cell, or a population of cells, from an epithelial phenotype convert to a less differentiated mesenchymal phenotype. A “mesenchymal-to-epithelial” transition is a biological process wherein a cell, or a population of cells, convert from a less differentiated mesenchymal phenotype to a more differentiated epithelial phenotype.
- Epitope: An antigenic determinant. These are particular chemical groups or peptide sequences on a molecule that are antigenic (that elicit a specific immune response). An antibody specifically binds a particular antigenic epitope on a polypeptide. Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents. An epitope typically includes at least 3, and more usually, at least 5, about 9, or 8 to 10 amino acids, and generally not more than 20 amino acids, in a unique spatial conformation. Methods of determining spatial conformation of epitopes include, for example, x-ray crystallography and 2-dimensional nuclear magnetic resonance. See, e.g., “Epitope Mapping Protocols” in Methods in Molecular Biology, Vol. 66, Glenn E. Morris, Ed (1996). In one embodiment, an epitope binds an MHC molecule, such as an HLA molecule or a DR molecule. These molecules bind polypeptides having the correct anchor amino acids separated by about eight to about ten amino acids, such as nine amino acids.
- Estrogen Receptor (ER): A receptor that is activated by the hormone 17β-estradiol (estrogen). The main function of the estrogen receptor is as a DNA binding transcription factor that regulates gene expression. Estrogen receptors are over-expressed in around 70% of breast cancer cases, referred to as “ER positive” or “ER+.” Therapy for ER+ breast cancer involves selective estrogen receptor modulators (SERMS) which behave as ER antagonists in breast tissue or aromatase inhibitors. ER status is also used to determine sensitivity of breast cancer lesions to tamoxifen and aromatase inhibitors.
- Expression Control Sequences: Nucleic acid sequences that regulate the expression of a heterologous nucleic acid sequence to which they are operatively linked. Expression control sequences are operatively linked to a nucleic acid sequence when the expression control sequences control and regulate the transcription and, as appropriate, translation of the nucleic acid sequence. Thus, expression control sequences can include appropriate promoters, enhancers, transcription terminators, a start codon (i.e., ATG) in front of a protein-encoding gene, splicing signal for introns, maintenance of the correct reading frame of that gene to permit proper translation of mRNA, and stop codons. The term “control sequences” is intended to include, at a minimum, components whose presence can influence expression, and can also include additional components whose presence is advantageous, for example, leader sequences and fusion partner sequences. Expression control sequences can include a promoter.
- A promoter is a minimal sequence sufficient to direct transcription. Also included are those promoter elements which are sufficient to render promoter-dependent gene expression controllable for cell-type specific, tissue-specific, or inducible by external signals or agents; such elements may be located in the 5′ or 3′ regions of the gene. Both constitutive and inducible promoters are included (see e.g., Bitter et al., Methods in Enzymology 153:516-544, 1987). For example, when cloning in bacterial systems, inducible promoters such as pL of bacteriophage lambda, plac, ptrp, ptac (ptrp-lac hybrid promoter) and the like can be used. In one embodiment, when cloning in mammalian cell systems, promoters derived from the genome of mammalian cells (such as the metallothionein promoter) or from mammalian viruses (such as the retrovirus long terminal repeat; the adenovirus late promoter; the vaccinia virus 7.5K promoter) can be used. Promoters are also disclosed herein that are effective when included in a poxviral vector. Promoters produced by recombinant DNA or synthetic techniques can also be used to provide for transcription of the nucleic acid sequences.
- HER2: Human Epidermal growth factor Receptor 2 (Her2) is also known as Her 2/neu (or ErbB-2, ERBB2). It is a member of the ErbB protein family (also known as the epidermal growth factor receptor family). HER2 has also been designated as CD340 (cluster of differentiation 340) and p185. HER2 is notable for its role in the pathogenesis of breast cancer and as a target of treatment. It is a cell membrane surface-bound receptor tyrosine kinase and is normally involved in the signal transduction pathways leading to cell growth and differentiation.
- Approximately 15-20 percent of breast cancers have an amplification of the HER2 gene or overexpression of its protein product. Overexpression of this receptor in breast cancer has been associated with increased disease recurrence and worse prognosis. Because of its prognostic role, breast tumors are routinely checked for overexpression of HER2. Overexpression also occurs in other cancer such as ovarian cancer, stomach cancer, and biologically aggressive forms of uterine cancer, such as uterine serous endometrial carcinoma.
- Heterologous: Originating from separate genetic sources or species. A polypeptide that is heterologous to Brachyury originates from a nucleic acid that does not encode Brachyury. In specific, non-limiting examples, with regard to a polypeptide comprising Brachyury, a heterologous amino acid sequence includes a 3-galactosidase, a maltose binding protein, and albumin, hepatitis B surface antigen, or an immunoglobulin amino acid sequence. Generally, an antibody that specifically binds to a protein of interest, such as Brachyury, will not specifically bind to a heterologous protein.
- Host cells: Cells in which a vector can be propagated and its DNA expressed. The cell may be prokaryotic or eukaryotic. The cell can be mammalian, such as a human cell. The term also includes any progeny of the subject host cell. It is understood that all progeny may not be identical to the parental cell since there may be mutations that occur during replication. However, such progeny are included when the term “host cell” is used.
- Immune response: A response of a cell of the immune system, such as a B cell, T cell, or monocyte, to a stimulus. In one embodiment, the response is specific for a particular antigen (an “antigen-specific response”). In one embodiment, an immune response is a T cell response, such as a CD4+ response or a CD8+ response. In another embodiment, the response is a B cell response, and results in the production of specific antibodies.
- Immunogenic polypeptide and Immnogenic Protein: A protein or peptide which comprises an allele-specific motif or other sequence such that the peptide will bind an MHC molecule and induce a T cell response, or a B cell response (e.g. antibody production) against the antigen.
- Immunogenic peptides are generally 7 to 20 amino acids in length, such as 9 to 12 amino acids in length. In one example, an immunogenic polypeptide includes an allele-specific motif or other sequence such that the peptide will bind an MHC molecule and induce a T cell response against the antigen (protein) from which the immunogenic polypeptide is derived. In one embodiment, immunogenic peptides are identified using sequence motifs or other methods, such as neural net or polynomial determinations, known in the art. Typically, algorithms are used to determine the “binding threshold” of peptides to select those with scores that give them a high probability of binding at a certain affinity and will be immunogenic. The algorithms are based either on the effects on MHC binding of a particular amino acid at a particular position, the effects on antibody binding of a particular amino acid at a particular position, or the effects on binding of a particular substitution in a motif-containing peptide. Within the context of an immunogenic peptide, a “conserved residue” is one which appears in a significantly higher frequency than would be expected by random distribution at a particular position in a peptide. In one embodiment, a conserved residue is one where the MHC structure may provide a contact point with the immunogenic peptide. In one example, an immunogenic “Brachyury polypeptide” is a series of contiguous amino acid residues from the Brachyury protein generally between 7 and 20 amino acids in length, such as about 8 to 11 residues in length. Specific immunogenic Brachyury polypeptides are 9 or 10 amino acid residues in length, or at most 12 amino acids in length.
- Immunogenic peptides and proteins can also be identified by measuring their binding to a specific MHC protein (Class I or Class II) and by their ability to stimulate CD4 and/or CD8 when presented in the context of the MHC protein. The characteristics of immunogenic polypeptides, are disclosed, for example, in PCT Publication No. WO 00/12706, which is incorporated herein by reference.
- Generally, an immunogenic Brachyury protein includes a number of immunogenic polypeptides, and can be used to induce an immune response in a subject, such as a CD4+ T cell response. In one example, an immunogenic Brachyury protein, when bound to a Major Histocompatibility Complex Class II molecule, activates CD4+ T cells against cells expressing wild-type Brachyury protein, and/or when bound to a Major Histocompatibility Complex Class I molecule, activates cytotoxic T lymphocytes (CTLs) against cells expressing wild-type Brachyury protein. Induction of CTLs using synthetic peptides and CTL cytotoxicity assays are known in the art, see U.S. Pat. No. 5,662,907, which is incorporated herein by reference.
- Immunogenic composition: A composition, such as a composition comprising a Brachyury protein or a nucleic acid encoding the Brachyury protein, that induces a measurable T cell response against cells expressing Brachyury protein, or induces a measurable B cell response (such as production of antibodies that specifically bind Brachyury) against a Brachyury protein. For in vitro use, the immunogenic composition can consist of the isolated nucleic acid, vector including the nucleic acid/or immunogenic protein. For in vivo use, the immunogenic composition will typically comprise the nucleic acid, vector including the nucleic acid, and or immunogenic protein, in pharmaceutically acceptable carriers, and/or other agents. An immunogenic composition can optionally include an adjuvant, a costimulatory molecule, or a nucleic acid encoding a costimulatory molecule.
- Immunostimulatory molecule: Molecules that stimulate the cells of the immune system including costimulatory molecules, cytokines and immunostimulatory nucleic acids, such as those that include a CpG motif.
- Inhibiting or treating a disease: Inhibiting a disease, such as cancer growth, refers to inhibiting the full development of a disease. In several examples, inhibiting a disease refers to lessening symptoms of a cancer, such as preventing the development of paraneoplastic syndrome in a person who is known to have a cancer, or lessening a sign or symptom of the cancer or reducing cancer volume. “Treatment” refers to a therapeutic intervention that ameliorates a sign or symptom of a disease or pathological condition related to the disease, such as the cancer.
- Isolated: An “isolated” biological component (such as a nucleic acid or protein or organelle) has been substantially separated or purified away from other biological components in the cell of the organism in which the component naturally occurs, i.e., other chromosomal and extra-chromosomal DNA and RNA, proteins and organelles. Nucleic acids and proteins that have been “isolated” include nucleic acids and proteins purified by standard purification methods. The term also embraces nucleic acids and proteins prepared by recombinant expression in a host cell as well as chemically synthesized nucleic acids.
- Label: A detectable compound or composition that is conjugated directly or indirectly to another molecule to facilitate detection of that molecule. Specific, non-limiting examples of labels include fluorescent tags, enzymatic linkages, and radioactive isotopes.
- Lentiviral vector: Lentiviruses are a subclass of Retroviruses. Lentiviral vectors can integrate into the genome of non-dividing cells. This feature of Lentiviruses is unique, as other Retroviruses can infect only dividing cells. The viral genome in the form of RNA is reverse-transcribed when the virus enters the cell to produce DNA, which is then inserted into the genome at a random position by the viral integrase enzyme. The vector, now called a provirus, remains in the genome and is passed on to the progeny of the cell when it divides. Lentiviral vectors include HIV-1, HIV-2, SIV (simian immunodeficiency virus), EIAV (equine infectious anaemia virus), FIV (feline immunodeficiency virus), CAEV (Caprine arthritis encephalitis virus), and VMV (Visna/maedi virus) vectors. Lentiviral vectors also encompass chimeric lentiviruses derived from at least two different lentiviruses.
- Linker sequence: A linker sequence is an amino acid sequence that covalently links two polypeptide domains. Linker sequences can be included in the between the Brachyury proteins disclosed herein to provide rotational freedom to the linked polypeptide domains. By way of example, in a recombinant molecule comprising two Brachyury proteins, linker sequences can be provided between them, so that the proteins comprises Brachyury protein-linker-Brachyury protein. Linker sequences, which are generally between 2 and 25 amino acids in length, are well known in the art and include, but are not limited to, four glycines and a serine spacer described by Chaudhary et al., Nature 339:394-397, 1989.
- Listeria: A Gram-positive bacilli. The genus Listeria currently contains seven species: L. grayi. L. innocua, L. ivanovii, L. monocytogenes, L. murrayi, L. seeligeri, and L. welshimeri. L. monocytogenes is an intracellular bacterium that has been used as a vector to deliver genes in vitro.
- Lymphocytes: A type of white blood cell that is involved in the immune defenses of the body. There are two main types of lymphocytes: B cells and T cells.
- Major Histocompatibility Complex (MHC): A generic designation meant to encompass the histocompatability antigen systems described in different species, including the human leukocyte antigens (“HLA”).
- Mammal: This term includes both human and non-human mammals. Similarly, the term “subject” includes both human and veterinary subjects.
- Neoplasm: An abnormal cellular proliferation, which includes benign and malignant tumors, as well as other proliferative disorders.
- Oligonucleotide: A linear polynucleotide sequence of up to about 100 nucleotide bases in length.
- Open reading frame (ORF): A series of nucleotide triplets (codons) coding for amino acids without any internal termination codons. These sequences are usually translatable into a peptide.
- Operably linked: A first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence. For instance, a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence, such as a sequence that encodes a Brachyury protein. Generally, operably linked DNA sequences are contiguous and, where necessary to join two protein-coding regions, in the same reading frame.
- Peptide Modifications: Brachyury proteins include synthetic embodiments of peptides described herein. In addition, analogs (non-peptide organic molecules), derivatives (chemically functionalized peptide molecules obtained starting with the disclosed peptide sequences) and variants (homologs) of these proteins can be utilized in the methods described herein. Each protein or polypeptide of this disclosure is comprised of a sequence of amino acids, which may be either L- and/or D-amino acids, naturally occurring and otherwise.
- Protein and polypeptides can be modified by a variety of chemical techniques to produce derivatives having essentially the same activity as the unmodified peptides, and optionally having other desirable properties. For example, carboxylic acid groups of the protein, whether carboxyl-terminal or side chain, can be provided in the form of a salt of a pharmaceutically-acceptable cation or esterified to form a C1-C16 ester, or converted to an amide of formula NR1R2 wherein R1 and R2 are each independently H or C1-C16 alkyl, or combined to form a heterocyclic ring, such as a 5- or 6-membered ring. Amino groups of the peptide, whether amino-terminal or side chain, can be in the form of a pharmaceutically-acceptable acid addition salt, such as the HCl, HBr, acetic, benzoic, toluene sulfonic, maleic, tartaric and other organic salts, or can be modified to C1-C16 alkyl or dialkyl amino or further converted to an amide.
- Hydroxyl groups of the peptide side chains may be converted to C1-C16 alkoxy or to a C1-C16 ester using well-recognized techniques. Phenyl and phenolic rings of the peptide side chains may be substituted with one or more halogen atoms, such as fluorine, chlorine, bromine or iodine, or with C1-C16 alkyl, C1-C16 alkoxy, carboxylic acids and esters thereof, or amides of such carboxylic acids. Methylene groups of the peptide side chains can be extended to homologous C2-C4 alkylenes. Thiols can be protected with any one of a number of well-recognized protecting groups, such as acetamide groups. Those skilled in the art will also recognize methods for introducing cyclic structures into proteins and polypeptides to select and provide conformational constraints to the structure that result in enhanced stability.
- Peptidomimetic and organomimetic embodiments are envisioned, whereby the three-dimensional arrangement of the chemical constituents of such peptido- and organomimetics mimic the three-dimensional arrangement of the peptide backbone and component amino acid side chains, resulting in such peptido- and organomimetics of a Brachyury protein having measurable or enhanced ability to generate an immune response. For computer modeling applications, a pharmacophore is an idealized three-dimensional definition of the structural requirements for biological activity. Peptido- and organomimetics can be designed to fit each pharmacophore with current computer modeling software (using computer assisted drug design or CADD). See Walters, “Computer-Assisted Modeling of Drugs,” in Klegerman & Groves, eds., 1993, Pharmaceutical Biotechnology, Interpharm Press: Buffalo Grove, Ill., pp. 165-174 and Principles of Pharmacology, Munson (ed.) 1995, Ch. 102, for descriptions of techniques used in CADD. Also included are mimetics prepared using such techniques.
- Pharmaceutically acceptable carriers: The pharmaceutically acceptable carriers of use are conventional. Remington's Pharmaceutical Sciences, by E. W. Martin, Mack Publishing Co., Easton, Pa., 15th Edition (1975), describes compositions and formulations suitable for pharmaceutical delivery of the fusion proteins herein disclosed.
- In general, the nature of the carrier will depend on the particular mode of administration being employed. For instance, parenteral formulations usually comprise injectable fluids that include pharmaceutically and physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like as a vehicle. For solid compositions (such as powder, pill, tablet, or capsule forms), conventional non-toxic solid carriers can include, for example, pharmaceutical grades of mannitol, lactose, starch, or magnesium stearate. In addition to biologically neutral carriers, pharmaceutical compositions to be administered can contain minor amounts of non-toxic auxiliary substances, such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like, for example sodium acetate or sorbitan monolaurate.
- A “therapeutically effective amount” is a quantity of a composition or a cell to achieve a desired effect in a subject being treated. For instance, this can be the amount of Brachyury protein or a vector encoding a Brachyury protein necessary to induce an immune response, inhibit cancer growth, reduce cancer volume, prevent cancer, or to measurably alter outward symptoms of the cancer. When administered to a subject, a dosage will generally be used that will achieve target tissue concentrations (for example, in lymphocytes) that has been shown to achieve an in vitro effect.
- Plasmid: A DNA molecule that is separate from, and can replicate independently of, the chromosomal DNA. They are double-stranded and, in many cases, circular. Generally, a gene to be replicated is inserted into copies of a plasmid containing genes that make cells resistant to particular antibiotics and a multiple cloning site (MCS, or polylinker), which is a short region containing several commonly used restriction sites allowing the easy insertion of DNA fragments at this location.
- Poliovirus: A human enterovirus and member of the family of Picornaviridae; the wild-type poliovirus causes poliomyelitis. Poliovirus is composed of an RNA genome and a protein capsid. The wild-type genome is a single-stranded positive-sense RNA genome that is about 7500 nucleotides long. The viral particle is about 30 nanometres in diameter with icosahedral symmetry.
- Polynucleotide: The term polynucleotide or nucleic acid sequence refers to a polymeric form of nucleotide at least 10 bases in length. A recombinant polynucleotide includes a polynucleotide that is not immediately contiguous with both of the coding sequences with which it is immediately contiguous (one on the 5′ end and one on the 3′ end) in the naturally occurring genome of the organism from which it is derived. The term therefore includes, for example, a recombinant DNA which is incorporated into a vector; into an autonomously replicating plasmid or virus; or into the genomic DNA of a prokaryote or eukaryote, or which exists as a separate molecule (e.g., a cDNA) independent of other sequences. The nucleotides can be ribonucleotides, deoxyribonucleotides, or modified forms of either nucleotide. The term includes single- and double-stranded forms of DNA.
- Polypeptide: A chain of amino acids, generally greater than eight amino acids in length, such as greater than fifteen amino acids in length, which can be post-translationally modified (e.g., glycosylation or phosphorylation) that is not the complete wild-type protein. A polypeptide can be at least 15, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 200 amino acids in length. Thus, a polypeptide can be, for example, 20-300, 30-300, 40-300, 50-300, 60-300, 70-300, 80-300, 90-300, 100-300, or 200-300 amino acids in length. In additional embodiments, a polypeptide is 15 to 10-, 20-100, 25-100, 30-100, 35-100, 40-100, 45-100, 50-100, 55-100, 60-100, 65-100, 70-100, 75-100, 80-100, 85-100, 90-100 or 95-100 amino acids in length. In further embodiments a polypeptide is up to 433, 434 or 435 amino acids in length.
- Protein: A chain of amino acids, generally greater than 100 amino acids in length, that has a specific function in a cell and is a complete wild-type protein or the complete wild type protein without the N-terminal methionine. A protein can be post-translationally modified. In one embodiment, the protein is a Brachyury protein.
- Measles virus (Mobrillivirus): A negative strand RNA virus belonging the Parmyoviridiae family that causes measles. Heterologous genes can be inserted into the viral genome. The non segmented genome of measles virus has an anti-message polarity which results in a genomic RNA which, when purified, is not translated either in vivo or in vitro and is not infectious.
- Poxvirus: Four genera of poxviruses infect humans: orthopox, parapox, yatapox, molluscipox. Orthopox includes smallpox virus (variola), vaccinia virus, cowpox virus, and monkeypox virus. Parapox includes the orf virus, pseudocowpox, and bovine papular stomatitis virus. Yatapox inlcudes tanapox virus, and yaba monkey tumor virus. Molluscipox includes molluscum contagiosum virus (MCV). Poxviridae viral particles (virions) are generally enveloped (external enveloped virion—EEV), though the intracellular mature virion (IMV) form of the virus, which contains different envelope, is also infectious.
- Vaccinia virus is used as an effective tool for heterologous protein expression. Vaccinia virus enters cells mainly by cell fusion. This virus contains three classes of genes, early, intermediate and late, that are transcribed by viral RNA polymerase and associated transcription factors. Vaccinia virus replicates its genome in cytoplasm of the infected cells and after late gene expression virion morphogenesis produces intracellular mature virion (IMV) that contains envelope, although the origin of the envelope membrane is still unknown. IMV is transported to Golgi, wherein the intracellular enveloped virus (IEV) is formed. IEV transports along microtubules to reach cell periphery and fuse with plasma membrane to become cell-associated enveloped virus (CEV) that triggers actin tails on cell surfaces or forms the extracellular enveloped virion (EEV), which is believed to be important for long range dissemination within the host organism.
- A “non-poxviral vector” is a vector that is not included in the four genera of poxviruses.
- Progesterone receptor (PR): A receptor, also known as NR3C3 (
nuclear receptor subfamily 3, group C, member 3), that is a steroid receptor that specifically binds progesterone. The progesterone receptor is not expressed on triple negative basal breast cancer cells. - Probes and primers: A probe comprises an isolated nucleic acid attached to a detectable label or reporter molecule. Primers are short nucleic acids, preferably DNA oligonucleotides, of about 15 nucleotides or more in length. Primers may be annealed to a complementary target DNA strand by nucleic acid hybridization to form a hybrid between the primer and the target DNA strand, and then extended along the target DNA strand by a DNA polymerase enzyme. Primer pairs can be used for amplification of a nucleic acid sequence, for example by polymerase chain reaction (PCR) or other nucleic-acid amplification methods known in the art. One of skill in the art will appreciate that the specificity of a particular probe or primer increases with its length. Thus, for example, a primer comprising 20 consecutive nucleotides will anneal to a target with a higher specificity than a corresponding primer of only 15 nucleotides. Thus, in order to obtain greater specificity, probes and primers can be selected that comprise about 20, 25, 30, 35, 40, 50 or more consecutive nucleotides.
- Purified: Brachyury proteins and nucleic acids as disclosed herein can be purified (and/or synthesized) by any of the means known in the art (see, e.g., Guide to Protein Purification, ed. Deutscher, Meth. Enzymol. 185, Academic Press, San Diego, 1990; and Scopes, Protein Purification: Principles and Practice, Springer Verlag, New York, 1982). Substantial purification denotes purification from other proteins, nucleic acids, or cellular components. The term purified does not require absolute purity; rather, it is intended as a relative term. A substantially purified protein is at least about 60%, 70%, 80%, 90%, 95%, 98% or 99% pure. Thus, in one specific, non-limiting example, a substantially purified protein is at least 90% free of other proteins or cellular components. In additional embodiments, a nucleic acid or cell preparation is purified such that the nucleic acid or cell represents at least about 60% (such as, but not limited to, 70%, 80%, 90%, 95%, 98% or 99%) of the total nucleic acid or cell content of the preparation, respectively. Thus, in one specific, non-limiting example, a substantially purified nucleic acid is at least 90% free of other nucleic acids or cellular components.
- Recombinant: A recombinant nucleic acid is one that has a sequence that is not naturally occurring or has a sequence that is made by an artificial combination of two otherwise separated segments of sequence. This artificial combination is often accomplished by chemical synthesis or, more commonly, by the artificial manipulation of isolated segments of nucleic acids, e.g., by genetic engineering techniques.
