CA3238020A1 - Lentiviral vectors for expression of human papillomavirus (hpv) antigens and its implementation in the treatment of hpv induced cancers - Google Patents
Lentiviral vectors for expression of human papillomavirus (hpv) antigens and its implementation in the treatment of hpv induced cancers Download PDFInfo
- Publication number
- CA3238020A1 CA3238020A1 CA3238020A CA3238020A CA3238020A1 CA 3238020 A1 CA3238020 A1 CA 3238020A1 CA 3238020 A CA3238020 A CA 3238020A CA 3238020 A CA3238020 A CA 3238020A CA 3238020 A1 CA3238020 A1 CA 3238020A1
- Authority
- CA
- Canada
- Prior art keywords
- acid sequence
- nucleic acid
- lentiviral vector
- protein
- antigen
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 239000013598 vector Substances 0.000 title claims abstract description 380
- 239000000427 antigen Substances 0.000 title claims abstract description 199
- 108091007433 antigens Proteins 0.000 title claims abstract description 199
- 102000036639 antigens Human genes 0.000 title claims abstract description 199
- 206010028980 Neoplasm Diseases 0.000 title claims abstract description 159
- 238000011282 treatment Methods 0.000 title claims abstract description 23
- 241000701806 Human papillomavirus Species 0.000 title claims description 264
- 230000014509 gene expression Effects 0.000 title description 25
- 150000007523 nucleic acids Chemical group 0.000 claims abstract description 267
- 239000002245 particle Substances 0.000 claims abstract description 114
- 229960005486 vaccine Drugs 0.000 claims abstract description 102
- 239000000203 mixture Substances 0.000 claims abstract description 47
- 201000011510 cancer Diseases 0.000 claims abstract description 23
- 230000002265 prevention Effects 0.000 claims abstract description 12
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 258
- 231100001222 nononcogenic Toxicity 0.000 claims description 206
- 101710132594 Protein E6 Proteins 0.000 claims description 66
- 101710132595 Protein E7 Proteins 0.000 claims description 66
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 claims description 28
- 102000037984 Inhibitory immune checkpoint proteins Human genes 0.000 claims description 28
- 108091008026 Inhibitory immune checkpoint proteins Proteins 0.000 claims description 28
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 claims description 28
- 241001492404 Woodchuck hepatitis virus Species 0.000 claims description 18
- 230000000890 antigenic effect Effects 0.000 claims description 18
- 108091093126 WHP Posttrascriptional Response Element Proteins 0.000 claims description 14
- 229940045513 CTLA4 antagonist Drugs 0.000 claims description 13
- 206010027476 Metastases Diseases 0.000 claims description 11
- 230000001124 posttranscriptional effect Effects 0.000 claims description 11
- 230000001105 regulatory effect Effects 0.000 claims description 11
- 229940126547 T-cell immunoglobulin mucin-3 Drugs 0.000 claims description 10
- 108700028146 Genetic Enhancer Elements Proteins 0.000 claims description 9
- 102000043129 MHC class I family Human genes 0.000 claims description 9
- 108091054437 MHC class I family Proteins 0.000 claims description 9
- 108020001507 fusion proteins Proteins 0.000 claims description 9
- 102000037865 fusion proteins Human genes 0.000 claims description 9
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 8
- 241000711975 Vesicular stomatitis virus Species 0.000 claims description 8
- 230000002685 pulmonary effect Effects 0.000 claims description 7
- 206010008342 Cervix carcinoma Diseases 0.000 claims description 6
- 241000713772 Human immunodeficiency virus 1 Species 0.000 claims description 6
- 206010057444 Oropharyngeal neoplasm Diseases 0.000 claims description 6
- 208000002471 Penile Neoplasms Diseases 0.000 claims description 6
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 claims description 6
- 201000010881 cervical cancer Diseases 0.000 claims description 6
- 206010061424 Anal cancer Diseases 0.000 claims description 5
- 208000007860 Anus Neoplasms Diseases 0.000 claims description 5
- 108090000288 Glycoproteins Proteins 0.000 claims description 5
- 102000003886 Glycoproteins Human genes 0.000 claims description 5
- 208000032271 Malignant tumor of penis Diseases 0.000 claims description 5
- 206010031096 Oropharyngeal cancer Diseases 0.000 claims description 5
- 206010034299 Penile cancer Diseases 0.000 claims description 5
- 206010047741 Vulval cancer Diseases 0.000 claims description 5
- 208000004354 Vulvar Neoplasms Diseases 0.000 claims description 5
- 201000011165 anus cancer Diseases 0.000 claims description 5
- 230000009401 metastasis Effects 0.000 claims description 5
- 201000006958 oropharynx cancer Diseases 0.000 claims description 5
- 206010046885 vaginal cancer Diseases 0.000 claims description 5
- 208000013139 vaginal neoplasm Diseases 0.000 claims description 5
- 201000005102 vulva cancer Diseases 0.000 claims description 5
- 108010061833 Integrases Proteins 0.000 claims description 4
- 108010089520 pol Gene Products Proteins 0.000 claims description 4
- 239000003814 drug Substances 0.000 claims description 3
- 125000003275 alpha amino acid group Chemical group 0.000 claims 10
- LWGJTAZLEJHCPA-UHFFFAOYSA-N n-(2-chloroethyl)-n-nitrosomorpholine-4-carboxamide Chemical compound ClCCN(N=O)C(=O)N1CCOCC1 LWGJTAZLEJHCPA-UHFFFAOYSA-N 0.000 claims 2
- 102100034343 Integrase Human genes 0.000 claims 1
- 150000001413 amino acids Chemical group 0.000 description 130
- 210000004027 cell Anatomy 0.000 description 129
- 108090000623 proteins and genes Proteins 0.000 description 118
- 102000004169 proteins and genes Human genes 0.000 description 106
- 235000018102 proteins Nutrition 0.000 description 104
- 241000699670 Mus sp. Species 0.000 description 87
- 241000341655 Human papillomavirus type 16 Species 0.000 description 74
- 241000388169 Alphapapillomavirus 7 Species 0.000 description 69
- 238000002255 vaccination Methods 0.000 description 28
- 108090000765 processed proteins & peptides Proteins 0.000 description 25
- 210000001744 T-lymphocyte Anatomy 0.000 description 23
- 241001465754 Metazoa Species 0.000 description 21
- 238000000034 method Methods 0.000 description 21
- 238000002347 injection Methods 0.000 description 20
- 239000007924 injection Substances 0.000 description 20
- 241000282414 Homo sapiens Species 0.000 description 15
- 238000007920 subcutaneous administration Methods 0.000 description 15
- VIQCGTZFEYDQMR-UHFFFAOYSA-N fluphenazine decanoate Chemical compound C1CN(CCOC(=O)CCCCCCCCC)CCN1CCCN1C2=CC(C(F)(F)F)=CC=C2SC2=CC=CC=C21 VIQCGTZFEYDQMR-UHFFFAOYSA-N 0.000 description 14
- 239000013612 plasmid Substances 0.000 description 14
- 235000001014 amino acid Nutrition 0.000 description 13
- 239000002773 nucleotide Substances 0.000 description 13
- 125000003729 nucleotide group Chemical group 0.000 description 13
- 102000004196 processed proteins & peptides Human genes 0.000 description 13
- 108020004705 Codon Proteins 0.000 description 12
- 238000006243 chemical reaction Methods 0.000 description 12
- 210000004443 dendritic cell Anatomy 0.000 description 12
- 239000003085 diluting agent Substances 0.000 description 12
- 229960002566 papillomavirus vaccine Drugs 0.000 description 12
- 230000000694 effects Effects 0.000 description 11
- 108020004414 DNA Proteins 0.000 description 10
- 238000004806 packaging method and process Methods 0.000 description 10
- 210000004881 tumor cell Anatomy 0.000 description 10
- 230000003612 virological effect Effects 0.000 description 10
- 108091054438 MHC class II family Proteins 0.000 description 9
- 239000003623 enhancer Substances 0.000 description 9
- 230000028993 immune response Effects 0.000 description 9
- 238000001727 in vivo Methods 0.000 description 9
- 210000003289 regulatory T cell Anatomy 0.000 description 9
- 210000000612 antigen-presenting cell Anatomy 0.000 description 8
- 244000005700 microbiome Species 0.000 description 8
- 210000004988 splenocyte Anatomy 0.000 description 8
- 238000010361 transduction Methods 0.000 description 8
- 230000026683 transduction Effects 0.000 description 8
- 102000043131 MHC class II family Human genes 0.000 description 7
- 108700019146 Transgenes Proteins 0.000 description 7
- 230000010354 integration Effects 0.000 description 7
- 238000005259 measurement Methods 0.000 description 7
- 108020004707 nucleic acids Proteins 0.000 description 7
- 102000039446 nucleic acids Human genes 0.000 description 7
- 230000002246 oncogenic effect Effects 0.000 description 7
- 229920001184 polypeptide Polymers 0.000 description 7
- 230000001225 therapeutic effect Effects 0.000 description 7
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 6
- 241000699666 Mus <mouse, genus> Species 0.000 description 6
- 230000005867 T cell response Effects 0.000 description 6
- 230000000259 anti-tumor effect Effects 0.000 description 6
- 230000008030 elimination Effects 0.000 description 6
- 238000003379 elimination reaction Methods 0.000 description 6
- 238000002474 experimental method Methods 0.000 description 6
- 238000003384 imaging method Methods 0.000 description 6
- 238000007918 intramuscular administration Methods 0.000 description 6
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 6
- 230000004614 tumor growth Effects 0.000 description 6
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 5
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 5
- 102100027268 Interferon-stimulated gene 20 kDa protein Human genes 0.000 description 5
- 102100040678 Programmed cell death protein 1 Human genes 0.000 description 5
- 101710086987 X protein Proteins 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 238000012217 deletion Methods 0.000 description 5
- 230000037430 deletion Effects 0.000 description 5
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 5
- 230000008595 infiltration Effects 0.000 description 5
- 238000001764 infiltration Methods 0.000 description 5
- 238000002743 insertional mutagenesis Methods 0.000 description 5
- 238000010253 intravenous injection Methods 0.000 description 5
- 238000004519 manufacturing process Methods 0.000 description 5
- 230000035772 mutation Effects 0.000 description 5
- 230000036961 partial effect Effects 0.000 description 5
- 230000004044 response Effects 0.000 description 5
- 238000010186 staining Methods 0.000 description 5
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 5
- 238000002560 therapeutic procedure Methods 0.000 description 5
- 229940021747 therapeutic vaccine Drugs 0.000 description 5
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 4
- 101710125370 C-type lectin domain family 6 member A Proteins 0.000 description 4
- 238000011740 C57BL/6 mouse Methods 0.000 description 4
- 108090000695 Cytokines Proteins 0.000 description 4
- 102000004127 Cytokines Human genes 0.000 description 4
- 102100034349 Integrase Human genes 0.000 description 4
- 208000009608 Papillomavirus Infections Diseases 0.000 description 4
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 4
- 230000004913 activation Effects 0.000 description 4
- 238000007792 addition Methods 0.000 description 4
- 238000005415 bioluminescence Methods 0.000 description 4
- 230000029918 bioluminescence Effects 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 4
- 238000001415 gene therapy Methods 0.000 description 4
- 230000002163 immunogen Effects 0.000 description 4
- 208000015181 infectious disease Diseases 0.000 description 4
- 230000001394 metastastic effect Effects 0.000 description 4
- 206010061289 metastatic neoplasm Diseases 0.000 description 4
- 231100000590 oncogenic Toxicity 0.000 description 4
- 108091033319 polynucleotide Proteins 0.000 description 4
- 102000040430 polynucleotide Human genes 0.000 description 4
- 239000002157 polynucleotide Substances 0.000 description 4
- 230000008569 process Effects 0.000 description 4
- 230000000069 prophylactic effect Effects 0.000 description 4
- 230000001177 retroviral effect Effects 0.000 description 4
- 239000013603 viral vector Substances 0.000 description 4
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 description 3
- 108700010070 Codon Usage Proteins 0.000 description 3
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 3
- 102000053602 DNA Human genes 0.000 description 3
- 101000889276 Homo sapiens Cytotoxic T-lymphocyte protein 4 Proteins 0.000 description 3
- 101000917826 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-a Proteins 0.000 description 3
- 101000917824 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-b Proteins 0.000 description 3
- 101001023379 Homo sapiens Lysosome-associated membrane glycoprotein 1 Proteins 0.000 description 3
- 241000725303 Human immunodeficiency virus Species 0.000 description 3
- 101000767631 Human papillomavirus type 16 Protein E7 Proteins 0.000 description 3
- 101150106931 IFNG gene Proteins 0.000 description 3
- 108060003951 Immunoglobulin Proteins 0.000 description 3
- 108010002350 Interleukin-2 Proteins 0.000 description 3
- 241000713666 Lentivirus Species 0.000 description 3
- 102100029204 Low affinity immunoglobulin gamma Fc region receptor II-a Human genes 0.000 description 3
- 102100035133 Lysosome-associated membrane glycoprotein 1 Human genes 0.000 description 3
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 3
- 108700019961 Neoplasm Genes Proteins 0.000 description 3
- 102000048850 Neoplasm Genes Human genes 0.000 description 3
- 108091008874 T cell receptors Proteins 0.000 description 3
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 3
- 102100024834 T-cell immunoreceptor with Ig and ITIM domains Human genes 0.000 description 3
- 101710090983 T-cell immunoreceptor with Ig and ITIM domains Proteins 0.000 description 3
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 3
- 102100040247 Tumor necrosis factor Human genes 0.000 description 3
- 241000700605 Viruses Species 0.000 description 3
- 241001275800 Zanclidae Species 0.000 description 3
- 238000004458 analytical method Methods 0.000 description 3
- 230000004663 cell proliferation Effects 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 230000007423 decrease Effects 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 238000003114 enzyme-linked immunosorbent spot assay Methods 0.000 description 3
- 238000000684 flow cytometry Methods 0.000 description 3
- 230000004907 flux Effects 0.000 description 3
- 230000036039 immunity Effects 0.000 description 3
- 102000018358 immunoglobulin Human genes 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- 230000006698 induction Effects 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 239000003446 ligand Substances 0.000 description 3
- 238000004020 luminiscence type Methods 0.000 description 3
- 239000003550 marker Substances 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 239000002609 medium Substances 0.000 description 3
- 229940021993 prophylactic vaccine Drugs 0.000 description 3
- 125000006850 spacer group Chemical group 0.000 description 3
- 241000894007 species Species 0.000 description 3
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- 238000004448 titration Methods 0.000 description 3
- 238000013518 transcription Methods 0.000 description 3
- 230000035897 transcription Effects 0.000 description 3
- 238000003146 transient transfection Methods 0.000 description 3
- 238000013519 translation Methods 0.000 description 3
- 241001430294 unidentified retrovirus Species 0.000 description 3
- HTBLMRUZSCCOLL-UHFFFAOYSA-N 8-benzyl-2-(furan-2-ylmethyl)-6-phenylimidazo[1,2-a]pyrazin-3-ol Chemical compound OC1=C(CC2=CC=CO2)N=C2N1C=C(N=C2CC1=CC=CC=C1)C1=CC=CC=C1 HTBLMRUZSCCOLL-UHFFFAOYSA-N 0.000 description 2
- 102100040839 C-type lectin domain family 6 member A Human genes 0.000 description 2
- 102100029968 Calreticulin Human genes 0.000 description 2
- 108090000549 Calreticulin Proteins 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 2
- 101001137987 Homo sapiens Lymphocyte activation gene 3 protein Proteins 0.000 description 2
- 101001111742 Homo sapiens Rhombotin-2 Proteins 0.000 description 2
- 101000954493 Human papillomavirus type 16 Protein E6 Proteins 0.000 description 2
- PIWKPBJCKXDKJR-UHFFFAOYSA-N Isoflurane Chemical compound FC(F)OC(Cl)C(F)(F)F PIWKPBJCKXDKJR-UHFFFAOYSA-N 0.000 description 2
- 102100020862 Lymphocyte activation gene 3 protein Human genes 0.000 description 2
- 241000283923 Marmota monax Species 0.000 description 2
- 108700020796 Oncogene Proteins 0.000 description 2
- 229930182555 Penicillin Natural products 0.000 description 2
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 2
- 239000006146 Roswell Park Memorial Institute medium Substances 0.000 description 2
- PXIPVTKHYLBLMZ-UHFFFAOYSA-N Sodium azide Chemical compound [Na+].[N-]=[N+]=[N-] PXIPVTKHYLBLMZ-UHFFFAOYSA-N 0.000 description 2
- 101710172711 Structural protein Proteins 0.000 description 2
- 230000006052 T cell proliferation Effects 0.000 description 2
- 208000012827 T-B+ severe combined immunodeficiency due to gamma chain deficiency Diseases 0.000 description 2
- 108091061763 Triple-stranded DNA Proteins 0.000 description 2
- 108090000848 Ubiquitin Proteins 0.000 description 2
- 102000044159 Ubiquitin Human genes 0.000 description 2
- 201000007146 X-linked severe combined immunodeficiency Diseases 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- 125000000539 amino acid group Chemical group 0.000 description 2
- 238000010171 animal model Methods 0.000 description 2
- 230000030741 antigen processing and presentation Effects 0.000 description 2
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 230000036952 cancer formation Effects 0.000 description 2
- 230000020411 cell activation Effects 0.000 description 2
- 238000004590 computer program Methods 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 201000010099 disease Diseases 0.000 description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 2
- 239000012636 effector Substances 0.000 description 2
- 239000012091 fetal bovine serum Substances 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 210000005260 human cell Anatomy 0.000 description 2
- 210000002865 immune cell Anatomy 0.000 description 2
- 210000000987 immune system Anatomy 0.000 description 2
- 230000003053 immunization Effects 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 238000009169 immunotherapy Methods 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 238000010255 intramuscular injection Methods 0.000 description 2
- 239000007927 intramuscular injection Substances 0.000 description 2
- 229960002725 isoflurane Drugs 0.000 description 2
- 208000032839 leukemia Diseases 0.000 description 2
- 208000037841 lung tumor Diseases 0.000 description 2
- 210000001165 lymph node Anatomy 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 210000004940 nucleus Anatomy 0.000 description 2
- 238000005457 optimization Methods 0.000 description 2
- 229910052760 oxygen Inorganic materials 0.000 description 2
- 239000001301 oxygen Substances 0.000 description 2
- 230000037361 pathway Effects 0.000 description 2
- 229940049954 penicillin Drugs 0.000 description 2
- 108700004029 pol Genes Proteins 0.000 description 2
- 101150088264 pol gene Proteins 0.000 description 2
- 230000001681 protective effect Effects 0.000 description 2
- RXWNCPJZOCPEPQ-NVWDDTSBSA-N puromycin Chemical compound C1=CC(OC)=CC=C1C[C@H](N)C(=O)N[C@H]1[C@@H](O)[C@H](N2C3=NC=NC(=C3N=C2)N(C)C)O[C@@H]1CO RXWNCPJZOCPEPQ-NVWDDTSBSA-N 0.000 description 2
- 238000003753 real-time PCR Methods 0.000 description 2
- 108020003175 receptors Proteins 0.000 description 2
- 102000005962 receptors Human genes 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 230000010076 replication Effects 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- DAEPDZWVDSPTHF-UHFFFAOYSA-M sodium pyruvate Chemical compound [Na+].CC(=O)C([O-])=O DAEPDZWVDSPTHF-UHFFFAOYSA-M 0.000 description 2
- 210000000130 stem cell Anatomy 0.000 description 2
- 230000000638 stimulation Effects 0.000 description 2
- 229960005322 streptomycin Drugs 0.000 description 2
- 238000010254 subcutaneous injection Methods 0.000 description 2
- 238000006467 substitution reaction Methods 0.000 description 2
- 230000004083 survival effect Effects 0.000 description 2
- 230000002195 synergetic effect Effects 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 230000001052 transient effect Effects 0.000 description 2
- 230000004565 tumor cell growth Effects 0.000 description 2
- 241000701161 unidentified adenovirus Species 0.000 description 2