- Replication defective: A viral vector that cannot further replicate and package its genomes. In one non-limiting example, when the cells of a subject are infected with a vector, a heterologous in the vector is expressed in the subject's cells, however, due to the fact that the patient's cells lack essential genes. Examples are the rev and cap genes for AAV, or gag, pol and env for a lentivirus. Generally, the genes necessary to replicate and package are not present, such that and wild-type virus cannot be formed in the subject's cells.
- Salmonella: A genus of rod-shaped, Gram-negative, non-spore-forming, predominantly motile enterobacteria with diameters around 0.7 to 1.5 μm, lengths from 2 to 5 μm, and flagella which grade in all directions (i.e. peritrichous). They are chemoorganotrophs, obtaining their energy from oxidation and reduction reactions using organic sources, and are facultative anaerobes. Salmonella can be used as delivery vector for therapeutic proteins, by including plasmids, such as those with truncated tetA genes in the host cell. Attenuated S. typhimirium can be transformed with DNA plasmids, such as, but not limited to, pIRES (Invitrogen) and used as a carrier for delivery of polypeptides and proteins.
- Selectively hybridize: Hybridization under moderately or highly stringent conditions that excludes non-related nucleotide sequences.
- In nucleic acid hybridization reactions, the conditions used to achieve a particular level of stringency will vary, depending on the nature of the nucleic acids being hybridized. For example, the length, degree of complementarity, nucleotide sequence composition (for example, GC v. AT content), and nucleic acid type (for example, RNA versus DNA) of the hybridizing regions of the nucleic acids can be considered in selecting hybridization conditions. An additional consideration is whether one of the nucleic acids is immobilized, for example, on a filter.
- A specific example of progressively higher stringency conditions is as follows: 2×SSC/0.1% SDS at about room temperature (hybridization conditions); 0.2×SSC/0.1%/SDS at about room temperature (low stringency conditions); 0.2×SSC/0.1% SDS at about 42° C. (moderate stringency conditions); and 0.1×SSC at about 68° C. (high stringency conditions). One of skill in the art can readily determine variations on these conditions (e.g., Molecular Cloning: A Laboratory Manual, 2nd ed., vol. 1-3, ed. Sambrook et al., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989). Washing can be carried out using only one of these conditions, e.g., high stringency conditions, or each of the conditions can be used, e.g., for 10-15 minutes each, in the order listed above, repeating any or all of the steps listed. However, as mentioned above, optimal conditions will vary, depending on the particular hybridization reaction involved, and can be determined empirically.
- Sequence identity: The similarity between amino acid sequences is expressed in terms of the similarity between the sequences, otherwise referred to as sequence identity. Sequence identity is frequently measured in terms of percentage identity (or similarity or homology); the higher the percentage, the more similar the two sequences are. Homologs or variants of a Brachyury protein will possess a relatively high degree of sequence identity when aligned using standard methods.
- Methods of alignment of sequences for comparison are well known in the art. Various programs and alignment algorithms are described in: Smith and Waterman, Adv. Appl. Math. 2:482, 1981; Needleman and Wunsch, J. Mol. Biol. 48:443, 1970; Higgins and Sharp, Gene 73:237, 1988; Higgins and Sharp, CABIOS 5:151, 1989; Corpet et al., Nucleic Acids Research 16:10881, 1988; and Pearson and Lipman, Proc. Natl. Acad. Sci. USA 85:2444, 1988. Altschul et al., Nature Genet. 6:119, 1994, presents a detailed consideration of sequence alignment methods and homology calculations.
- The NCBI Basic Local Alignment Search Tool (BLAST) (Altschul et al., J. Mol. Biol. 215:403, 1990) is available from several sources, including the National Center for Biotechnology Information (NCBI, Bethesda, Md.) and on the internet, for use in connection with the sequence analysis programs blastp, blastn, blastx, tblastn and tblastx. A description of how to determine sequence identity using this program is available on the NCBI website on the internet.
- Homologs and variants of a Brachyury protein are typically characterized by possession of at least 75%, for example at least 80%, sequence identity, or at least 90% i sequence identity, counted over the full length alignment with the amino acid sequence of Brachyury using the NCBI Blast 2.0, gapped blastp set to default parameters. For comparisons of amino acid sequences of greater than about 30 amino acids, the
Blast 2 sequences function is employed using the default BLOSUM62 matrix set to default parameters, (gap existence cost of 11, and a per residue gap cost of 1). When aligning short peptides (fewer than around 30 amino acids), the alignment should be performed using theBlast 2 sequences function, employing the PAM30 matrix set to default parameters (open gap 9,extension gap 1 penalties). Proteins with even greater similarity to the reference sequences will show increasing percentage identities when assessed by this method, such as at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99% sequence identity. When less than the entire sequence is being compared for sequence identity, homologs and variants will typically possess at least 80% sequence identity over short windows of 10-20 amino acids, and can possess sequence identities of at least 85% or at least 90% or 95% depending on their similarity to the reference sequence. Methods for determining sequence identity over such short windows are available at the NCBI website on the internet. One of skill in the art will appreciate that these sequence identity ranges are provided for guidance only; it is entirely possible that strongly significant homologs could be obtained that fall outside of the ranges provided. - Specific binding agent: An agent that binds substantially only to a defined target. Thus a Brachyury specific binding agent is an agent that binds substantially to a Brachyury protein. In one embodiment, the specific binding agent is a monoclonal or polyclonal antibody that specifically binds Brachyury protein.
- T Cell: A white blood cell critical to the immune response. T cells include, but are not limited to, CD4+ T cells and CD8+ T cells. A CD4+ T lymphocyte is an immune cell that carries a marker on its surface known as “cluster of
differentiation 4” (CD4) and is MHC Class II restricted. These cells, often called helper T cells, help orchestrate the immune response, including antibody responses as well as killer T cell responses. CD8+ T cells carry the “cluster ofdifferentiation 8” (CD8) marker and are MHC Class I restricted. In one embodiment, a CD8 T cell is a cytotoxic T lymphocyte. In another embodiment, a CD8 cell is a suppressor T cell. - Therapeutically active protein: An agent composed of amino acids, such as a Brachyury protein, that causes induction of an immune response, as measured by clinical response (for example increase in a population of immune cells, increased cytolytic activity against cells that express Brachyury, or measurable reduction of tumor burden). Therapeutically active molecules can also be made from nucleic acids. Examples of a nucleic acid based therapeutically active molecule is a nucleic acid sequence that encodes a Brachyury protein, wherein the nucleic acid sequence is operably linked to a control element such as a promoter.
- In one embodiment, a therapeutically effective amount of a composition, such as a Brachyury protein or a vector encoding the Brachyury protein, is an amount used to generate an immune response, or to treat or prevent cancer in a subject. In several examples, “treatment” refers to a therapeutic intervention that ameliorates a sign or symptom of a cancer, or a reduction in tumor burden.
- Transduced: A transduced cell is a cell into which has been introduced a nucleic acid molecule by molecular biology techniques. As used herein, the term transduction encompasses all techniques by which a nucleic acid molecule might be introduced into such a cell, including transfection with viral vectors, transformation with plasmid vectors, and introduction of naked DNA by electroporation, lipofection, and particle gun acceleration.
- Vector: A nucleic acid molecule as introduced into a host cell, thereby producing a transformed host cell. A vector may include nucleic acid sequences that permit it to replicate in a host cell, such as an origin of replication. A vector may also include one or more selectable marker gene and other genetic elements known in the art. Vectors include plasmid vectors, including plasmids for expression in gram negative and gram positive bacterial cell. Exemplary vectors include those for expression in E. coli and Salmonella. Vectors also include poxviral vectors, such as, but are not limited to, retrovirus, orthopox, avipox, fowlpox, capripox, suipox, adenoviral, herpes virus, alpha virus, baculovirus, Sindbis virus, vaccinia virus and poliovirus vectors. Vectors also include vectors for expression in yeast cells.
- Yeast: Unicellular microorganisms that belong to one of three classes: Ascomycetes, Basidiomycetes and Fungi Imperfecti. A yeast can be a non-pathogenic strain such as Saccharomyces cerevisiae. Yeawst strains include Saccharomyces, Candida (which can be pathogenic), Cryptococcus, Hansemdla, Kluyveromyces, Pichia, Rhodotorula, Schizosaccharomyces and Yarrowia. Yeast genera include Saccharomyces, Candida, Hansenula. Pichia or Schizosaccharomyces. Species of yeast strains include Saccharomyces cerevisiae, Saccharomyces carlsbergensis, Candida albicans, Candida kefvr, Candida tropicalis, Cryptococcus laurentii. Cryptococcus neoformans, Hansenula anomala, Hansenula polymorpha, Kluyveromyces fragilis, Kluyveromyces lactis, Kluyveromyces marxianus var. lactis, Pichia pastoris. Rhodotorula rubra, Schizosaccharomyces pombe, and Yarrowia lipolytica.
- Yeast vehicles” include, but are not limited to, a live intact (whole) yeast microorganism (i.e., a yeast cell having all its components including a cell wall), a killed (dead) or inactivated intact yeast microorganism, or derivatives of intact yeast including: a yeast spheroplast (i.e., a yeast cell lacking a cell wall), a yeast cytoplast (i.e., a yeast cell lacking a cell wall and nucleus), a yeast ghost (i.e., a yeast cell lacking a cell wall, nucleus and cytoplasm), a subcellular yeast membrane extract or fraction thereof (also referred to as a yeast membrane particle or a subcellular yeast particle), any other yeast particle, or a yeast cell wall preparation. A “non-yeast vector” is a composition that does not include yeast vehicles.
- Unless otherwise explained, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. The singular terms “a,” “an,” and “the” include plural referents unless context clearly indicates otherwise. The term “comprises” means “includes.” Similarly, comprising “A or B” includes “A,” “B,” and both “A and B.” It is further to be understood that all base sizes or amino acid sizes, and all molecular weight or molecular mass values, given for nucleic acids or polypeptides are approximate, and are provided for description. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of this disclosure, suitable methods and materials are described below. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including explanations of terms, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.
- Immunogenic Brachyury Protein and Brachyury Polyepeptides
- Brachyury (also known as “T-protein”) is a protein which is transcribed in the mesoderm. In one embodiment, the Brachyury protein has a sequence set forth as:
-
(SEQ ID NO: 1) MSSPGTESAGKSLQYRVDHLLSAVENELQAGSEKGDPTERELRVGLE ESELWLRFKELTNEMIVTKNGRRMFPVLKVNVSGLDPNAMYSFLLDF VAADNHRWKYVNGEWVPGGKPEPQAPSCVYIHPDSPNFGAHWMKAPV SFSKVKLTNKLNGGGQIMLNSLHKYEPRIHIVRVGGPQRMITSHCFP ETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERSDHKEMMEEPGD SQQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTL RSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNWSSLGMPAHP SMLPVSHNASPPTSSSQYPSLWSVSNGAVTPGSQAAAVSNGLGAQFF RGSPAHYTPLTHPVSAPSSSGSPLYEGAAAATDIVDSQYDAAAQGRL IASWTPVSPPSM (see also GENBANK ® Accession No NP_003172 and GENBANK ® Accession No. NM_003181, as available on Feb. 23, 2007, incorporated herein by reference). - Using the genetic code, one of skill in the art can readily produce a nucleic acid sequence encoding Brachyury. In one example, Brachyury protein is encoded by a nucleic acid having a sequence set forth as:
-
(SEQ ID NO: 2) tttgcttttg cttatttccg tccatttccc tctctgcgcg cggaccttcc ttttccagat ggtgagagcc gcggggacac ccgacgccgg ggcaggctga tccacgatcc tgggtgtgcg taacgccgcc tggggctccg tgggcgaggg acgtgtgggg acaggtgcac cggaaactgc cagactggag agttgaggca tcggaggcgc gagaacagca ctactactgc ggcgagacga gcgcggcgca tcccaaagcc cggccaaatg cgctcgtccc tgggagggga gggaggcgcg cctggagcgg ggacagtctt ggtccgcgcc ctcctcccgg gtctgtgccg ggacccggga cccgggagcc gtcgcaggtc tcggtccaag gggccccttt tctcggaagg gcggcggcca agagcaggga aggtggatct caggtagcga gtctgggctt cggggacggc ggggagggga gccggacggg aggatgagct cccctggcac cgagagcgcg ggaaagagcc tgcagtaccg agtggaccac ctgctgagcg ccgtggagaa tgagctgcag gcgggcagcg agaagggcga ccccacagag cgcgaactgc gcgtgggcct ggaggagagc gagctgtggc tgcgcttcaa ggagctcacc aatgagatga tcgtgaccaa gaacggcagg aggatgtttc cggtgctgaa ggtgaacgtg tctggcctgg accccaacgc catgtactcc ttcctgctgg acttcgtggc ggcggacaac caccgctgga agtacgtgaa cggggaatgg gtgccggggg gcaagccgga gccgcaggcg cccagctgcg tctacatcca ccccgactcg cccaacttcg gggcccactg gatgaaggct cccgtctcct tcagcaaagt caagctcacc aacaagctca acggaggggg ccagatcatg ctgaactcct tgcataagta tgagcctcga atccacatag tgagagttgg gggtccacag cgcatgatca ccagccactg cttccctgag acccagttca tagcggtgac tgcttatcag aacgaggaga tcacagctct taaaattaag tacaatccat ttgcaaaagc tttccttgat gcaaaggaaa gaagtgatca caaagagatg atggaggaac ccggagacag ccagcaacct gggtactccc aatgggggtg gcttcttcct ggaaccagca ccctgtgtcc acctgcaaat cctcatcctc agtttggagg tgccctctcc ctcccctcca cgcacagctg tgacaggtac ccaaccctga ggagccaccg gtcctcaccc taccccagcc cctatgctca tcggaacaat tctccaacct attctgacaa ctcacctgca tgtttatcca tgctgcaatc ccatgacaat tggtccagcc ttggaatgcc tgcccatccc agcatgctcc ccgtgagcca caatgccagc ccacctacca gctccagtca gtaccccagc ctgtggtctg tgagcaacgg cgccgtcacc ccgggctccc aggcagcagc cgtgtccaac gggctggggg cccagttctt ccggggctcc cccgcgcact acacacccct cacccatccg gtctcggcgc cctcttcctc gggatcccca ctgtacgaag gggcggccgc ggccacagac atcgtggaca gccagtacga cgccgcagcc caaggccgcc tcatagcctc atggacacct gtgtcgccac cttccatgtg aagcagcaag gcccaggtcc cgaaagatgc agtgactttt tgtcgtggca gccagtggtg actggattga cctactaggt acccagtggc agtctcaggt taagaaggaa atgcagcctc agtaacttcc ttttcaaagc agtggaggag cacacggcac ctttccccag agccccagca tcccttgctc acacctgcag tagcggtgct gtcccaggtg gcttacagat gaacccaact gtggagatga tgcagttggc ccaacctcac tgacggtgaa aaaatgtttg ccagggtcca gaaacttttt ttggtttatt tctcatacag tgtattggca actttggcac accagaattt gtaaactcca ccagtcctac tttagtgaga taaaaagcac actcttaatc ttcttccttg ttgctttcaa gtagttagag ttgagctgtt aaggacagaa taaaatcata gttgaggaca gcaggtttta gttgaattga aaatttgact gctctgcccc ctagaatgtg tgtattttaa gcatatgtag ctaatctctt gtgttgttaa actataactg tttcatattt ttcttttgac aaagtagcca aagacaatca gcagaaagca ttttctgcaa aataaacgca atatgcaaaa tgtgattcgt ccagttatta gtgaagcccc tccttttgtg agtatttact gtttattg. - In other embodiments, Brachyury protein has an amino acid sequence at least 90% identical to SEQ ID NO: 1, for example a polypeptide that is at least or about 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%0 or 99% identical to SEQ ID NO: 1. Brachyury proteins are disclosed herein that can be used to induce an immune response (are immunogenic), wherein the Brachyury protein can produce a Brachyury-specific CD4+ T cell response. In some embodiments, the Brachyury protein produces a Brachyury specific CD4+ T cell response and a Brachyury Specific CD8+ T cell response.
- SEQ ID NO: 1 provides an exemplary sequence for the full-length Brachyury; another full length Brachyury is this amino acid sequence with the N-terminal methionine removed. In some examples, the Brachyury protein includes the amino acid sequence set forth as SEQ ID NO: 1, with substitutions at position 177 (Asp vs. Gly, respectively), position 368 (Thr vs. Ser, respectively) and position 409 (Asn vs. Asp, respectively). Thus, these sequences can be used to induce a Brachyury specific CD4+ T cell response.
- Positions 41 to 223 of the amino acid sequence set forth as SEQ ID NO: 1 represents the T-box DNA binding domain of human Brachyury, and the T-box domain in other Brachyury sequences, including Brachyury sequences from other species, can be readily identified by comparison to these sequences. As used herein, reference to a T-box domain of a Brachyury protein can include an additional 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 or 40 consecutive amino acids of the Brachyury sequence on the N-terminal and/or the C-terminal end of the defined T-box domain (e.g., on either side of positions 41-223 of SEQ ID NO: 1). In some embodiments, the Brachyury protein comprises the T-box domain of SEQ ID NO: 1 and induces a Brachyury specific CD4+ T cell response. In some embodiment, the polypeptide includes the T-box DNA binding domain or a portion thereof.
- Human Brachyury has very high homology with Brachyury from other animal species and therefore, the sequences of Brachyury from other organisms can be utilized, particularly where these sequences are identical, substantially homologous, and elicit an effective immune response against the target antigen (e.g., native Brachyury expressed by a tumor cell). For example, murine Brachyury, which was cloned by Hermann and colleagues in 1990 (Hermann et al., supra), and is approximately 85% identical to human Brachyury at the nucleotide level. Murine Brachyury is approximately 91% identical to human Brachyury at the amino acid level. With respect to Brachyury from other animals, at the amino acid level, human Brachyury is 99.5% identical to Brachyury from Pan troglodytes, 90.1% identical to Brachyury from Canis lupus familiaris, 88.5% identical to Brachyury from Bos Taurus, 92.2% identical to Brachyury from Rattus norvegicus, and 80.9% identical to Brachyury from Gallus gallus. Nucleic acids encoding these Brachyury proteins can be used in the poxviral vectors and methods disclosed herein. Generally, the T-box domain of these Brachyury proteins is included in the region of amino acids 1-223. These polypeptides can be used to induce a Brachyury specific CD4+ T cell response.
- Mouse and human Brachyury differ by two amino acids (at positions 26 and 96) in the T-box region. The murine Brachyury has the amino acid sequence set forth as:
-
(SEQ ID NO: 3, 436 amino acids) MSSPGTESAGKSLQYRVDHLLSAVESELQAGSEKGDPTERELRVGLE ESELWLRFKELTNEMIVTKNGRRMFPVLKVNVSGLDPNAMYSFLLDF VTADNHRWKYVNGEWVPGGKPEPQAPSCVYIHPDSPNFGAHWMKAPV SFSKVKLTNKLNGGGQIMLNSLHKYEPRIHIVRVGGPQRMITSHCFP ETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERNDHKDVMEEPGD CQQPGYSQWGWLVPGAGTLCPPASSHPQFGGSLSLPSTHGCERYPAL RNHRSSPYPSPYAHRNSSPTYADNSSACLSMLQSHDNWSSLGVPGHT SMLPVSHNASPPTGSSQYPSLWSVSNGTITPGSQTAGVSNGLGAQFF RGSPAHYTPLTHTVSAATSSSSGSPMYEGAATVTDISDSQYDTAQSL LIASWTPVSPPSM
A nucleotide sequence encoding murine Brachyury is: -
(SEQ ID NO: 4) ggctccgcag agtgaccctt tttcttggaa aagcggtggc gagagaagtg aaggtggctg ttgggtaggg agtcaagact cctggaaggt ggagagggtg gcgggaggat gagctcgccgggcacagaga gcgcagggaa gagcctgcag taccgagtgg accacctgct cagcgccgtggagagcgagc tgcaggcggg cagcgagaag ggagacccca ccgaacgcga actgcgagtg ggcctggagg agagcgagct gtggctgcgc ttcaaggagc taactaacga gatgattgtg accaagaacg gcaggaggat gttcccggtg ctgaaggtaa atgtgtcagg cctggacccc aatgccatgt actctttctt gctggacttc gtgacggctg acaaccaccg ctggaaatat gtgaacgggg agtgggtacc tgggggcaaa ccagagcctc aggcgcccag ctgcgtctac atccacccag actcgcccaa ttttggggcc cactggatga aggcgcctgt gtctttcagc aaagtcaaac tcaccaacaa gctcaatgga gggggacaga tcatgttaaa ctccttgcat aagtatgaac ctcggattca catcgtgaga gttgggggcc cgcaacgcat gatcaccagc cactgctttc ccgagaccca gttcatagct gtgactgcct accagaatga ggagattaca gcccttaaaa ttaaatacaa cccatttgct aaagccttcc ttgatgccaa agaaagaaac gaccacaaag atgtaatgga ggaaccgggg gactgccagc agccggggta ttcccaatgg gggtggcttg ttcctggtgc tggcaccctc tgcccgcctg ccagctccca ccctcagttt ggaggctcgc tctctctccc ctccacacac ggctgtgaga ggtacccagc tctaaggaac caccggtcat cgccctaccc cagcccctat gctcatcgga acagctctcc aacctatgcg gacaattcat ctgcttgtct gtccatgctg cagtcccatg ataactggtc tagcctcgga gtgcctggcc acaccagcat gctgcctgtg agtcataacg ccagcccacc tactggctct agccagtatc ccagtctctg gtctgtgagc aatggtacca tcaccccagg ctcccagaca gctggggtgt ccaacgggct gggagctcag ttctttcgag gctcccctgc acattacaca ccactgacgc acacggtctc agctgccacg tcctcgtctt ctggttctcc gatgtatgaa ggggctgcta cagtcacaga catttctgac agccagtatg acacggccca aagcctcctc atagcctcgt ggacacctgt gtcaccccca tctatgtgaa ttgaactttc ctccatgtgc tgagacttgt aacaaccggt gtcaactgga tcttctaggc tcaaagtggc aggctcttgg gacaagggaa aaataaataa ataaaagcta gatactaaca actccatttt caaataagag caataataca tgtcctataa tcatgttcta cagcctcttg tttgatacct acagtagtga tatgtgtcct acattatgaa gccaaggaca gagagacggc tgtggtccag ttttttgtga ctggcagtta atcagagtcc tttgctaggt agggtcctat atcttgtgtt tctctacaac atatatgtga ctttgaaatc ctggaattcg tccaccccct gtcctacttt agtgagacac aaggtacacc tctaatgtcc tcccttgttg ccttagagta gttaactttg aggacagaaa aaagcatagc cagaagattg taactgaacc gtcaactgtt ctgcccttgg aacatgccta ctttaagcac acgtagcttt ttgtgttggg aagtcaactg tatggatact tttctgttga caaagtagcc aaagacaatc tgcagaaagt gttttctgca caataaaggc aatatatagc acctgg, See also the amino acid and nucleic acid sequences set forth in GENBANK ® Accession No. NM_009309 (GI: 118130357), Oct. 29, 2011, incorporated herein by reference.
Positions 41 to 223 of SEQ ID NO:4 represent the T-box DNA binding domain of murine Brachyury. These Brachyury proteins can also be used to induce a Brachyury specific T cell response. - In one embodiment, the Brachyury protein includes, consists essentially of, or consists of, an amino acid sequence at least at least 90% identical to SEQ ID NO: 1, for example a polypeptide that is about 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 1. In another embodiment, the Brachyury proteins do not include the first amino acid of SEQ ID NO: 1 (methionine). IN further embodiments, the Brachyury protein includes, or consists of, amino acids 2-435 of SEQ ID NO: 1. In yet another embodiment, the Brachyury protein includes, or consists of, the amino acid sequence set forth as SEQ ID NO:1, with substitutions at position 177 (Asp vs. Gly, respectively), position 368 (Thr vs. Ser, respectively) and position 409 (Asn vs. Asp, respectively).
- In some examples, the Brachyury protein includes amino acids 1-15 of SEQ ID NO: 1. In yet another embodiment, the Brachyury protein includes, consists essentially of, or consists of, the amino acid sequence set forth as SEQ ID NO: 3.
- Brachyury polypeptides are also of use in the methods disclosed herein. The These Brachyury polypeptides include at least 15, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 200, or at least 300, or at least 400 amino acids of a Brachyury protein, such as 435 amino acids of a Brachyury protein. The Brachyury protein can include 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300 or 400 amino acids of a Brachyury protein. In some embodiments, a Brachyury polypeptide is 15-400, 20-400, 30-400, 40-400, 50-400, 60-400, 70-400, 80-400, 90-400, 100-400, or 200-400 amino acids of a Brachyury protein. In other embodiments, a Brachyury polypeptide is 15-300, 20-300, 30-300, 40-300, 50-300, 60-300, 70-300, 80-300, 90-300, 100-300, or 200-300 amino acids of a Brachyury protein. In additional embodiments, the Brachyury polypeptide is 15 to 10-, 20-100, 25-100, 30-100, 35-100, 40-100, 45-100, 50-100, 55-100, 60-100, 65-100, 70-100, 75-100, 80-100, 85-100, 90-100 or 95-100 amino acids of any of the Brachyury proteins disclosed herein. The Brachyury polypeptide can be 15, 50, 100, 150, 250, 300, 350, 400, 430, 431, 432, 433 or 434 amino acids in length. The Brachyury polypeptide can be 15-430, 15-431, 15-432, 15-433, 15-434 or 15-435 amino acids in length. An exemplary polypeptide is shown in
FIG. 2 . - In further embodiments, a Brachyury polypeptide is 15-20 amino acids in length, such as 15-17 amino acids in length, such as 15, 16, 17, 17, 19 or 20 amino acids in length and binds MHC Class II. The MHC Class II antigen can be encoded by a HLA-DP, HLA-DR, HLA-B, HLA-DQA1 or HLA-DQB1 allele.
- It is disclosed herein that Brachyury protein, Brachyury polypeptides, nucleic acids encoding Brachyury proteins and polypeptides, and non-pox non-yeast viral vectors including a polynucleotide encoding a Brachyury protein can be used to induce Brachyury specific CD4+ T cells in a subject. In additional embodiments the Brachyury protein, Brachyury polypeptide, polynucleotide encoding a Brachyury protein or polypeptide, or non-pox non-yeast vector include the polynucleotide induce a Brachyury specific CD8+ T cell response, or both a Brachyury specific CD4+ T cell response and a CD8+ T cell response.
- In several embodiments, the isolated Brachyury protein or polypeptide is included in a fusion protein. Thus, the fusion protein can include the Brachyury protein or Brachyury polypeptide (see above) and a second heterologous moiety, such as a myc protein, an enzyme or a carrier (such as a hepatitis carrier protein or bovine serum albumin) covalently linked to the Brachyury protein or polypeptide. Thus, in several specific non-limiting examples, the fusion protein includes a Brachyury protein (or Brachyury polypeptide) and six sequential histidine residues, a β-galactosidase amino acid sequence, and/or an immunoglobulin amino acid sequence.
- Brachyury proteins or polypeptides that are linked to a carrier are also of use in the disclosed methods. Generally, a carrier is an immunogenic macromolecule to which an antigenic molecule can be bound. When bound to a carrier, the bound Brachyury protein or Brachyury polypeptide becomes more immunogenic. Carriers are chosen to increase the immunogenicity of the bound molecule and/or to elicit higher titers of antibodies against the carrier which are diagnostically, analytically, and/or therapeutically beneficial. Covalent linking of a molecule to a carrier can confer enhanced immunogenicity and T cell dependence (see Pozsgay et al., PNAS 96:5194-97, 1999; Lee et al., J. Immunol. 116:1711-18, 1976; Dintzis et al., PNAS 73:3671-75, 1976). Useful carriers include polymeric carriers, which can be natural (for example, polysaccharides, polypeptides or proteins from bacteria or viruses), semi-synthetic or synthetic materials containing one or more functional groups to which a reactant moiety can be attached. Bacterial products and viral proteins (such as hepatitis B surface antigen and core antigen) can also be used as carriers, as well as proteins from higher organisms such as keyhole limpet hemocyanin, horseshoe crab hemocyanin, edestin, mammalian serum albumins, and mammalian immunoglobulins. Suitable carriers include, but are not limited to, a hepatitis B small envelope protein HBsAg. This protein has the capacity to self-assemble into aggregates and can form viral-like particles. The preparation of HBsAg is well documented, see for example European Patent Application Publication No. EP-A-0 226 846, European Patent Application Publication No. EP-A-0 299 108 and PCT Publication No. WO 01/117554, and the amino acid sequence disclosed, for example, in Tiollais et al., Nature, 317: 489, 1985, and European Patent Publication No. EP-A-0 278 940, and PCT Publication No. WO 91/14703, all of which are incorporated herein by reference.
- In other embodiments, only the Brachyury protein or polypeptide is utilized. Thus, a second heterologous moiety is non-covalently linked to the Brachyury protein or polypeptide.
- Nucleic Acids Encoding Brachyury Protein and Polypeptides
- Nucleic acids that encode a Brachyury protein and/or polypeptide can readily be produced. These nucleic acids include DNA, cDNA and RNA sequences which encode the Brachyury polypeptide of interest. Silent mutations in the coding sequence result from the degeneracy (i.e., redundancy) of the genetic code, whereby more than one codon can encode the same amino acid residue. Thus, for example, leucine can be encoded by CTT, CTC, CTA, CTG, TTA, or TTG; serine can be encoded by TCT, TCC, TCA, TCG, AGT, or AGC; asparagine can be encoded by AAT or AAC; aspartic acid can be encoded by GAT or GAC; cysteine can be encoded by TGT or TGC; alanine can be encoded by GCT, GCC, GCA, or GCG; glutamine can be encoded by CAA or CAG; tyrosine can be encoded by TAT or TAC; and isoleucine can be encoded by ATT, ATC, or ATA. Tables showing the standard genetic code can be found in various sources (e.g., L. Stryer, 1988, Biochemistry, 3.sup.rd Edition, W.H. 5 Freeman and Co., NY).
- A nucleic acid encoding a Brachyury protein can be cloned or amplified by in vitro methods, such as the polymerase chain reaction (PCR), the ligase chain reaction (LCR), the transcription-based amplification system (TAS), the self-sustained sequence replication system (3SR) and the Qβ replicase amplification system (QB). For example, a polynucleotide encoding the Brachyury protein can be isolated by polymerase chain reaction of cDNA using primers based on the DNA sequence of the molecule. A wide variety of cloning and in vitro amplification methodologies are well known to persons skilled in the art. PCR methods are described in, for example, U.S. Pat. No. 4,683,195; Mullis et al., Cold Spring Harbor Symp. Quant. Biol. 51:263, 1987; and Erlich, ed., PCR Technology, (Stockton Press, N Y, 1989). Polynucleotides also can be isolated by screening genomic or cDNA libraries with probes selected from the sequences of the desired polynucleotide under stringent hybridization conditions.
- A polynucleotide sequence encoding a Brachyury protein or polypeptide can be operatively linked to expression control sequences. An expression control sequence operatively linked to a coding sequence is ligated such that expression of the coding sequence is achieved under conditions compatible with the expression control sequences. The expression control sequences include, but are not limited to, appropriate promoters, enhancers, transcription terminators, a start codon (i.e., ATG) in front of a protein-encoding gene, splicing signal for introns, maintenance of the correct reading frame of that gene to permit proper translation of mRNA, and stop codons. Suitable promoters include, but are not limited to, an SV40 early promoter, RSV promoter, adenovirus major late promoter, human CMV immediate early I promoter, poxvirus promoter, 30K promoter, I3 promoter, sE/L promoter, 7.5K promoter, 40K promoter, and C1 promoter. T DNA vaccines are described in U.S. Pat. Nos. 5,589,466; 5,973,972, which are each incorporated herein by reference. In addition to the delivery protocols described in those applications, alternative methods of delivering DNA are described in U.S. Pat. Nos. 4,945,050 and 5,036,006, which are both incorporated herein by reference.
- Plasmids have been designed with a number of goals in mind, such as achieving regulated high copy number and avoiding potential causes of plasmid instability in bacteria, and providing means for plasmid selection that are compatible with human therapeutic use. Particular attention has been paid to the dual requirements of gene therapy plasmids. First, they are suitable for maintenance and fermentation in E. coli, so that large amounts of DNA can be produced and purified. Second, they are safe and suitable for use in human patients and animals. The first requirement calls for high copy number plasmids that can be selected for and stably maintained relatively easily during bacterial fermentation. The second requirement calls for attention to elements such as selectable markers and other coding sequences. In some embodiments plasmids that encode a Brachyury protein or polypeptide are composed of: (1) a high copy number replication origin, (2) a selectable marker, such as, but not limited to, the neo gene for antibiotic selection with kanamycin, (3) transcription termination sequences, and (4) a multicloning site for incorporation of various nucleic acid cassettes; and (5) a nucleic acid sequence encoding a Brachyury protein and/or a Brachyury polypeptide.
- There are numerous plasmid vectors that are known in the art for inducing a nucleic acid encoding a protein. These include, but are not limited to, the vectors disclosed in U.S. Pat. Nos. 6,103,470; 7,598,364; 7,989,425; and U.S. Pat. No. 6,416,998, which are incorporated herein by reference.
- Non-Pox Non-Yeast Vectors
- Non-poxviral non-yeast vectors can be used to express the Brachyury proteins and/or polypeptides disclosed herein. These vectors are not poxvirus vectors, and thus are not an orthopox, suipox, avipox, or capripox virus vector. Orthopox include vaccinia, ectromelia, and raccoon pox. One example of an orthopox is vaccinia. Avipox includes fowlpox, canary pox and pigeon pox. Capripox include goatpox and sheeppox. An example of a suipox is swinepox vector. Exemplary pox viral vectors for expression as described for example, in U.S. Pat. No. 6,165,460, which is incorporated herein by reference. The vaccinia virus genome is known in the art. It is composed of a HIND F13L region, TK region, and an HA region. Recombinant vaccinia virus has been used to incorporate an exogenous gene for expression of the exogenous gene product (see, for example, Perkus et al. Science 229:981-984, 1985; Kaufman et al. Inti J. Cancer 48:900-907, 1991; Moss Science 252:1662, 1991). Baxby and Paoletti (Vaccine 10:8-9, 1992) disclose the construction and use as a vector, of the non-replicating poxvirus, including canarypox virus, fowlpox virus and other avian species. Sutter and Moss (Proc. Nat'l. Acad. Sci U.S.A. 89:10847-10851, 1992) and Sutter et al. (Virology 1994) disclose the construction and use as a vector, the non-replicating recombinant Ankara virus (MVA, modified vaccinia Ankara) in the construction and use of a vector. These vectors are not used in the present methods.
- The vectors disclosed herein are also non-yeast vectors. Thus, the disclosed vectors are not used for expression in yeast such as S. cerevisiae or Kluyveromyces lactis. Thus, the disclosed vectors generally do not include all the required elements for expression in yeast. As examples, promoters are known to be of use in yeast expression systems such as the constitutive promoters plasma membrane H+-ATPase (PMA1), glyceraldehyde-3-phosphate dehydrogenase (GPD), phosphoglycerate kinase-1 (PGK1), alcohol dehydrogenase-1 (ADH1), and pleiotropic drug-resistant pump (PDR5). The promoters are not utilized in the presently disclosed vectors. In addition, many inducible promoters, such as GAL1-10 (induced by galactose), PHO5 (induced by low extracellular inorganic phosphate), and tandem heat shock HSE elements (induced by temperature elevation to 37° C.) are not used in the present vectors. Promoters that direct variable expression in response to a titratable inducer include the methionine-responsive MET3 and MET25 promoters and copper-dependent CUP1 promoters; these promoters are not utilized. In additional examples, the vectors do not include yeast nutritional markers (such as URA3, ADE3, HIS1, and others) for selection in yeast.
- A number of non-pox non-yeast viral vectors can be utilized, including polyoma, SV40 (Madzak et al., 1992, J. Gen. Virol., 73:15331536), adenovirus (Berkner, 1992, Cur. Top. Microbiol. Immunol., 158:39-6; Berliner et al., 1988, Bio Techniques, 6:616-629; Gorziglia et al., 1992, J. Virol., 66:4407-4412; Quantin et al., 1992, Proc. Nad. Acad. Sci. USA, 89:2581-2584; Rosenfeld et al., 1992, Cell, 68:143-155; Wilkinson et al., 1992, Nucl. Acids Res., 20:2233-2239; Stratford-Perricaudet et al., 1990, Hum. Gene Ther., 1:241-256), vaccinia virus (Mackett et al., 1992, Biotechnology, 24:495-499), adeno-associated virus (Muzyczka, 1992, Curr. Top. Microbiol. Immunol., 158:91-123; On et al., 1990, Gene, 89:279-282), herpes viruses including HSV and EBV (Margolskee, 1992, Curr. Top. Microbiol. Immunol., 158:67-90; Johnson et al., 1992, J. Virol., 66:29522965; Fink et al., 1992. Hum. Gene Ther. 3:11-19; Breakfield et al., 1987, Mol. Neurobiol., 1:337-371; Fresse et al., 1990, Biochem. Pharmacol., 40:2189-2199), Sindbis viruses (H. Herweijer et al., 1995, Human Gene Therapy 6:1161-1167; U.S. Pat. Nos. 5,091,309 and 5,2217,879), alphaviruses (S. Schlesinger, 1993, Trends Biotechnol. 11:18-22; I. Frolov et al., 1996, Proc. Natl. Acad. Sci. USA 93:11371-11377), human herpesvirus vectors (HHV) such as HHV-6 and HHV-7, and retroviruses of avian (Brandyopadhyay et al., 1984, Mol. Cell Biol., 4:749-754; Petropouplos et al., 1992, J. Virol., 66:3391-3397), murine (Miller, 1992, Curr. Top. Microbiol. Immunol., 158:1-24; Miller et al., 1985, Mol. Cell Biol., 5:431-437; Sorge et al., 1984, Mol. Cell Biol., 4:1730-1737; Mann et al., 1985, J. Virol., 54:401-407), and human origin (Page et al., 1990, J. Virol., 64:5370-5276; Buchschalcher et al., 1992, J. Virol., 66:2731-2739). Baculovirus (Autographa californica multinuclear polyhedrosis virus; AcMNPV) vectors can be used. Vectors can be obtained from commercial sources (such as PharMingen, San Diego, Calif.; Protein Sciences Corp., Meriden, Conn.; Stratagene, La Jolla, Calif.). Suitable vectors are disclosed, for example, in U.S. Published Patent Application No. 2010/0247486, which is incorporated herein by reference. In specific non-limiting examples, the vectors are retrovirus vectors (for example, lentivirus vectors), measles virus vectors, alphavirus vectors, baculovirus vectors, Sindbis virus vectors, adenovirus and poliovirus vectors. These vectors include a polynucleotide that encodes a Brachyury protein or Brachyury polypeptide.
- Non-pox non-yeast vectors that encode a Brachyury protein or Brachyury polypeptide include at least one expression control element operationally linked to the nucleic acid sequence encoding the Brachyury protein or polypeptide. The expression control elements are inserted in the vector to control and regulate the expression of the nucleic acid sequence. Examples of expression control elements of use in these vectors includes, but is not limited to, lac system, operator and promoter regions of phage lambda, promoters derived from polyoma, adenovirus, retrovirus or SV40. Additional operational elements include, but are not limited to, leader sequence, termination codons, polyadenylation signals and any other sequences necessary for the appropriate transcription and subsequent translation of the nucleic acid sequence encoding the Brachyury protein or the Brachyury polypeptide in the host system. The expression vector can contain additional elements necessary for the transfer and subsequent replication of the expression vector containing the nucleic acid sequence in the host system. Examples of such elements include, but are not limited to, origins of replication and selectable markers. It will further be understood by one skilled in the art that such vectors can be constructed using conventional methods (Ausubel et al., (1987) in “Current Protocols in Molecular Biology,” John Wiley and Sons, New York, N.Y.) and are commercially available.
- Optionally, the vector can encode one or more immunostimulatory molecules, such as IL-2, IL-6, IL-12, LFA (for example, LFA-1, LFA-2 and/or LFA-3), CD72, RANTES, G-CSF, GM-CSF, TNF-α, IFN-γ, ICAM-1, B7-1, B7-2, other B7 related molecules, OX-40L or 41 BBL, or combinations of these molecules. These immuostimulatory molecules can be used as biological adjuvants (see, for example, Salgaller et al., 1998, J. Surg. Oncol. 68(2):122-38; Lotze et al., 2000, Cancer J Sci. Am. 6(Suppl 1):S61-6, Cao et al., 1998, Stem Cells 16(Suppl 1):251-60; Kuiper et al., 2000, Adv. Exp. Med. Biol. 465:381-90). In several examples, the vector can encode IL-2, RANTES, GM-CSF, TNF-α, IFN-γ, G-CSF, LFA-3, CD72, B7-1, B7-2, B7-1, B7-2, OX-40L, 41 BBL and/or ICAM-1.
- Basic techniques for preparing recombinant DNA viruses containing a heterologous DNA sequence encoding a Brachyury protein or Brachyury polypeptide are known in the art. Such techniques involve, for example, homologous recombination between the DNA sequences flanking the DNA sequence in a donor plasmid and homologous sequences present in a parental virus (Mackett et al., 1982, Proc. Natl. Acad. Sci. USA 79:7415-7419). In particular, recombinant viral vectors can be used in delivering the gene. The vector can be constructed, for example, by steps known in the art, including using a unique restriction endonuclease site that is naturally present or artificially inserted in the parental viral vector to insert the heterologous DNA encoding the Brachyury protein or Brachyury polypeptide.
- Generally, a DNA donor vector contains the following elements: (i) a prokaryotic origin of replication, so that the vector may be amplified in a prokaryotic host; (ii) a gene encoding a marker which allows selection of prokaryotic host cells that contain the vector (e.g., a gene encoding antibiotic resistance); (iii) at least one DNA sequence encoding the Brachyury protein or Brachyury polypeptide located adjacent to a transcriptional promoter capable of directing the expression of the sequence; and (iv) DNA sequences homologous to the region of the parent virus genome where the foreign gene(s) will be inserted, flanking the construct of element (iii). Methods for constructing donor plasmids for the introduction of multiple foreign genes into viral virus are described in PCT Publication no WO 91/19803, incorporated herein by reference.
- Generally, DNA fragments for construction of the donor vector, including fragments containing transcriptional promoters and fragments containing sequences homologous to the region of the parent virus genome into which foreign DNA sequences are to be inserted, can be obtained from genomic DNA or cloned DNA fragments. The donor plasmids can be mono, di-, or multivalent (i.e., can contain one or more inserted foreign DNA sequences). The donor vector can contain an additional gene that encodes a marker that will allow identification of recombinant viruses containing inserted foreign DNA. Several types of marker genes can be used to permit the identification and isolation of recombinant viruses. These include genes that encode antibiotic or chemical resistance (e.g., see Spyropoulos et al., 1988, J. Virol. 62:1046; Falkner and Moss, 1988, J. Virol. 62:1849; Franke et al., 1985, Mol. Cell. Biol. 5:1918), as well as genes such as the E. coli lacZ gene, that permit identification of recombinant viral plaques by colorimetric assay (Panicali et al., 1986, Gene 47:193-199).
- The DNA gene sequence to be inserted into the virus can be placed into a donor plasmid into which DNA homologous to a section of DNA such as that of the insertion site of the virus where the DNA is to be inserted has been inserted. Separately the DNA gene sequence to be inserted is ligated to a promoter. The promoter-gene linkage is positioned in the plasmid construct so that the promoter-gene linkage is flanked on both ends by DNA homologous to a DNA sequence flanking a region of viral DNA that is the desired insertion region. With a parental adenoviral vector, an adenoviral promoter is used. Similarly, with a parental lentiviral vector, a lentivirus promoter is used. The resulting plasmid construct is then amplified by growth within E. coli bacteria and isolated. Next, the isolated plasmid containing the DNA gene sequence to be inserted is transfected into a cell culture, along with the parental virus. Recombination between homologous viral DNA in the plasmid and the viral genome respectively results in a recombinant virus modified by the presence of the promoter-gene construct in its genome, at a site that does not affect virus viability.
- As noted above, the DNA sequence is inserted into a region (insertion region) in the virus that does not affect virus viability of the resultant recombinant virus. One of skill in the art can readily identify such regions in a virus by, for example, randomly testing segments of virus DNA for regions that allow recombinant formation without seriously affecting virus viability of the recombinant.
- Homologous recombination between donor plasmid DNA and viral DNA in an infected cell can result in the formation of recombinant viruses that incorporate the desired elements. Appropriate host cells for in vivo recombination are generally eukaryotic cells that can be infected by the virus and transfected by the plasmid vector. Examples of such cells suitable for use with viral vectors are fibroblasts, HuTK143 (human) cells, and CV-1 and BSC-40 (both monkey kidney) cells. Infection of cells with a virus and transfection of these cells with plasmid vectors is accomplished by techniques standard in the art (see U.S. Pat. No. 4,603,112 and PCT Publication No. WO 89/03429). Following in vivo recombination, recombinant viral progeny can be identified. For example, co-integration of a gene encoding a marker or indicator gene with the foreign gene(s) of interest, as described above, can be used to identify recombinant progeny. One specific non-limiting example of an indicator gene is the E. coli lacZ gene. Recombinant viruses expressing beta-galactosidase can be selected using a chromogenic substrate for the enzyme (Panicali et al., 1986, Gene 47:193). Once a recombinant virus has been identified, a variety of well-known methods can be used to assay the expression of the Brachyury protein or Brachyury polypeptide encoded by the inserted DNA fragment. These methods include black plaque assay (an in situ enzyme immunoassay performed on viral plaques), Western blot analysis, radioimmunoprecipitation (RIPA), and enzyme immunoassay (EIA).
- This disclosure encompasses a recombinant vector comprising more than one antigen of interest for the purpose of having a multivalent vaccine. For example, the recombinant vectors, such as a viral vector, can comprise the virus genome or portions thereof, the nucleic acid sequence encoding the Brachyury protein or Brachyury polypeptide and a nucleic acid sequence encoding a carrier, such as, but not limited to, hepatitis B surface antigen.
- The vectors of use in the methods disclosed herein are non-yeast, non-poxviral vectors. Vectors that are useful include adenovirus, alphavirus, lentivirus, measles virus and poliovirus vectors. However, this disclosure is not limited to these types of non-yeast non-poxviral vectors. Additional vectors herpes simplex viruses, human papilloma virus, Simian immunodeficiency viruses, human T cell lymphoma virus (HTLV), human foamy virus, spumaviruses, mammalian type B retroviruses, mammalian type C retroviruses, avian type C retroviruses, mammalian type D retroviruses. Vectors also include Epstein-Barr virus vectors, Moloney murine leukemia virus vectors, Harvey murine sarcoma virus vectors, murine mammary tumor virus vectors, Rous sarcoma virus vectors and nonviral plasmid vectors. Several types of vectors of use are disclosed below. Compositions including these vectors are of use in inducing a CD4+ T cell response to Brachyury and for the treatment of cancer. These compositions also can be used to induce a CD8+ T cell response to Brachyury.