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- HJCMDXDYPOUFDY-WHFBIAKZSA-N Ala-Gln Chemical compound C[C@H](N)C(=O)N[C@H](C(O)=O)CCC(N)=O HJCMDXDYPOUFDY-WHFBIAKZSA-N 0.000 description 1
- FDQGNLOWMMVRQL-UHFFFAOYSA-N Allobarbital Chemical compound C=CCC1(CC=C)C(=O)NC(=O)NC1=O FDQGNLOWMMVRQL-UHFFFAOYSA-N 0.000 description 1
- 102000008096 B7-H1 Antigen Human genes 0.000 description 1
- 108010074708 B7-H1 Antigen Proteins 0.000 description 1
- 208000023514 Barrett esophagus Diseases 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 208000005623 Carcinogenesis Diseases 0.000 description 1
- 101710150820 Cellular tumor antigen p53 Proteins 0.000 description 1
- 241000501789 Cocal virus Species 0.000 description 1
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 1
- 241000450599 DNA viruses Species 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 108010067770 Endopeptidase K Proteins 0.000 description 1
- 101710091045 Envelope protein Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 108091006027 G proteins Proteins 0.000 description 1
- 102000030782 GTP binding Human genes 0.000 description 1
- 108091000058 GTP-Binding Proteins 0.000 description 1
- 102100031181 Glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 1
- 102100028970 HLA class I histocompatibility antigen, alpha chain E Human genes 0.000 description 1
- 102100028966 HLA class I histocompatibility antigen, alpha chain F Human genes 0.000 description 1
- 102000025850 HLA-A2 Antigen Human genes 0.000 description 1
- 108010074032 HLA-A2 Antigen Proteins 0.000 description 1
- 108010091938 HLA-B7 Antigen Proteins 0.000 description 1
- 108010016121 HLA-C*05 antigen Proteins 0.000 description 1
- 241000700721 Hepatitis B virus Species 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000986085 Homo sapiens HLA class I histocompatibility antigen, alpha chain E Proteins 0.000 description 1
- 101000986080 Homo sapiens HLA class I histocompatibility antigen, alpha chain F Proteins 0.000 description 1
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 1
- 101100155061 Homo sapiens UBE3A gene Proteins 0.000 description 1
- 108010048209 Human Immunodeficiency Virus Proteins Proteins 0.000 description 1
- 108700020129 Human immunodeficiency virus 1 p31 integrase Proteins 0.000 description 1
- 241000709701 Human poliovirus 1 Species 0.000 description 1
- 208000029462 Immunodeficiency disease Diseases 0.000 description 1
- 101150008942 J gene Proteins 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 206010027458 Metastases to lung Diseases 0.000 description 1
- 101100155062 Mus musculus Ube3a gene Proteins 0.000 description 1
- 108010004217 Natural Cytotoxicity Triggering Receptor 1 Proteins 0.000 description 1
- 102100032870 Natural cytotoxicity triggering receptor 1 Human genes 0.000 description 1
- 108091005461 Nucleic proteins Proteins 0.000 description 1
- 239000004677 Nylon Substances 0.000 description 1
- 102000043276 Oncogene Human genes 0.000 description 1
- 108020002230 Pancreatic Ribonuclease Proteins 0.000 description 1
- 102000005891 Pancreatic ribonuclease Human genes 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 101710188315 Protein X Proteins 0.000 description 1
- 239000012979 RPMI medium Substances 0.000 description 1
- 108700008625 Reporter Genes Proteins 0.000 description 1
- 108050002653 Retinoblastoma protein Proteins 0.000 description 1
- 241000712907 Retroviridae Species 0.000 description 1
- 108091006629 SLC13A2 Proteins 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 108091081024 Start codon Proteins 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 108700005078 Synthetic Genes Proteins 0.000 description 1
- 108010008038 Synthetic Vaccines Proteins 0.000 description 1
- 230000006044 T cell activation Effects 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 102000006275 Ubiquitin-Protein Ligases Human genes 0.000 description 1
- 108010083111 Ubiquitin-Protein Ligases Proteins 0.000 description 1
- 102100030434 Ubiquitin-protein ligase E3A Human genes 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 241000711970 Vesiculovirus Species 0.000 description 1
- 108020005202 Viral DNA Proteins 0.000 description 1
- 108010003533 Viral Envelope Proteins Proteins 0.000 description 1
- 241000021375 Xenogenes Species 0.000 description 1
- 210000001015 abdomen Anatomy 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- HUTDUHSNJYTCAR-UHFFFAOYSA-N ancymidol Chemical compound C1=CC(OC)=CC=C1C(O)(C=1C=NC=NC=1)C1CC1 HUTDUHSNJYTCAR-UHFFFAOYSA-N 0.000 description 1
- 230000003466 anti-cipated effect Effects 0.000 description 1
- NOFOAYPPHIUXJR-APNQCZIXSA-N aphidicolin Chemical compound C1[C@@]23[C@@]4(C)CC[C@@H](O)[C@@](C)(CO)[C@@H]4CC[C@H]3C[C@H]1[C@](CO)(O)CC2 NOFOAYPPHIUXJR-APNQCZIXSA-N 0.000 description 1
- SEKZNWAQALMJNH-YZUCACDQSA-N aphidicolin Natural products C[C@]1(CO)CC[C@]23C[C@H]1C[C@@H]2CC[C@H]4[C@](C)(CO)[C@H](O)CC[C@]34C SEKZNWAQALMJNH-YZUCACDQSA-N 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 229960003852 atezolizumab Drugs 0.000 description 1
- 229950002916 avelumab Drugs 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- IYNDLOXRXUOGIU-LQDWTQKMSA-M benzylpenicillin potassium Chemical compound [K+].N([C@H]1[C@H]2SC([C@@H](N2C1=O)C([O-])=O)(C)C)C(=O)CC1=CC=CC=C1 IYNDLOXRXUOGIU-LQDWTQKMSA-M 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 231100000504 carcinogenesis Toxicity 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 230000003778 catagen phase Effects 0.000 description 1
- 230000003915 cell function Effects 0.000 description 1
- 239000008004 cell lysis buffer Substances 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 230000010307 cell transformation Effects 0.000 description 1
- 229940121420 cemiplimab Drugs 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 238000012761 co-transfection Methods 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 108091036078 conserved sequence Proteins 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000010924 continuous production Methods 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 210000004748 cultured cell Anatomy 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- 238000004163 cytometry Methods 0.000 description 1
- 238000007405 data analysis Methods 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000003112 degranulating effect Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 229950009791 durvalumab Drugs 0.000 description 1
- 210000003162 effector t lymphocyte Anatomy 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 210000003743 erythrocyte Anatomy 0.000 description 1
- 239000003797 essential amino acid Substances 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 230000006870 function Effects 0.000 description 1
- 238000010230 functional analysis Methods 0.000 description 1
- 108010027225 gag-pol Fusion Proteins Proteins 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 231100000024 genotoxic Toxicity 0.000 description 1
- 230000001738 genotoxic effect Effects 0.000 description 1
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 238000003306 harvesting Methods 0.000 description 1
- 210000002064 heart cell Anatomy 0.000 description 1
- 238000000265 homogenisation Methods 0.000 description 1
- 102000050324 human LMO2 Human genes 0.000 description 1
- 230000008105 immune reaction Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 230000006054 immunological memory Effects 0.000 description 1
- 238000002513 implantation Methods 0.000 description 1
- 230000008676 import Effects 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 238000011221 initial treatment Methods 0.000 description 1
- 238000010212 intracellular staining Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 239000007928 intraperitoneal injection Substances 0.000 description 1
- 230000002601 intratumoral effect Effects 0.000 description 1
- 229960005386 ipilimumab Drugs 0.000 description 1
- 210000003292 kidney cell Anatomy 0.000 description 1
- 230000002045 lasting effect Effects 0.000 description 1
- 229940027569 lentiviral vector vaccine Drugs 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 210000005229 liver cell Anatomy 0.000 description 1
- 230000005923 long-lasting effect Effects 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 210000005265 lung cell Anatomy 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 208000019420 lymphoid neoplasm Diseases 0.000 description 1
- 239000012139 lysis buffer Substances 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 238000013507 mapping Methods 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 230000015654 memory Effects 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 230000000394 mitotic effect Effects 0.000 description 1
- 238000009126 molecular therapy Methods 0.000 description 1
- 229950001907 monalizumab Drugs 0.000 description 1
- 210000004877 mucosa Anatomy 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 229960003301 nivolumab Drugs 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 210000004492 nuclear pore Anatomy 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 229920001778 nylon Polymers 0.000 description 1
- 229960002621 pembrolizumab Drugs 0.000 description 1
- 230000002688 persistence Effects 0.000 description 1
- 230000002085 persistent effect Effects 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 239000011148 porous material Substances 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 230000001566 pro-viral effect Effects 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 229950010131 puromycin Drugs 0.000 description 1
- 108010045647 puromycin N-acetyltransferase Proteins 0.000 description 1
- 229940056270 quavonlimab Drugs 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 229940124551 recombinant vaccine Drugs 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 229940121484 relatlimab Drugs 0.000 description 1
- 238000009256 replacement therapy Methods 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 102220036548 rs140382474 Human genes 0.000 description 1
- 229940061626 sabatolimab Drugs 0.000 description 1
- 208000011581 secondary neoplasm Diseases 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 239000012679 serum free medium Substances 0.000 description 1
- 210000002363 skeletal muscle cell Anatomy 0.000 description 1
- 210000000329 smooth muscle myocyte Anatomy 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 229940054269 sodium pyruvate Drugs 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 230000010473 stable expression Effects 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 229950007133 tiragolumab Drugs 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 210000005010 torso Anatomy 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 108091006106 transcriptional activators Proteins 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 230000002463 transducing effect Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 229950007217 tremelimumab Drugs 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 231100000588 tumorigenic Toxicity 0.000 description 1
- 230000000381 tumorigenic effect Effects 0.000 description 1
- 238000005199 ultracentrifugation Methods 0.000 description 1
- 229940125575 vaccine candidate Drugs 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/53—DNA (RNA) vaccination
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/58—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
- A61K2039/585—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation wherein the target is cancer
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16041—Use of virus, viral particle or viral elements as a vector
- C12N2740/16043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2830/00—Vector systems having a special element relevant for transcription
- C12N2830/48—Vector systems having a special element relevant for transcription regulating transport or export of RNA, e.g. RRE, PRE, WPRE, CTE
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Immunology (AREA)
- Virology (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Microbiology (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Physics & Mathematics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Plant Pathology (AREA)
- Gastroenterology & Hepatology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
Abstract
The present invention relates to a lentiviral vector, in particular a non-integrative lentiviral vector, comprising at least four distinct nucleic acid sequences encoding HPV antigens, to a lentiviral vector particle comprising said vector, to an isolated cell comprising the same, and to a vaccine composition comprising the said lentiviral vector, lentiviral vector particle or cell. The present invention further relates to their implementation in the treatment or prevention of an HPV induced cancer.
Description
TITLE OF THE INVENTION
LENTIVIRAL VECTORS FOR EXPRESSION OF HUMAN PAPILLOMAVIRUS (HPV) ANTIGENS AND ITS IMPLEMENTATION IN THE TREATMENT OF HPV INDUCED
CANCERS
FIELD OF THE INVENTION
The present invention relates to the field of recombinant vaccine technology and relates to improvements of lentiviral vectors, which can be used as therapeutic and prophylactic vaccines. In particular, the present invention relates to lentiviral vectors expressing Human Papillomavirus (HPV) antigens and to their implementation in the prevention and treatment of HPV induced cancers.
BACKGROUND OF THE INVENTION
HPV is responsible for 5.2% of cancers throughout the world (Tota et al.. Prey Med 2011 Oct; 53 Suppl 1:S12-21). More than 100 HPV types have been identified and have been classified into 3 groups depending on their association with cancer: high risk-types with a high oncogenic potential (among them, HPV type 16 (HPV-16) and HPV type 18 (HPV-18)), low risk-types that are associated with benign lesions (HPV-6, -11) and cutaneous types (among them, HPV-1, -2, -3, -4...) (Chen et al. Virology vol. 516 (2018): 86-101). The fraction of HPV associated cancer varies upon cancer type and geography, but it is estimated that 90 % of cervical, 91 % of anal, 75% of vaginal, 70% of oropharyngeal, 69%
of vulvar and 63% of penile cancers are related with HPV infections (Saraiya et al., J
Natl Cancer Inst.
2015 Apr 29;107(6)).
The two most common types of HPV found in cancers are HPV16 and HPV18.
For instance, HPV16 and HPV18 are thought to be involved in 70-75% of all cervical cancers (de Sanjose et al., Eur J Cancer. 2013 Nov;49(16):3450-61). HPV16 and 18 are also largely involved in anal (91%), oropharyngeal (70%), vaginal (75%), penile (63%) and vulvar (68%) cancers (Saraiya et al., J Natl Cancer Inst. 2015 Apr 29;107(6)).
Thereby, a therapeutic vaccine targeting HPV16/18 could potentially be used to treat and prevent related cancers, irrespective of their location.
Human papillomaviruses (HPV) are non-enveloped, double-stranded DNA
viruses. Their genome encodes six non-structural proteins (early proteins El, E2, E4, E5, E6
LENTIVIRAL VECTORS FOR EXPRESSION OF HUMAN PAPILLOMAVIRUS (HPV) ANTIGENS AND ITS IMPLEMENTATION IN THE TREATMENT OF HPV INDUCED
CANCERS
FIELD OF THE INVENTION
The present invention relates to the field of recombinant vaccine technology and relates to improvements of lentiviral vectors, which can be used as therapeutic and prophylactic vaccines. In particular, the present invention relates to lentiviral vectors expressing Human Papillomavirus (HPV) antigens and to their implementation in the prevention and treatment of HPV induced cancers.
BACKGROUND OF THE INVENTION
HPV is responsible for 5.2% of cancers throughout the world (Tota et al.. Prey Med 2011 Oct; 53 Suppl 1:S12-21). More than 100 HPV types have been identified and have been classified into 3 groups depending on their association with cancer: high risk-types with a high oncogenic potential (among them, HPV type 16 (HPV-16) and HPV type 18 (HPV-18)), low risk-types that are associated with benign lesions (HPV-6, -11) and cutaneous types (among them, HPV-1, -2, -3, -4...) (Chen et al. Virology vol. 516 (2018): 86-101). The fraction of HPV associated cancer varies upon cancer type and geography, but it is estimated that 90 % of cervical, 91 % of anal, 75% of vaginal, 70% of oropharyngeal, 69%
of vulvar and 63% of penile cancers are related with HPV infections (Saraiya et al., J
Natl Cancer Inst.
2015 Apr 29;107(6)).
The two most common types of HPV found in cancers are HPV16 and HPV18.
For instance, HPV16 and HPV18 are thought to be involved in 70-75% of all cervical cancers (de Sanjose et al., Eur J Cancer. 2013 Nov;49(16):3450-61). HPV16 and 18 are also largely involved in anal (91%), oropharyngeal (70%), vaginal (75%), penile (63%) and vulvar (68%) cancers (Saraiya et al., J Natl Cancer Inst. 2015 Apr 29;107(6)).
Thereby, a therapeutic vaccine targeting HPV16/18 could potentially be used to treat and prevent related cancers, irrespective of their location.
Human papillomaviruses (HPV) are non-enveloped, double-stranded DNA
viruses. Their genome encodes six non-structural proteins (early proteins El, E2, E4, E5, E6
2 and E7) and two structural proteins (late proteins Li and L2) (Chen et al.
Virology vol. 516 (2018): 86-101).
Among theses proteins, E6 and E7 have been well characterized for their oncogenicity. They are known to inactivate p53 and pRb tumour suppressor proteins, thereby promoting cell proliferation. E6/E7 oncogenes are crucial for both the induction of HPV-linked malignant cell transformation and the maintenance of the oncogenic phenotype of HPV-positive cancer cells (Yim and Park, Cancer Res Treat. 2005 Dec;37(6):319-24.). The E6 and E7 proteins are expressed throughout the infection by all HPV positive cells and this observation makes them perfect targets for vaccines.
Recombinant viral vectors have been widely developed for vaccination purposes. Modification of viral genomes allowed the production of non-toxic and non-infectious viral particles that can be used as tools to introduce genetic material into target cells. The use of recombinant viral vectors to elicit a T-cell mediated immunity is a very promising approach for vaccination. A variety of viral vectors have been evaluated for vaccination purposes including retroviruses vectors, adenoviruses vectors and vaccinia virus vectors (Milone and O'Doherty, Leukemia (2018) 32:1529-1541 and Ku et aL, Expert Review of Vaccines (2021). Lentiviruses are part of the Retroviridae family, which includes the human immunodeficiency viruses (HIV). Lentiviral vectors are mainly derived from HIV-1. They have been improved in their safety by removal of the LTR U3 sequence, resulting in "self-inactivating" vectors that are entirely devoid of viral promoter and enhancer sequences.
Lentiviral vectors have emerged as promising tools because they exhibit several advantages over other viral systems. In particular, lentiviral vectors are not toxic and, unlike other retroviruses, are capable of transducing non-dividing cells, in particular dendritic cells (He et al. 2007, Expert Rev vaccines, 6(6):913-24), allowing a sustained antigen presentation through the endogenous pathway.
As opposed to the other commonly used viral vectors, lentiviral vectors have the capacity to transduce non-dividing cells. Efficient transduction in non-dividing cells requires the formation of a triple-stranded DNA structure called the central DNA
"flap", which maximizes the efficiency of gene import into the nuclei of non-dividing cells, including dendritic cells (DCs) (Arhel et al., EMBO J. 2007 Jun 20; 26(12): 3025-3037) (Zennou et al., Cell. 2000 Apr 14;101(2):173-85).
Dendritic cells (DCs) are of primary importance for antigen presentation as they constitute the main class of antigen presenting cells (APCs) whose primary function is to
Virology vol. 516 (2018): 86-101).
Among theses proteins, E6 and E7 have been well characterized for their oncogenicity. They are known to inactivate p53 and pRb tumour suppressor proteins, thereby promoting cell proliferation. E6/E7 oncogenes are crucial for both the induction of HPV-linked malignant cell transformation and the maintenance of the oncogenic phenotype of HPV-positive cancer cells (Yim and Park, Cancer Res Treat. 2005 Dec;37(6):319-24.). The E6 and E7 proteins are expressed throughout the infection by all HPV positive cells and this observation makes them perfect targets for vaccines.