- Adenovirus Vectors
- Adenovirus vectors (Ad) vectors can be produced that encode a Brachyury protein or a Brachyury polypeptide and are of use in the methods disclosed herein. These vectors are of use in the methods disclosed herein, including replication competent, replication deficient, gutless forms thereof, and adeno-associated virus (AAV) vectors. Without being bound by theory, adenovirus vectors are known to exhibit strong expression in vitro, excellent titer, and the ability to transduce dividing and non-dividing cells in vivo (Hitt et al., Adv in Virus Res 55:479-505, 2000). When used in vivo these vectors lead to strong but transient gene expression due to immune responses elicited to the vector backbone.
- Adenoviral vectors are often constructed by insertion of a nucleic acid encoding a Brachyury protein in place of, or in the middle of, essential viral sequences such as those found at the E1 region of adenovirus (Berkner, BioTechniques, 6:616-629, 1988; Graham et al., Methods in Molecular Biology, 7:109-128, Ed: Murcy, The Human Press Inc., 1991). Inactivation of essential viral genes by, for example, deletion or insertion, disables the adenovirus' ability to replicate. To propagate such vectors in cell culture, the deleted genes must be provided in trans (for example, the E1A and E1B proteins in the case of an E1 delete vector). These replication-defective adenoviruses are produced in packaging cells engineered to complement the replication-incompetent virus by expressing the subset of genetic elements deleted from their viral genome. Potential sites for the insertion of a nucleic acid of interest, such as a nucleic acid encoding a Brachyury protein, in recombinant adenoviral vectors include, without limitation, the E1, E2, E3 and the E4 region. In some embodiments, a recombinant adenoviral vector is produced from a human adenovirus that has the E1 region deleted and replaced with a nucleic acid encoding a Brachyury protein or Brachyury polypeptide. The resulting viral vector, with one or more of its essential genes inactivated, is replication defective (Statford-Perricaudet et al., Human Gene Therapy, 1:241-256, 1990).
- The recombinant adenovirus vectors can include: (1) a packaging site enabling the vector to be incorporated into replication-defective Ad virions; and (2) the nucleic acid encoding the Brachyury protein or Brachyury polypeptide. Other elements of use for incorporation into infectious virions, include the 5′ and 3′ Ad ITRs; the E2 and E3 genes can be included in the vector. In some embodiments, a nucleic acid encoding a Brachyury protein or Brachyury polypeptide is inserted into adenovirus in the deleted E1A, E1B or E3 region of the virus genome. In some embodiments, the adenovirus vectors do not express one or more wild-type adenovirus gene products, such as E1a, E1b, E2, E3, E4. In some non-limiting examples, virions are typically used together with packaging cell lines that complement the functions of E1, E2A, E4 and optionally the E3 gene regions (see, for example, U.S. Pat. Nos. 5,872,005, 5,994,106, 6,133,028 and 6,127,175, incorporated by reference herein in their entirety). Adenovirus vectors can be purified and formulated using techniques known in the art.
- In some embodiments, packaging cell lines such as the human embryonic kidney 293 (“HEK-293” or “293”) cell line (Graham et al., J. Gen. Virol., 36:59-72, 1977) or human embryonic retinoblast (“HER-911” or “911”) cell line (Fallaux et al., Hum. Gene Ther., 7:215-222, 1996), provide in trans the missing region, such as the E1 region, so that the deleted or modified adenoviral vector can replicate in such cells. Suitable adenoviral vectors are disclosed, for example, in U.S. Patent Publication No. 20080193484, which is incorporated herein by reference. Replication-defective adenovirus virions encapsulating the recombinant adenovirus vectors can be made by standard techniques known in the art using packaging cells and packaging technology. Examples of these methods can be found, for example, in U.S. Pat. No. 5,872,005, incorporated herein by reference in its entirety.
- Recombinant AAV vectors are characterized in that they are capable of directing the expression and the production of the selected transgenic products in targeted cells. Thus, the recombinant vectors comprise at least all of the sequences of AAV essential for encapsidation and the physical structures for infection of target cells.
- Recombinant AAV (rAAV) virions can be constructed such that they include, as operatively linked components in the direction of transcription, control sequences including transcriptional initiation and termination sequences, and the nucleic acid encoding the Brachyury protein or Brachyury polypeptide. These components are bounded on the 5′ and 3′ end by functional AAV inverted terminal repeat (ITR) sequences. By “functional AAV ITR sequences” is meant that the ITR sequences function as intended for the rescue, replication and packaging of the AAV virion. Hence, AAV ITRs for use in the vectors need not have a wild-type nucleotide sequence, and can be altered by the insertion, deletion or substitution of nucleotides, or the AAV ITRs can be derived from any of several AAV serotypes, provided they are functional. An AAV vector is a vector derived from an adeno-associated virus serotype, including without limitation, AAV-1, AAV-2, AAV-3, AAV-4, AAV-5, AAV-6, AAV-7, AAV-8, etc. In some embodiments, the AAV vectors have the wild type REP and CAP genes deleted in whole or part, but retain functional flanking ITR sequences. These vectors can all be used, without limitation, for the expression of a Brachyury protein.
- Alphavirus
- Alphaviruses encoding a Brachyury protein or Brachyury polypeptide are provided and are of use in the methods disclosed herein. Alphaviruses are a set of serologically related arthropod-borne viruses of the Togavirus family. Twenty-six known viruses and virus subtypes have been classified within the alphavirus genus utilizing the hemagglutination inhibition (HI) assay. Briefly, the HI test segregates the 26 alphaviruses into three major complexes: the Venezuelan encephalitis (VE) complex, the Semliki Forest (SF) complex, and the western encephalitis (WE) complex. In addition, four additional viruses, eastern encephalitis (EE), Barmah Forest, Middelburg, and Ndumu, receive individual classification based on the HI serological assay. Representative examples of suitable alphaviruses include Aura (American Type Culture Collection (ATCC) VR-368), Bebaru virus (ATCC VR-600, ATCC VR-1240), Cabassou (ATCC VR-922), Chikungunya virus (ATCC VR-64, ATCC VR-1241), Eastern equine encephalomyelitis virus (ATCC VR-65, ATCC VR-1242), Fort Morgan (ATCC VR-924), Getah virus (ATCC VR-369, ATCC VR-1243), Kyzylagach (ATCC VR-927), Mayaro (ATCC VR-66), Mayaro virus (ATCC VR-1277), Middleburg (ATCC VR-370), Mucambo virus (ATCC VR-580, ATCC VR-1244), Ndumu (ATCC VR-371), Pixuna virus (ATCC VR-372, ATCC VR-1245), Ross River virus (ATCC VR-373, ATCC VR-1246), Semliki Forest (ATCC VR-67, ATCC VR-1247), Sindbis virus (ATCC VR-68, ATCC VR-1248), Tonate (ATCC VR-925), Triniti (ATCC VR-469), Una (ATCC VR-374), Venezuelan equine encephalomyelitis (ATCC VR-69), Venezuelan equine encephalomyelitis virus (ATCC VR-923, ATCC VR-1250 ATCC VR-1249, ATCC VR-532), Western equine encephalomyelitis (ATCC VR-70, ATCC VR-1251, ATCC VR-622, ATCC VR-1252), Whataroa (ATCC VR-926), and Y-62-33 (ATCC VR-375), see U.S. Pat. No. 5,843,723, which is incorporated herein by reference.
- In some embodiments, and alphavirus vector is a Sinbis virus. In some embodiments, recombinant alphavirus vector constructs are utilized that include a 5′ sequence which is capable of initiating transcription of an alphavirus, a nucleotide sequence encoding alphavirus nonstructural proteins, a viral junction region which has been inactivated such that viral transcription of the subgenomic fragment is prevented, an alphavirus RNA polymerase recognition sequence, and a nucleic acid sequence encoding a Brachyury protein. Alphavirus vector constructs which have inactivated viral junction regions do not transcribe the subgenomic fragment, making them suitable for a wide variety of applications.
- In some embodiments, the alphavirus such as Sinbis virus, constructs are provided which contain a 5′ promoter which is capable of initiating the synthesis of viral RNA in vitro from cDNA. The 5′ promoters include both eukaryotic and prokaryotic promoters, such as, for example, the β-galactosidase promoter, trpE promoter, lacZ promoter, T7 promoter, T3 promoter, SP6 promoter, SV40 promoter, CMV promoter, and MoMLV LTR. Representative examples of such sequences include nucleotides 1-60, and to a lesser extent nucleotides 150-210, of the wild-type Sindbis virus, nucleotides 10-75 for tRNA Asparagine (Schlesinger et al., U.S. Pat. No. 5,091,309, incorporated herein by refernece), and 5′ sequences from other Togaviruses which initiate transcription.
- Alphavirus vectors can contain sequences which encode alphavirus nonstructural proteins (NSPs). As an example, for Sindbis virus there are four nonstructural proteins, NSP1, NSP2, NSP3 and NSP4, which encode proteins that enable the virus to self-replicate.
Nonstructural proteins 1 through 3 (NSP1-NSP3) are, encoded bynucleotides 60 to 5750 of the wild-type Sindbis virus. These proteins are produced as a polyprotein and later cleaved into nonstructural proteins NSP1, NSP2, and NSP3. NSP4. The alphavirus vector constructs can also include a viral junction region which has been inactivated, such that viral transcription of the subgenomic fragment is prevented. Briefly, the alphavirus viral junction region normally controls transcription initiation of the subgenomic mRNA. In the case of the Sindbis virus, the normal viral junction region typically begins at approximately nucleotide number 7579 and continues through at least nucleotide number 7612 (and possibly beyond), see U.S. Pat. No. 5,843,723 for the complete sequence, incorporated herein by reference. - Several members of the alphavirus genus can be used as “replicon” expression vectors. Replicon vectors may be utilized in any of several formats, including DNA vector constructs, RNA replicon vectors, and recombinant replicon particles (see below). These include, for example, SIN (Xiong et al., Science 243:1188-1191, 1989; Dubensky et al., J. Virol. 70:508-519, 1996; Hariharan et al., J. Virol. 72:950-958, 1998; Polo et al., PNAS 96:4598-4603, 1999), Semliki Forest virus (Liljestrom, Bio/Technology 9:1356-1361, 1991; Berglund et al., Nat. Biotech. 16:562-565, 1998), VEE (Pushko et al. Virology 239:389-401, 1997), and chimeras of multiple alphaviruses (U.S. Pat. No. 6,376,236; PCT Publication No. WO2002099035; Perri et al., J. Virol. 77:10394-10403, 2003).
- Alphavirus vector constructs are also disclosed in U.S. Pat. Nos. 5,789,245; 5,843,723; 5,814,482, and U.S. Pat. No. 6,015,694; PCT Publication No. WO 00/61772; and PCT Publication No. WO 02/99035. Generally, these vectors include a 5′ sequence which initiates transcription of alphavirus RNA, a nucleotide sequence encoding alphavirus nonstructural proteins, a viral subgenomic junction region promoter which directs the expression of an adjacent heterologous nucleic acid sequence, an RNA polymerase recognition sequence and a polyadenylate tract.
- An alphavirus can be used as a replicon (a recombinant alphavirus particle) that is a virus-like particle containing a self-replicating alphavirus vector or “replicon” nucleic acid. The replicon particle itself is generally considered to be replication incompetent or “defective,” that is no progeny replicon particles will result when a host cell is infected with a replicon particle, because genes encoding one or more structural proteins necessary for packaging are deleted.
- Although alphavirus vectors can be used directly for administration in vivo as RNA, or delivered as a plasmid-based cDNA (e.g., Eukaryotic Layered Vector Initiation System), often, for in vivo vaccine and therapeutic applications, the alphavirus RNA replicon vector or replicon RNA is first packaged into a virus-like particle, comprising alphavirus structural proteins (e.g., capsid protein and envelope glycoproteins). Alphavirus and replicons of use are disclosed, for example, in Published U.S. Patent Application No. 20110002958, which is incorporated herein by reference. Because of their configuration, vector replicons do not express these alphavirus structural proteins necessary for packaging into recombinant alphavirus replicon particles. Thus, to generate replicon particles, the structural proteins must be provided in trans.
- Packaging can be accomplished by a variety of methods, including transient approaches such as co-transfection of in vitro transcribed replicon and defective helper RNA(s) (Liljestrom, Bio/Technology 9:1356-1361, 1991; Bredenbeek et al., I Virol. 67:6439-6446, 1993; Frolov et al., J. Virol. 71:2819-2829, 1997; Pushko et al., Virology 239:389-401, 1997; U.S. Pat. No. 5,789,245 and U.S. Pat. No. 5,842,723) or plasmid DNA-based replicon and defective helper constructs (Dubensky et al., J. Virol. 70:508-519, 1996), as well as introduction of alphavirus replicons into stable packaging cell lines (PCL) (Polo et al., PNAS 96:4598-4603, 1999; U.S. Pat. Nos. 5,789,245; 5,842,723; 6,015,694).
- The trans packaging methodologies permit the modification of one or more structural protein genes (for example, to incorporate sequences of alphavirus variants such as the attenuated mutants, see U.S. Pat. Nos. 5,789,245; 5,842,723; 6,015,694), followed by the subsequent incorporation of the modified structural protein into the final replicon particles. In addition, such packaging permits the overall modification of alphavirus replicon particles by packaging of a vector construct or RNA replicon derived from a first alphavirus using structural proteins derived from a second alphavirus different from that of the vector construct.
- Measles Virus
- Measles viruses encoding a Brachyury protein or Brachyury polypeptide are provided and are of use in the methods disclosed herein. The nucleic acid sequences of Measles Viruses are disclosed in PCT Publication No. WO 98/13501, which provides the sequence of a DNA copy of the positive strand (antigenomic) message sense RNA of various wild-type of vaccine measles strains, including Edmonston Wild-type strain, Moraten strain and Schwarz strain. PCT Publication No. WO 97/06270, incorporated herein by reference, discloses the production of recombinant measles vectors.
- An attenuated strain of measles virus can also be used to deliver a Brachyury protein or Brachyury polypeptide. The Moraten attenuated form of the virus has been used world-wide as a vaccine and has an excellent safety record (Hilleman, et al., J. Am. Med. Assoc. 206: 587-590, 1968). Accordingly, in one embodiment, the Moraten strain is used. The Moraten vaccine is commercially available from MERCK® and is provided lyophilized in a vial which when reconstituted to 0.5 ml comprises 103 pfu/ml.
- In a further embodiment, the Edmonston-B vaccine strain of measles virus is used (MV-Edm) (Enders and Peebles, Proc. Soc. Exp. Biol. Med. 86: 277-286, 1954). MV-Edm grows efficiently in tumor cells but its growth is severely restricted in primary cultures of human peripheral blood mononuclear cells, normal dermal fibroblasts, and vascular smooth muscle cells. A form of the Enders attenuated Edmonston strain is available commercially from Merck (ATTENUVAX®). Other attenuated measles virus strains can also be utilized, such as Leningrad-16, and Moscow-5 strains (Sinitsyna, et al., Res. Virol. 141(5): 517-31, 1990), Schwarz strain (Fourrier, et al., Pediatrie 24(1): 97-8, 1969), 9301B strain (Takeda, et al. J. VIROL. 72/11: 8690-8696), the AIK-C strain (Takehara, et al., Virus Res 26 (2): 167-75, 1992), and those described in Schneider-Shaulies, et al., PNAS 92(2): 3943-7, 1995).
- In some embodiments, the recombinant measles virus nucleotide sequence comprises a replicon having a total number of nucleotides which is a multiple of six. The “rule of six” is expressed in the fact that the total number of nucleotides present in the recombinant cDNA finally amount to a total number of nucleotides which is a multiple of six, a rule which allows efficient replication of genome RNA of the measles virus.
- In additional embodiments, heterologous DNA, such as a nucleic acid encoding Brachyury protein, is cloned in the measles virus within an Additional Transcription Unit (ATU) inserted in the cDNA corresponding to the antigenomic RNA of measles virus. The location of the ATU can vary along the cDNA: it is however located in such a site that it will benefit from the expression gradient of the measles virus. Therefore, the ATU can be spread along the cDNA. In one embodiment, the ATU is inserted in the N-terminal portion of the sequence and especially within the region upstream from the L-gene of the measles virus and upstream from the M gene of the virus. In other embodiments, the ATU is inserted upstream from the N gene of the virus, see U.S. Published Patent Application No. 2011/0129493, incorporated herein by reference. Particular cistrons in the measles virus genome can targeted to modify genes whose expression is associated with attenuation (Schneider-Shaulies et at. PNAS 92(2): 3943-7, 1995, Takeda, et al. J. Virol. 72/11: 8690-8696, 1998). Thus, in one embodiment, a recombinant measles virus strain is generated encoding a Brachyury protein or Brachyury polypeptide in any of an H protein, a V protein, a C protein, and combinations thereof.
- Recombinant measles virus vectors include the plasmid pTM-MVSchw which contains the cDNA resulting from reverse transcription of the antigenomic RNA of measles virus and an adapted expression control sequence including a promoter and terminator for the T7 polymerase. Vectors are also disclosed, for example, in U.S. Published Patent Application No. 2006/0013826, which is incorporated herein by reference. These vectors are of use in the methods disclosed herein.
- Additional attenuated strains of measles virus can be produced that express a Brachyury protein or Brachyury polypeptide. Attenuated strains of viruses are obtained by serial passage of the virus in cell culture (e.g., in non-human cells), until a virus is identified which is immunogenic but not pathogenic. While wild type virus will cause fatal infection in marmosets, vaccine strains do not. Individuals receiving an attenuated measles virus vaccine do not display classical measles symptoms. Attenuation is associated with decreased viral replication (as measured in vivo by inability to cause measles in monkeys), diminished viremia, and failure to induce cytopathological effects in tissues (e.g., cell-cell fusion, multinucleated cells). See U.S. Pat. No. 7,393,527, which is incorporated herein by reference.
- In one embodiment, an effective dose of an attenuated measles virus encoding a Brachyury protein or Brachyury polypeptide is produced by infecting a primary cell or a continuous cell line with a starting innoculum of a stock comprising an attenuated Moraten strain of measles virus (or an innoculum of an MMR stock) or the MV-Edm strain or any of the other strains described above and expanding the virus after serial passage. Cells or cell lines include, but are not limited to, monkey kidney or testes cells or monkey cell lines (e.g., Vero, KB, CV-1, BSC-1, and the like). Viral replication in cells is observed as cell-cell fusion and syncytia formation.
- The attenuated measles virus is expanded until a desired dose concentration is obtained in standard cell culture media. In one embodiment, the therapeutically effective dose concentration is about 103 to 1012 pfu. In another embodiment of the invention, the concentration is about 105 to 108 pfu. Viral titer can be assayed by inoculating cells (e.g., Vero cells) in culture dishes (e.g., such as 35 mm dishes). After 2-3 hours of viral adsorption, the inoculum is removed and cells are overlaid with a mixture of cell culture medium and agarose or methylcellulose (e.g., 2 ml DMEM containing 5% FCS and 1% SeaPlaque agarose). After about 3 to about 5 days, cultures are fixed with 1 ml of 10% trifluoroacetic acid for about 1 hour, then UV cross-linked for 30 minutes. After removal of the agarose overlay, cell monolayers are stained with crystal violet and plaques are counted to determine viral titer. Virus is harvested from cell syncytia by scraping cells from the dishes, subjecting them to freeze/thawing (e.g., approximately two rounds), and centrifuging. The cleared supernatants represent “plaque purified” virus.
- Viral stocks are produced by infection of cell monolayers (e.g., adsorption for about 1.5 hours at 37° C.), followed by scraping of infected cells into a suitable medium (e.g., Opti-MEM, Gibco-BRL) and freeze/thaw lysis (for example, 2 rounds). Viral stocks are aliquoted, frozen and stored at 70° C.-80° C. and can be stored at concentrations higher than the therapeutically effective dose. In one embodiment, viral stock is stored in a stabilizing solution. Stabilizing solutions are known in the art, see for example, U.S. Pat. No. 4,985,244, and U.S. Pat. No. 4,500,512.
- Poliovirus
- Polioviruses encoding a Brachyury protein or a Brachyury polypeptide are provided and are of use in the methods disclosed herein. The entire poliovirus genome has been cloned and sequenced and the viral proteins identified. An infectious poliovirus cDNA is also available which has allowed further genetic manipulation of the virus (Racaniello V R et al., Science 214(4542) 916-919, 1981). The wild-type genomic RNA molecule is 7433 nucleotides long, polyadenylated at the 3′ end and has a small covalently attached viral protein (VPg) at the 5′ terminus (Kitamura N et al., Nature 291:547-553; 1981 Racaniello V R et al., Proc. Natl. Acad. Sci. USA 78:4887-4891, 1981). Expression of the poliovirus genome occurs via the translation of a single protein (polyprotein) which is subsequently processed by virus encoded proteases (2A and 3C) to give the mature structural (capsid) and nonstructural proteins (Kitamura N et al., Nature 291:547-553, 1981; Koch F et al., The Molecular Biology of Poliovirus, Springer-Verlag, Vienna, 1985). Poliovirus replication is catalyzed by the virus-encoded RNA-dependent RNA polymerase, which copies the genomic RNA to give a complementary RNA molecule, which then serves as a template for further RNA production (Koch F et al., supra; Kuhn R J et al., in D J Rowlands et al. (ed.) Molecular Biology of Positive Strand RNA viruses, Academic Press Ltd., London, 1987). The translation and proteolytic processing of the poliovirus polyprotein is described in Nicklin M J H et al., Bio/Technology 4:33-42, 1986.
- The viral RNA genome encodes the necessary proteins required for generation of new progeny RNA, as well as encapsidation of the new RNA genomes. In vitro, poliovirus is lytic, resulting in the complete destruction of permissive cells. Since the viral replication cycle does not include any DNA intermediates, there is no possibility of integration of viral DNA into the host chromosomal DNA.
- Early studies identified three poliovirus types based on reactivity to antibodies (Koch F et al., supra, 1985). These three serological types, designated as type I, type II, and type III, have been further distinguished as having numerous nucleotide differences in both the non-coding regions and the protein coding regions. All three strains are suitable for use in delivering heterologous proteins. In addition, there are also available attenuated versions of all three strains of poliovirus.
- Replicons can comprise deoxyribonucleic acid (DNA) or ribonucleic acid (RNA). Replicons are poliovirus-based polynucleotides that lack a wild type poliovirus nucleic acid necessary for encapsidation of the virus. Consequently, newly encapsidated replicons cannot be produced following initial cell entry in the absence of the missing nucleic acid. Replicons can lack this nucleic acid as a result of any modification of the wildtype poliovirus nucleic acid including, but not limited to, deletions, insertions, and substitutions, including an insertion of a nucleic acid encoding a Brachyury protein. In some embodiments, poliovirus replicons lack a wild type poliovirus nucleic acid that encodes at least a portion of a protein that is required for encapsidation. Proteins necessary for replicon encapsidation include proteins that are part of the capsid structure. Examples of such proteins are those encoded by the VP1, VP2, VP3, and VP4 genes of the poliovirus P1 capsid precursor region, the Vpg protein, and those proteins that are necessary for proper processing of structural proteins of the capsid structure, such as the proteases responsible for cleaving the viral polyprotein. Thus, in some embodiments, the poliovirus vector lacks nucleic acid sequences encoding one or more of VP1, VP2, VP3, and VP4, genes of the poliovirus P1 capsid precursor region, the Vpg protein, and encodes a Brachyury protein or Brachyury polypeptide.