Recombinant viral vectors have been widely developed for vaccination purposes. Modification of viral genomes allowed the production of non-toxic and non-infectious viral particles that can be used as tools to introduce genetic material into target cells. The use of recombinant viral vectors to elicit a T-cell mediated immunity is a very promising approach for vaccination. A variety of viral vectors have been evaluated for vaccination purposes including retroviruses vectors, adenoviruses vectors and vaccinia virus vectors (Milone and O'Doherty, Leukemia (2018) 32:1529-1541 and Ku et aL, Expert Review of Vaccines (2021). Lentiviruses are part of the Retroviridae family, which includes the human immunodeficiency viruses (HIV). Lentiviral vectors are mainly derived from HIV-1. They have been improved in their safety by removal of the LTR U3 sequence, resulting in "self-inactivating" vectors that are entirely devoid of viral promoter and enhancer sequences.
Lentiviral vectors have emerged as promising tools because they exhibit several advantages over other viral systems. In particular, lentiviral vectors are not toxic and, unlike other retroviruses, are capable of transducing non-dividing cells, in particular dendritic cells (He et al. 2007, Expert Rev vaccines, 6(6):913-24), allowing a sustained antigen presentation through the endogenous pathway.
As opposed to the other commonly used viral vectors, lentiviral vectors have the capacity to transduce non-dividing cells. Efficient transduction in non-dividing cells requires the formation of a triple-stranded DNA structure called the central DNA
"flap", which maximizes the efficiency of gene import into the nuclei of non-dividing cells, including dendritic cells (DCs) (Arhel et al., EMBO J. 2007 Jun 20; 26(12): 3025-3037) (Zennou et al., Cell. 2000 Apr 14;101(2):173-85).
Dendritic cells (DCs) are of primary importance for antigen presentation as they constitute the main class of antigen presenting cells (APCs) whose primary function is to
3 present antigens and initiate an immune response (Steinman, R., Banchereau, J.
Nature 449, 419-426 (2007)). Mature DCs migrate to the draining lymph node and where they present the antigen-derived short peptides at the surface through Major Histocompatibility Complex (MHC) molecules. Antigen-specific T cells present in the lymph nodes can then interact with peptide-MHC complexes through TCR (T Cell Receptor). The recognition of peptide-MHC
by specific TCR in conjunction with co-stimulatory signals, initiates T cell activation (Steinman, R., Banchereau, J. Nature 449,419-426 (2007)).
The aim of the present invention is to provide therapeutic and prophylactic vaccines for the prevention and treatment of HPV-induced cancers.
Therapeutic vaccination against high-risk human papillomaviruses with an integrase defective lentiviral vector expressing non-oncogenic HPV16 E7 fused to calreticulin (CRT) has been described (Grasso et al., Int J Cancer. 2013 Jan 15;132(2):335-44). The tests were perfonned against early-stage tumors and showed the ability of this construct to eradicate said tumors in a reasonable but not perfect number of vaccinated mice.
Accordingly, there is still a need in the art for the treatment of more aggressive and/or well implanted tumors induced by HPV, which are known in the art as being more difficult to eliminate than small and early-stage tumors.
There is also a need for a treatment of resistant tumors induced by HPV, i.e.
tumors characterized in that they are strongly infiltrated with Regulatory T
cells (Tregs).
There is moreover a need for a therapeutic vaccine allowing infiltration with CD8+ and CD4+ cells in HPV-induced tumors to be treated while reducing Tregs in said tumors.
There is also a need for the generation of a strong immunological memory against HPV and in particular against PDHPV antigens, more particularly against HPV16 and .. HPV18 antigens.
There is also a need for the generation of a novel safe, non-oncogenic, prophylactic and therapeutic vaccine against HPV induced cancers.
There is further a need for a vaccine allowing, after administration of a single dose, to fully eliminate primary tumors and to provide a strong protection against relapse.
The invention has for purpose to meet the above-mentioned needs.
SUMMARY OF THE INVENTION
The present invention accordingly relates to the following items:
Nature 449, 419-426 (2007)). Mature DCs migrate to the draining lymph node and where they present the antigen-derived short peptides at the surface through Major Histocompatibility Complex (MHC) molecules. Antigen-specific T cells present in the lymph nodes can then interact with peptide-MHC complexes through TCR (T Cell Receptor). The recognition of peptide-MHC
by specific TCR in conjunction with co-stimulatory signals, initiates T cell activation (Steinman, R., Banchereau, J. Nature 449,419-426 (2007)).
The aim of the present invention is to provide therapeutic and prophylactic vaccines for the prevention and treatment of HPV-induced cancers.
Therapeutic vaccination against high-risk human papillomaviruses with an integrase defective lentiviral vector expressing non-oncogenic HPV16 E7 fused to calreticulin (CRT) has been described (Grasso et al., Int J Cancer. 2013 Jan 15;132(2):335-44). The tests were perfonned against early-stage tumors and showed the ability of this construct to eradicate said tumors in a reasonable but not perfect number of vaccinated mice.
Accordingly, there is still a need in the art for the treatment of more aggressive and/or well implanted tumors induced by HPV, which are known in the art as being more difficult to eliminate than small and early-stage tumors.
There is also a need for a treatment of resistant tumors induced by HPV, i.e.
tumors characterized in that they are strongly infiltrated with Regulatory T
cells (Tregs).
There is moreover a need for a therapeutic vaccine allowing infiltration with CD8+ and CD4+ cells in HPV-induced tumors to be treated while reducing Tregs in said tumors.
There is also a need for the generation of a strong immunological memory against HPV and in particular against PDHPV antigens, more particularly against HPV16 and .. HPV18 antigens.
There is also a need for the generation of a novel safe, non-oncogenic, prophylactic and therapeutic vaccine against HPV induced cancers.
There is further a need for a vaccine allowing, after administration of a single dose, to fully eliminate primary tumors and to provide a strong protection against relapse.
The invention has for purpose to meet the above-mentioned needs.
SUMMARY OF THE INVENTION
The present invention accordingly relates to the following items:
4 PCT/EP2022/081839 Item 1: a lentiviral vector, in particular a non-integrative lentiviral vector, comprising at least four distinct nucleic acid sequences selected from the group consisting of:
- at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen, - at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen, - at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen, and - at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen.
As illustrated in the examples, lentiviral vectors of the invention allow for a strong therapeutic and prophylactic activity against HPV-induced tumors.
Item 2: The lentiviral vector according to item 1, wherein the nucleic acid sequence encoding the non-oncogenic Human papillomavirus (HPV16) protein E6 antigen encodes an amino acid sequence having at least 80% sequence identity with the amino acid sequence set forth as SEQ ID NO: 7, the nucleic acid sequence being in particular selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID
NO: 5 and SEQ ID NO: 6.
Item 3: The lentiviral vector according to item 1 or 2, wherein the nucleic acid sequence encoding the non-oncogenic Human papillomavirus (HPV16) protein E7 antigen encodes an amino acid sequence having at least 68% sequence identity with the amino acid sequence set forth as SEQ ID NO: 16, the nucleic acid sequence being in particular selected from the group consisting of SEQ ID NO: 14 and SEQ ID NO: 15.
Item 4: The lentiviral vector according to any one of items 1 to 3, wherein the nucleic acid sequence encoding the non-oncogenic Human papillomavirus (HPV18) protein E6 antigen encodes an amino acid sequence having at least 60% sequence identity with the amino acid sequence set forth as SEQ ID NO: 24, the nucleic acid sequence being in particular selected from the group consisting of SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID
NO: 22 and SEQ ID NO: 23.
Item 5: The lentiviral vector according to any one of items 1 to 4, wherein the nucleic acid sequence encoding the non-oncogenic Human papillomavirus (HPV18) protein E7 antigen encodes an amino acid sequence having at least 83% sequence identity with the amino acid sequence set forth as SEQ ID NO: 33, the nucleic acid sequence being in particular selected from the group consisting of SEQ ID NO: 30, SEQ ID NO: 31 and SEQ ID
NO: 32.
Item 6: The lentiviral vector according to any one of items 1 to 5, wherein the at
- at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen, - at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen, - at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen, and - at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen.
As illustrated in the examples, lentiviral vectors of the invention allow for a strong therapeutic and prophylactic activity against HPV-induced tumors.
Item 2: The lentiviral vector according to item 1, wherein the nucleic acid sequence encoding the non-oncogenic Human papillomavirus (HPV16) protein E6 antigen encodes an amino acid sequence having at least 80% sequence identity with the amino acid sequence set forth as SEQ ID NO: 7, the nucleic acid sequence being in particular selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID
NO: 5 and SEQ ID NO: 6.
Item 3: The lentiviral vector according to item 1 or 2, wherein the nucleic acid sequence encoding the non-oncogenic Human papillomavirus (HPV16) protein E7 antigen encodes an amino acid sequence having at least 68% sequence identity with the amino acid sequence set forth as SEQ ID NO: 16, the nucleic acid sequence being in particular selected from the group consisting of SEQ ID NO: 14 and SEQ ID NO: 15.
Item 4: The lentiviral vector according to any one of items 1 to 3, wherein the nucleic acid sequence encoding the non-oncogenic Human papillomavirus (HPV18) protein E6 antigen encodes an amino acid sequence having at least 60% sequence identity with the amino acid sequence set forth as SEQ ID NO: 24, the nucleic acid sequence being in particular selected from the group consisting of SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID
NO: 22 and SEQ ID NO: 23.
Item 5: The lentiviral vector according to any one of items 1 to 4, wherein the nucleic acid sequence encoding the non-oncogenic Human papillomavirus (HPV18) protein E7 antigen encodes an amino acid sequence having at least 83% sequence identity with the amino acid sequence set forth as SEQ ID NO: 33, the nucleic acid sequence being in particular selected from the group consisting of SEQ ID NO: 30, SEQ ID NO: 31 and SEQ ID
NO: 32.
Item 6: The lentiviral vector according to any one of items 1 to 5, wherein the at
5 least four distinct nucleic acid sequences encoding antigens are fused together, forming a single antigenic nucleic acid sequence encoding a single antigenic fusion protein under the control of a single promoter sequence.
Item 7: The lentiviral vector according to any one of items 1 to 6, wherein the order of the at least four distinct nucleic acid sequences, from 5' end to 3' end, is selected from the group consisting of:
(a) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen;
(b) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen;
(c) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen; and (d) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen - nucleic acid sequence encoding a non-.. oncogenic Human papillomavirus (HPV16) protein E6 antigen.
Item 8: The lentiviral vector according to any one of items 1 to 7, wherein the order of the at least four distinct nucleic acid sequences, from 5' end to 3' end, is (a) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen
Item 7: The lentiviral vector according to any one of items 1 to 6, wherein the order of the at least four distinct nucleic acid sequences, from 5' end to 3' end, is selected from the group consisting of:
(a) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen;
(b) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen;
(c) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen; and (d) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen - nucleic acid sequence encoding a non-.. oncogenic Human papillomavirus (HPV16) protein E6 antigen.
Item 8: The lentiviral vector according to any one of items 1 to 7, wherein the order of the at least four distinct nucleic acid sequences, from 5' end to 3' end, is (a) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen
6 - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen.
Item 9: The lentiviral vector according to any one of items 1 to 8, comprising a nucleic acid sequence which encodes an amino acid sequence having at least 90%
sequence identity with the amino acid sequence set forth as SEQ ID NO: 42, the nucleic acid sequence being in particular the nucleic acid sequence SEQ ID NO: 41.
Item 10: The lentiviral vector according to any one of items 1 to 9, being selected from the group consisting of the non-integrative lentiviral vectors filed at the CNCM
under accession numbers 1-5759, 1-5760, 1-5761 and 1-5762, and is in particular the non-integrative lentiviral vector filed at the CNCM under accession number 1-5759.
Item 11: The lentiviral vector according to any one of items 1 to 10, wherein the lentiviral vector comprises a MHC Class I promoter, and in particular a 02-microglobulin promoter.
Item 12: The lentiviral vector according to any one of items 1 to 11, wherein the lentiviral vector comprises a cPPT/CTS sequence, in particular the cPPT/CTS
sequence set forth as sequence SEQ ID NO: 37.
Item 13: The lentiviral vector according to any one of items 1 to 12, wherein the lentiviral vector comprises a 3' long terminal repeat (LTR) which is devoid of its U3 promoter sequence.
Item 14: The lentiviral vector according to any one of items 1 to 13, wherein the lentiviral vector does not comprise a constitutive enhancer sequence.
Item 15: The non-integrative lentiviral vector according to any one of items 1 to 14, wherein the lentiviral vector comprises a mutant form of the woodchuck hepatitis B virus (WHV) post-transcriptional regulatory element (WPRE), and in particular having the sequence set forth as sequence SEQ ID NO: 38.
Item 16: A lentiviral vector particle, in particular a non-integrative lentiviral vector particle, comprising at least one lentiviral vector as defined in any one of items 1 to 15.
Item 17: The lentiviral vector particle according to item 16, wherein the lentiviral vector particle comprises a functional lentiviral integrase protein.
Item 9: The lentiviral vector according to any one of items 1 to 8, comprising a nucleic acid sequence which encodes an amino acid sequence having at least 90%
sequence identity with the amino acid sequence set forth as SEQ ID NO: 42, the nucleic acid sequence being in particular the nucleic acid sequence SEQ ID NO: 41.
Item 10: The lentiviral vector according to any one of items 1 to 9, being selected from the group consisting of the non-integrative lentiviral vectors filed at the CNCM
under accession numbers 1-5759, 1-5760, 1-5761 and 1-5762, and is in particular the non-integrative lentiviral vector filed at the CNCM under accession number 1-5759.
Item 11: The lentiviral vector according to any one of items 1 to 10, wherein the lentiviral vector comprises a MHC Class I promoter, and in particular a 02-microglobulin promoter.
Item 12: The lentiviral vector according to any one of items 1 to 11, wherein the lentiviral vector comprises a cPPT/CTS sequence, in particular the cPPT/CTS
sequence set forth as sequence SEQ ID NO: 37.
Item 13: The lentiviral vector according to any one of items 1 to 12, wherein the lentiviral vector comprises a 3' long terminal repeat (LTR) which is devoid of its U3 promoter sequence.
Item 14: The lentiviral vector according to any one of items 1 to 13, wherein the lentiviral vector does not comprise a constitutive enhancer sequence.
Item 15: The non-integrative lentiviral vector according to any one of items 1 to 14, wherein the lentiviral vector comprises a mutant form of the woodchuck hepatitis B virus (WHV) post-transcriptional regulatory element (WPRE), and in particular having the sequence set forth as sequence SEQ ID NO: 38.
Item 16: A lentiviral vector particle, in particular a non-integrative lentiviral vector particle, comprising at least one lentiviral vector as defined in any one of items 1 to 15.
Item 17: The lentiviral vector particle according to item 16, wherein the lentiviral vector particle comprises a functional lentiviral integrase protein.
7 Item 18: The lentiviral vector particle according to item 16 or 17, wherein the lentiviral vector particle comprises a vesicular stomatitis virus glycoprotein (VSVG), in particular a VSV-G Indiana serotype or a VSV-G New Jersey serotype.
Item 19: The lentiviral vector particle according to any one of items 16 to 18, wherein the lentiviral vector particle comprises HIV-1 subtype D Gag and Pol proteins.
Item 20: An isolated cell comprising the lentiviral vector according to any one of items 1 to 14 or the lentiviral vector particle according to any of items 16 to 19.
Item 21: A vaccine composition comprising a lentiviral vector according to any one of items 1 to 14, a lentiviral vector particle according to any one of items 16 to 19, or a cell according to item 19.
Item 22: The vaccine composition according to item 21, for use in the treatment or prevention of an HPV induced cancer, in particular selected from the group consisting of cervical cancer, vaginal cancer, vulvar cancer, penile cancer, anal cancer, oropharyngeal cancer, and metastases thereof, in particular pulmonary metastasis thereof.
Item 23: A lentiviral vector according to any one of items 1 to 15, a lentiviral vector particle according to any one of items 16 to 19, or a cell according to item 20, for use as a medicament or vaccine.
Item 24: The lentiviral vector, lentiviral vector particle or cell, according to item 23, for use in the treatment or prevention of an HPV induced cancer, in particular selected from the group consisting of cervical cancer, vaginal cancer, vulvar cancer, penile cancer, anal cancer, oropharyngeal cancer, and metastases thereof, in particular pulmonary metastasis thereof.
Item 25: The vaccine composition for use according to item 22, or the lentiviral vector, lentiviral vector particle or cell for use according to item 23 or 24, wherein said vaccine composition, lentiviral vector, lentiviral vector particle or cell is administered in combination with at least one immune checkpoint inhibitor, in particular at least one monoclonal antibody selected from the group consisting of anti-PD-1, anti-PD-L1, anti-CTLA-4, anti-NKG2A, anti-TIM-3, anti-TIGIT and anti-LAG-3 monoclonal antibodies and more particularly with at least one anti-PD-1 monoclonal antibody.
Item 26: The vaccine composition, lentiviral vector, lentiviral vector particle or cell for use according to item 25, wherein the at least one immune checkpoint inhibitor is administered simultaneously or separately, and in particular the at least one immune checkpoint inhibitor is administered at least 2, and in particular at least 4 days after the
Item 19: The lentiviral vector particle according to any one of items 16 to 18, wherein the lentiviral vector particle comprises HIV-1 subtype D Gag and Pol proteins.
Item 20: An isolated cell comprising the lentiviral vector according to any one of items 1 to 14 or the lentiviral vector particle according to any of items 16 to 19.
Item 21: A vaccine composition comprising a lentiviral vector according to any one of items 1 to 14, a lentiviral vector particle according to any one of items 16 to 19, or a cell according to item 19.
Item 22: The vaccine composition according to item 21, for use in the treatment or prevention of an HPV induced cancer, in particular selected from the group consisting of cervical cancer, vaginal cancer, vulvar cancer, penile cancer, anal cancer, oropharyngeal cancer, and metastases thereof, in particular pulmonary metastasis thereof.
Item 23: A lentiviral vector according to any one of items 1 to 15, a lentiviral vector particle according to any one of items 16 to 19, or a cell according to item 20, for use as a medicament or vaccine.
Item 24: The lentiviral vector, lentiviral vector particle or cell, according to item 23, for use in the treatment or prevention of an HPV induced cancer, in particular selected from the group consisting of cervical cancer, vaginal cancer, vulvar cancer, penile cancer, anal cancer, oropharyngeal cancer, and metastases thereof, in particular pulmonary metastasis thereof.
Item 25: The vaccine composition for use according to item 22, or the lentiviral vector, lentiviral vector particle or cell for use according to item 23 or 24, wherein said vaccine composition, lentiviral vector, lentiviral vector particle or cell is administered in combination with at least one immune checkpoint inhibitor, in particular at least one monoclonal antibody selected from the group consisting of anti-PD-1, anti-PD-L1, anti-CTLA-4, anti-NKG2A, anti-TIM-3, anti-TIGIT and anti-LAG-3 monoclonal antibodies and more particularly with at least one anti-PD-1 monoclonal antibody.
Item 26: The vaccine composition, lentiviral vector, lentiviral vector particle or cell for use according to item 25, wherein the at least one immune checkpoint inhibitor is administered simultaneously or separately, and in particular the at least one immune checkpoint inhibitor is administered at least 2, and in particular at least 4 days after the
8 administration of the said vaccine composition, lentiviral vector, lentiviral vector particle or cell.
The details, examples and preferences provided in relation to any particular one or more of the stated aspects of the present invention will be further described herein and apply equally to all aspects of the present invention. Any combination of the embodiments, examples and preferences described herein in all possible variations thereof is encompassed by the present invention unless otherwise indicated herein, or otherwise clearly contradicted by context.
BRIEF DESCRIPTION OF THE FIGURES
Figure 1 demonstrates that HPV vaccines of the invention are immunogenic in vivo. Mice were injected i.m. with lx107TU of lentiviral vector particles comprising the lentiviral vector filed at the CNCM under accession number 1-5759, the lentiviral vector filed at the CNCM
under accession number 1-5760, the lentiviral vector filed at the CNCM under accession number 1-5761 or the lentiviral vector filed at the CNCM under accession number 1-5762 or 50 L of diluent. 14 days later, splenocytes were prepared and restimulated overnight for IFNg ELISPOT with 4 distinct peptide pools.
Abscissa: from left to right: results obtained with the lentiviral vector filed at the CNCM
under accession number 1-5759, the lentiviral vector filed at the CNCM under accession number 1-5760, the lentiviral vector filed at the CNCM under accession number 1-5761, the lentiviral vector filed at the CNCM under accession number 1-5762 or with 50 1_, of diluent (control).
Ordinate: Spot Forming Cells (SFC)/106 cells.
Figure 2 shows that invention vaccine fully eliminates well implanted tumors in vivo. TC-1 cells were injected s.c. and tumor volume was measured every other day (caliper measurement). When average tumor volume is 70 mm3, mice were randomized and vaccinated with 1x108 TU i.m. of LV-GFP Indiana (as a control), Indiana lentiviral vector particles comprising 1-5759, Indiana lentiviral vector particles comprising 1-5760, Indiana
The details, examples and preferences provided in relation to any particular one or more of the stated aspects of the present invention will be further described herein and apply equally to all aspects of the present invention. Any combination of the embodiments, examples and preferences described herein in all possible variations thereof is encompassed by the present invention unless otherwise indicated herein, or otherwise clearly contradicted by context.
BRIEF DESCRIPTION OF THE FIGURES
Figure 1 demonstrates that HPV vaccines of the invention are immunogenic in vivo. Mice were injected i.m. with lx107TU of lentiviral vector particles comprising the lentiviral vector filed at the CNCM under accession number 1-5759, the lentiviral vector filed at the CNCM
under accession number 1-5760, the lentiviral vector filed at the CNCM under accession number 1-5761 or the lentiviral vector filed at the CNCM under accession number 1-5762 or 50 L of diluent. 14 days later, splenocytes were prepared and restimulated overnight for IFNg ELISPOT with 4 distinct peptide pools.
Abscissa: from left to right: results obtained with the lentiviral vector filed at the CNCM
under accession number 1-5759, the lentiviral vector filed at the CNCM under accession number 1-5760, the lentiviral vector filed at the CNCM under accession number 1-5761, the lentiviral vector filed at the CNCM under accession number 1-5762 or with 50 1_, of diluent (control).
Ordinate: Spot Forming Cells (SFC)/106 cells.
Figure 2 shows that invention vaccine fully eliminates well implanted tumors in vivo. TC-1 cells were injected s.c. and tumor volume was measured every other day (caliper measurement). When average tumor volume is 70 mm3, mice were randomized and vaccinated with 1x108 TU i.m. of LV-GFP Indiana (as a control), Indiana lentiviral vector particles comprising 1-5759, Indiana lentiviral vector particles comprising 1-5760, Indiana
9 lentiviral vector particles comprising 1-5761 or Indiana lentiviral vector particles comprising 1-5762.
Abscissa: Days.
Ordinate: Tumor volume (mm3).
Figure 3 illustrates the ability of lentiviral vector according to the invention expressing design 1-5759, 1-5760, 1-5761, 1-5762, or diluent as control, to generate a long lasting immunity to prevent relapses. Mice which eliminated primary tumor were rechallenged on the other flank at day 60. Control mice (untreated) were also injected s.c. in order to check on the tumor cell growth in naive mice.
Abscissa: Days.
Ordinate: Tumor volume (mm3).
Figure 4 represents a dose/response in mouse. lx106 TC-1 cells were injected in the flank of animals and tumor volume was measured twice a week (caliper measurement). When average tumor volume was 80mm3, mice were randomized and vaccinated with diluent (control), 1x107 TU of 1-5759 vaccine or 1x108 TU (i.m.) of 1-5759 vaccine.
Abscissa: Days.
Ordinate: Tumor volume (mm3).
Figure 5 represents lymphocytic tumor infiltration after vaccination with a lentiviral vector according to the invention. lx106 TC1 tumor cells were injected (s.c.) on the flank of animal, and the tumor volume was measured twice a week (caliper measurement). When average tumor volume was 80mm3, mice were randomized and vaccinated with either diluent (control), or 1x107TU of 1-5759 vaccine or 1x108TU (i.m.) of 1-5759 vaccine.
Ten days after vaccination, tumors were collected, digested and analyzed by flow cytometry.
FACS staining was performed and data were acquired on Macsquant facs according to methods well known in the art.
Abscissa: from left to right: diluent (control); 1x108 TU of 1-5759 vaccine.
Ordinate: Top left Figure: % CD8+ T cells (within live cells); Top right Figure: % CD4+ T
cells (within live cells); Bottom Figure: % Treg cells (within live cells).
Figure 6 represents the ability of vectors according to the invention to eliminate well-established large tumors. 1x106 TC1 cells were injected (s.c.) on the flank of animal. When 5 average tumor volume was around 300 mm3, mice were randomized and vaccinated with diluent (control), or 1x108 TU (i.m.) of the vaccine according to the invention comprising lentiviral vector particles comprising the lentiviral vector filed at the CNCM
under accession number 1-5759.
Abscissa: Days.
Abscissa: Days.
Ordinate: Tumor volume (mm3).
Figure 3 illustrates the ability of lentiviral vector according to the invention expressing design 1-5759, 1-5760, 1-5761, 1-5762, or diluent as control, to generate a long lasting immunity to prevent relapses. Mice which eliminated primary tumor were rechallenged on the other flank at day 60. Control mice (untreated) were also injected s.c. in order to check on the tumor cell growth in naive mice.
Abscissa: Days.
Ordinate: Tumor volume (mm3).
Figure 4 represents a dose/response in mouse. lx106 TC-1 cells were injected in the flank of animals and tumor volume was measured twice a week (caliper measurement). When average tumor volume was 80mm3, mice were randomized and vaccinated with diluent (control), 1x107 TU of 1-5759 vaccine or 1x108 TU (i.m.) of 1-5759 vaccine.
Abscissa: Days.
Ordinate: Tumor volume (mm3).
Figure 5 represents lymphocytic tumor infiltration after vaccination with a lentiviral vector according to the invention. lx106 TC1 tumor cells were injected (s.c.) on the flank of animal, and the tumor volume was measured twice a week (caliper measurement). When average tumor volume was 80mm3, mice were randomized and vaccinated with either diluent (control), or 1x107TU of 1-5759 vaccine or 1x108TU (i.m.) of 1-5759 vaccine.
Ten days after vaccination, tumors were collected, digested and analyzed by flow cytometry.
FACS staining was performed and data were acquired on Macsquant facs according to methods well known in the art.
Abscissa: from left to right: diluent (control); 1x108 TU of 1-5759 vaccine.
Ordinate: Top left Figure: % CD8+ T cells (within live cells); Top right Figure: % CD4+ T
cells (within live cells); Bottom Figure: % Treg cells (within live cells).
Figure 6 represents the ability of vectors according to the invention to eliminate well-established large tumors. 1x106 TC1 cells were injected (s.c.) on the flank of animal. When 5 average tumor volume was around 300 mm3, mice were randomized and vaccinated with diluent (control), or 1x108 TU (i.m.) of the vaccine according to the invention comprising lentiviral vector particles comprising the lentiviral vector filed at the CNCM
under accession number 1-5759.
Abscissa: Days.
10 Ordinate: Tumor volume (mm3).
Figure 7 depicts T cell response in human PBMC labelled with CFSE and cultured in absence (unstimulated condition) or presence of a vaccine according to the invention (1-5759). Cell proliferation and activation were measured after 2 weeks of culture (n=3).
CD8+ T cells and CD4+ T cells proliferation (measured by CFSE dilution) (A) and expression of activation marker (B) were increased by addition of lentiviral vectors of the invention in the culture.
Abscissa: from left to right: Unstimulated (Unstim - control); 1-5759 vaccine.
Ordinate: (A) Left Figure: % of CFSElow in CD8+ population; Right Figure: % of CFSElow in CD4+ population. (B) Left Figure: % of CD25+ in CD4+ population; Right Figure: % of CD25+ in CD8+ population.
Figures 8A to 8D depicts four examples of antigen constructs of lentiviral vectors according to the invention. Each of these antigen constructs consists in the four following sequences in various orders: a nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen and a nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen.
Figure 8A
represents the antigen construct of the lentiviral vector filed at the CNCM
under accession number 1-5759. Figure 8B represents the antigen construct of the lentiviral vector filed at the CNCM under accession number 1-5760. Figure 8C represents the antigen construct of the
Figure 7 depicts T cell response in human PBMC labelled with CFSE and cultured in absence (unstimulated condition) or presence of a vaccine according to the invention (1-5759). Cell proliferation and activation were measured after 2 weeks of culture (n=3).
CD8+ T cells and CD4+ T cells proliferation (measured by CFSE dilution) (A) and expression of activation marker (B) were increased by addition of lentiviral vectors of the invention in the culture.
Abscissa: from left to right: Unstimulated (Unstim - control); 1-5759 vaccine.
Ordinate: (A) Left Figure: % of CFSElow in CD8+ population; Right Figure: % of CFSElow in CD4+ population. (B) Left Figure: % of CD25+ in CD4+ population; Right Figure: % of CD25+ in CD8+ population.
Figures 8A to 8D depicts four examples of antigen constructs of lentiviral vectors according to the invention. Each of these antigen constructs consists in the four following sequences in various orders: a nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen and a nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen.
Figure 8A
represents the antigen construct of the lentiviral vector filed at the CNCM
under accession number 1-5759. Figure 8B represents the antigen construct of the lentiviral vector filed at the CNCM under accession number 1-5760. Figure 8C represents the antigen construct of the
11 lentiviral vector filed at the CNCM under accession number 1-5761 and Figure 8D represents the antigen construct of the lentiviral vector filed at the CNCM under accession number I-5762.
Figures 9A and 9B depict T-cell cytokine responses of splenocytes analyzed by Intracellular Cytokine Staining (ICS), with or without stimulation with a mixture of ETTDPDRAHYNIVTF (SEQ ID NO: 39) and PDRAHYNIVTFCCKC (SEQ ID NO: 40) synthetic peptides, both containing the RAHYNIVTF H-2Db-restficted T-cell epitope (bold characters represent H-2Db anchor residues) (SEQ ID NO: 49), the splenocytes being obtained 14 days post-vaccination of C57BL/6 mice (n = 5/group) through i.m.
immunization with a Ctrl Lenti (LV-GFP Indiana) or with a vaccine according to the invention comprising lentiviral vector particles comprising the lentiviral vector filed at the CNCM
under accession number 1-5759. Figure 9A in particular represents the cytometric gating strategy carried out on cytokine-producing CD8+ T cells and degranulation activity of the IFN-y-producing CD8+
T cells, assessed by surface CD107a staining. Figure 9B represents the recapitulative frequencies of each (poly)functional cell subsets and of IFN-y+ CD107a+ cells within the CDS+ T subset.
Figure 10 depicts cytometric analysis of tumor infiltrating innate immune cells (NK) of tumor-engrafted and vaccinated with a HPV-vaccine according to the invention (1-5759), or of tumor-engrafted and non vaccinated mice (control ¨ Ctrl Lenti). CD1 lb and NKp46 were detected.
Figure 11 represents the ability of vectors according to the invention to eliminate well-established large tumors. A rechallenge of cured mice which eliminated the primary tumor (right panel) was performed on the other flank with 1.106 TC-1 tumor cells 119 days after the first engraftment and were maintained without any therapy. Control mice (untreated ¨ control aged-mice ¨ left panel) were also injected s.c. in order to check on the tumor cell growth.
Abscissa: Days after tumor rechallenge.
Ordinate: Tumor volume (mm3).
Figures 12A and 12B illustrate the synergy between a vaccination with a suboptimal dose of a vaccine according to the invention (1-5759) and an anti-PD-1 therapy (monoclonal antibody anti-PD-1).
RECTIFIED SHEET (RULE 91) ISA/EP
Figures 9A and 9B depict T-cell cytokine responses of splenocytes analyzed by Intracellular Cytokine Staining (ICS), with or without stimulation with a mixture of ETTDPDRAHYNIVTF (SEQ ID NO: 39) and PDRAHYNIVTFCCKC (SEQ ID NO: 40) synthetic peptides, both containing the RAHYNIVTF H-2Db-restficted T-cell epitope (bold characters represent H-2Db anchor residues) (SEQ ID NO: 49), the splenocytes being obtained 14 days post-vaccination of C57BL/6 mice (n = 5/group) through i.m.
immunization with a Ctrl Lenti (LV-GFP Indiana) or with a vaccine according to the invention comprising lentiviral vector particles comprising the lentiviral vector filed at the CNCM
under accession number 1-5759. Figure 9A in particular represents the cytometric gating strategy carried out on cytokine-producing CD8+ T cells and degranulation activity of the IFN-y-producing CD8+
T cells, assessed by surface CD107a staining. Figure 9B represents the recapitulative frequencies of each (poly)functional cell subsets and of IFN-y+ CD107a+ cells within the CDS+ T subset.
Figure 10 depicts cytometric analysis of tumor infiltrating innate immune cells (NK) of tumor-engrafted and vaccinated with a HPV-vaccine according to the invention (1-5759), or of tumor-engrafted and non vaccinated mice (control ¨ Ctrl Lenti). CD1 lb and NKp46 were detected.
Figure 11 represents the ability of vectors according to the invention to eliminate well-established large tumors. A rechallenge of cured mice which eliminated the primary tumor (right panel) was performed on the other flank with 1.106 TC-1 tumor cells 119 days after the first engraftment and were maintained without any therapy. Control mice (untreated ¨ control aged-mice ¨ left panel) were also injected s.c. in order to check on the tumor cell growth.
Abscissa: Days after tumor rechallenge.
Ordinate: Tumor volume (mm3).
Figures 12A and 12B illustrate the synergy between a vaccination with a suboptimal dose of a vaccine according to the invention (1-5759) and an anti-PD-1 therapy (monoclonal antibody anti-PD-1).
RECTIFIED SHEET (RULE 91) ISA/EP
12 Figure 12A represents the evolution of tumor volumes (mm3 ¨ordinate) over days post tumor engraftement in mice (DO) (abscissa). Experiments were performed on three identical groups of tumor-engrafted mice. In the first group (10 mice - group control - left panel of Figure 12A), the mice were administered a LV-empty Indiana (D13) (as a control) (day indicated by .. an arrow) and four days later with an anti-PD-1 (Programmed cell Death protein-1) monoclonal antibody (D17, then D20, D22, D24, D28 and D31). In the second group (12 mice - group control ¨ middle panel of Figure 12A), the mice were administered a vaccine according to the invention (1-5759) (D13) (day indicated by an arrow) and four days later with a control antibody (isotype ctrl) (D17, then D20, D22, D24, D28 and D31). In the third group (14 mice - left panel of Figure 12A), the mice were administered a vaccine according to the invention (D13) (1-5759) (day indicated by an arrow) and four days later with a mAb anti-PD-1 (D17, then D20, D22, D24, D28 and D31).
Figure 12B represents the survival (% of mice ¨ ordinate) of the mice of each group (group control 1 : Ctrl Lenti + anti-PD-1; group control 2 : 1-5759 + ctrl Ig; group 3: 1-5759 + anti-PD-1) over time (days ¨ abscissa).
Figures 13A and 13B represent the cure of mice with pulmonary metastatic foci induced by intravenous injection of TC1-nLuc cells after a single infection of Lenti-HPV-07 vaccine.
Figure 13A represents the variation of luminescence values expressed as photons per second (p/s) (ordinate ¨ Total Flux) due to nanoluciferase stably expressed by TC1-nLuc cells .. injected to different groups of mice overtime (abscissa ¨ days) after i.v.
injection of said cells to said mice. 3 groups of mice were tested : a negative control group with mice not being injected with TC1-nLuc cells 1 ____ (n=11) (Neg Ctrl), a control group with mice injected with TC1-nLuc cells and at day 5 with a Control Lenti (LV-empty Indiana) ¨
1.109 TU (n=11) (TC1 + Ctrl Lenti) ¨11,¨ and a group with mice injected with TC1-nLuc cells and at day 5 with a vaccine according to the invention (Lenti-HPV-07 (1-5759)) ¨ 1.109 TU
(n=11) (TC1 +Lenti-HPV-07) --0¨.
Figure 13B represents the individual p/s values, for individual mice of the three experimental groups detailed above, at day 22 post tumor injection. Ordinate: luminescence values expressed as photons per second (p/s) (Total Flux). Abscissa, from left to right: group Neg Ctrl, group Ctrl Lenti then group Lenti-HPV-07.
Figure 12B represents the survival (% of mice ¨ ordinate) of the mice of each group (group control 1 : Ctrl Lenti + anti-PD-1; group control 2 : 1-5759 + ctrl Ig; group 3: 1-5759 + anti-PD-1) over time (days ¨ abscissa).
Figures 13A and 13B represent the cure of mice with pulmonary metastatic foci induced by intravenous injection of TC1-nLuc cells after a single infection of Lenti-HPV-07 vaccine.
Figure 13A represents the variation of luminescence values expressed as photons per second (p/s) (ordinate ¨ Total Flux) due to nanoluciferase stably expressed by TC1-nLuc cells .. injected to different groups of mice overtime (abscissa ¨ days) after i.v.
injection of said cells to said mice. 3 groups of mice were tested : a negative control group with mice not being injected with TC1-nLuc cells 1 ____ (n=11) (Neg Ctrl), a control group with mice injected with TC1-nLuc cells and at day 5 with a Control Lenti (LV-empty Indiana) ¨
1.109 TU (n=11) (TC1 + Ctrl Lenti) ¨11,¨ and a group with mice injected with TC1-nLuc cells and at day 5 with a vaccine according to the invention (Lenti-HPV-07 (1-5759)) ¨ 1.109 TU
(n=11) (TC1 +Lenti-HPV-07) --0¨.
Figure 13B represents the individual p/s values, for individual mice of the three experimental groups detailed above, at day 22 post tumor injection. Ordinate: luminescence values expressed as photons per second (p/s) (Total Flux). Abscissa, from left to right: group Neg Ctrl, group Ctrl Lenti then group Lenti-HPV-07.