- Replicons are typically introduced into a cell in an RNA form. Encapsidated replicons are able to enter cells via interaction of the capsid proteins with poliovirus receptor. Replicons are fully capable of RNA replication (amplification) upon introduction into cells and translation, in the correct reading frame, of the single polyprotein through which expression of the entire replicon genome occurs. Translation of replicon sequences may be transient, usually lasting only about 24-48 hours. High levels of replicon-encoded proteins can accumulate during the translation period. Encapsidated replicons are able to enter cells via interaction of the capsid proteins with the hPVR protein.
- In some embodiments, replicons comprise RNA, including sequences encoding Brachyury protein, and are encapsidated. In some examples, the replicons have a deletion of the capsid (P1) gene and are derived from the RNA genome of
poliovirus type 1,type 2,type 3 or combinations thereof. Further, a nucleic acid encoding a Brachyury protein or Brachyury polypeptide can be substituted for part or all of the capsid (P1) gene such that the portion of the capsid (P1) gene which remains, if any, is insufficient to support encapsidation in vivo. Generally, the term “P1 replicons” refers to replicons in which the entire nucleic acid encoding the P1 capsid precursor protein has been deleted or altered such that the proteins which are normally encoded by this nucleic acid are not expressed or are expressed in a non-functional form. The proteins that are normally encoded by the P capsid precursor region of the poliovirus genome include the proteins encoded by the VP1, VP2, VP3, and VP4 genes. P1 replicons, therefore, lack the VP1, VP2, VP3, and VP4 genes or comprise unexpressible or non-functional forms of the VP1, VP2, VP3, and VP4 genes. P1 replicons can include a nucleic acid encoding a Brachyury protein or Brachyury polypeptide substituted for the VP1, VP2, VP3, and VP4 genes. - In some embodiments, encapsidated replicons may be produced by introducing both a replicon and a complementing expression vector that provides the missing nucleic acid necessary for encapsidation in trans to a host cell. A “replicon encapsidation vector” refers to a non-poliovirus-based vector that comprises a nucleic acid required for replicon encapsidation and provides the required nucleic acid (or encoded protein) in trans. Replicon encapsidation vectors can be introduced into a host cell prior to, concurrently with, or subsequent to replicon introduction. Suitable methods for encapsidation are disclosed in U.S. Pat. No. 6,680,169, which is incorporated by reference herein. Methods which can be used to prepare encapsidated replicons have been described Porter D C et al., J. Virol. 67:3712-3719, 1993; Porter D C et al., 1995, J. Virol. 69:1548-1555, 1995; PCT Publication No. WO 96/25173; U.S. Pat. Nos. 5,614,413, 5,817,512; 6,063,384; and U.S. Pat. No. 6,680,169.
- Nonencapsidated replicons can be delivered directly to target cells, for example by direct injection into, for example, muscle cells (see, for example, Acsadi G et al., Nature 352(6338):815-818, 1991; Wolff J A et al., Science 247:1465-1468, 1990), or by electroporation, transfection mediated by calcium phosphate, transfection mediated by DEAE-dextran, liposome-mediated transfection or receptor-mediated nucleic acid uptake (see for example Wu G et al., J. Biol. Chem. 263:14621-14624, 1988; Wilson J M et al., J. Biol. Chem. 267:963-967, 1992; and U.S. Pat. No. 5,166,320), or other methods of delivering naked nucleic acids to target cells.
- Retroviral Vectors
- Retroviral vectors, including lentiviral vectors encoding a Brachyury protein and/or Brachyury polypeptide are provided and are of use in the methods disclosed herein. Retroviral vectors have been tested and found to be suitable delivery vehicles for the stable introduction of a variety of genes of interest into the genomic DNA of a broad range of target cells. Without being bound by theory, the ability of retroviral vectors to deliver unrearranged, single copy transgenes into cells makes retroviral vectors well suited for transferring genes into cells. Further, retroviruses enter host cells by the binding of retroviral envelope glycoproteins to specific cell surface receptors on the host cells. Consequently, pseudotyped retroviral vectors in which the encoded native envelope protein is replaced by a heterologous envelope protein that has a different cellular specificity than the native envelope protein (e.g., binds to a different cell-surface receptor as compared to the native envelope protein) can also be used.
- Generally, retroviruses contain three major coding domains, gag, pol, env, which code for essential virion proteins. Retroviral vectors are of use wherein gag, pol and/or env are absent or not functional. Retroviral vectors are disclosed, for example, in U.S. Published Patent Application No. 20060286634, which is incorporated herein by reference herein.
- Thus retroviral vectors are provided which include, for example, retroviral transfer vectors comprising a nucleic acid encoding a Brachyury protein and retroviral packaging vectors comprising one or more packaging elements. In some embodiments, pseudotyped retroviral vectors are provided encoding a heterologous or functionally modified envelope protein for producing pseudotyped retrovirus.
- There are many retroviruses and examples include: murine leukemia virus (MLV), lentivirus such as human immunodeficiency virus (HIV), equine infectious anaemia virus (EIAV), mouse mammary tumor virus (MMTV), Rous sarcoma virus (RSV), Fujinami sarcoma virus (FuSV), Moloney murine leukemia virus (Mo-MLV), FBR murine osteosarcoma virus (FBR MSV), Moloney murine sarcoma virus (Mo-MSV), Abelson murine leukemia virus (A-MLV), Avian myelocytomatosis virus-29 (MC29), and Avian erythroblastosis virus (AEV). Other retroviruses suitable for use include, but are not limited to, Avian Leukosis Virus, Bovine Leukemia Virus, Mink-Cell Focus-Inducing Virus. The core sequence of the retroviral vectors can be derived from a wide variety of retroviruses, including for example, B, C, and D type retroviruses as well as spumaviruses and lentiviruses (see RNA Tumor Viruses, Second Edition, Cold Spring Harbor Laboratory, 1985). An example of a retrovirus suitable for use in the compositions and methods disclosed herein, includes, but is not limited to, lentivirus.
- One lentivirus is a human immunodeficiency virus (HIV), for example,
type 1 or 2 (i.e., HIV-1 or HIV-2). Other lentivirus vectors include sheep Visna/maedi virus, feline immunodeficiency virus (FIV), bovine lentivirus, simian immunodeficiency virus (SIV), an equine infectious anemia virus (EIAV), and a caprine arthritis-encephalitis virus (CAEV). - Lentiviruses share several structural virion proteins in common, including the envelope glycoproteins SU (gp120) and TM (gp41), which are encoded by the env gene; CA (p24), MA (p117) and NC (p7-11), which are encoded by the gag gene; and RT, PR and IN encoded by the pol gene. HIV-1 and HIV-2 contain accessory and other proteins involved in regulation of synthesis and processing virus RNA and other replicative functions. The accessory proteins, encoded by the vif, vpr, vpu/vpx, and nef genes, can be omitted (or inactivated) from the recombinant system. In addition, tat and rev can be omitted or inactivated, such as by mutation or deletion.
- Without being bound by theory, the use of lentivirus-based gene transfer techniques generally relies on the in vitro production of recombinant lentiviral particles carrying a highly deleted viral genome in which a gene of interest, such as a nucleic acid encoding a Brachyury protein or Brachyury polypeptide, is accommodated. In particular, the recombinant lentivirus are recovered through the in trans co-expression in a permissive cell line of (1) the packaging constructs, i.e., a vector expressing the Gag-Pol precursors together with Rev (alternatively expressed in trans); (2) a vector expressing an envelope receptor, generally of an heterologous nature, and (3) the transfer vector, consisting in the viral cDNA deprived of all open reading frames, but maintaining the sequences required for replication, incapsidation, and expression, in which the sequences to be expressed are inserted. In one embodiment the lentigen lentiviral vector described in Lu, X. et al. Journal of gene medicine 6:963-973, 2004 is used to express the Brachyury protein or Brachyury polypeptide. Suitable lentiviral vectors are also disclosed, for example, in U.S. Published Patent Application No. 20100062524, which is incorporated herein by reference.
- Retroviral packaging systems for generating producer cells and producer cell lines that produce retroviruses, and methods of making such packaging systems are known in the art. Generally, the retroviral packaging systems include at least two packaging vectors: a first packaging vector which includes a first nucleotide sequence comprising a gag, a pol, or gag and pol genes; and a second packaging vector which includes a second nucleotide sequence comprising a heterologous or functionally modified envelope gene. In some embodiments, the retroviral elements are derived from a lentivirus, such as HIV. These vectors can lack a functional tat gene and/or functional accessory genes (vif, vpr, vpu, vpx, nef). In other embodiments, the system further comprises a third packaging vector that comprises a nucleotide sequence comprising a rev gene. The packaging system can be provided in the form of a packaging cell that contains the first, second, and, optionally, third nucleotide sequences.
- First generation lentiviral vector packaging systems provide separate packaging constructs for gag/pol and env, and typically employ a heterologous or functionally modified envelope protein for safety reasons. In second generation lentiviral vector systems, the accessory genes, vif, vpr, vpu and nef, are deleted or inactivated. Third generation lentiviral vector systems are those from which the tat gene has been deleted or otherwise inactivated (e.g., via mutation). Compensation for the regulation of transcription normally provided by tat can be provided by the use of a strong constitutive promoter, such as the human cytomegalovirus immediate early (HCMV-IE) enhancer/promoter. Other promoters/enhancers can be selected based on strength of constitutive promoter activity, specificity for target tissue (e.g., liver-specific promoter), or other factors relating to desired control over expression, as is understood in the art. For example, in some embodiments, an inducible promoter such as tet can be used to achieve controlled expression. The gene encoding rev can be provided on a separate expression construct, such that a typical third generation lentiviral vector system will involve four plasmids: one each for gagpol, rev, envelope and the transfer vector. Regardless of the generation of packaging system employed, gag and pol can be provided on a single construct or on separate constructs.
- Typically, the packaging vectors are included in a packaging cell, and are introduced into the cell via transfection, transduction or infection. Methods for transfection, transduction or infection are well known by those of skill in the art. A retroviral vector of the present invention can be introduced into a packaging cell line, via transfection, transduction or infection, to generate a producer cell or cell line. The packaging vectors can be introduced into human cells or cell lines by standard methods including, for example, calcium phosphate transfection, lipofection or electroporation. In some embodiments, the packaging vectors are introduced into the cells together with a dominant selectable marker, such as neo, DHFR, Gin synthetase or ADA, followed by selection in the presence of the appropriate drug and isolation of clones. A selectable marker gene can be linked physically to genes encoding by the packaging vector.
- Stable cell lines, wherein the packaging functions are configured to be expressed by a suitable packaging cell, are known. For example, see U.S. Pat. No. 5,686,279; and Ory et al., Proc. Natl. Acad. Sci. 93:11400-11406, 1996, which describe packaging cells. Zufferey et al., Nature Biotechnology 15:871-875, 1997 disclose a lentiviral packaging plasmid wherein
sequences 3′ of pol including the HIV-1 envelope gene are deleted. The construct contains tat and rev sequences and the 3′ LTR is replaced with poly A sequences. The 5′ LTR and psi sequences are replaced by another promoter, such as one which is inducible. For example, a CMV promoter can be used. - The packaging vectors can include additional changes to the packaging functions to enhance lentiviral protein expression and to enhance safety. For example, all of the HIV sequences upstream of gag can be removed. Also, sequences downstream of envelope can be removed. Moreover, steps can be taken to modify the vector to enhance the splicing and translation of the RNA.
- A self-inactivating vector (SIN) can be used, which improves the biosafety of the vector by deletion of the HIV-1 long terminal repeat (LTR) as described, for example, by Zufferey et al., J. Virology 72(12):9873-9880, 1998. Inducible vectors can also be used, such as through a tet-inducible LTR.
- Host Cells
- DNA sequences encoding a Brachyury protein and/or Brachyury polypeptide can be expressed from a vector in vitro by DNA transfer into a suitable host cell. The term “host cell” also includes any progeny of the subject host cell. It is understood that all progeny may not be identical to the parental cell since there may be mutations that occur during replication. Methods of stable transfer, meaning that the foreign DNA is continuously maintained in the host, are known in the art.
- Hosts cells can include microbial, insect and mammalian host cells. Methods of expressing DNA sequences having eukaryotic or viral sequences in prokaryotes are well known in the art. Non-limiting examples of suitable host cells include animal cells (for example, mammalian cells, such as human). Techniques for the propagation of mammalian cells in culture are well-known (see, Jakoby and Pastan (eds), 1979, Cell Culture. Methods in Enzymology, volume 58, Academic Press, Inc., Harcourt Brace Jovanovich, N.Y.). Examples of commonly used mammalian host cell lines are VERO and HeLa cells, CHO cells, and WI38, BHK, and COS cell lines, although cell lines may be used, such as cells designed to provide higher expression desirable glycosylation patterns, or other features.
- Transformation of a host cell with recombinant DNA can be carried out by conventional techniques as are well known to those skilled in the art. Where the host is prokaryotic, such as, but not limited to, E coli, competent cells which are capable of DNA uptake can be prepared from cells harvested after exponential growth phase and subsequently treated by the CaCl2) method using procedures well known in the art. Alternatively, MgCl2 or RbCl can be used. Transformation can also be performed after forming a protoplast of the host cell if desired, or by electroporation.
- When the host is a eukaryote, such methods of transfection of DNA as calcium phosphate coprecipitates, conventional mechanical procedures such as microinjection, electroporation, insertion of a plasmid encased in liposomes, or infection with the poxvirus vectors can be used. Eukaryotic cells can also be co-transformed with polynucleotide sequences encoding a Brachyury protein or Brachyury polypeptide, and a second foreign DNA molecule encoding a selectable phenotype, such as the herpes simplex thymidine kinase gene. Methods for using viral vectors to transform eukaryotic cells are known, (see for example, Eukaryotic Viral Vectors, Cold Spring Harbor Laboratory, Gluzman ed., 1982).
- A nucleic acid encoding a Brachyury protein is expressed in the host cell, such as a Salmonella host cell, for example S typhimurium host cell, or a Listeria, such as a L. monocytogenes host cell. A host cell-compatible promoter is any promoter or promoter/enhancer that is able to initiate sufficient transcription of the Brachyury protein or Brachyury polypeptide, such as in amounts sufficient to induce a Brachyury specific CD4+ T cell response when the host cell is introduced into the subject. Some examples of expression control sequences are a promoter/enhancer from the cytomegalovirus (CMV) immediate
early gene 1 or the Rous sarcoma virus (RSV) long terminal repeat or thesimian virus 40 promoter or theadenovirus 2 major late promoter or the mouse mammary tumor virus promoter (MMTV). These host cells can be used in attenuated and/or heat-killed forms. These host cells can be administered multiple times without eliciting host neutralizing activity. - In some embodiments the host cell are utilized with an adjuvant. Specific non-limiting examples of adjuvants of use are GM-CSF, Bacillus-Calmette-Guerin adjvant or CD40 ligand (CD40L).
- Attenuated Bacteria: Listeria and Salmonella
- Prokaryotic host cells include Listeria and Salmonella, which can be used directly to provide a Brachyury protein and/or Brachyury polypeptide, such as for use in the methods disclosed herein. Thus, in some embodiments, an attenuated invasive intracellular bacterium capable of infecting a mammalian host or cell thereof, but having a decreased ability in intra- and intercellular movement in the host as compared to a wild type bacterium is utilized. In some embodiments, the bactium is transformed with (a) a promoter activated when said bacterium is present in the cytosol of a host cell, operably linked to a structural gene or fragment thereof, encoding a polypeptide which is lethal to the bacterium, (b) a host cell-compatible promoter, operably linked to a structural gene or fragment thereof, encoding a Brachyury protein, wherein (a) and (b) can be on the same plasmid or different plasmids or (a) can be integrated into the bacterial chromosome. The attenuated bacteria include a number of intracellular bacteria, such as Salmonella, Yersinia, Renibacterium and Listeria capable of intracellular growth (Coynault et al., Molecular Microbiology 22, 149-160, 1996; Hohmann et al., Vaccine 14, 19-14, 1996; Karem et al., Infection and Immuity 63, 4557-4563, 1995; O'Callaghan et al., Infection and Immunity 56, 419-423, 1988; Sigwart et al., Infection and Immunity 57, 1858-61, 1989; and Sinha et al., Infection and Immunity 65, 1566-1569, 1997).
- The disclosed attenuated invasive bacteria can still invade a host, or cells thereof, but are not pathogenic. In some embodiments, attenuation can be achieved by mutation (see T. Maniatis, et al. Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor, N.Y., 1989). In specific non-limiting examples, attenuation can be caused by mutating the bacterial genes which encode for pathogenic and/or toxic polypeptides. Such a mutation can be achieved randomly, such as by chemical modification and selected later, for example, for loss of function, or it can be site directed. Thus in some embodiments, the bacterium is attenuated by deletion, insertion or point mutations, to eliminate the function of certain genes that encode polypeptides which lead to pathogenesis. In some embodiments, the bacterium is attenuated by deletion of an entire operon by chromosomal deletion, such as the attenuated L. monocytogenes mutant strain DELTA2 that is a derivative of the fully virulent wild-type strain EGD, and lacks the entire lecithinase operon consisting of the genes mpl, actA and plcB due to a chromosomal deletion. Due to the deletion of this operon the inflammatory response caused by L. monocytogenes during infection of a mammalian host is significantly reduced. Suitable bacteria are disclosed for example, in U.S. Pat. No. 6,143,551, which is incorporated by reference herein.
- A variety of potential live Salmonella strains with different attenuation levels, which subsequently serve as platforms for the development of recombinant live Salmonella carrier strains that express heterologous antigens. Such recombinant live Salmonella vaccine carriers are equipped with modules comprising variable gene cassettes that regulate the expression of heterologous antigens in Salmonella and determine presentation of the heterologous antigens to the host immune system. By combinations of both systems, differently attenuated live Salmonella vaccine strains and variable gene cassettes, a variety of recombinant live carrier strains can be generated that have broad application.
- S. typhimurium contains two type III secretion systems for virulence determinants. The first controls bacterial invasion of epithelial cells, and is encoded by genes within a 40 kb pathogenicity island (SPI1). The other is encoded by genes within a second 40 kb pathogenicity island (SPI2) and is required for systemic growth of this pathogen within its host. The genes located on pathogenicity island SPI1 are mainly responsible for early steps of the infection process, the invasion of non-phagocytic host cells by the bacterium. For most of the SPI1 genes, mutations result in a reduced invasiveness in vitro. However, mutants that are defective in invasion are not necessarily avirulent. In comparison, virulence studies of SPI2 mutants have shown them to be attenuated by at least five orders of magnitude compared with the wild-type strain after both oral and intraperitoneal inoculation of mice.
- Many of the genes encoding components of the SPI2 secretion system are located in a 25 kb segment of SPI2. SPI2 contains genes for a type III secretion apparatus (ssa) and a two component regulatory system (ssr), as well as candidate genes for a set of secreted effectors (sse) and their specific chaperones (ssc). On the basis of similarities with genes present in other bacterial pathogens, the first 13 genes within the ssaK/U operon and ssaJ encode components of the secretion system apparatus. A number of additional genes, including ssaC, which encode a secretion system apparatus protein and a two component regulatory protein, respectively, are found in a region approximately 8 kb from ssaJ.
- Thus, an attenuated gram-negative cell can have inactivated at least one gene selected from effector (sse) gene secretion apparatus (ssa) genes, chaperon (ssc) genes and regulation (ssr) genes. With regard to the sse genes are affected by the inactivation, the inactivated gene is preferably sseC, sseD, sseE or a combination thereof. As far as the ssr genes are affected by the inactivation, preferably at least ssrB is inactivated. As far as the ssc genes are affected by the inactivation, preferably at least sscB is inactivated.
- Attenuation can be the result of original mutations in SPI2 gene locus. Combination of the individual mutations in the SPI2 gene locus with each other, and with other known attenuating gene mutations, such as aroA, results in a broad repertoire of attenuation and immunogenicity. Different expression cassettes can be introduced on these platforms, allowing further modulation of the immune response directed against the heterologous antigens.
- Pathogenic Salmonella or Listeria serve as a basis for the construction of a panel of different live Salmonella vaccine prototypes generated by gradual attenuations accomplished through the introduction of defined SPI2 gene locus mutations. Each resulting individual live Salmonella vaccine prototype is further transformed into a multivalent recombinant vaccine by the introduction of exchangeable DNA modules carrying (1) a nucleic acid encoding a Brachyury protein or polypeptide and (2) adequate expression systems executing efficacious antigen presentation to the host immune system. In concert, these features elicit a specific immune response, such as a Brachyury specific T cell response.
- The inactivation of the gene of the SPI2 locus (or functional homologue thereof in cells other than Salmonella) is effected by a mutation which may comprise deletion. In some embodiments, the deletion is cause by insertion of a heterologous nucleic acid, such as a nucleic acid encoding Brachyury into the gene to be inactivated. With regard to Salmonella, pathogenic Salmonella species are gradually attenuated by mutations in individual virulence genes that are part of the SPI2 gene locus, for example an sse gene coding for an effector protein, such as sseC, ssed or sseE, or an ssc gene, such as sscB, coding for a chaperone, or an ssr gene, such as ssrB, coding for a regulator. Individual mutation of each of these genes leads to a unique individual grade of attenuation, which, in turn, effects a characteristic immune response at the mucosal, humoral and cellular levels. The individual grade of attenuation can be moderately increased by combinations of at least two gene mutations within the SPI2 gene locus or by combination with a mutation in another Salmonella gene known to attenuate virulence, such as an aro gene, for eample aroA. A stronger grade of attenuation is achieved by mutation of a virulence gene that is part of a polycistronic gene cluster encoding several virulence factors, such as the transcriptional unit comprising the sseC, sseD, sseE and sscB genes, such that the mutation exerts a polar effect, disrupting expression of the following genes. The grade of attenuation may directly depend on the number of virulence genes that are affected by the polar mutation as well as their individual characteristics. Finally, the strongest attenuation is achieved when regulatory genes, such as ssrB, are mutated. Again, each mode of attenuation of Salmonella leads to the generation of a live Salmonella strain that evokes an immune response, see U.S. Pat. No. 7,700,104, which is incorporated herein by reference.
- With regard to Listeria, L. monocytogenes is a Gram-positive, facultative intracellular bacterium that lacks lipopolysaccharide (LPS) and is also able to invade a wider range of mammalian cells where it replicates in the cytosol as well (Portnoy et al., Infect. Immun. 60, 1263, 1992). Since it invades its host through the intestinal mucosal surface, L. monocytogenes is also a candidate for oral vaccination. Shortly after infection, bacteria are found in the spleen where professional APC are abundant. Delivery of DNA to those cells is therefore significantly enhanced by the use of suitably constructed L. monocytogenes. Attenuated L. monocytogenes cells are lysed in the cytosol of the host cell by the production of a Pac-dependent phage lysin releasing plasmid DNA which carries a heterologous gene, such as a nucleic acid encoding Brachyury protein, under the control of a promoter, such as, but not limited to, the human cytomegalovirus major immediate-early promoter/enhancer region. Beside the advantages of avoiding the use of antibiotics, lysin-mediated plasmid release is an efficient method comparable to eliminating the bacteria by antibiotic treatment.
- The attenuated bacterium can be a mutant of wild-type Listeria which invades host cells and is released into the cytosol of the infected cells with similar efficiencies as the wild-type strain, but is impaired in intra- and intercellular movement. For example, the mutant L. monocytogenes strain DELTA2 is unable to polymerise host cell actin in the cytosol which L. monocytogenes wild type strain uses for its movement inside the host cell. Furthermore, due to the deletion of plcB, the bacterium is unable to lyse the host cell membranes which the wild type strain lyses upon entering neighboring cells. Mutant bacteria are therefore unable to move from one infected cell into a neighboring cell (cell-to-cell spread). This illustrates a decreased ability as compared to wild type strains in intra- and inter-cellular movement. In some embodiments the attenuated bacterium is a mutant of L. monocytogenes which invades the host and is released into the cytosol of the infected cells with similar efficiencies as the wild-type strain, but it is not pathogenic, i.e., it doesn't cause a disease. In specific non-limiting examples, the bacterium is L. monocytogenes that lacks the entire lecithinase operon containing the genes mpl, actA and plcB, and encodes a Brachyury protein or a Brachyury polypeptide.