13 SUMMARY OF THE SEQUENCES
SEQ ID NO: 1 is a nucleic acid sequence encoding the E6 protein from HPV 16 SEQ ID NO: 2 is a nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 16 SEQ ID NO: 3 is a nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 16 SE() ID NO: 4 is a nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 16 SEQ ID NO: 5 is a nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 16 SEQ ID NO: 6 is a nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 16 SEQ ID NO: 7 is the amino acid sequence of the E6 protein from HPV 16 SEQ ID NO: 8 is an amino acid sequence of a non-oncogenic variant of the E6 protein from SEQ ID NO: 9 is an amino acid sequence of a non-oncogenic variant of the E6 protein from SEQ ID NO: 10 is an amino acid sequence of a non-oncogenic variant of the E6 protein from SEQ ID NO: 11 is an amino acid sequence of a non-oncogenic variant of the E6 protein from SEQ ID NO: 12 is an amino acid sequence of a non-oncogenic variant of the E6 protein from SE() ID NO: 13 is a nucleic acid sequence encoding the E7 protein from HPV 16 SEQ ID NO: 14 is a nucleic acid sequence encoding a non-oncogenic variant of the E7 protein from HPV 16 SEQ ID NO: 15 is a nucleic acid sequence encoding a non-oncogenic variant of the E7 protein from HPV 16 SEQ ID NO: 16 is the amino acid sequence of the E7 protein from HPV 16 SEQ ID NO: 17 is an amino acid sequence of a non-oncogenic variant of the E7 protein from
SEQ ID NO: 1 is a nucleic acid sequence encoding the E6 protein from HPV 16 SEQ ID NO: 2 is a nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 16 SEQ ID NO: 3 is a nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 16 SE() ID NO: 4 is a nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 16 SEQ ID NO: 5 is a nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 16 SEQ ID NO: 6 is a nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 16 SEQ ID NO: 7 is the amino acid sequence of the E6 protein from HPV 16 SEQ ID NO: 8 is an amino acid sequence of a non-oncogenic variant of the E6 protein from SEQ ID NO: 9 is an amino acid sequence of a non-oncogenic variant of the E6 protein from SEQ ID NO: 10 is an amino acid sequence of a non-oncogenic variant of the E6 protein from SEQ ID NO: 11 is an amino acid sequence of a non-oncogenic variant of the E6 protein from SEQ ID NO: 12 is an amino acid sequence of a non-oncogenic variant of the E6 protein from SE() ID NO: 13 is a nucleic acid sequence encoding the E7 protein from HPV 16 SEQ ID NO: 14 is a nucleic acid sequence encoding a non-oncogenic variant of the E7 protein from HPV 16 SEQ ID NO: 15 is a nucleic acid sequence encoding a non-oncogenic variant of the E7 protein from HPV 16 SEQ ID NO: 16 is the amino acid sequence of the E7 protein from HPV 16 SEQ ID NO: 17 is an amino acid sequence of a non-oncogenic variant of the E7 protein from
14 SEO ID NO: 18 is an amino acid sequence of a non-oncogenic variant of the E7 protein from SEO ID NO: 19 is a nucleic acid sequence encoding the E6 protein from HPV 18 SEO ID NO: 20 is a nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 18 SEO ID NO: 21 is a nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 18 SEO ID NO: 22 is a nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 18 SEO ID NO: 23 is a nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 18 SEO ID NO: 24 is the amino acid sequence of the E6 protein from HPV 18 SEO ID NO: 25 is an amino acid sequence of a non-oncogenic variant of the E6 protein from SEO ID NO: 26 is an amino acid sequence of a non-oncogenic variant of the E6 protein from SEO ID NO: 27 is an amino acid sequence of a non-oncogenic variant of the E6 protein from SEO ID NO: 28 is an amino acid sequence of a non-oncogenic variant of the E6 protein from SEO ID NO: 29 is a nucleic acid sequence encoding the E7 protein from HPV 18 SEO ID NO: 30 is a nucleic acid sequence encoding a non-oncogenic variant of the E7 protein from HPV 18 SEO ID NO: 31 is a nucleic acid sequence encoding a non-oncogenic variant of the E7 protein from HPV 18 SEO ID NO: 32 is a nucleic acid sequence encoding a non-oncogenic variant of the E7 protein from HPV 18 SE() ID NO: 33 is the amino acid sequence of the E7 protein from HPV 18 SEO ID NO: 34 is an amino acid sequence of a non-oncogenic variant of the E7 protein from SEO ID NO: 35 is an amino acid sequence of a non-oncogenic variant of the E7 protein from SEO ID NO: 36 is an amino acid sequence of a non-oncogenic variant of the E7 protein from SEO ID NO: 37 is a nucleic acid sequence encoding the cPPT/CTS sequence SEO ID NO: 38 is the nucleic acid sequence encoding a mutant form of the woodchuck 5 hepatitis B virus (WHV) post-transcriptional regulatory element (WPRE) SEO ID NO: 39 is a synthetic E7HPvio-derived peptide containing the RAHYNIVTF
H-2Db-restricted T-cell epitope SEO ID NO: 40 is a synthetic E7HPvt6-derived peptide containing the RAHYNIVTF
H-2Db-restricted T-cell epitope DETAILED DESCRIPTION OF THE INVENTION
The inventors have discovered that the administration of a lentiviral vector encoding at least four distinct human papillomavirus (HPV) antigens, and in particular at least 4 HPV antigens selected among proteins E6 and E7 of at least two different HPV
subtypes, and in particular of HPV16 and HPV18 subtypes, to an individual in need thereof results in a high prophylactic and therapeutic activity on HPV induced cancers.
Lentiviral vectors according to the invention can enable the induction of a strong, lasting and broad cell-mediated response against tumors induced by an HPV infection.
Lentiviral vectors according to the invention, as well as lenviral vector particules comprising them, isolated cells comprising said lentiviral vectors or lentiviral vector particles and vaccine compositions comprising them are described throughout the present specification.
Definitions All scientific and technical terms used in this application have meanings commonly used in the art unless otherwise specified.
As used herein, "transgene" means a polynucleotide that can be expressed, via recombinant techniques, in a non-native environment or heterologous cell under appropriate conditions.
As used herein, the temi "recombinant", when used in reference to a cell of the invention, indicates that the cell has been modified by the introduction of an endogenous and/or heterologous nucleic acid or protein into the cell or the alteration of a native cell or that the cell is derived from a cell so modified. Thus, for example, recombinant cells express genes or nucleic acid that are not found within the native (non-recombinant) form of the cell or express native (eg endogenous) genes at a different level than their native level or express additional or supplementary copies of native (eg endogenous) at a different level than their native level. An isolated cell according to the invention is recombinant in that it comprises at least one lentiviral vector according to the invention and/or at least one lentiviral vector particle according to the invention.
As used herein, the term "recombinant", when used in reference to a vector, are sequences formed/obtained by technics of genetic engineering well known to the man skilled in the art.
As used herein, the term "polypeptide" refers to a molecule comprising amino acid residues linked by peptide bonds and containing more than five amino acid residues. The amino acids are identified by either the single-letter or three-letter designations. The term "protein" as used herein is synonymous with the term "polypeptide" and may also refer to two or more polypeptides. Thus, the terms "protein", "peptide" and "polypeptide"
can be used interchangeably. Polypeptides may optionally be modified (e.g., glycosylated, phosphorylated, acylated, farnesylated, prenylated, sulfonated, and the like) to add functionality. Polypeptides exhibiting activity may be referred to as enzymes.
It will be understood that, as a result of the degeneracy of the genetic code, a multitude of nucleotide sequences encoding a given polypeptide may be produced.
The term "operably linked" as used herein refers to two or more nucleic acid .. sequence elements that are physically linked and are in a functional relationship with each other. For instance, in a lentiviral vector according to the invention, a promoter is operably linked to a coding sequence, also termed herein "antigen construct" as the promoter is able to initiate or regulate the transcription or expression of the antigen construct, in which case the antigen construct should be understood as being "under the control of" the promoter.
Generally, when two nucleic acid sequences are operably linked, they will be in the same orientation and usually also in the same reading frame. They usually will be essentially contiguous, although this may not be required.
The terms "encoding" or "coding for" refer to the process by which a polynucleotide, through the mechanisms of transcription and translation, produces an amino-acid sequence.
For each or the amino acid sequences of interest, reference sequences are described herein. The present description also encompasses amino acid sequences having specific percentages of amino acid identity with a reference amino acid sequence.
For obvious reasons, in all the present description, a specific nucleic acid sequence or a specific amino acid sequence which complies with, respectively, the considered nucleotide or amino acid identity, should further lead to obtaining a protein (or antigen) which displays the desired biological activity. As used herein, the "percentage of identity" between two nucleic acid sequences or between two amino acid sequences is determined by comparing both optimally aligned sequences through a comparison window.
The portion of the nucleotide or amino-acid sequence in the comparison window may thus include additions or deletions (for example "gaps") as compared to the reference sequence (which does not include these additions or these deletions) so as to obtain an optimal alignment between both sequences.
The terms "sequence homology" or "sequence identity" or "homology" or "identity" are used interchangeably herein. For the purpose of the invention, it is defined here that in order to determine the percentage of sequence homology or sequence identity of two amino acid sequences or of two nucleic acid sequences, the sequences are aligned for optimal comparison purposes. In order to optimize the alignment between the two sequences gaps may be introduced in any of the two sequences that are compared. Such alignment can be carried out over the full length of the sequences being compared.
Alternatively, the alignment may be carried out over a shorter length, for example over about 20, about 50, about 100 or more nucleic acids/based or amino acids. The sequence identity is the percentage of identical matches between the two sequences over the reported aligned region.
A comparison of sequences and determination of percentage of sequence identity between two sequences can be accomplished using a mathematical algorithm. The skilled person will be aware of the fact that several different computer programs are available to align two sequences and determine the identity between two sequences (Kruskal, J. B.
(1983) An overview of sequence comparison In D. Sankoff and J. B. Kruskal, (ed.), Time warps, string edits and macromolecules: the theory and practice of sequence comparison, pp.
1-44 Addison Wesley).
The percent sequence identity between two amino acid sequences or between two nucleotide sequences may be determined using the Needleman and Wunsch algorithm for the alignment of two sequences. (Needleman, S. B. and Wunsch, C. D. (1970) J.
Mol. Biol.
48, 443-453). Both amino acid sequences and nucleotide sequences can be aligned by the algorithm. The Needleman-Wunsch algorithm has been implemented in the computer program NEEDLE.
For the purpose of the invention, the NEEDLE program from the EMBOSS
package was used (version 2.8.0 or higher, EMBOSS: The European Molecular Biology Open Software Suite (2000) Rice, P. LongdenJ. and Bleasby,A. Trends in Genetics 16, (6) pp276 277, http://emboss.bioinformatics.n1/). For protein sequences EBLOSUM62 is used for the substitution matrix. For nucleotide sequence, EDNAFULL is used. The optional parameters used are a gap opening penalty of 10 and a gap extension penalty of 0.5. No end gap penalty is added. In the Output section, Yes has been indicated in response to the question "Brief identity and similarity" and "SRS pairwise" indicated as Output alignment format.
After alignment by the program NEEDLE as described above the percentage of sequence identity between a query sequence and a sequence of the invention is calculated as follows: Number of corresponding positions in the alignment showing an identical amino acid or identical nucleotide in both sequences divided by the total length of the alignment after subtraction of the total number of gaps in the alignment. The identity defined as herein can be obtained from NEEDLE by using the NOBRIEF option and is labeled in the output of the program as "longest-identity".
The similarity of nucleotide and amino acid sequences, i.e. the percentage of sequence identity, can be determined via sequence alignments using several other art-known algorithms, preferably with the mathematical algorithm of Karlin and Altschul (Karlin &
Altschul (1993) Proc. Natl. Acad. Sci. USA 90: 5873-5877), with hmmalign (HMMER
package, http://hmmer.wustl.edu/) or with the CLUSTAL algorithm (Thompson, J.
D., Higgins, D. G. & Gibson, T. J. (1994) Nucleic Acids Res. 22, 4673-80) available e.g. on https://www.ebi.ac.uk/Tools/msa/clustalo/ or the GAP program (mathematical algorithm of the University of Iowa) or the mathematical algorithm of Myers and Miller (1989 - Cabios 4:
11-17) or Clone Manager 9. Preferred parameters used are the default parameters as they are set on https://www.ebi.ac.uk/Tools/msa/clustalo/.
The grade of sequence identity (sequence matching) may be calculated using e.g.
BLAST, BLAT or BlastZ (or BlastX). A similar algorithm is incorporated into the BLASTN
and BLASTP programs of Altschul et al (1990) J. Mol. Biol. 215, 403-410. BLAST
polynucleotide searches are performed with the BLASTN program, score = 100, word length = 12, to obtain polynucleotide sequences that are homologous to those nucleic acids which encode the relevant protein.
BLAST protein searches are performed with the BLASTP program, score = 50, word length = 3, to obtain amino acid sequences homologous to the SHC
polypeptide. To obtain gapped alignments for comparative purposes, Gapped BLAST is utilized as described in Altschul et al (1997) Nucleic Acids Res. 25, 3389-3402. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs are used.
Sequence matching analysis may be supplemented by established homology mapping techniques like Shuffle-LAGAN (Brudno M., Bioinformatics 2003b, 19 Suppl 1:
154-162) or Markov random fields. When percentages of sequence identity are referred to in the present application, these percentages are calculated in relation to the full length of the longer sequence, if not specifically indicated otherwise.
In particular embodiments, % identity between two sequences is determined using CLUSTAL 0 (version 1.2.4).
The terms non-oncogenic used herein are used in their traditional meaning, i.e. it relates to an element, in the present case to antigens, unable to cause the foimation of tumors.
As detailed elsewhere, antigens implemented in the present invention have been genetically amended in order to become nononcogenic. It means, according to the usual meaning of these terms, that the nucleic acid sequences encoding the antigens implemented herein are not found in nature and are modified either by introduction or by deletion or by modification of their nucleic acid sequences, leading to encoded amino acid sequences that also do not naturally exist in nature.
The man skilled in the art has known for a long time a variety of means to perform a deletion, substitution or introduction in a nucleic acid sequence.
As will be understood by those of skill in the art, it can moreover be advantageous to modify a coding sequence to enhance its expression in a particular host.
The genetic code is redundant with 64 possible codons, but most organisms typically use a subset of these codons.
The codons that are utilized most often in a species are called optimal codons, and those not utilized very often are classified as rare or low-usage codons. Codons can be substituted to reflect the preferred codon usage of the host, in a process sometimes called "codon optimization" or "controlling for species codon bias." Codon optimization for other host cells can be readily determined using codon usage tables or can be performed using commercially available software, such as CodonOp (www.idtdna.com/CodonOptfrom) from Integrated DNA Technologies. Optimized coding sequences containing codons preferred by a particular prokaryotic or eukaryotic host (Murray et al, 1989 , Nucl Acids Res . 17: 477-508) can be prepared, for example, to increase the rate of translation or to produce recombinant RNA
transcripts having desirable properties, such as a longer half-life, as compared with transcripts produced from a non-optimized sequence. Translation stop codons can also be modified to reflect host preference. For example, typical stop codon for monocotyledonous plants is 5 UGA, whereas insects and E. coli commonly use UAA as the stop codon (Dalphin et al, 1996, Nucl Acids Res. 24: 216-8).
A "non-integrative" lentiviral vector means that, when this lentiviral vector is in a cell, it does not integrate into the host cell genome. A non-integrative lentiviral vector particle relates to a lentiviral vector particle that comprises a non-integrative lentiviral vector. It can 10 also be termed integration-defective lentiviral vectors or non-integrating lentiviral vectors.
HPV-induced cancers are also known as cancers associated with HPV (Human Papillomavirus). Indeed, when HPV infections are not successfully controlled by the immune system of an infected host. When a high-risk HPV infection persists for many years, it can lead to cell changes that, if untreated, may get worse over time and become cancer.
Lentiviral vector according to the invention The inventors have conceived novel therapeutic and prophylactic lentiviral vectors based vaccins against HPV-induced cancers.
In particular, the present invention relates to a lentiviral vector comprising at least four distinct nucleic acid sequences selected from a group of particular non-oncogenic HPV antigens.
By distinct nucleic acid sequences, it is meant that the at least four nucleic acid sequences comprised in the lentiviral vector are all different, i.e. that each of them is a different member of the group of particular non-oncogenic HPV antigens.
The group of non-oncogenic HPV antigens is the following:
- a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 16 (HPV16) protein E6 antigen;
- a nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen;
- a nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen; and - a nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen.
Unlike most HPV proteins that are lost after integration of HPV, E6 and E7 proteins are continuously expressed in HPV induced tumors (Ghittoni, Raffaella et al. Virus genes vol. 40,1 (2010): 1-13; Morrow, Matthew P et al. Expert review of vaccines vol. 12,3 (2013): 271-83). These proteins interfere with cell functions and are known to play an important role in HPV associated cancerogenesis. (Tomaie, Vjekoslay. Cancers vol. 8,10 95.
19 Oct. 2016; Ghittoni, Raffaella et al. Virus genes vol. 40,1 (2010): 1-13).
E6 and E7 are thought to interfere with multiple pathways but most importantly, E6 protein expression in the cell leads to ubiquitin-mediated degradation of the tumor suppressor p53 by direct interaction with the cellular E3 ubiquitin ligase, E6AP (Huibregtse, J M et al. The EMBO
journal vol.
10,13 (1991): 4129-35; Martinez-Zapien, Denise et al. Nature vol. 529,7587 (2016): 541-5) and E7 binds to Rb protein hereby disrupting the interaction between Rb and E2F and releasing E2F factor (Cassetti, M Cristina et al. Vaccine vol. 22,3-4 (2004):
520-7).
As E6 and E7 protein are expressed in all HPV induced cancers, it was decided to include antigens from these proteins for the two major subtypes (HPV16 and HPV18) in lentiviral vectors of the invention. In order to develop a vaccine from E6 and E7 antigen, it is of major importance to abolish the oncogenic risk associated to these proteins.
Non-oncogenic E6 and E7 proteins are thus implemented in the invention. By "non-oncogenic E6 and E7 HPV proteins", it means that their encoding sequences were modified to remove p53, Mi2b and Rb binding sites as well as PDZ binding motif. In a particular embodiment, as partial mutation of the binding sites of the E6 and E7 HPV proteins did not allow to fully abolish Rb binding, said sites were in particular fully removed from the sequences implemented in the present invention.
A lentiviral vector according to the invention may be single-stranded or double-stranded. A lentiviral vector according to the invention may be an RNA or DNA
molecule.
In the context of the present invention, a "lentiviral vector" means a non-replicating vector for the transduction of a host cell with a transgene comprising cis-acting lentiviral RNA or DNA sequences, and requiring essential lentiviral proteins (e.g., Gag, Pol, and/or Env) and accessory proteins (e.g, Tat, Rev) that are provided in trans.
The lentiviral vector lacks expression of all functional HIV proteins. The lentiviral vector genome may be present in the form of an RNA or DNA molecule, depending on the stage of production or development of said retroviral vectors.