- In some embodiments, a structural gene or fragment thereof is also included, such as encoding a polypeptide which is lethal to the bacterium is any polypeptide which when expressed in the bacterium will result in the release of plasmid DNA and death of the bacterium, for example by lysis of the bacterium. In some embodiments, the polypeptide can be a bacteriophage lysin, preferable the gene product of ply 118 or other Listeria-phage-encoded lysins, for example the mureinhydrolase encoded by the iap gene of L. monocytogenes or other iap-related genes especially iap of L. grayi. The lysis protein PLY 118 is a late gene product of the Listeria bacteriophage A118 necessary for the release of progeny phages. PLY 118 is a highly active, cell wall-hydrolyzing enzyme specific for Listeria (Loessner et al., Mol. Microbiol. 16, 1231, 1995). By a promoter activated when it is present in an invasive bacterium which is in the cytosol of a host cell, it is meant any promoter which, when the bacteria is inside the infected cell, is (under the control of a transcription activator which is) preferentially turned on, driving its transcription. For example, the L. monocytogenes promoter PactA can be used. The PactA promoter is controlled by the transcription activator PrfA which regulates most of the known virulence genes of L. monocytogenes and is specifically activated in the cytosol of the infected host cells to interact with the actA promoter. Other promoters which can be used are other promoters of L. monocytogenes, such as those controlling the expression of inlC and other genes for small internalins (Engelbrecht et al., Mol. Microbiol. 21:823-837, 1996).
- Therapeutic Methods and Pharmaceutical Compositions
- The Brachyury proteins and Brachyury polypeptides disclosed herein, nucleic acids encoding the Brachyury proteins or Brachyury polypeptides, or host cells including these nucleic acids can be used to generate an immune response in a subject, such as, but not limited to, a Brachyury specific CD4+ T cell response and/or a Brachyury CD8+ T cells response. In several examples, the subject has a cancer that expresses Brachyury. In other embodiments, the method is a method for preventing cancer in the subject. The subject can be at risk of developing cancer. In specific non-limiting examples, the subject has high grade prostatic intraepithelial neoplasia, familial adenomatous polyposis, or atypia of the breast. The the methods include administering to a subject a therapeutically effective amount of one or more of the Brachyury proteins and/or polypeptides disclosed herein, nucleic acids encoding these Brachyury proteins or Brachyury polypeptides, host cells, such as Listeria or Salmonella host cells, dendritic cells presenting epitopes of the protein or polypeptide, and/or vectors including these nucleic acids, in order to generate an immune response.
- The methods can include selecting a subject in need of treatment, such as a subject with a cancer that expresses Brachyury or a cancer with the potential to express Brachyury. In several examples, the methods include selecting a subject with a cancer of the small intestine, stomach, kidney, bladder, uterus, ovaries, testes lung, colon, prostate, tumor of B cell origin (such as chronic lymphocytic leukemia (CLL), a B cell lymphoma, Burkitt's lymphoma or a Hodgkin's lymphoma) or breast cancer wherein the cancer expresses Brachyury or has the potential to express Brachyury. In some non-limiting examples, examples, the cancer is radiation resistant and/or chemotherapy resistant. In additional non-limiting examples, the subject has breast cancer, such as a ductal carcinoma, for example an infiltrating ductal carcinoma or an estrogen receptor negative and progesterone receptor negative breast cancer. In further examples, the subject has high-grade prostatic intraepithelial neoplasia, familial adenomatous polyposis, or atypia of the breast.
- In exemplary applications, compositions are administered to a subject in an amount sufficient to raise an immune response to Brachyury-expressing cells, such as a CD4+ T cell response. A Brachyury specific CD8+ T cell response can also be induced using the methods disclosed herein. Administration induces a sufficient immune response to slow the proliferation of Brachyury-expressing cells, or to inhibit their growth, or to reduce a sign or a symptom of the cancer, or to prevent a cancer. Amounts effective for this use will depend upon the severity of the disease, the general state of the patient's health, and the robustness of the patient's immune system. In one example, a therapeutically effective amount of the composition is that which provides either subjective relief of a symptom(s) or an objectively identifiable improvement as noted by the clinician or other qualified observer. The composition can include a Brachyury protein and/or a Brachyury polypeptide, a nucleic acid encoding a Brachyury protein and/or a Brachyury polypeptide, a vector including the nucleic acid, or a host cell expressing the Brachyury protein and/or Brachyury polypeptide. It should be noted that these compositions can be used in combination.
- The composition can be administered by any means known to one of skill in the art (see Banga, A., “Parenteral Controlled Delivery of Therapeutic Peptides and Proteins,” in Therapeutic Peptides and Proteins, Technomic Publishing Co., Inc., Lancaster, Pa., 1995). Thus, the composition can be administered either locally or systemically, such as by intramuscular, subcutaneous, intraperitoneal or intravenous injection, but even oral, nasal, transdermal or anal administration is contemplated. In one embodiment, administration is by subcutaneous or intramuscular injection.
- Use of Proteins, Polypeptides, Nucleic Acids and Host Cells
- When the Brachyury protein and/or the Brachyury polypeptide is administered, to extend the time during which protein is available to stimulate a response, the protein and/or polypeptide can be provided as an implant, an oily injection, in a liposome, or as a particulate system. The particulate system can be a microparticle, a microcapsule, a microsphere, a nanocapsule, or similar particle. (see, e.g., Banga, supra). A particulate carrier based on a synthetic polymer has been shown to act as an adjuvant to enhance the immune response, in addition to providing a controlled release. Adjuvants can also be used in combination with the protein, including, for example, chitosan, aluminum salts, an immunostimulatory oligodeoxynucletoide, liposomes and/or one or more cytokines. The Brachyury protein or polypeptide can be administered in a liposome.
- In one specific, non-limiting example, the Brachyury protein is administered in a manner to direct the immune response to a cellular response (that is, a Brachyury specific CD4+ response and/or CD8+ response), rather than a humoral (antibody) response. The Brachyury polypeptide can induce both a Brachyury specific CD4+ T cell response and a Brachyury specific CD8+ T cell response. Methods for measuring a CD4+ and CD8+ T cell response are known in the art, and include biological assays, ELISPOT assays, and fluorescence activated cell sorting. An exemplary assay for measuring Brachyury specific CD4+ T cells is disclosed in the examples below.
- In one specific, non-limiting example, a pharmaceutical composition for intravenous administration would include about 0.1 μg to 10 mg of immunogenic Brachyury protein and/or Brachyury polypeptide per patient per day. Dosages from 0.1 up to about 100 mg per patient per day can be used, particularly if the agent is administered to a secluded site and not into the circulatory or lymph system, such as into a body cavity or into a lumen of an organ. Actual methods for preparing administrable compositions will be known or apparent to those skilled in the art and are described in more detail in such publications as Remingtons Pharmaceutical Sciences, 19th Ed., Mack Publishing Company, Easton, Pa., 1995.
- Optionally, one or more immunostimulatory molecules, such as IL-2, IL-6, IL-12, LFA (for example, LFA-1, LFA-2 and/or LFA-3), CD72, RANTES, G-CSF, GM-CSF, TNF-α, IFN-γ, ICAM-1, B7-1, B7-2, other B7 related molecules, OX-40L and/or or 41 BBL, or combinations of these molecules, can be used as biological adjuvants (see, for example, Salgaller et al., 1998, J. Surg. Oncol. 68(2):122-38; Lotze et al., 2000, Cancer J Sci. Am. 6(Suppl 1):S61-6; Cao et al., 1998, Stem Cells 16(Suppl 1):251-60; Kuiper et al., 2000, Adv. Exp. Med. Biol. 465:381-90). These molecules can be administered systemically (or locally) to the host. In several examples, IL-2, RANTES, GM-CSF, TNF-α, IFN-γ, G-CSF, LFA-3, CD72, B7-1, B7-2, B7-1, B7-2, OX-40L, 41 BBL and/or ICAM-1 are administered. IL-15 or an IL-15/IL-15 receptor complex can be administered.
- A number of means for inducing cellular responses, both in vitro and in vivo, are known. Lipids have been identified as agents capable of assisting in priming T cells in vivo against various antigens. For example, as described in U.S. Pat. No. 5,662,907, palmitic acid residues can be attached to the alpha and epsilon amino groups of a lysine residue and then linked (for example, via one or more linking residues, such as glycine, glycine-glycine, serine, serine-serine, or the like) to an immunogenic peptide or protein. The lipidated peptide can then be injected directly in a micellar form, incorporated in a liposome, or emulsified in an adjuvant. As another example, E. coli lipoproteins, such as tripalmitoyl-S-glycerylcysteinlyseryl-serine can be used to prime tumor specific T cells when covalently attached to an appropriate peptide or protein (see, Deres et al., Nature 342:561, 1989). Further, as the induction of neutralizing antibodies can also be primed with the same molecule conjugated to a protein which displays an appropriate epitope, two compositions can be combined to elicit both humoral and cell-mediated responses where that is deemed desirable.
- A pharmaceutical composition including a Brachyury protein and/or Brachyury polypeptide is thus provided. These compositions are used to generate an immune response, such as for immunotherapy.
- In one embodiment, the Brachyury protein and/or the Brachyury polypeptide is mixed with an adjuvant containing two or more of a stabilizing detergent, a micelle-forming agent, and an oil. Suitable stabilizing detergents, micelle-forming agents, and oils are detailed in U.S. Pat. No. 5,585,103; 5,709,860; 5,270,202; and U.S. Pat. No. 5,695,770, all of which are incorporated by reference. A stabilizing detergent is any detergent that allows the components of the emulsion to remain as a stable emulsion. Such detergents include polysorbate, 80 (TWEEN) (Sorbitan-mono-9-octadecenoate-poly(oxy-1,2-ethanediyl; manufactured by ICI Americas, Wilmington, Del.),
TWEEN 40™,TWEEN 20™,TWEEN 60™, Zwittergent™ 3-12, TEEPOL HB7™, and SPAN 85™. These detergents are usually provided in an amount of approximately 0.05 to 0.5%, such as at about 0.2%. A micelle forming agent is an agent which is able to stabilize the emulsion formed with the other components such that a micelle-like structure is formed. Such agents generally cause some irritation at the site of injection in order to recruit macrophages to enhance the cellular response. Examples of such agents include polymer surfactants described by BASF Wyandotte publications, e.g., Schmolka, J. Am. Oil. Chem. Soc. 54:110, 1977, and Hunter et al., J. Immunol 129:1244, 1981, PLURONIC™ L62LF, L101, and L64, PEG1000, and TETRONIC™ 1501, 150R1, 701, 901, 1301, and 130R1. The chemical structures of such agents are well known in the art. In one embodiment, the agent is chosen to have a hydrophile-lipophile balance (HLB) of between 0 and 2, as defined by Hunter and Bennett, J. Immun. 133:3167, 1984. The agent can be provided in an effective amount, for example between 0.5 and 10%, or in an amount between 1.25 and 5%. - The oil included in the composition is chosen to promote the retention of the antigen in oil-in-water emulsion, such as to provide a vehicle for the desired antigen, and preferably has a melting temperature of less than 65° C. such that emulsion is formed either at room temperature (about 20° C. to 25° C.), or once the temperature of the emulsion is brought down to room temperature. Examples of such oils include squalene, Squalane, EICOSANE™, tetratetracontane, glycerol, and peanut oil or other vegetable oils. In one specific, non-limiting example, the oil is provided in an amount between 1 and 10%, or between 2.5 and 5%. The oil should be both biodegradable and biocompatible so that the body can break down the oil over time, and so that no adverse affects, such as granulomas, are evident upon use of the oil.
- In one embodiment, the adjuvant is a mixture of stabilizing detergents, micelle-forming agent, and oil available under the name PROVAX® (IDEC Pharmaceuticals, San Diego, Calif.). In other embodiments, the Brachyury protein and/or Brachyury polypeptide are included in a liposome.
- Adjuvants can also be administered with the Brachyury protein and/or Brachyury polypeptide. An adjuvant can be any immunostimulatory molecule, such as a cytokine, immunostimulatory nucleic acid, or a biological adjuvant (see above). The adjuvant can be chitosan. Chitosan is a linear polysaccharide formed from repeating beta (1-4 linked) N-acetyl-D-glucosamine and D-glucosamine units, and is derived from the partial deacetylation of chitin obtained from the shells of crustaceans. Chitosan can be made commercially by a heterogeneous alkaline hydrolysis of chitin to give a product which possesses a random distribution of remaining acetyl moieties. The properties of chitosans depend upon inter alia the degree of deacetylation, and the molecular weight. Most commercially available chitosans contain a population of chitosan molecules of varying molecular weights and varying concentrations of the component N-acetyl-D-glucosamine and D-glucosamine groups. The immunological properties of chitosans are known to be linked to the ratio between the N-acetyl-D-glucosamine and D-glucosamine groups. The efficacy of chitosans as adjuvants depends to a considerable extent on the extent of the level of deacetylation. Thus, in some embodiments, the chitosan is at least 80% deacetylated, see U.S. Pat. No. 6,534,065, which is incorporated herein by reference.
- Controlled release parenteral formulations can be made as implants, oily injections, or as particulate systems. For a broad overview of protein delivery systems, see Banga, Therapeutic Peptides and Proteins: Formulation, Processing, and Delivery Systems, Technomic Publishing Company, Inc., Lancaster, Pa., 1995. Particulate systems include microspheres, microparticles, microcapsules, nanocapsules, nanospheres, and nanoparticles. Microcapsules contain the therapeutic protein as a central core. In microspheres, the therapeutic agent is dispersed throughout the particle. Particles, microspheres, and microcapsules smaller than about 1 μm are generally referred to as nanoparticles, nanospheres, and nanocapsules, respectively. Capillaries have a diameter of approximately 5 μm so that only nanoparticles are administered intravenously. Microparticles are typically around 100 μm in diameter and are administered subcutaneously or intramuscularly (see Kreuter, Colloidal Drug Delivery Systems, J. Kreuter, ed., Marcel Dekker, Inc., New York, N.Y., pp. 219-342, 1994; Tice & Tabibi, Treatise on Controlled Drug Delivery, A. Kydonieus, ed., Marcel Dekker, Inc. New York, N.Y., pp. 315-339, 1992).
- Polymers can be used for ion-controlled release. Various degradable and nondegradable polymeric matrices for use in controlled drug delivery are known in the art (Langer, Accounts Chem. Res. 26:537, 1993). For example, the block copolymer, polaxamer 407 exists as a viscous yet mobile liquid at low temperatures but forms a semisolid gel at body temperature. It has shown to be an effective vehicle for formulation and sustained delivery of recombinant interleukin-2 and urease (Johnston et al., Pharm. Res. 9:425, 1992; and Pec. J. Parent. Sci. Tech. 44(2):58, 1990). Alternatively, hydroxyapatite has been used as a microcarrier for controlled release of proteins (Ijntema et al., Int. J. Pharm. 112:215, 1994). In yet another aspect, liposomes are used for controlled release as well as drug targeting of the lipid-capsulated drug (Betageri et al., Liposome Drug Delivery Systems, Technomic Publishing Co., Inc., Lancaster, Pa., 1993). Numerous additional systems for controlled delivery of therapeutic proteins are known (e.g., U.S. Pat. Nos. 5,055,303; 5,188,837; 4,235,871; 4,501,728; 4,837,028; 4,957,735; and U.S. Pat. Nos. 5,019,369; 5,055,303; 5,514,670; 5,413,797; 5,268,164; 5,004,697; 4,902,505; 5,506,206; 5,271,961; 5,254,342; and U.S. Pat. No. 5,534,496).
- In another embodiment, the composition includes a nucleic acid encoding a Brachyury protein and/or a Brachyury polypeptide. A therapeutically effective amount of the polynucleotide encoding the Brachyury protein and/or the Brachyury polypeptide can be administered to a subject in order to generate an immune response. In one specific, non-limiting example, a therapeutically effective amount of the polynucleotide encoding the Brachyury protein and/or Brachyury polypeptide is administered to a subject to treat or prevent cancer.
- Optionally, one or more immunostimulatory molecules and/or costimulatory molecules, such as IL-2, IL-6, IL-12, LFA (for example, LFA-1, LFA-2 and/or LFA-3), CD72, RANTES, G-CSF, GM-CSF, TNF-α, IFN-γ ICAM-1, B7-1, B7-2, other B7 related molecules, OX-40L or 41 BBL, or combinations of these molecules, can be used as biological adjuvants (see, for example, Salgaller et al., 1998, J. Surg. Oncol. 68(2):122-38; Lotze et al., 2000. Cancer J Sci. Am. 6(Suppl 1):561-6; Cao et al., 1998, Stem Cells 16(Suppl 1):251-60; Kuiper et al., 2000, Adv. Exp. Med. Biol. 465:381-90). These molecules can be administered systemically (or locally) to the host. In several examples, IL-2, RANTES, GM-CSF, TNF-α, IFN-γ, G-CSF, LFA-3, CD72, B7-1, B7-2, B7-1, B7-2, OX-40L, 41 BBL and/or ICAM-1 are administered. L-15 or an IL-15/IL-15 receptor complex can be administered.
- Optionally, a non-pox non-yeast vector is administered that encodes one or more immunostimulatory or costimulatory molecules, such as IL-2, IL-6, IL-12, IL-15, LFA (for example, LFA-1, LFA-2 and/or LFA-3), CD72, RANTES, G-CSF, GM-CSF, TNF-α, IFN-γ, ICAM-1, B7-1, B7-2, other B7 related molecules, OX-40L or 41 BBL, or combinations of these molecules (see, for example, Salgaller et al., 1998, J. Surg. Oncol. 68(2):122-38; Lotze et al., 2000, Cancer J Sci. Am. 6(Suppl 1):S61-6; Cao et al., 1998, Stem Cells 16(Suppl 1):251-60; Kuiper et al., 2000, Adv. Exp. Med. Biol. 465:381-90). In several examples, the vector can encode IL-2, RANTES, GM-CSF, TNF-α, IFN-γ, G-CSF, LFA-3, CD72, B7-1, B7-2, B7-1, B7-2, OX-40L, 41 BBL and/or ICAM-1. In various embodiments, the nucleic acid encoding the biological adjuvant can be cloned into same vector as the Brachyury protein or Brachyury polypeptide coding sequence, or the nucleic acid can be cloned into one or more separate vectors for co-administration. In addition, nonspecific immunomodulating factors such as Bacillus Cahnette-Guerin (BCG) and levamisole can be co-administered.
- One approach to administration of nucleic acids is direct immunization with plasmid DNA, such as with a mammalian expression plasmid. As described above, the nucleotide sequence encoding a Brachyury protein or polypeptide can be placed under the control of a promoter to increase expression of the molecule.
- Immunization by nucleic acid constructs is well known in the art and taught, for example, in U.S. Pat. No. 5,643,578 (which describes methods of immunizing vertebrates by introducing DNA encoding a desired antigen to elicit a cell-mediated or a humoral response), and U.S. Pat. No. 5,593,972 and U.S. Pat. No. 5,817,637 (which describe operably linking a nucleic acid sequence encoding an antigen to regulatory sequences enabling expression). U.S. Pat. No. 5,880,103 describes several methods of delivery of nucleic acids encoding immunogenic peptides or other antigens to an organism. The methods include liposomal delivery of the nucleic acids (or of the synthetic peptides themselves), and immune-stimulating constructs, or ISCOMS™, negatively charged cage-like structures of 30-40 nm in size formed spontaneously on mixing cholesterol and Quil A™ (saponin). Protective immunity has been generated in a variety of experimental models of infection, including toxoplasmosis and Epstein-Barr virus-induced tumors, using ISCOMS™ as the delivery vehicle for antigens (Mowat and Donachie, Immunol. Today 12:383, 1991). Doses of antigen as low as 1 μg encapsulated in ISCOMS™ have been found to produce Class I mediated CTL responses (Takahashi et al., Nature 344:873, 1990). In other embodiments, the nucleic acid can be loaded onto gold microspheres by standard methods and introduced into the skin by a device such as Bio-Rad's HELIOS™ Gene Gun. The nucleic acids can be “naked,” consisting of plasmids under control of a strong promoter. Typically, the DNA is injected into muscle, although it can also be injected directly into other sites, including tissues in proximity to metastases. Dosages for injection are usually around 0.5 μg/kg to about 50 mg/kg, and typically are about 0.005 mg/kg to about 5 mg/kg (see, for example, U.S. Pat. No. 5,589,466).
- In another approach to using nucleic acids for immunization, a Brachyury protein or Brachyury polypeptide can also be expressed by attenuated host cells or non-pox non-yeast viral vectors. These vectors and host cells are disclosed above. Suitable non-pox non-yeast viral vector, include an adenovirus, an alphvirus, a lentivirus, a measles virus or a poliovirus vector. Suitable host cell include an attenuated bacterium, such as Listeria or Salmonella host cells.
- A first recombinant non-pox virus encoding a Brachyury protein can be used in conjunction with a second recombinant non-pox virus which has incorporated into a viral genome or infectable portion thereof one or more genes or DNA sequences encoding B7-1, B7-2, or B7-1 and B7-2, wherein the composition is able to coinfect a host cell resulting in coexpression of the polypeptide and the B7-1, B7-2, or B7-1 and B7-2 encoding genes or DNA sequences (see U.S. Pat. No. 6,893,869, and U.S. Pat. No. 6,045,908, which are incorporated by reference herein). The expression of the B7 gene family has been shown to be an important mechanism of anti-tumor responses in both mice and humans.
- When a non-pox viral vector is utilized, it is desirable to provide the recipient with a dosage of each recombinant virus in the composition in the range of from about 10′ to about 1010 plaque forming units/mg mammal, although a lower or higher dose can be administered. The composition of recombinant viral vectors can be introduced into a mammal either prior to any evidence of a cancer, or to mediate regression of the disease in a mammal afflicted with the cancer. Examples of methods for administering the composition into mammals include, but are not limited to, exposure of cells to the recombinant virus ex vivo, or injection of the composition into the affected tissue or intravenous, subcutaneous, intradermal or intramuscular administration of the virus. Alternatively the recombinant viral vector or combination of recombinant viral vectors may be administered locally by direct injection into the cancerous lesion in a pharmaceutically acceptable carrier. Generally, the quantity of recombinant non-pox viral vector, carrying the nucleic acid sequence of a Brachyury protein or Brachyury polypeptide to be administered is based on the titer of virus particles. An exemplary range of the immunogen to be administered is 105 to 1010 virus particles per mammal, such as a human.
- In the embodiment where a combination of a first recombinant viral vector carrying a nucleic acid sequence of a Brachyury protein or Brachyury polypeptide and a second recombinant viral vector carrying the nucleic acid sequence of one or more costimulatory or immunostimulatory molecules is used, the mammal can be immunized with different ratios of the first and second recombinant viral vector. In one embodiment the ratio of the first vector to the second vector is about 1:1, or about 1:3, or about 1:5. Optimal ratios of the first vector to the second vector may easily be titered using the methods known in the art (see, for example, U.S. Pat. No. 6,893,869, incorporated herein by reference). Simultaneous production of an immunostimulatory molecule and the Brachyury protein or Brachyury polypeptide enhances the generation of specific effectors. Without being bound by theory, dependent upon the specific immunostimulatory molecules, different mechanisms might be responsible for the enhanced immunogenicity: augmentation of help signal (IL-2), recruitment of professional APC (GM-CSF), increase in CTL frequency (IL-2), effect on antigen processing pathway and MHC expression (IFNγ and TNFα) and the like. For example, IL-2, IL-6, IL-15, interferon, tumor necrosis factor, or a nucleic acid encoding these molecules, can be administered in conjunction with a Brachyury protein, or a nucleic acid encoding a Brachyury protein or Brachyury polypeptide. The co-expression of a Brachyury protein or Brachyury polypeptide together with at least one immunostimulatory molecule can be effective in an animal model to show anti-tumor effects.