In a preferred embodiment, a lentiviral vector of the invention is a non-integrative lentiviral vector.
Non-integrating lentiviral vectors have been designed to mitigate the risks of potential oncogenesis linked to insertional mutagenesis events, particularly for vaccination purposes. Examples of non-integrating lentiviral vectors are provided in Coutant et al., PLOS
ONE 7(11):e48644 (2012), Karwacz et al., J. Virol. 83(7):3094-3103 (2009), Negri et al., Molecular Therapy 15(9):1716-1723 (2007); and Hu et al., Vaccine 28:6675-6683 (2010).
Consequently, it has been reported that a non-integrating lentiviral vector system can mitigate the potential risk of insertional mutagenesis as compared to an integrating system (Hu et al., Vaccine 28:6675-6683 (2010)). It has been further reported that in some functional analysis, both the magnitude and quality of the immune responses elicited by DC-directed integration-defective lentiviral vectors (IDLVs) are comparable to that of its integrating counterpart.
Thus, integration-defective lentiviral vectors (IDLVs) have been considered safer vectors than integrating vectors for human administration, with comparable effectiveness.
In addition, deletion in the U3 region of the 3' LTR of the viral promoter and enhancer sequences in self-inactivating lentiviral vectors limits the likelihood of endogenous promoter activation. These concerns with safety directly address the experiences gained from the SCID-X1 gene therapy trial carried out in 1998-1999, perfonned with Moloney virus-based retroviral vectors on children suffering from a rare form of X-linked (SCID-X1 gene) severe immunodeficiency disease (Cavazzana-Calvo et al., 2000, Science., 288(5466):669-72). During this trial, four of nine children developed leukemia as a result of the integration of the Moloney-derived retroviral vector at close proximity to the human LMO2 proto-oncogene (Hacein-Bey-Abina et al., 2008, J.Clin.Invest., 118(9):3132-3142). It was demonstrated that malignancy was the consequence of the proximity of the viral U3 promoter/enhancer to the LMO2 proto-oncogene. As a result, safety is a major concern for the administration of lentivectors to humans.
Accordingly, a lentiviral vector according to the invention may comprise long terminal repeats (LTRs) sequences in cis as known in the art and in particular comprise a 3' long terminal repeat (LTR) which is devoid of its U3 promoter sequence (Miyoshi H et al, 1998, J Virol. 72(1 0):81 50-7; Zufferey et al., 1998, J V/ro/ 72(12):9873-80).
Enhancers are cis-acting sequences, which can act as transcriptional activators at a distance. They have been widely employed in viral derived vectors because they appear to be the most efficient for obtaining transgene strong expression in a variety of cell types, in particular DCs (Chinnasamy et al., 2000, Hum Gene Ther 11(13):1901-9; Rouas et al., 2008, Cancer Gene Ther 9(9):715-24; Kimura et al., 2007, Mol Ther 15(7):1390-9; Gruh et al., 2008, J Gene Med 10(1) 21-32). However, given the safety issue of insertional mutagenesis, such transcriptional enhancer sequences should be deleted from the lentiviral vector constructs to abolish the risk of insertional mutagenesis by enhancer proximity effect. This enhancer proximity effect is by far the most frequent mechanism of insertional mutagenesis and is the only effect described in human or animal cases of tumorigenic events after gene transfer.
Accordingly, a lentiviral vector according to the invention may not comprise a constitutive enhancer sequence.
Previous studies have reported on the replacement of viral promoters by DC-specific promoters deriving from major histocompatibility complex class II
genes (MHC class II) (Kimura et al., 2007, Mol Ther 15(7):1390-9) and dectin-2 genes (Lopes et al., 2008, J
Virol 82(1):86-95). The dectin-2 gene promoter used in Lopes et al. contains a putative enhancer and an adenoviral conserved sequence (inverted terminal repeats in adenovirus promoter) (Bonkabara et al., 2001, J. Immunology, 167:6893-6900). The MHC
class II gene promoter used by Kimura et al. does not contain any known enhancer.
Yet, without an enhancer, the MHC class II promoter was found not to provide sufficient transgene expression in DCs, when administered intravenously. In particular, lentiviral vectors including MHC class II promoters did not provoke an immune reaction in immunocompetent C57BL/6 mice, in contrast to the immune responses observed with CMV
promoters/enhancers. Although integration and persistent transgene expression were observed after injection in mice, the lentiviral vectors transcribed through MHC class II promoters failed to stimulate an antigen-specific CD8+ cytotoxic T-lymphocyte response, even after vaccination boost. The authors of these studies therefore concluded that the use of MHC class II promoters was of interest only for applications where persistence of expression is sought as in gene replacement therapy, but not in the context of immunotherapy. Of note, MHC class II
promoters are expressed poorly in most cell types.
Thus, the MHC class II promoter is not an adequate promoter for lentiviral vectors for induction of an immune response against an antigen via IV
injection. Moreover, the dectin-2 promoter is expressed poorly in most cell types and appears to contain an enhancer. Thus, the dectin-2 promoter is not a good promoter for lentiviral vectors for safety reasons.
Accordingly, a lentiviral vector according to the invention may comprise an MHC Class I promoter, i.e. the nucleic acid sequences encoding antigens of a lentiviral vector according to the invention may be under the control of an MHC Class I
promoter.
An appropriate MHC Class I promoter may be selected from the group consisting of a 132-microglobulin promoter, a HLA-A2 promoter, a HLA-B7 promoter, a HLA-Cw5 promoter, a HLA-E promoter or a HLA-F promoter and is more particularly a f32-microglobulin promoter.
MHC Class I promoters are dendritic-specific (APCs) in that expression of the promoter in BDCA+ dendritic cells is higher than the expression in kidney, smooth muscle, liver, and heart cells. They also have relatively high expression in other transduced cell types, for example, expression of the promoter in BDCA+ dendritic cells is only 12-100 times the expression of that promoter in skeletal muscle cells, in contrast to 900 times with the MHCII
HLA-DRct promoter.
This promoter drives in particular the transcription of the nucleic acid sequences encoding HPV antigens in a lentiviral vector of the invention.
Said promoter can be a naturally occurring or a synthetic MHC Class I
promoter, obtained using well known molecular biological techniques.
A lentiviral vector according to the invention may comprise a cPPT/CTS
sequence, such as described in EP2169073. This cPPT/CTS sequence may in particular be the sequence set forth as sequence SEQ ID NO: 37.
Indeed, efficient integration and replication in non-dividing cells generally requires the presence of two cis-acting sequences at the center of the lentiviral genome, the central polypurine tract (cPPT) and the central termination sequence (CTS).
This leads to the formation of a triple-stranded DNA structure called the central DNA "flap", which acts as a signal for uncoating of the pre-integration complex at the nuclear pore and efficient importation of the expression cassette into the nucleus of non-dividing cells, such as dendritic cells.
A lentiviral vector of the invention may comprise a Woodchuck hepatitis B
virus (WHV) Post-Transcriptional Regulatory Element (WPRE), which allows a more stable expression of the transgene in vivo, and in particular a mutant form of the woodchuck hepatitis B virus (WHY) post-transcriptional regulatory element (WPRE).
The mutated Woodchuck Posttranscriptional Regulatory Element (mWPRE) is characterized in that point mutations are introduced to avoid expression of the X protein contained in the WPRE region as said X protein may have oncogenic properties (Kingsman et al., Gene Ther. 2005 Jan;12(1):3-4).
The mutant form of the woodchuck hepatitis B virus (WHV) post-transcriptional regulatory element (WPRE) comprised in a lentiviral vector of the invention may in particular 5 have the nucleic acid sequence set forth as sequence SEQ ID NO: 38.
In a particular embodiment, a lentiviral vector according to the invention, and in particular a non-integrative lentiviral vector of the invention:
(i) comprises at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen, at least one nucleic acid sequence 10 encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen, at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen, and at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen;
(ii) comprises a 3' long terminal repeat (LTR) which is devoid of its U3
H-2Db-restricted T-cell epitope SEO ID NO: 40 is a synthetic E7HPvt6-derived peptide containing the RAHYNIVTF
H-2Db-restricted T-cell epitope DETAILED DESCRIPTION OF THE INVENTION
The inventors have discovered that the administration of a lentiviral vector encoding at least four distinct human papillomavirus (HPV) antigens, and in particular at least 4 HPV antigens selected among proteins E6 and E7 of at least two different HPV
subtypes, and in particular of HPV16 and HPV18 subtypes, to an individual in need thereof results in a high prophylactic and therapeutic activity on HPV induced cancers.
Lentiviral vectors according to the invention can enable the induction of a strong, lasting and broad cell-mediated response against tumors induced by an HPV infection.
Lentiviral vectors according to the invention, as well as lenviral vector particules comprising them, isolated cells comprising said lentiviral vectors or lentiviral vector particles and vaccine compositions comprising them are described throughout the present specification.
Definitions All scientific and technical terms used in this application have meanings commonly used in the art unless otherwise specified.
As used herein, "transgene" means a polynucleotide that can be expressed, via recombinant techniques, in a non-native environment or heterologous cell under appropriate conditions.
As used herein, the temi "recombinant", when used in reference to a cell of the invention, indicates that the cell has been modified by the introduction of an endogenous and/or heterologous nucleic acid or protein into the cell or the alteration of a native cell or that the cell is derived from a cell so modified. Thus, for example, recombinant cells express genes or nucleic acid that are not found within the native (non-recombinant) form of the cell or express native (eg endogenous) genes at a different level than their native level or express additional or supplementary copies of native (eg endogenous) at a different level than their native level. An isolated cell according to the invention is recombinant in that it comprises at least one lentiviral vector according to the invention and/or at least one lentiviral vector particle according to the invention.
As used herein, the term "recombinant", when used in reference to a vector, are sequences formed/obtained by technics of genetic engineering well known to the man skilled in the art.
As used herein, the term "polypeptide" refers to a molecule comprising amino acid residues linked by peptide bonds and containing more than five amino acid residues. The amino acids are identified by either the single-letter or three-letter designations. The term "protein" as used herein is synonymous with the term "polypeptide" and may also refer to two or more polypeptides. Thus, the terms "protein", "peptide" and "polypeptide"
can be used interchangeably. Polypeptides may optionally be modified (e.g., glycosylated, phosphorylated, acylated, farnesylated, prenylated, sulfonated, and the like) to add functionality. Polypeptides exhibiting activity may be referred to as enzymes.
It will be understood that, as a result of the degeneracy of the genetic code, a multitude of nucleotide sequences encoding a given polypeptide may be produced.
The term "operably linked" as used herein refers to two or more nucleic acid .. sequence elements that are physically linked and are in a functional relationship with each other. For instance, in a lentiviral vector according to the invention, a promoter is operably linked to a coding sequence, also termed herein "antigen construct" as the promoter is able to initiate or regulate the transcription or expression of the antigen construct, in which case the antigen construct should be understood as being "under the control of" the promoter.
Generally, when two nucleic acid sequences are operably linked, they will be in the same orientation and usually also in the same reading frame. They usually will be essentially contiguous, although this may not be required.
The terms "encoding" or "coding for" refer to the process by which a polynucleotide, through the mechanisms of transcription and translation, produces an amino-acid sequence.
For each or the amino acid sequences of interest, reference sequences are described herein. The present description also encompasses amino acid sequences having specific percentages of amino acid identity with a reference amino acid sequence.
For obvious reasons, in all the present description, a specific nucleic acid sequence or a specific amino acid sequence which complies with, respectively, the considered nucleotide or amino acid identity, should further lead to obtaining a protein (or antigen) which displays the desired biological activity. As used herein, the "percentage of identity" between two nucleic acid sequences or between two amino acid sequences is determined by comparing both optimally aligned sequences through a comparison window.
The portion of the nucleotide or amino-acid sequence in the comparison window may thus include additions or deletions (for example "gaps") as compared to the reference sequence (which does not include these additions or these deletions) so as to obtain an optimal alignment between both sequences.
The terms "sequence homology" or "sequence identity" or "homology" or "identity" are used interchangeably herein. For the purpose of the invention, it is defined here that in order to determine the percentage of sequence homology or sequence identity of two amino acid sequences or of two nucleic acid sequences, the sequences are aligned for optimal comparison purposes. In order to optimize the alignment between the two sequences gaps may be introduced in any of the two sequences that are compared. Such alignment can be carried out over the full length of the sequences being compared.
Alternatively, the alignment may be carried out over a shorter length, for example over about 20, about 50, about 100 or more nucleic acids/based or amino acids. The sequence identity is the percentage of identical matches between the two sequences over the reported aligned region.
A comparison of sequences and determination of percentage of sequence identity between two sequences can be accomplished using a mathematical algorithm. The skilled person will be aware of the fact that several different computer programs are available to align two sequences and determine the identity between two sequences (Kruskal, J. B.
(1983) An overview of sequence comparison In D. Sankoff and J. B. Kruskal, (ed.), Time warps, string edits and macromolecules: the theory and practice of sequence comparison, pp.
1-44 Addison Wesley).
The percent sequence identity between two amino acid sequences or between two nucleotide sequences may be determined using the Needleman and Wunsch algorithm for the alignment of two sequences. (Needleman, S. B. and Wunsch, C. D. (1970) J.
Mol. Biol.
48, 443-453). Both amino acid sequences and nucleotide sequences can be aligned by the algorithm. The Needleman-Wunsch algorithm has been implemented in the computer program NEEDLE.
For the purpose of the invention, the NEEDLE program from the EMBOSS
package was used (version 2.8.0 or higher, EMBOSS: The European Molecular Biology Open Software Suite (2000) Rice, P. LongdenJ. and Bleasby,A. Trends in Genetics 16, (6) pp276 277, http://emboss.bioinformatics.n1/). For protein sequences EBLOSUM62 is used for the substitution matrix. For nucleotide sequence, EDNAFULL is used. The optional parameters used are a gap opening penalty of 10 and a gap extension penalty of 0.5. No end gap penalty is added. In the Output section, Yes has been indicated in response to the question "Brief identity and similarity" and "SRS pairwise" indicated as Output alignment format.
After alignment by the program NEEDLE as described above the percentage of sequence identity between a query sequence and a sequence of the invention is calculated as follows: Number of corresponding positions in the alignment showing an identical amino acid or identical nucleotide in both sequences divided by the total length of the alignment after subtraction of the total number of gaps in the alignment. The identity defined as herein can be obtained from NEEDLE by using the NOBRIEF option and is labeled in the output of the program as "longest-identity".
The similarity of nucleotide and amino acid sequences, i.e. the percentage of sequence identity, can be determined via sequence alignments using several other art-known algorithms, preferably with the mathematical algorithm of Karlin and Altschul (Karlin &
Altschul (1993) Proc. Natl. Acad. Sci. USA 90: 5873-5877), with hmmalign (HMMER
package, http://hmmer.wustl.edu/) or with the CLUSTAL algorithm (Thompson, J.
D., Higgins, D. G. & Gibson, T. J. (1994) Nucleic Acids Res. 22, 4673-80) available e.g. on https://www.ebi.ac.uk/Tools/msa/clustalo/ or the GAP program (mathematical algorithm of the University of Iowa) or the mathematical algorithm of Myers and Miller (1989 - Cabios 4:
11-17) or Clone Manager 9. Preferred parameters used are the default parameters as they are set on https://www.ebi.ac.uk/Tools/msa/clustalo/.
The grade of sequence identity (sequence matching) may be calculated using e.g.
BLAST, BLAT or BlastZ (or BlastX). A similar algorithm is incorporated into the BLASTN
and BLASTP programs of Altschul et al (1990) J. Mol. Biol. 215, 403-410. BLAST
polynucleotide searches are performed with the BLASTN program, score = 100, word length = 12, to obtain polynucleotide sequences that are homologous to those nucleic acids which encode the relevant protein.
BLAST protein searches are performed with the BLASTP program, score = 50, word length = 3, to obtain amino acid sequences homologous to the SHC
polypeptide. To obtain gapped alignments for comparative purposes, Gapped BLAST is utilized as described in Altschul et al (1997) Nucleic Acids Res. 25, 3389-3402. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs are used.
Sequence matching analysis may be supplemented by established homology mapping techniques like Shuffle-LAGAN (Brudno M., Bioinformatics 2003b, 19 Suppl 1:
154-162) or Markov random fields. When percentages of sequence identity are referred to in the present application, these percentages are calculated in relation to the full length of the longer sequence, if not specifically indicated otherwise.
In particular embodiments, % identity between two sequences is determined using CLUSTAL 0 (version 1.2.4).
The terms non-oncogenic used herein are used in their traditional meaning, i.e. it relates to an element, in the present case to antigens, unable to cause the foimation of tumors.
As detailed elsewhere, antigens implemented in the present invention have been genetically amended in order to become nononcogenic. It means, according to the usual meaning of these terms, that the nucleic acid sequences encoding the antigens implemented herein are not found in nature and are modified either by introduction or by deletion or by modification of their nucleic acid sequences, leading to encoded amino acid sequences that also do not naturally exist in nature.
The man skilled in the art has known for a long time a variety of means to perform a deletion, substitution or introduction in a nucleic acid sequence.
As will be understood by those of skill in the art, it can moreover be advantageous to modify a coding sequence to enhance its expression in a particular host.
The genetic code is redundant with 64 possible codons, but most organisms typically use a subset of these codons.
The codons that are utilized most often in a species are called optimal codons, and those not utilized very often are classified as rare or low-usage codons. Codons can be substituted to reflect the preferred codon usage of the host, in a process sometimes called "codon optimization" or "controlling for species codon bias." Codon optimization for other host cells can be readily determined using codon usage tables or can be performed using commercially available software, such as CodonOp (www.idtdna.com/CodonOptfrom) from Integrated DNA Technologies. Optimized coding sequences containing codons preferred by a particular prokaryotic or eukaryotic host (Murray et al, 1989 , Nucl Acids Res . 17: 477-508) can be prepared, for example, to increase the rate of translation or to produce recombinant RNA
transcripts having desirable properties, such as a longer half-life, as compared with transcripts produced from a non-optimized sequence. Translation stop codons can also be modified to reflect host preference. For example, typical stop codon for monocotyledonous plants is 5 UGA, whereas insects and E. coli commonly use UAA as the stop codon (Dalphin et al, 1996, Nucl Acids Res. 24: 216-8).
A "non-integrative" lentiviral vector means that, when this lentiviral vector is in a cell, it does not integrate into the host cell genome. A non-integrative lentiviral vector particle relates to a lentiviral vector particle that comprises a non-integrative lentiviral vector. It can 10 also be termed integration-defective lentiviral vectors or non-integrating lentiviral vectors.
HPV-induced cancers are also known as cancers associated with HPV (Human Papillomavirus). Indeed, when HPV infections are not successfully controlled by the immune system of an infected host. When a high-risk HPV infection persists for many years, it can lead to cell changes that, if untreated, may get worse over time and become cancer.
Lentiviral vector according to the invention The inventors have conceived novel therapeutic and prophylactic lentiviral vectors based vaccins against HPV-induced cancers.
In particular, the present invention relates to a lentiviral vector comprising at least four distinct nucleic acid sequences selected from a group of particular non-oncogenic HPV antigens.