- Single or multiple administrations of the compositions are administered depending on the dosage and frequency as required and tolerated by the subject. In one embodiment, the dosage is administered once as a bolus, but in another embodiment can be applied periodically until a therapeutic result is achieved. Generally, the dose is sufficient to induce an immune response to Brachyury, to treat or ameliorate symptoms or signs of disease, without producing unacceptable toxicity to the subject. Systemic or local administration can be utilized.
- Use of Antigen Presenting Cells
- In another method, antigen presenting cells (APCs), such as dendritic cells, are pulsed or co-incubated with a Brachyury protein and/or Brachyury polypeptide in vitro. In one specific, non-limiting example, the antigen presenting cells can be autologous cells. A therapeutically effective amount of the antigen presenting cells, such as dendritic cells presenting epitopes of the protein or polypeptide can then be administered to a subject. In some embodiments, the method is a method of treating and/or preventing cancer in a subject.
- The Brachyury protein and/or Brachyury polypeptide can be delivered to the dendritic cells or to dendritic cell precursors via any method known in the art, including, but not limited to, pulsing dendritic cells directly with antigen, or utilizing a broad variety of antigen delivery vehicles, such as, for example, liposomes, or other vectors known to deliver antigen to cells. In one specific, non-limiting example an antigenic formulation includes about 0.1 μg to about 1,000 μg, or about 1 to about 100 μg of a selected Brachyury protein. The Brachyury protein can also be administered with agents that promote dendritic cell maturation. Specific, non-limiting examples of agents of use are interleukin-4 (IL-4) and granulocyte/macrophage colony stimulating factor (GM-CSF), or flt-3 ligand (flt-3L). The preparation can also contain buffers, excipients, and preservatives, amongst other ingredients.
- In one embodiment, mature antigen presenting cells are generated to present the Brachyury protein and/or Brachyury polypeptide epitopes. These dendritic cells are then administered alone (or in combination with another agent) to a subject with a cancer that expresses Brachyury, or has the potential to express Brachyury, such as a small intestine, stomach, kidney, bladder, uterus, ovary, testis, lung colon, prostate cancer, a tumor of B cell origin (such as chronic lymphocytic leukemia (CLL), a B cell lymphoma, Burkitt's lymphoma or a Hodgkin's lymphoma) or breast cancer, such as an infiltrating ductal carcinoma or an estrogen receptor negative and progesterone receptor negative breast cancer. In some examples, the cancer is radiation resistant and/or chemotherapy resistant. The antigen presenting cells can also be administered to prevent these cancers. The subject can have high grade prostatic intraepithelial neoplasia, familial adenomatous polyposis, or atypia of the breast.
- The cells can be administered to a subject to inhibit the growth of cells of Brachyury expressing cancer or a cancer that has the potential to express Brachyury. In these applications, a therapeutically effective amount of activated antigen presenting cells are administered to a subject suffering from a disease, in an amount sufficient to raise an immune response to Brachyury-expressing cells. The resulting immune response is sufficient to slow the proliferation of such cells or to inhibit their growth, or to reduce a sign or a symptom of the tumor.
- In a supplemental method, any of these immunotherapies is augmented by administering a cytokine, such as interleukin (IL)-2, IL-3, IL-6, IL-10, IL-12, IL-15, GM-CSF, or interferons. In another embodiment, the mature dendritic cells are administered in conjunction with a chemotherapeutic agent.
- Combination Therapy
- In some embodiments, the subject is administered a Brachury protein, a Brachyury polypeptide, a nucleic acid encoding a Brachyury protein, a host cell expressing the Brachyury protein, and/or dendritic cells, and is administered an additional agent. In one example, this administration is sequential. However, the administration can be simultaneous.
- In some embodiments the subject has cancer. The cancer can express Brachyury or have the potential to express Brachyury. Thus, the additional agent can be a chemotherapeutic agent. Additional agents include radiation, small molecule targeted therapies, monoclonal antibodies, and/or checkpoint inhibitors, such as anti-PD-1, anti-PD-L1, anti-CTLA-4, and others. In some embodiments, the subject is administered an epithelial growth factor receptor inhibitor, a transforming growth factor (TGF)-3 inhibitor, or a tyrosine kinase inhibitor.
- In some embodiments, the additional chemotherapeutic agent is an epithelial growth factor receptor (EGFR) inhibitor. Numerous compounds are known that inhibit EGFR, see for example, U.S. Pat. Nos. 5,196,446; 5,217,999; 5,459,061; 7,049,410; 6,355,678, which are incorporated herein by reference. A number of EGFR inhibitors are in clinical development, such as for the treatment of lung cancer. These include tustuzumab, lapatinib, pertuzumab, panitumumab, genfitinib (IRESSA®), erlotinib (TARCEVA®), cetuximab (ERTIBUX®), afatinib, nectiumumab, nimotuzumab, PF299804 (Pfizer), R05083945 (Roche), ABT-806 (Abbott) and AP2113 (Ariad). In other embodiments, the additional chemotherapeutic agent is a tyrosine kinase inhibitor. These include, but are not limited to avastin and termsirolimus.
- Examples of additional agents of use are alkylating agents, antimetabolites, natural products, or hormones and their antagonists. Examples of alkylating agents include nitrogen mustards (such as mechlorethamine, cyclophosphamide, melphalan, uracil mustard or chlorambucil), alkyl sulfonates (such as busulfan), nitrosoureas (such as carmustine, lomustine, semustine, streptozocin, or dacarbazine). Examples of antimetabolites include folic acid analogs (such as methotrexate), pyrimidine analogs (such as 5-FU or cytarabine), and purine analogs, such as mercaptopurine or thioguanine. Examples of natural products include vinca alkaloids (such as vinblastine, vincristine, or vindesine), epipodophyllotoxins (such as etoposide or teniposide), antibiotics (such as dactinomycin, daunorubicin, doxorubicin, bleomycin, plicamycin, or mitocycin C), and enzymes (such as L-asparaginase). Examples of miscellaneous agents include platinum coordination complexes (such as cis-diamine-dichloroplatinum II also known as cisplatin), substituted ureas (such as hydroxyurea), methyl hydrazine derivatives (such as procarbazine), and adrenocrotical suppressants (such as mitotane and aminoglutethimide). Examples of hormones and antagonists include adrenocorticosteroids (such as prednisone), progestins (such as hydroxyprogesterone caproate, medroxyprogesterone acetate, and magestrol acetate), estrogens (such as diethylstilbestrol and ethinyl estradiol), antiestrogens (such as tamoxifen), and androgens (such as testosterone proprionate and fluoxymesterone). Examples of the most commonly used chemotherapy drugs that can be concurrently administered with the disclosed immunotherapy include Adriamycin, Alkeran, Ara-C, BiCNU, Busulfan, CCNU, Carboplatinum, Cisplatinum, Cytoxan, Daunorubicin, DTIC, 5-FU, Fludarabine, Hydrea, Idarubicin, Ifosfamide, Methotrexate, Mithramycin, Mitomycin, Mitoxantrone, Nitrogen Mustard, Taxol (or other taxanes, such as docetaxel), Velban, Vincristine, VP-16, while some more newer drugs include Gemcitabine (Gemzar), Herceptin, Irinotecan (Camptosar, CPT-11), Leustatin, Navelbine, Rituxan STI-571, Taxotere. Topotecan (Hycamtin). Xeloda (Capecitabine), Zevelin and calcitriol. Non-limiting examples of immunomodulators that can be used include AS-101 (Wyeth-Ayerst Labs.), bropirimine (Upjohn), gamma interferon (Genentech), GM-CSF (granulocyte macrophage colony stimulating factor, Genetics Institute), IL-2 (Cetus or Hoffman-LaRoche), human immune globulin (Cutter Biological), IMREG (from Imreg of New Orleans, La.), SK&F 106528, and TNF (tumor necrosis factor; Genentech).
- The additional agent can be a small molecule, a vaccine, or a biologic. For example, when the additional agent is a vaccine, the vaccine can be a yeast-based or viral-based (e.g., poxviral-based) vaccine. Examples of viral vectors include poxvirus, retrovirus, adenovirus, adeno-associated virus, herpes virus, polio virus, alphavirus, baculorvirus, and Sindbis virus. In one embodiment, the viral vector is a poxvirus selected from the group consisting of orthopox, avipox, fowlpox, raccoon pox, rabbit pox, capripox (e.g., sheep pox), leporipox, and suipox (e.g., swinepox). Examples of avipox viruses include fowlpox, pigeonpox, and canarypox, such as ALVAC. Examples of orthopox viruses include vaccinia, modified vaccinia Ankara (MVA), Wyeth, NYVAC, TROYVAC, Dry-Vax, POXVAC-TC (Schering-Plough Corporation), and derivatives thereof. For example, derivatives of the Wyeth strain include, but are not limited to, derivatives which lack a functional K1L gene.
- The vaccine can encode any suitable antigen, such as the Brachyury protein or Brachyury polypeptide described herein, 5-α-reductase, α-fetoprotein (“AFP”), AM-1, APC, April, B melanoma antigen gene (“BAGE”), β-catenin, Bc112, bcr-abl, Brachyury, CA-125, caspase-8 (“CASP-8”, also known as “FLICE”), Cathepsins, CD19, CD20, CD21/complement receptor 2 (“CR2”), CD22/BL-CAM, CD23/FcεRII, CD33, CD35/complement receptor 1 (“CR1”), CD44/PGP-1, CD45/leucocyte common antigen (“LCA”), CD46/membrane cofactor protein (“MCP”), CD52/CAMPATH-1, CD55/decay accelerating factor (“DAF”), CD59/protectin, CDC27, CDK4, carcinoembryonic antigen (“CEA”), c-myc, cyclooxygenase-2 (“cox-2”), deleted in colorectal cancer gene (“DCC”), DcR3, E6/E7, CGFR, EMBP, Dna78, farnesyl transferase, fibroblast growth factor-8a (“FGF8a”), fibroblast growth factor-8b (“FGF8b”), FLK-1/KDR, folic acid receptor, G250, G melanoma antigen gene family (“GAGE-family”), gastrin 17, gastrin-releasing hormone, ganglioside 2 (“GD2”)/ganglioside 3 (“GD3”)/ganglioside-monosialic acid-2 (“GM2”), gonadotropin releasing hormone (“GnRH”), UDP-GlcNAc:R1Man(α1-6)R2 [GlcNAc to Man(α1-6)] β1,6-N-acetylglucosaminyltransferase V (“GnT V”), GPI, gp100/Pme 17, gp-100-in4, gp15, gp75/tyrosine-related protein-1 (“gp75/TRP-1”), human chorionic gonadotropin (“hCG”), heparanase, Her2/neu, human mammary tumor virus (“HMTV”), 70 kiloDalton heat-shock protein (“HSP70”), human telomerase reverse transcriptase (“hTERT”), insulin-like growth factor receptor-1 (“IGFR-1”), interleukin-13 receptor (“IL-13R”), inducible nitric oxide synthase (“iNOS”), Ki67, KIAA0205, K-ras, H-ras, N-ras, KSA, LKLR-FUT, melanoma antigen-encoding family (“MAGE-family”, including at least MAGE-1, MAGE-2, MAGE-3, and MAGE-4), mammaglobin, MAP17, Melan-A/melanoma antigen recognized by T-cells-1 (“MART-1”), mesothelin, MIC A/B, MT-MMPs, mucin, testes-specific antigen NY-ESO-1, osteonectin, p15, P170/MDR1, p53, p97/melanotransferrin, PAI-1, platelet-derived growth factor (“PDGF”), μPA, PRAME, probasin, progenipoietin, prostate-specific antigen (“PSA”), prostate-specific membrane antigen (“PSMA”), RAGE-1, Rb, RCAS1, SART-1, SSX-family, STAT3, STn, TAG-72, transforming growth factor-alpha (“TGF-α”), transforming growth factor-beta (“TGF-β”), Thymosin-beta-15, tumor necrosis factor-alpha (“TNF-α”), TP1, TRP-2, tyrosinase, vascular endothelial growth factor (“VEGF”), ZAG, p161NK4, and/or glutathione-S-transferase (“GST”).
- In one embodiment, the vaccine is PROSTVAC™, which is a sequentially dosed combination of two different poxviruses each encoding prostate specific antigen (PSA) plus three immune enhancing co-stimulatory molecules, B7.1, ICAM-1, and LFA-3 (TRICOM). The first poxvirus is Vaccinia-PSA-TRICOM, and the second poxvirus is Fowlpox-PSA-TRICOM.
- Thus, the invention provides a method for treating or preventing cancer in a subject comprising administering to the subject a combination therapy comprising:
- (1) (a) a protein comprising an amino acid sequence at least 90% identical to the amino acid sequence set forth as SEQ ID NO: 1; (b) a polypeptide comprising at least 15 consecutive amino acids of the amino acid sequence set forth at SEQ ID NO: 1; (c) a nucleic acid encoding the protein or the polypeptide; (d) a host cell expressing the protein or the polypeptide; or (e) a non-pox non-yeast vector encoding the protein or the polypeptide, and
- (2) a small molecule, a vaccine (e.g., a pox-viral or yeast vaccine as described above), or a biologic,
- thereby treating or preventing cancer in the subject.
-
FIGS. 1 and 2 show the induction of CD4+ cells using Brachyury protein and a Brachyury polypeptide. - I.
FIG. 1 - Methods:
- Dendritic cells (DCs) from 2 normal donors were prepared from the adherent cell fraction of peripheral blood mononuclear cells (PBMCs) by culture in the presence of GM-CSF and IL-4. On day 5, a purified, recombinant full length Brachyury protein was added to the cultures (10 μg/ml) for 48 hours. For
donor 2, an additional culture was set up using purified HSA (human serum albumin) control protein (10 μg/ml). On day 7, protein-pulsed DCs were harvested, irradiated (20 Gy) and used as antigen-presenting cells (APCs) to stimulate autologous PBMCs (ratio DC:PBMCs equal to 1:10). Ondays 3 and 5, IL-2 (20 U/ml) was added to the cultures. Cells were harvested on day 7 and CD4+ T cells were isolated by negative selection utilizing CD4 purification magnetic beads (Miltenyi Biotec). CD4+ T cells were subsequently stimulated in a similar manner for an additional 7-day cycle. On day 7, CD4+ T cells were re-purified by using CD4 purification magnetic beads, and evaluated for IFN-gamma production in response to autologous, irradiated PBMCs (ratio PBMCs:CD4+ T cells equal to 3:1) alone or pulsed with control HSA protein vs. Brachyury protein (10 μg/ml). Culture supernatants were collected at 96 hours and evaluated for IFN-gamma by ELISA. - Summary of Findings:
- As shown in
FIG. 1 , Brachyury-specific CD4+ T cells can be expanded from the blood of normal donors by culture of PBMCs in the presence of autologous DCs pulsed with a purified, full length Brachyury protein. After 2 rounds of in vitro stimulation, Brachyury-specific CD4+ T cells specifically released IFN-gamma in response to stimulation with autologous PBMCs pulsed with purified Brachyury protein (full length, recombinant) but not with a control, irrelevant protein (HAS). - II.
FIG. 2 - Methods: A CD4+ Brachyury-specific T-cell line (T-BRA) was generated from a prostate patient vaccinated with a PSA-based vaccine. CD40L-matured autologous DCs were used as antigen-presenting cells (APCs). PBMCs obtained on day 90 post-vaccination were added to the APCs and pulsed with 10 μg/mL of Brachyury 9-mer agonist peptide (WLLPGTSTV) at an effector:APC ratio of 10:1. The culture was then incubated for 3 days at 37° C. in a humidified atmosphere containing 5% CO2. The culture was then supplemented with recombinant human IL-7 and IL-15 at a concentration of 10 ng/ml for 5 days. The 3-day incubation with peptide and 5-day IL-7 and IL-15 supplement constituted one in vitro stimulation (IVS) cycle. Autologous DCs were used as APCs for 3 in vitro stimulation (IVS) cycles. Irradiated (23,000 rads) autologous EBV-transformed B cells were used as APCs after the third IVS cycle. For re-stimulation with EBV-transformed B cells, peptides at a concentration of 10 μg/mL were used to pulse the autologous EBV-transformed B cells at an effector:APC ratio of 1:3. CD4+ T cells were then isolated from the cell culture at the end of the 4th IVS and stimulated with a Brachyury class II 15-mer peptide (Brachyury class IIB)(QWGWLLPGTSTL). The cultures were then supplemented with recombinant human IL-7 and IL-15 at a concentration of 10 ng/mL for 5 days. The CD4+ T cell line was then assayed for specificity to the Brachyury class IIB epitope by stimulation with APCs pulsed with the Brachyury class IIB or a control Brachyury class IIA epitope.
-
FIGS. 3-7 show the results achieved. -
TABLE 1 Expression of Brachyury in primary breast carcinoma tissues by immunohistochemistry utilizing a murine monoclonal anti-brachyury Ab Tumor Adjacent Distal Pt # % Positivity Intensity tissue tissue 1 80 ++ pos neg 2 80 ++ pos neg 3 90 ++ pos neg 4 90 + neg neg 5 90 + pos neg 6 30 + neg neg 7 15 +++ neg neg 8 60 + neg neg 9 focal + neg neg 10 70 + neg neg 11 40 + neg neg 12 30 + neg neg 13 focal + neg neg 14 90 +++ neg neg 15 90 −/+ pos neg 16 30 + neg neg 17 neg neg neg neg 18 50 ++ neg neg 19 neg neg neg neg 20 neg neg neg neg 21 40 ++ pos neg 22 30 ++ pos neg 23 85 ++ pos neg 24 80 +++ pos neg 25 30 + pos neg 26 50 ++ pos neg 27 65 ++ pos NA 28 40 +++ pos neg 29 25 ++ pos NA 30 15 + pos NA Pos = positive; neg = negative; NA = not available -
TABLE 2 Brachyury expression in primary breast carcinoma tissues by immunohistochemistry by lymph node status, tumor grade, and hormone receptor expression Number of Tumor tissue tumors positive sample for Brachyury Lymph node status: Node-negative 13/15 (86.7%)* Node-positive 10/11 (93.3%) Grade: G1 2/3 (66.7%) G2 — G3 25/27 (92.6%) ER/PR expression: ER+ PR+ 4/6 (66.7%) ER− PR− 21/22 (95.5%) ER/PR/HER2 expression: ER+ PR+ HER2+ 1/2 (50.0%) ER+ PR+ HER2− 3/4 (75.0%) ER− PR− HER2+ 12/12 (100.0%) ER− PR− HER2− 9/10 (90.0%) Statistical analysis was performed, comparing node-positive vs. node-negative, grade 3 vs.grade 1, and ER− PR− vs. ER+ PR+ samples.*Numbers in parentheses indicate percentage. -
TABLE 3 Expression of Brachyury in metastatic breast carcinoma lesions by immunohistochemistry using a murine monoclonal anti-brachyury Ab Brachyury Pt # Site % Positivity Intensity 6 Breast primary tumor 30 + 6 Met+ lymph node (a) 90 + 6 Met+ lymph node (b) 90 + 6 Non-met lymph node neg neg 9 Breast primary tumor focal + 9 Met+ lymph node (a) 60 ++ 9 Met+ lymph node (b) 60 ++ 9 Non-met lymph node neg neg 31 Pleura 90 + 32 Bone 90 ++ 33 Bone 90 + 34 Brain 70 ++ - Human matched breast primary tumor tissues and metastatic lymph nodes from two patients were analyzed for Brachyury expression by immunohistochemistry. The breast primary tumor tissue samples were from infiltrating ductal adenocarcinomas. Two lymph nodes positive for metastasis from each patient (a, b) and 1 lymph node negative for metastasis from same patient (c) were assayed. Metastatic lesions from additional patients were also analyzed for Brachyury expression by immunohistochemistry. Adjacent and distal breast tissues in the samples were negative for Brachyury expression.
- The breast primary tumor tissue samples were from 30 infiltrating ductal adenocarcinomas. Brachyury expression for each sample is reported as staining in tumor cells (% positivity, intensity), staining in breast adjacent tissue, and staining in breast distal tissue.
- In view of the many possible embodiments to which the principles of the disclosed invention may be applied, it should be recognized that the illustrated embodiments are only preferred examples of the invention and should not be taken as limiting the scope of the invention. Rather, the scope of the invention is defined by the following claims. We therefore claim as our invention all that comes within the scope and spirit of these claims.