By distinct nucleic acid sequences, it is meant that the at least four nucleic acid sequences comprised in the lentiviral vector are all different, i.e. that each of them is a different member of the group of particular non-oncogenic HPV antigens.
The group of non-oncogenic HPV antigens is the following:
- a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 16 (HPV16) protein E6 antigen;
- a nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen;
- a nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen; and - a nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen.
Unlike most HPV proteins that are lost after integration of HPV, E6 and E7 proteins are continuously expressed in HPV induced tumors (Ghittoni, Raffaella et al. Virus genes vol. 40,1 (2010): 1-13; Morrow, Matthew P et al. Expert review of vaccines vol. 12,3 (2013): 271-83). These proteins interfere with cell functions and are known to play an important role in HPV associated cancerogenesis. (Tomaie, Vjekoslay. Cancers vol. 8,10 95.
19 Oct. 2016; Ghittoni, Raffaella et al. Virus genes vol. 40,1 (2010): 1-13).
E6 and E7 are thought to interfere with multiple pathways but most importantly, E6 protein expression in the cell leads to ubiquitin-mediated degradation of the tumor suppressor p53 by direct interaction with the cellular E3 ubiquitin ligase, E6AP (Huibregtse, J M et al. The EMBO
journal vol.
10,13 (1991): 4129-35; Martinez-Zapien, Denise et al. Nature vol. 529,7587 (2016): 541-5) and E7 binds to Rb protein hereby disrupting the interaction between Rb and E2F and releasing E2F factor (Cassetti, M Cristina et al. Vaccine vol. 22,3-4 (2004):
520-7).
As E6 and E7 protein are expressed in all HPV induced cancers, it was decided to include antigens from these proteins for the two major subtypes (HPV16 and HPV18) in lentiviral vectors of the invention. In order to develop a vaccine from E6 and E7 antigen, it is of major importance to abolish the oncogenic risk associated to these proteins.
Non-oncogenic E6 and E7 proteins are thus implemented in the invention. By "non-oncogenic E6 and E7 HPV proteins", it means that their encoding sequences were modified to remove p53, Mi2b and Rb binding sites as well as PDZ binding motif. In a particular embodiment, as partial mutation of the binding sites of the E6 and E7 HPV proteins did not allow to fully abolish Rb binding, said sites were in particular fully removed from the sequences implemented in the present invention.
A lentiviral vector according to the invention may be single-stranded or double-stranded. A lentiviral vector according to the invention may be an RNA or DNA
molecule.
In the context of the present invention, a "lentiviral vector" means a non-replicating vector for the transduction of a host cell with a transgene comprising cis-acting lentiviral RNA or DNA sequences, and requiring essential lentiviral proteins (e.g., Gag, Pol, and/or Env) and accessory proteins (e.g, Tat, Rev) that are provided in trans.
The lentiviral vector lacks expression of all functional HIV proteins. The lentiviral vector genome may be present in the form of an RNA or DNA molecule, depending on the stage of production or development of said retroviral vectors.
In a preferred embodiment, a lentiviral vector of the invention is a non-integrative lentiviral vector.
Non-integrating lentiviral vectors have been designed to mitigate the risks of potential oncogenesis linked to insertional mutagenesis events, particularly for vaccination purposes. Examples of non-integrating lentiviral vectors are provided in Coutant et al., PLOS
ONE 7(11):e48644 (2012), Karwacz et al., J. Virol. 83(7):3094-3103 (2009), Negri et al., Molecular Therapy 15(9):1716-1723 (2007); and Hu et al., Vaccine 28:6675-6683 (2010).
Consequently, it has been reported that a non-integrating lentiviral vector system can mitigate the potential risk of insertional mutagenesis as compared to an integrating system (Hu et al., Vaccine 28:6675-6683 (2010)). It has been further reported that in some functional analysis, both the magnitude and quality of the immune responses elicited by DC-directed integration-defective lentiviral vectors (IDLVs) are comparable to that of its integrating counterpart.
Thus, integration-defective lentiviral vectors (IDLVs) have been considered safer vectors than integrating vectors for human administration, with comparable effectiveness.
In addition, deletion in the U3 region of the 3' LTR of the viral promoter and enhancer sequences in self-inactivating lentiviral vectors limits the likelihood of endogenous promoter activation. These concerns with safety directly address the experiences gained from the SCID-X1 gene therapy trial carried out in 1998-1999, perfonned with Moloney virus-based retroviral vectors on children suffering from a rare form of X-linked (SCID-X1 gene) severe immunodeficiency disease (Cavazzana-Calvo et al., 2000, Science., 288(5466):669-72). During this trial, four of nine children developed leukemia as a result of the integration of the Moloney-derived retroviral vector at close proximity to the human LMO2 proto-oncogene (Hacein-Bey-Abina et al., 2008, J.Clin.Invest., 118(9):3132-3142). It was demonstrated that malignancy was the consequence of the proximity of the viral U3 promoter/enhancer to the LMO2 proto-oncogene. As a result, safety is a major concern for the administration of lentivectors to humans.
Accordingly, a lentiviral vector according to the invention may comprise long terminal repeats (LTRs) sequences in cis as known in the art and in particular comprise a 3' long terminal repeat (LTR) which is devoid of its U3 promoter sequence (Miyoshi H et al, 1998, J Virol. 72(1 0):81 50-7; Zufferey et al., 1998, J V/ro/ 72(12):9873-80).
Enhancers are cis-acting sequences, which can act as transcriptional activators at a distance. They have been widely employed in viral derived vectors because they appear to be the most efficient for obtaining transgene strong expression in a variety of cell types, in particular DCs (Chinnasamy et al., 2000, Hum Gene Ther 11(13):1901-9; Rouas et al., 2008, Cancer Gene Ther 9(9):715-24; Kimura et al., 2007, Mol Ther 15(7):1390-9; Gruh et al., 2008, J Gene Med 10(1) 21-32). However, given the safety issue of insertional mutagenesis, such transcriptional enhancer sequences should be deleted from the lentiviral vector constructs to abolish the risk of insertional mutagenesis by enhancer proximity effect. This enhancer proximity effect is by far the most frequent mechanism of insertional mutagenesis and is the only effect described in human or animal cases of tumorigenic events after gene transfer.
Accordingly, a lentiviral vector according to the invention may not comprise a constitutive enhancer sequence.
Previous studies have reported on the replacement of viral promoters by DC-specific promoters deriving from major histocompatibility complex class II
genes (MHC class II) (Kimura et al., 2007, Mol Ther 15(7):1390-9) and dectin-2 genes (Lopes et al., 2008, J
Virol 82(1):86-95). The dectin-2 gene promoter used in Lopes et al. contains a putative enhancer and an adenoviral conserved sequence (inverted terminal repeats in adenovirus promoter) (Bonkabara et al., 2001, J. Immunology, 167:6893-6900). The MHC
class II gene promoter used by Kimura et al. does not contain any known enhancer.
Yet, without an enhancer, the MHC class II promoter was found not to provide sufficient transgene expression in DCs, when administered intravenously. In particular, lentiviral vectors including MHC class II promoters did not provoke an immune reaction in immunocompetent C57BL/6 mice, in contrast to the immune responses observed with CMV
promoters/enhancers. Although integration and persistent transgene expression were observed after injection in mice, the lentiviral vectors transcribed through MHC class II promoters failed to stimulate an antigen-specific CD8+ cytotoxic T-lymphocyte response, even after vaccination boost. The authors of these studies therefore concluded that the use of MHC class II promoters was of interest only for applications where persistence of expression is sought as in gene replacement therapy, but not in the context of immunotherapy. Of note, MHC class II
promoters are expressed poorly in most cell types.
Thus, the MHC class II promoter is not an adequate promoter for lentiviral vectors for induction of an immune response against an antigen via IV
injection. Moreover, the dectin-2 promoter is expressed poorly in most cell types and appears to contain an enhancer. Thus, the dectin-2 promoter is not a good promoter for lentiviral vectors for safety reasons.
Accordingly, a lentiviral vector according to the invention may comprise an MHC Class I promoter, i.e. the nucleic acid sequences encoding antigens of a lentiviral vector according to the invention may be under the control of an MHC Class I
promoter.
An appropriate MHC Class I promoter may be selected from the group consisting of a 132-microglobulin promoter, a HLA-A2 promoter, a HLA-B7 promoter, a HLA-Cw5 promoter, a HLA-E promoter or a HLA-F promoter and is more particularly a f32-microglobulin promoter.
MHC Class I promoters are dendritic-specific (APCs) in that expression of the promoter in BDCA+ dendritic cells is higher than the expression in kidney, smooth muscle, liver, and heart cells. They also have relatively high expression in other transduced cell types, for example, expression of the promoter in BDCA+ dendritic cells is only 12-100 times the expression of that promoter in skeletal muscle cells, in contrast to 900 times with the MHCII
HLA-DRct promoter.
This promoter drives in particular the transcription of the nucleic acid sequences encoding HPV antigens in a lentiviral vector of the invention.
Said promoter can be a naturally occurring or a synthetic MHC Class I
promoter, obtained using well known molecular biological techniques.
A lentiviral vector according to the invention may comprise a cPPT/CTS
sequence, such as described in EP2169073. This cPPT/CTS sequence may in particular be the sequence set forth as sequence SEQ ID NO: 37.
Indeed, efficient integration and replication in non-dividing cells generally requires the presence of two cis-acting sequences at the center of the lentiviral genome, the central polypurine tract (cPPT) and the central termination sequence (CTS).
This leads to the formation of a triple-stranded DNA structure called the central DNA "flap", which acts as a signal for uncoating of the pre-integration complex at the nuclear pore and efficient importation of the expression cassette into the nucleus of non-dividing cells, such as dendritic cells.
A lentiviral vector of the invention may comprise a Woodchuck hepatitis B
virus (WHV) Post-Transcriptional Regulatory Element (WPRE), which allows a more stable expression of the transgene in vivo, and in particular a mutant form of the woodchuck hepatitis B virus (WHY) post-transcriptional regulatory element (WPRE).
The mutated Woodchuck Posttranscriptional Regulatory Element (mWPRE) is characterized in that point mutations are introduced to avoid expression of the X protein contained in the WPRE region as said X protein may have oncogenic properties (Kingsman et al., Gene Ther. 2005 Jan;12(1):3-4).
The mutant form of the woodchuck hepatitis B virus (WHV) post-transcriptional regulatory element (WPRE) comprised in a lentiviral vector of the invention may in particular 5 have the nucleic acid sequence set forth as sequence SEQ ID NO: 38.
In a particular embodiment, a lentiviral vector according to the invention, and in particular a non-integrative lentiviral vector of the invention:
(i) comprises at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen, at least one nucleic acid sequence 10 encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen, at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen, and at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen;
(ii) comprises a 3' long terminal repeat (LTR) which is devoid of its U3
15 promoter sequence;
(iii) does not comprise a constitutive enhancer sequence;
(iv) comprises an MHC Class I promoter, and in particular a 32-microglobulin promoter;
(v) comprises a cPPT/CTS sequence, having in particular the sequence set forth 20 as sequence SEQ ID NO: 37; and (vi) comprises a mutant form of the woodchuck hepatitis B virus (WHY) post-transcriptional regulatory element (WPRE), having in particular the nucleic acid sequence set forth as sequence SEQ ID NO: 38.
25 As previously mentioned, a lentiviral vector according to the invention is characterized in that it comprises:
- at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen, - at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen, - at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen, and - at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen.
The at least four, and in particular the four, distinct nucleic acid sequences encoding HPV antigens of a lentiviral vector of the invention may in particular be fused together, forming a single antigenic nucleic acid sequence encoding a single antigenic fusion protein under the control of a single promoter sequence, in particular (i) in the absence of any linking sequence (also termed spacer herein) between each of the at least four distinct nucleic acid sequences or (ii) with a linking sequence (or spacer) between at least two of the at least four distinct nucleic acid sequences, and more particularly with a a linking sequence (or spacer) between each of the at least four distinct nucleic acid sequences.
A nucleic acid sequence encoding a non-oncogenic Human papillomavirus 16 (HPV16) protein E6 antigen may in particular have a nucleic acid sequence encoding an amino acid sequence having at least 80 % sequence identity with the amino acid sequence set forth as SEQ ID NO: 7.
As described herein, an amino acid sequence having at least 80 % amino acid identity with a reference amino acid sequence encompasses amino acid sequences having at least 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% and 99% amino acid identity with the said reference amino acid sequence.
In particular, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 16 (HPV16) protein E6 antigen may in particular have a nucleic acid sequence having at least 80% sequence identity with a nucleic acid sequence selected from the group consisting of the nucleic acid sequences set forth as SEQ ID NO: 2, SEQ ID NO:
3, SEQ ID
NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6.
As described herein, a nucleic acid sequence having at least 80% nucleotide identity with a reference nucleic acid sequence encompasses nucleic acid sequences having at least 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% and 99% nucleotide identity with the said reference nucleic acid sequence.
In a particular embodiment, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 16 (HPV16) protein E6 antigen may in particular have a nucleic acid sequence selected from the group consisting of the nucleic acid sequences set forth as SEQ ID
NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6.
A nucleic acid sequence encoding a non-oncogenic Human papillomavirus 16 (HPV16) protein E6 antigen may in particular have a nucleic acid sequence encoding an amino acid sequence having at least 80% sequence identity with an amino acid sequence selected from the group consisting of the amino acid sequences set forth as SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 and SEQ ID NO: 12.
In a particular embodiment, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 16 (HPV16) protein E6 antigen may in particular have a nucleic acid sequence encoding an amino acid sequence selected from the group consisting of the amino acid sequences set forth as SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID
NO: 11 and SEQ ID NO: 12.
A nucleic acid sequence encoding a non-oncogenic Human papillomavirus 16 (HPV16) protein E7 antigen may in particular have a nucleic acid sequence encoding an amino acid sequence having at least 68 % sequence identity with the amino acid sequence set forth as SEQ ID NO: 16.
As described herein, an amino acid sequence having at least 68 % amino acid identity with a reference amino acid sequence encompasses amino acid sequences having at least 69 %, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% and 99% amino acid identity with the said reference amino acid sequence.
In particular, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 16 (HPV16) protein E7 antigen may in particular have a nucleic acid sequence having at least 80% sequence identity with a nucleic acid sequence selected from the group consisting of the nucleic acid sequences set forth as SEQ ID NO: 14 and SEQ ID
NO: 15.
As described herein, a nucleic acid sequence having at least 80% nucleotide identity with a reference nucleic acid sequence encompasses nucleic acid sequences having at least 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% and 99% nucleotide identity with the said reference nucleic acid sequence.
In a particular embodiment, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 16 (HPV16) protein E7 antigen may in particular have a nucleic acid sequence selected from the group consisting of the nucleic acid sequences set forth as SEQ ID
NO: 14 and SEQ ID NO: 15.
A nucleic acid sequence encoding a non-oncogenic Human papillomavirus 16 (HPV16) protein E7 antigen may in particular have a nucleic acid sequence encoding an amino acid sequence having at least 80% sequence identity with an amino acid sequence selected from the group consisting of the amino acid sequences set forth as SEQ ID NO: 17 and SEQ ID NO: 18.
In a particular embodiment, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 16 (HPV16) protein E7 antigen may in particular have a nucleic acid sequence encoding an amino acid sequence selected from the group consisting of the amino acid sequences set forth as SEQ ID NO: 17 and SEQ ID NO: 18.
A nucleic acid sequence encoding a non-oncogenic Human papillomavirus 18 (HPV18) protein E6 antigen may in particular have a nucleic acid sequence encoding an amino acid sequence having at least 60 % sequence identity with the amino acid sequence set forth as SEQ ID NO: 24.
As described herein, an amino acid sequence having at least 60 % amino acid identity with a reference amino acid sequence encompasses amino acid sequences having at least 61 %, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% and 99% amino acid identity with the said reference amino acid sequence.
In particular, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 18 (HPV18) protein E6 antigen may in particular have a nucleic acid sequence having at least 80% sequence identity with a nucleic acid sequence selected from the group consisting of the nucleic acid sequences set forth as SEQ ID NO: 20, SEQ ID
NO: 21, SEQ
ID NO: 22 and SEQ ID NO: 23.
As described herein, a nucleic acid sequence having at least 80% nucleotide identity with a reference nucleic acid sequence encompasses nucleic acid sequences having at least 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% and 99% nucleotide identity with the said reference nucleic acid sequence.
In a particular embodiment, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 18 (HPV18) protein E6 antigen may in particular have a nucleic acid sequence selected from the group consisting of the nucleic acid sequences set forth as SEQ ID
NO: 20, SEQ ID NO: 21, SEQ ID NO: 22 and SEQ ID NO: 23.
A nucleic acid sequence encoding a non-oncogenic Human papillomavirus 18 (HPV18) protein E6 antigen may in particular have a nucleic acid sequence encoding an amino acid sequence having at least 80% sequence identity with an amino acid sequence selected from the group consisting of the amino acid sequences set forth as SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27 and SEQ ID NO: 28.
In a particular embodiment, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 18 (HPV18) protein E6 antigen may in particular have a nucleic acid sequence encoding an amino acid sequence selected from the group consisting of the amino acid sequences set forth as SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27 and SEQ ID
NO: 28.
A nucleic acid sequence encoding a non-oncogenic Human papillomavirus 18 (HPV18) protein E7 antigen may in particular have a nucleic acid sequence encoding an amino acid sequence having at least 83% sequence identity with the amino acid sequence set forth as SEQ ID NO: 33.
As described herein, an amino acid sequence having at least 83% amino acid identity with a reference amino acid sequence encompasses amino acid sequences having at least 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%
and 99% amino acid identity with the said reference amino acid sequence.
In particular, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 18 (HPV18) protein E7 antigen may in particular have a nucleic acid sequence having at least 80% sequence identity with a nucleic acid sequence selected from the group consisting of the nucleic acid sequences set forth as SEQ ID NO: 30, SEQ ID NO: 31 and SEQ ID NO: 32.
As described herein, a nucleic acid sequence having at least 80% nucleotide identity with a reference nucleic acid sequence encompasses nucleic acid sequences having at least 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% and 99% nucleotide identity with the said reference nucleic acid sequence.
In a particular embodiment, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 18 (HPV18) protein E7 antigen may in particular have a nucleic acid sequence selected from the group consisting of the nucleic acid sequences set forth as SEQ ID
NO: 30, SEQ ID NO: 31 and SEQ ID NO: 32.
A nucleic acid sequence encoding a non-oncogenic Human papillomavirus 18 (HPV18) protein E7 antigen may in particular have a nucleic acid sequence encoding an amino acid sequence having at least 80% sequence identity with an amino acid sequence selected from the group consisting of the amino acid sequences set forth as SEQ ID NO: 34, 5 SEQ ID NO: 35 and SEQ ID NO: 36.
In a particular embodiment, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 18 (HPV18) protein E7 antigen may in particular have a nucleic acid sequence encoding an amino acid sequence selected from the group consisting of the amino acid sequences set forth as SEQ ID NO: 34, SEQ ID NO: 35 and SEQ ID NO: 36.
As indicated above, a lentiviral vector according to the invention comprises:
- at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen (also termed herein noE6-HPV16), - at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen (also termed herein noE7-HPV16), - at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen (also termed herein noE6-HPV18), and - at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen (also termed herein noE7-HPV18).