Claims (23)
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US16/107,559 US11357839B2 (en) | 2012-09-14 | 2018-08-21 | Brachyury protein, non-poxvirus non-yeast vectors encoding Brachyury protein, and their use |
US17/833,383 US20220313801A1 (en) | 2012-09-14 | 2022-06-06 | Brachyury protein, non-poxvirus non-yeast vectors encoding brachyury protein, and their use |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201261701525P | 2012-09-14 | 2012-09-14 | |
PCT/US2013/059737 WO2014043518A1 (en) | 2012-09-14 | 2013-09-13 | Brachyury protein, non-poxvirus non-yeast vectors encoding brachyury protein, and their use |
US201514428308A | 2015-03-13 | 2015-03-13 | |
US16/107,559 US11357839B2 (en) | 2012-09-14 | 2018-08-21 | Brachyury protein, non-poxvirus non-yeast vectors encoding Brachyury protein, and their use |
Related Parent Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2013/059737 Division WO2014043518A1 (en) | 2012-09-14 | 2013-09-13 | Brachyury protein, non-poxvirus non-yeast vectors encoding brachyury protein, and their use |
US14/428,308 Division US20150224181A1 (en) | 2012-09-14 | 2013-09-13 | Brachyury protein, non-poxvirus non-yeast vectors encoding brachyury protein, and their use |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US17/833,383 Division US20220313801A1 (en) | 2012-09-14 | 2022-06-06 | Brachyury protein, non-poxvirus non-yeast vectors encoding brachyury protein, and their use |
Publications (2)
Publication Number | Publication Date |
---|---|
US20190046619A1 true US20190046619A1 (en) | 2019-02-14 |
US11357839B2 US11357839B2 (en) | 2022-06-14 |
Family
ID=49304319
Family Applications (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/428,308 Abandoned US20150224181A1 (en) | 2012-09-14 | 2013-09-13 | Brachyury protein, non-poxvirus non-yeast vectors encoding brachyury protein, and their use |
US16/107,559 Active US11357839B2 (en) | 2012-09-14 | 2018-08-21 | Brachyury protein, non-poxvirus non-yeast vectors encoding Brachyury protein, and their use |
US17/833,383 Pending US20220313801A1 (en) | 2012-09-14 | 2022-06-06 | Brachyury protein, non-poxvirus non-yeast vectors encoding brachyury protein, and their use |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/428,308 Abandoned US20150224181A1 (en) | 2012-09-14 | 2013-09-13 | Brachyury protein, non-poxvirus non-yeast vectors encoding brachyury protein, and their use |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US17/833,383 Pending US20220313801A1 (en) | 2012-09-14 | 2022-06-06 | Brachyury protein, non-poxvirus non-yeast vectors encoding brachyury protein, and their use |
Country Status (4)
Country | Link |
---|---|
US (3) | US20150224181A1 (en) |
EP (1) | EP2895191B1 (en) |
ES (1) | ES2752190T3 (en) |
WO (1) | WO2014043518A1 (en) |
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2022241198A3 (en) * | 2021-05-13 | 2022-12-22 | Thomas Jefferson University | Use of ectromelia virus for cancer immunotherapy and vaccines |
WO2023250054A1 (en) * | 2022-06-23 | 2023-12-28 | Merck Sharp & Dohme Llc | Immunogenic compositions for epstein-barr virus proteins |
Families Citing this family (10)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP3539567A1 (en) | 2007-07-02 | 2019-09-18 | Etubics Corporation | Methods and compositions for producing an adenovirus vector for use with multiple vaccinations |
US9605276B2 (en) | 2012-08-24 | 2017-03-28 | Etubics Corporation | Replication defective adenovirus vector in vaccination |
JP6647315B2 (en) | 2015-01-09 | 2020-02-14 | イーチュービクス コーポレイション | Methods and compositions for combination immunotherapy |
EP3256140B1 (en) | 2015-01-09 | 2020-04-01 | Etubics Corporation | Compositions for ebola virus vaccination |
US11149087B2 (en) | 2015-04-20 | 2021-10-19 | Etubics Corporation | Methods and compositions for combination immunotherapy |
EP3331554B1 (en) * | 2015-08-03 | 2022-05-11 | The U.S.A. as represented by the Secretary, Department of Health and Human Services | Brachyury deletion mutants, non-yeast vectors encoding brachyury deletion mutants, and their use |
US20190183870A1 (en) | 2016-01-05 | 2019-06-20 | The United States Of America, As Represented By The Secretary, Dept. Of Health And Human Services | Combination of histone deacetylase inhibitor and immunotherapy |
WO2017136342A1 (en) | 2016-02-02 | 2017-08-10 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Fulvestrant for inducing immune-mediated cytotoxic lysis of cancer cells |
AU2018266103B2 (en) | 2017-05-09 | 2024-06-13 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Combination PDL1 and TGF-beta blockade in patients with HPV+ malignancies |
WO2019038388A1 (en) | 2017-08-24 | 2019-02-28 | Bavarian Nordic A/S | Combination therapy for treating cancer with an intravenous administration of a recombinant mva and an antibody |
Family Cites Families (111)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4235871A (en) | 1978-02-24 | 1980-11-25 | Papahadjopoulos Demetrios P | Method of encapsulating biologically active materials in lipid vesicles |
US4444487A (en) | 1979-07-02 | 1984-04-24 | Xerox Corporation | Multiple-flash fuser |
FR2505657A1 (en) | 1981-05-13 | 1982-11-19 | Pasteur Institut | IMPROVEMENTS IN LIVE STABILIZING AGENTS FOR THE PREPARATION OF VACCINES, AND STABILIZED VACCINES CONTAINING SAID STABILIZING AGENTS |
US4603112A (en) | 1981-12-24 | 1986-07-29 | Health Research, Incorporated | Modified vaccinia virus |
US4501728A (en) | 1983-01-06 | 1985-02-26 | Technology Unlimited, Inc. | Masking of liposomes from RES recognition |
GB8308235D0 (en) | 1983-03-25 | 1983-05-05 | Celltech Ltd | Polypeptides |
US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
US4957735A (en) | 1984-06-12 | 1990-09-18 | The University Of Tennessee Research Corporation | Target-sensitive immunoliposomes- preparation and characterization |
US5019369A (en) | 1984-10-22 | 1991-05-28 | Vestar, Inc. | Method of targeting tumors in humans |
US5036006A (en) | 1984-11-13 | 1991-07-30 | Cornell Research Foundation, Inc. | Method for transporting substances into living cells and tissues and apparatus therefor |
US4945050A (en) | 1984-11-13 | 1990-07-31 | Cornell Research Foundation, Inc. | Method for transporting substances into living cells and tissues and apparatus therefor |
US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
US4745055A (en) | 1985-05-07 | 1988-05-17 | California Biotechnology Inc. | Fused protein for enzyme immunoassay system |
US4895800A (en) | 1985-11-26 | 1990-01-23 | Phillips Petroleum Company | Yeast production of hepatitis B surface antigen |
US5091309A (en) | 1986-01-16 | 1992-02-25 | Washington University | Sindbis virus vectors |
CA1340456C (en) | 1986-07-07 | 1999-03-23 | Hubert J.P. Schoemaker | Chimeric rodent/human immunoglobulins specific for tumor-associated antigens |
US4902505A (en) | 1986-07-30 | 1990-02-20 | Alkermes | Chimeric peptides for neuropeptide delivery through the blood-brain barrier |
GB8626412D0 (en) | 1986-11-05 | 1986-12-03 | Clark M R | Antibodies |
US4837028A (en) | 1986-12-24 | 1989-06-06 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
AP56A (en) | 1987-01-30 | 1989-09-26 | Smithkline Biologicals S A | Hepatitis B virus surface antigens and hybrid antigehs containing them. |
US5166320A (en) | 1987-04-22 | 1992-11-24 | University Of Connecticut | Carrier system and method for the introduction of genes into mammalian cells |
JPS63307827A (en) | 1987-06-08 | 1988-12-15 | Kitasato Inst:The | Stabilized live vaccine and production thereof |
ES2056799T3 (en) | 1987-07-17 | 1994-10-16 | Rhein Biotech Ges Fur Biotechn | CODANT DNA MOLECULES FOR THE FMDH CONTROL AND STRUCTURAL GENE REGIONS FOR A PROTEIN THAT HAS AN FMDH ACTIVITY AND ITS USE. |
US5004697A (en) | 1987-08-17 | 1991-04-02 | Univ. Of Ca | Cationized antibodies for delivery through the blood-brain barrier |
DE10399031I1 (en) | 1987-08-28 | 2004-01-29 | Health Research Inc | Recombinant viruses. |
CA1323293C (en) | 1987-12-11 | 1993-10-19 | Keith C. Backman | Assay using template-dependent nucleic acid probe reorganization |
US5217999A (en) | 1987-12-24 | 1993-06-08 | Yissum Research Development Company Of The Hebrew University Of Jerusalem | Styryl compounds which inhibit EGF receptor protein tyrosine kinase |
WO1990001069A1 (en) | 1988-07-20 | 1990-02-08 | Segev Diagnostics, Inc. | Process for amplifying and detecting nucleic acid sequences |
US5217879A (en) | 1989-01-12 | 1993-06-08 | Washington University | Infectious Sindbis virus vectors |
US5055303A (en) | 1989-01-31 | 1991-10-08 | Kv Pharmaceutical Company | Solid controlled release bioadherent emulsions |
US5703055A (en) | 1989-03-21 | 1997-12-30 | Wisconsin Alumni Research Foundation | Generation of antibodies through lipid mediated DNA delivery |
US5270202A (en) | 1989-11-03 | 1993-12-14 | Syamal Raychaudhuri | Anti-idiotypic antibodies to human melanoma-associated proteoglycan antigen |
US5271961A (en) | 1989-11-06 | 1993-12-21 | Alkermes Controlled Therapeutics, Inc. | Method for producing protein microspheres |
US5188837A (en) | 1989-11-13 | 1993-02-23 | Nova Pharmaceutical Corporation | Lipsopheres for controlled delivery of substances |
US5459061A (en) | 1990-01-26 | 1995-10-17 | W. Alton Jones Cell Science Center, Inc. | Hybridomas producing monoclonal antibodies which specifically bind to continuous epitope on the human EGF receptor and compete with EGF for binding to the EGF receptor |
US5427930A (en) | 1990-01-26 | 1995-06-27 | Abbott Laboratories | Amplification of target nucleic acids using gap filling ligase chain reaction |
GB9007024D0 (en) | 1990-03-29 | 1990-05-30 | Imperial College | Novel vaccine |
US5196446A (en) | 1990-04-16 | 1993-03-23 | Yissum Research Development Company Of The Hebrew University Of Jerusalem | Certain indole compounds which inhibit EGF receptor tyrosine kinase |
US5268164A (en) | 1990-04-23 | 1993-12-07 | Alkermes, Inc. | Increasing blood-brain barrier permeability with permeabilizer peptides |
WO1991019803A1 (en) | 1990-06-19 | 1991-12-26 | Applied Biotechnology, Incorporated | Self assembled, defective, nonself-propagating viral particles |
US5709860A (en) | 1991-07-25 | 1998-01-20 | Idec Pharmaceuticals Corporation | Induction of cytotoxic T-lymphocyte responses |
EP0596032B2 (en) | 1991-07-25 | 2004-04-07 | Idec Pharmaceuticals Corporation | Induction of cytotoxic t-lymphocyte responses |
US5254342A (en) | 1991-09-30 | 1993-10-19 | University Of Southern California | Compositions and methods for enhanced transepithelial and transendothelial transport or active agents |
US5643578A (en) | 1992-03-23 | 1997-07-01 | University Of Massachusetts Medical Center | Immunization by inoculation of DNA transcription unit |
ATE154240T1 (en) | 1992-03-12 | 1997-06-15 | Alkermes Inc | ACTH CONTAINING MICRO SPHERES WITH CONTROLLED RELEASE |
US6416998B1 (en) | 1992-09-02 | 2002-07-09 | Baylor College Of Medicine | Plasmid encoding a modified steroid hormone |
US5534496A (en) | 1992-07-07 | 1996-07-09 | University Of Southern California | Methods and compositions to enhance epithelial drug transport |
US5662907A (en) | 1992-08-07 | 1997-09-02 | Cytel Corporation | Induction of anti-tumor cytotoxic T lymphocytes in humans using synthetic peptide epitopes |
EP0671926B1 (en) | 1992-08-11 | 2002-11-13 | President And Fellows Of Harvard College | Immunomodulatory peptides |
US5593972A (en) | 1993-01-26 | 1997-01-14 | The Wistar Institute | Genetic immunization |
US6133028A (en) | 1993-05-28 | 2000-10-17 | Transgene S.A. | Defective adenoviruses and corresponding complementation lines |
US5834256A (en) | 1993-06-11 | 1998-11-10 | Cell Genesys, Inc. | Method for production of high titer virus and high efficiency retroviral mediated transduction of mammalian cells |
CA2125344A1 (en) | 1993-07-01 | 1995-01-02 | Casey D. Morrow | Encapsidated recombinant poliovirus nucleic acid and methods of making and using same |
US5614413A (en) | 1993-07-01 | 1997-03-25 | The Uab Research Foundation | Encapsidated recombinant poliovirus nucleic acid and methods of making and using same |
US5514670A (en) | 1993-08-13 | 1996-05-07 | Pharmos Corporation | Submicron emulsions for delivery of peptides |
US6015686A (en) | 1993-09-15 | 2000-01-18 | Chiron Viagene, Inc. | Eukaryotic layered vector initiation systems |
US5648211A (en) | 1994-04-18 | 1997-07-15 | Becton, Dickinson And Company | Strand displacement amplification using thermophilic enzymes |
EP0784690B1 (en) | 1994-06-10 | 2006-08-16 | Genvec, Inc. | Complementary adenoviral vector systems and cell lines |
US6239116B1 (en) | 1994-07-15 | 2001-05-29 | University Of Iowa Research Foundation | Immunostimulatory nucleic acid molecules |
US6429199B1 (en) | 1994-07-15 | 2002-08-06 | University Of Iowa Research Foundation | Immunostimulatory nucleic acid molecules for activating dendritic cells |
WO1996002555A1 (en) | 1994-07-15 | 1996-02-01 | The University Of Iowa Research Foundation | Immunomodulatory oligonucleotides |
US6207646B1 (en) | 1994-07-15 | 2001-03-27 | University Of Iowa Research Foundation | Immunostimulatory nucleic acid molecules |
KR100392551B1 (en) | 1994-07-15 | 2003-10-30 | 아크조 노벨 엔브이 | Use of RNA Polymerase to Improve Nucleic Acid Amplification Methods |
PT784483E (en) | 1994-10-03 | 2001-05-31 | Us Gov Health & Human Serv | COMPOSITION COMPOSING A RECOMBINANT VIRUS THAT EXPRESSES AN ANTIGEN AND A RECOMBINANT VIRUS THAT EXPRESSES AN IMMUNOSTIMULATING MOLECULE |
US5872005A (en) | 1994-11-03 | 1999-02-16 | Cell Genesys Inc. | Packaging cell lines for adeno-associated viral vectors |
IL116816A (en) | 1995-01-20 | 2003-05-29 | Rhone Poulenc Rorer Sa | Cell for the production of a defective recombinant adenovirus or an adeno-associated virus and the various uses thereof |
CN1083020C (en) | 1995-02-14 | 2002-04-17 | 智索股份有限公司 | Biodegradable fiber and nonwoven fabric |
US6001349A (en) | 1995-02-22 | 1999-12-14 | Therion Biologics Corporation | Generation of human cytotoxic T-cells specific for carcinoma self-associated antigens and uses thereof |
US5763270A (en) | 1995-06-07 | 1998-06-09 | Genemedicine, Inc. | Plasmid for delivery of nucleic acids to cells and methods of use |
AT402203B (en) | 1995-06-13 | 1997-03-25 | Himmler Gottfried Dipl Ing Dr | METHOD FOR TRANSCRIPTION-FREE AMPLIFICATION OF NUCLEIC ACIDS |
US6165460A (en) | 1995-07-10 | 2000-12-26 | Therion Biologics Corporation | Generation of immune responses to prostate-specific antigen (PSA) |
DE69510207T3 (en) | 1995-08-09 | 2007-02-15 | Schweiz. Serum- & Impfinstitut Bern | Process for producing infectious minus-stranded RNA viruses |
KR970029803A (en) | 1995-11-03 | 1997-06-26 | 김광호 | Precharge Circuit of Semiconductor Memory Device |
EP0932684A2 (en) | 1996-09-27 | 1999-08-04 | American Cyanamid Company | 3' genomic promoter region and polymerase gene mutations responsible for attenuation in viruses of the order designated mononegavirales |
US5842723A (en) | 1996-11-25 | 1998-12-01 | Burex Automotive America, Inc. | Flexible connection arrangement for connecting a pipe of an exhaust system to an engine, especially in a motor vehicle |
EP1012276A2 (en) | 1997-02-24 | 2000-06-28 | Therion Biologics Corporation | Recombinant pox virus for immunization against muc1 tumor-associated antigen |
JP2001513776A (en) | 1997-02-28 | 2001-09-04 | ユニバーシティ オブ アイオワ リサーチ ファウンデーション | Use of nucleic acids containing unmethylated CpG dinucleotides in the treatment of LPS-related disorders |
US6406705B1 (en) | 1997-03-10 | 2002-06-18 | University Of Iowa Research Foundation | Use of nucleic acids containing unmethylated CpG dinucleotide as an adjuvant |
ATE370740T1 (en) | 1997-05-20 | 2007-09-15 | Ottawa Health Research Inst | METHOD FOR PRODUCING NUCLEIC ACID CONSTRUCTS |
CA2292760A1 (en) | 1997-06-04 | 1998-12-10 | Oxford Biomedica (Uk) Limited | Vector |
US6969609B1 (en) | 1998-12-09 | 2005-11-29 | The United States Of America As Represented By The Department Of Health And Human Serivces | Recombinant vector expressing multiple costimulatory molecules and uses thereof |
GB9725084D0 (en) | 1997-11-28 | 1998-01-28 | Medeva Europ Ltd | Vaccine compositions |
US6143551A (en) | 1997-12-29 | 2000-11-07 | Schering Aktiengesellschaft | Delivery of polypeptide-encoding plasmid DNA into the cytosol of macrophages by attenuated listeria suicide bacteria |
ES2284247T3 (en) | 1998-04-03 | 2007-11-01 | University Of Iowa Research Foundation | METHODS AND PRODUCTS TO STIMULATE THE IMMUNITY SYSTEM USING OLIGONUCLEOTIDES AND IMMUNOTHERAPEUTIC CYTOQUINS. |
US6031078A (en) | 1998-06-16 | 2000-02-29 | Millennium Pharmaceuticals, Inc. | MTbx protein and nucleic acid molecules and uses therefor |
US6355678B1 (en) | 1998-06-29 | 2002-03-12 | Parker Hughes Institute | Inhibitors of the EGF-receptor tyrosine kinase and methods for their use |
US6849255B2 (en) * | 1998-08-18 | 2005-02-01 | Yissum Research Development Company Of The Hebrew University Of Jerusalem | Methods and compositions for enhancing cartilage repair |
DE69936868T2 (en) | 1998-09-01 | 2008-05-15 | The Government Of The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | PAGE-4, A GAGE-SIMILAR GENE ON THE X-CHROMOSOME EXPRESSED BY NEOPLASTIC PROSTATE, TESTIS AND UTERUS, AND ITS APPLICATIONS |
ES2356863T3 (en) | 1998-09-04 | 2011-04-13 | Emergent Product Development Uk Limited | MUTANTS OF SPI2 OF SALMONELLA ATENUATED AS CARRIERS OF ANTIGENS. |
US20020131976A1 (en) | 1998-12-23 | 2002-09-19 | Ajit Lalvani | Tuberculosis vaccine |
CA2373300C (en) | 1999-04-14 | 2012-02-21 | Chiron Corporation | Compositions and methods for generating an immune response utilizing alphavirus-based vector systems |
US7049410B2 (en) | 1999-05-14 | 2006-05-23 | Majumdar Adhip P N | Antibodies to a novel EGF-receptor related protein (ERRP) |
IL147507A0 (en) | 1999-07-13 | 2002-08-14 | Us Gov Health & Human Serv | T-cell receptor y and uses thereof |
CA2383213A1 (en) | 1999-09-10 | 2001-03-15 | Fordham University | Methods and compositions for the treatment and prevention of graft rejection using heat shock proteins |
WO2001078789A2 (en) | 2000-04-14 | 2001-10-25 | The Uab Research Foundation | Poliovirus replicons encoding therapeutic agents and uses thereof |
US7118740B1 (en) | 2000-09-22 | 2006-10-10 | Mayo Foundation For Medical Education And Research | Method for limiting the growth of cancer cells using an attenuated measles virus |
EP1399183B1 (en) | 2001-05-31 | 2010-06-30 | Novartis Vaccines and Diagnostics, Inc. | Chimeric alphavirus replicon particles |
AU2002327412A1 (en) | 2001-08-02 | 2003-02-17 | Institut Clayton De La Recherche | Methods and compositions relating to improved lentiviral vector production systems |
US6635481B1 (en) | 2001-12-28 | 2003-10-21 | Origene Technologies, Inc. | Tbx3 gene and methods of using it |
US6780595B2 (en) | 2002-02-26 | 2004-08-24 | Origene Technologies, Inc. | Human Tbx20 gene and uses |
ES2427139T3 (en) | 2002-06-20 | 2013-10-29 | Institut Pasteur | Recombinant measles viruses expressing epitopes of RNA virus antigens and use of recombinant viruses for the preparation of vaccine compositions |
WO2004028563A1 (en) | 2002-09-27 | 2004-04-08 | Genexine Inc. | A vaccine enhancing the protective immunity to hepatitis c virus using plasmid dna and recombinant adenovirus |
US8642045B2 (en) | 2003-08-29 | 2014-02-04 | Virus Ikagaku Kenkyusho Inc. | Recombinant virus vector originating in HHV-6 or HHV-7, method of producing the same, method of transforming host cell using the same, host cell transformed thereby and gene therapy method using the same |
EP1766034B1 (en) | 2004-05-21 | 2014-03-19 | Novartis Vaccines and Diagnostics, Inc. | Alphavirus vectors for influenza virus vaccines |
WO2006060089A2 (en) | 2004-10-25 | 2006-06-08 | Biogen Idec Ma Inc. | Novel methods for producing adenoviral vector preparations with reduced replication-competent adenovirus contamination and novel adenoviral vectors and preparations |
US7598364B2 (en) | 2005-11-14 | 2009-10-06 | Merial Limited | Plasmid encoding canine BMP-7 |
DK2918598T3 (en) * | 2007-02-28 | 2019-04-29 | The Govt Of U S A As Represented By The Secretary Of The Dept Of Health And Human Services | Brachyury polypeptides and methods of use |
CN102099053A (en) | 2008-05-26 | 2011-06-15 | 卡迪拉保健有限公司 | Combined measles-human papilloma vaccine |
CA2759013C (en) * | 2009-04-17 | 2021-10-19 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Combination immunotherapy compositions against cancer and methods |
WO2012019127A2 (en) * | 2010-08-05 | 2012-02-09 | The Regents Of The University Of Colorado | Combination yeast-based immunotherapy and arginine therapy for the treatment of myeloid-derived supressor cell-associated diseases |
RU2619850C2 (en) * | 2011-03-17 | 2017-05-18 | Глоубиммьюн, Инк. | Immunotherapeutic compositions based on yeast with brachyury |
-
2013
- 2013-09-13 WO PCT/US2013/059737 patent/WO2014043518A1/en active Application Filing
- 2013-09-13 US US14/428,308 patent/US20150224181A1/en not_active Abandoned
- 2013-09-13 ES ES13773456T patent/ES2752190T3/en active Active
- 2013-09-13 EP EP13773456.2A patent/EP2895191B1/en active Active
-
2018
- 2018-08-21 US US16/107,559 patent/US11357839B2/en active Active
-
2022
- 2022-06-06 US US17/833,383 patent/US20220313801A1/en active Pending
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2022241198A3 (en) * | 2021-05-13 | 2022-12-22 | Thomas Jefferson University | Use of ectromelia virus for cancer immunotherapy and vaccines |
WO2023250054A1 (en) * | 2022-06-23 | 2023-12-28 | Merck Sharp & Dohme Llc | Immunogenic compositions for epstein-barr virus proteins |
Also Published As
Publication number | Publication date |
---|---|
EP2895191B1 (en) | 2019-06-05 |
US20150224181A1 (en) | 2015-08-13 |
EP2895191A1 (en) | 2015-07-22 |
ES2752190T3 (en) | 2020-04-03 |
WO2014043518A1 (en) | 2014-03-20 |
US20220313801A1 (en) | 2022-10-06 |
US11357839B2 (en) | 2022-06-14 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20220313801A1 (en) | Brachyury protein, non-poxvirus non-yeast vectors encoding brachyury protein, and their use | |
US12012438B2 (en) | Brachyury deletion mutants, non-yeast vectors encoding brachyury deletion mutants, and their use | |
JP5995926B2 (en) | Promoterless cassette for expression of alphavirus structural proteins | |
WO2002080982A2 (en) | Nucleic acid mucosal immunization | |
KR20230034933A (en) | Vaccines based on attenuated poxvirus vectors for protection against COVID-19 | |
JP2004518443A (en) | Recombinant poxvirus for chimeric proteins of human immunodeficiency virus | |
EP2849779B1 (en) | Cellular vaccine and method of inducing an immune response in a subject | |
CA3238020A1 (en) | Lentiviral vectors for expression of human papillomavirus (hpv) antigens and its implementation in the treatment of hpv induced cancers | |
US7517683B2 (en) | HIV-like particles and the use thereof | |
De Andres et al. | Use of B7 costimulatory molecules as adjuvants in a prime-boost vaccination against Visna/Maedi ovine lentivirus | |
Izumi et al. | Intravenous Inoculation of Replication-DeficientRecombinant Vaccinia Virus DIs Expressing Simian ImmunodeficiencyVirus Gag Controls Highly Pathogenic Simian-HumanImmunodeficiency Virus inMonkeys | |
US20110165190A1 (en) | Compositions and Methods for Immunizing Against Immunodeficiency Viruses | |
CN118354790A (en) | Lentiviral vectors for expression of Human Papilloma Virus (HPV) antigens and their use in the treatment of HPV-induced cancers |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
FEPP | Fee payment procedure |
Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE AFTER FINAL ACTION FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: ADVISORY ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT VERIFIED |
|
STCF | Information on status: patent grant |
Free format text: PATENTED CASE |