In a particular embodiment, a lentiviral vector according to the invention, and in particular a non-integrative lentiviral vector of the invention:
(i) comprises a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 16 (HPV16) protein E6 antigen; a nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen; a nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen and a nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen;
the nucleic acid sequences encoding non-oncogenic HPV antigens being in particular fused together, forming a single antigenic nucleic acid sequence encoding a single antigenic fusion protein; under the control of a single promoter sequence, more particularly in the absence of any linking sequence between each of them;
(ii) comprises a 3' long terminal repeat (LTR) which is devoid of its U3 promoter sequence;
(iii) does not comprise a constitutive enhancer sequence;
(iv) comprises an MHC Class I promoter, and in particular a 132-microglobulin promoter;
(v) comprises a cPPT/CTS sequence, having in particular the sequence set forth as sequence SEQ ID NO: 37; and (vi) comprises a mutant form of the woodchuck hepatitis B virus (WHV) post-transcriptional regulatory element (WPRE), having in particular the nucleic acid sequence set forth as sequence SEQ ID NO: 38.
A lentiviral vector according to the invention may more particularly comprise:
- a nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen, the nucleic acid sequence having at least 80%
sequence identity with a nucleic acid sequence selected from the group consisting of the nucleic acid sequences set forth as SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID
NO:
6, the nucleic acid sequence being in particular selected from the group consisting of the nucleic acid sequences set forth as SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID
NO: 5 and SEQ ID NO: 6;
- at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen, the nucleic acid sequence having at least 80%
sequence identity with a nucleic acid sequence selected from the group consisting of the nucleic acid sequences set forth as SEQ ID NO: 14 and SEQ ID NO: 15, the nucleic acid sequence being in particular selected from the group consisting of the nucleic acid sequences set forth as SEQ ID NO: 14 and SEQ ID NO: 15;
- at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen, the nucleic acid sequence having at least 80%
sequence identity with a nucleic acid sequence selected from the group consisting of the nucleic acid sequences set forth as SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO:
22 and SEQ ID NO: 23, the nucleic acid sequence being in particular selected from the group consisting of the nucleic acid sequences set forth as SEQ ID NO: 20, SEQ ID
NO: 21, SEQ
ID NO: 22 and SEQ ID NO: 23; and - at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen, the nucleic acid sequence having at least 80%
sequence identity with a nucleic acid sequence selected from the group consisting of the nucleic acid sequences set forth as SEQ ID NO: 30, SEQ ID NO: 31 and SEQ ID NO: 32, the nucleic acid sequence being in particular selected from the group consisting of the nucleic acid sequences set forth as SEQ ID NO: 30, SEQ ID
NO: 31 and SEQ ID NO: 32;
the nucleic acid sequences encoding non-oncogenic HPV antigens being in particular fused together, forming a single antigenic nucleic acid sequence encoding a single antigenic fusion protein; under the control of a single promoter sequence, more particularly in the absence of any linking sequence between each of them.
The at least four, and in particular the four, distinct nucleic acid sequences encoding HPV antigens in a lentiviral vector according to the invention, and in particular a non-integrative lentiviral vector of the invention, may be in any order in the traditional 5' to 3' reading direction (from 5' end to 3' end).
In particular, the four distinct nucleic acid sequences encoding HPV antigens noE6-HPV16, noE7-HPV16, noE6-HPV18 and noE7-HPV18 as defined above may be in any order, in the traditional 5' end to 3' end reading direction, among the 24 possible combinations in lentiviral vectors according to the invention, and in particular non-integrative lentiviral vectors according to the invention.
In a particular embodiment, the order of the at least four distinct nucleic acid sequences, from 5' end to 3' end, is selected from the group consisting of:
(a) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen;
(b) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen;
(c) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen; and (d) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen, the nucleic acid sequences encoding non-oncogenic HPV antigens being in particular fused together, forming a single antigenic nucleic acid sequence encoding a single antigenic fusion protein; under the control of a single promoter sequence, more particularly in the absence of any linking sequence between each of them.
These orders are represented in Figures 8A to 8D.
The order of the at least four distinct nucleic acid sequences, from 5' end to 3' end, in a lentiviral vector according to the invention may more particularly be:
(d) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen, the nucleic acid sequences encoding non-oncogenic HPV antigens being in particular fused together, forming a single antigenic nucleic acid sequence encoding a single antigenic fusion protein; under the control of a single promoter sequence, more particularly in the absence of any linking sequence between each of them.
Preferably, the order of the at least four distinct nucleic acid sequences, from 5' end to 3' end, in a lentiviral vector according to the invention is:
(a) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen, the nucleic acid sequences encoding non-oncogenic HPV antigens being in particular fused together, forming a single antigenic nucleic acid sequence encoding a single antigenic fusion protein; under the control of a single promoter sequence, more particularly in the absence of any linking sequence between each of them.
More preferably, the order of the at least four distinct nucleic acid sequences, from 5' end to 3' end, in a lentiviral vector according to the invention is:
(a) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen, the nucleic acid sequences encoding non-oncogenic HPV antigens being fused together and forming a single antigenic nucleic acid sequence encoding a single antigenic fusion protein; under the control of a single promoter sequence, in the absence of any linking sequence between each of them.
These four different groups of antigens constructs have been respectively implemented in the present examples in:
- the lentiviral vector filed at the Collection Nationale de Cultures de Microorganismes (CNCM) on October 21, 2021 under accession number 1-5759 (above order (a));
- the lentiviral vector filed at the Collection Nationale de Cultures de Microorganismes (CNCM) on October 21, 2021 under accession number 1-5760 (above order (b));
- the lentiviral vector filed at the Collection Nationale de Cultures de Microorganismes (CNCM) on October 21, 2021 under accession number 1-5761 (above order (c)); or - the lentiviral vector filed at the Collection Nationale de Cultures de Microorganismes (CNCM) on October 21, 2021 under accession number 1-5762 (above order (d)).
Accordingly, the antigen construct of the lentiviral vector filed at the CNCM
under accession number 1-5759 has the following nucleotidic sequence set forth as SEQ ID
NO: 41:
atgcccggagacacccccaccctgcacgaatacatgctggacctgcagcccgaaaccaccgaccccgaccgcg ctcactacaacatcgttacattctgttgtaaatgcgactccaccctgagaagatgcgtgcagtccacccacgtggacat caggaccctgg aggacctcctcatgggaaccctgggtatcgtctgccccatcgcctcccaggcattcaggacccccaggaaaggcccagg aagttgcc ccagctctgcaccgaactgcagaccaccattcatgacatcatcctcgaatgcgtgtactgcaagcagcagctcctgagg agggaggtg tacg atttcg ccttc ag ag acggctgtatcgtctac agg aaccc ctatgccgtctgcg ac aaatgcctg aagttttattcc aag atctccg a gtacaggcactattgctacagcctgtatgggaccaccctggagcagcagtacaacaagcccctgtgcgacctcctgatc aggtgcatc aactgccagaagcccctgaggttccacaacatccgcggcaggtggaccggaaggtgcatgtcctgctgcaggtccgccg gccccgg acctaaagccaccctccaggacatcgttctccacctggagccccagaacgagatccccgtggactcagaagaggagaac gacgaga tcgacggcgtcaaccaccagcacctgcccgctcgcagagccgaaccccagagacacaccatgctctgcatgtgctgcaa atgcgaa gcccggattaagttggtggtggaaagcagcgccgacgatctgagggccttccagcagctcttcctcaacaccctgtcat cgtgtgccc ctgggtgggcgagcccggtagaaccatcccctacaagctgcccgatctgtgcacagagctgaacacctccctgcaggac atcgagat cacctgcgtctactgcaagaccgtgctggaactgaccgaggtgttcgaattcgcclicaaggacggcttcgtggtgtac agggacagc attccccacgccgcctgccataagctggagaaactgaccaacaccggactgtataacctgctgatcaggtgtctgaggt gccagaagg cagagaaactgagacatctgaacgagaaaaggaggttccacaatattgccgggcactgataa (SEQ ID NO: 41) and encodes the following amino acid sequence set forth as SEQ ID NO: 42:
MPGDTPTLHEYMLDLQPETTDPDRAHYNIVTFCCKCDSTLRRCVQSTHV
RREVYDFAFRDGCIVYRNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLC
DLLIRCINCQKPLRFHNIRGRWTGRCMS CCRS AGPGPKATLQDIVLHLEPQNEIPVDS E
EENDEIDGVNHQHLPARRAEPQRHTMLCMCCKCEARIKLVVESS ADDLRAFQQLFLN
TLSFVCPWVGEPGRTIPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDGF
(SEQ ID NO: 42) The antigen construct of the lentiviral vector filed at the CNCM under accession number 1-5760 has the following nucleotidic sequence set forth as SEQ ID NO:
43:
atgttccaggacccccaggagaggccccggaagttgccccagctgtgcaccgagctgcagaccaccatccacga catcatcctcgaatgcgtgtactgcaagcagcagctgctgaggagggaggtgtatgactttgccacagagacggatgca ttgtctaca ggaacccctacgccgtgtgcgacaaatgcctgaagttctactccaagatcagcgagtacaggcactactgctactccct gtacggcac caccctcgaacagcagtacaacaaacccctgtgcgacctcctgattaggtgcatcaactgccagaagcccctcaggttc cacaacatc cgcggccgctggaccggccgatgcatgtcttgctgcaggggccccgacgacccctacaagctccccgacctgtgcaccg aactcaa cacctccctgcaggacatcgagatcacctgcgtgtattgcaagaccgtgctggagctgaccgaggttttcgaatttgcc tttaaggacgg cttcgtcgtgtatagggactccatcccccacgccgcctgccataagctggagaagctcaccaacaccggactgtataat ctgctgatca ggtgcctcaggtgccagaaggcagaaaagctgaggcatctcaacg agaagcgccggttccacaatattgccggccccggagac ac ccccacactccatgagtacatgctcgacctgcagcccgaaaccaccgaccccgacagagcccactacaacatcgtgacc ttctgctgc aagtgcgactccaccctgagaagatgcgtgcagtccacccacgtggacatccgcacactcgaagacctgctgatgggaa ccctggg catcgtgtgccccatcggccccgatgacaaggccaccttgcaggacatcgtgctgcacctggaaccacagaacgagatc cccgtcga ctccgaagaagaaaacgacgaaatcgacggagtgaatcaccagcacctgcccgccagaagggccgagcctcagagacac accat gctctgcatgtgctgcaaatgcgaagccaggattaagctggtggtggagagcagcgccgacgacctgagggccaccagc agctctt cctgaacacactgtccttcgtgtgcccctgggcctgataa (SEQ ID NO: 43) and encodes the following amino acid sequence set forth as SEQ ID NO: 44:
MFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDG
CIVYRNPYAVCDKCL KFYS KIS EYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPL
RFHNIRGRWTGRCMSCCRGPDDPYKLPDLCTELNTS LQDIEITCVYCKTVLELTEVFE
FAFKDGFVVYRDS IPHAACHKLEKLTNT GLYNLLIRCLRCQKAEKLRHLNEKRRFHNI
AGPGDTPTLHEYMLDLQPETTDPDRAHYNIVTFCCKCDSTLRRCVQSTHVDIRTLEDL
LMGTLGIVCPIGPDDKATLQDIVLHLEPQNEIPVDSEEENDEIDGVNHQHLPARRAEP
QRHTMLCMCCKCEARIKLVVESSADDLRAFQQLFLNTLSFVCPWA (SEQ ID NO: 44) The antigen construct of the lentiviral vector filed at the CNCM under accession number 1-5761 has the following nucleotidic sequence set forth as SEQ ID NO:
45:
atgaggcggccctacaagctgcccgacctgtgcaccgagctgaacacctccctgcaggacatcgagatcacctg cgtgtactgcaagaccgtgctggagctgaccgaggtgttcgaattcgcattcaaggacggattcgtcgtgtatagggac agcattccac acgccgcctgccacaagctggagaaattgactaac accggactgtataatctgctgatccggtgcctgaggtgtcagaaggccgaga agctgaggcatctgaacgagaaaaggagattccacaatatcgccggacacttccaggacccccaggagaggcccaggaa actgcc ccagttgtgcaccgagctccagacaaccatccacgacatcatcctggagtgcgtgtactgtaagcagcagttgctgagg agagaggtg tatgacttcgccttcagagacggatgcattgtctataggaacccctacgccgtgtgcgacaagtgcctgaagttctact ccaagatcagt gagtacaggcattactgctacagcctgtatggaaccacactggaacagcagtacaacaagcccctgtgcgacctcctga ttaggtgcat caactgccagaagcccctcaggaccacaacatccggggcaggtggaccggaaggtgcatgtcctgctgcaggtccgccg gccccg gacctaaagccaccctccaggacatcgtgctgcacctggagccccagaacgagatccccgtcgactcagaggaggagaa cgacga aattgacggcgtcaaccaccagcacctgcccgctcgcagagccgaaccccagagacacaccatgctctgcatgtgctgc aaatgcga ggcccggattaagctggtggtggagagctccgccgacgatctgagagccttccagcagctcttcctgaacaccctgtcc ttcgtgtgcc cctgggccggtcccggtgacacacctaccctgcacgagtacatgctcgatctgcagcccgagaccaccgaccccgatcg cgcacac tacaacatcgtgaccttctgctgcaaatgtgacagcaccctgagacggtgcgtccagtccacccacgttgacatccgca ccctcgaaga cctgctcatgggaaccctgggcatcgtgtgccccatcgcctgataa (SEQ ID NO: 45) and encodes the following amino acid sequence set forth as SEQ ID NO: 46:
MRRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDGFVVYR
DSIPHAACHKLEKLTNTGLYNLLIRCLRCQKAEKLRHLNEKRRFHNIAGHFQDPQERP
RKLPQLCTELQTTIHDIILECVYC KQQLLRREVYDFAI-RDGCIVYRNPYAVCDKCLKF
YS KIS EYRHYCYSLY GTTLEQQYNKPLCDLLIRCINCQKPLRFHNIRGRWTGRCMSCC
RSAGPGPKATLQDIVLHLEPQNEIPVDSEEENDEIDGVNHQHLPARRAEPQRHTMLC
MCCKCEARIKLVVES S ADDLRAFQQLFLNTLS FVCPWAGPGDTPTLHEYMLDLQPET
TDPDRAHYNIVTFCCKCDSTLRRCVQSTHVDIRTLEDLLMGTLGIVCPIA (SEQ ID
NO: 46) The antigen construct of the lentiviral vector filed at the CNCM under accession number 1-5762 has the following nucleotidic sequence set forth as SEQ ID NO:
47:
atgggccctaaggccaccctgcaggacatcgtgctgcacttggagccccagaacgagatccccgtggacagcga ggaggagaacgacgaaatcgacggcgtgaaccaccagcacctgcccgcaagaagggccgaaccccagaggcacaccatg ctctg ..
catgtgctgcaaatgcgaggccaggatcaagctggtggtggaaagcagcgccgacgatctgagggcattccagcagctg ttcctgaa caccctctccttcgtgtgccctggggaacccggcaggaccatcccctataaactgcccgacctctgcaccgagctgaac acctccctg caggacattgagatcacctgcgtctactgcaaaaccgtcctggaactgaccgaggtgttcgagttcgccttcaaagacg gcttcgtcgt gtacagggacagcatcccccacgccgcctgccataagctggagaaactgaccaacaccggcctgtacaacctgctgatc cggtgcct gagatgtcagaaggccgagaaactgaggcacctcaacgagaaaaggagattccacaatattgccgggcccggcgacacc ccaacc ..
ctgcacgaatacatgctcgacctgcagcccgaaaccaccgaccccgacagagcccactacaacatcgtgaccttctgct gcaagtgc gactccaccctgagaagatgcgtgcagtccacccacgtggacatccgcacactcgaagacctgctgatgggaaccctgg gcatcgtg tgccccatcgcacccaggccatcaggacccccaggaacggccaagaaagctgccccagctctgcaccgaactgcagacc accatc cacgacatcatcctggaatgcgtctactgtaagcagcagttgctgaggagggaggtgtatgatttcgccttcagagacg gctgcatcgt ctacaggaacccctacgccgtgtgcgacaaatgcctgaagttctactccaagatctccgaatacagacactattgctac agcctgtacg gcaccaccctcgaacagcagtacaacaaacccctgtgcgacctcctgatcaggtgcatcaactgccagaagcccctccg gaccaca acatccgaggaagatggaccggccggtgcatgtcctgctgcaggtcctgataa (SEQ ID NO: 47) and encodes the following amino acid sequence set forth as SEQ ID NO: 48:
MGPKATLQDIVLHLEPQNEIPVDSEEENDEIDGVNHQHLPARRAEPQRH
TMLCMCCKCEARIKLVVESSADDLRAFQQLFLNTLSFVCPGEPGRTIPYKLPDLCTEL
NTSLQDIEITCVYCKTVLELTEVFEFAFKDGFVVYRDSIPHAACHKLEKLTNTGLYNL
LIRCLRCQKAEKLRHLNEKRRFHNIAGPGDTPTLHEYMLDLQPETTDPDRAHYNIVTF
CCKCDSTLRRCVQSTHVDIRTLEDLLMGTLGIVCPIASQAFQDPQERPRKLPQLCTEL
QTTIHDIILECVYCKQQLLRREVYDFAFRDGCIVYRNPYAVCDKCLKFYSKISEYRHY
CYSLYGTTLEQQYNKPLCDLL1RCINCQKPLRFHNIRGRWTGRCMSCCRS (SEQ ID
NO: 48) A lentiviral vector according to the invention may in particular comprise a nucleic acid sequence which encodes an amino acid sequence having at least 90%
sequence identity with the amino acid sequence set forth as SEQ ID NO: 42, the nucleic acid sequence being in particular the nucleic acid sequence SEQ ID NO: 41.
As described herein, a amino acid sequence having at least 90% identity with a reference amino acid sequence encompasses amino acid sequences having at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% and 100% identity with the said reference amino acid sequence.
Accordingly, a lentiviral vector according to the invention may more particularly be selected from the group consisting of lentiviral vectors filed at the CNCM
under accession numbers I-5759, 1-5760, 1-5761 and 1-5762, and is in particular lentiviral vector filed at the CNCM under accession number 1-5762. A lentiviral vector according to the invention may preferably be the lentiviral vector filed at the CNCM under accession number 1-5759 and accordingly preferably comprises the nucleic acid sequence SEQ ID NO: 41.
Lentiviral vector particles according to the invention Another object of the present invention relates to a lentiviral vector particle comprising at least one lentiviral vector according to the invention, and in particular at least one lentirival vector as defined above.
A lentiviral vector particle according to the invention, which contains a lentiviral vector according to the invention, can be produced by recombinant technology known in the art upon transient transfection of cells, for example HEK 293T human cultured cells, by different DNA plasmids:
(i) a packaging plasmid, which expresses at least the Gag, Pol, Rev, Tat and, in some cases, structural and enzymatic proteins necessary for the packaging of the transfer construct;
(ii) a lentiviral vector according to the invention, containing an expression cassette (antigens) and HIV cis-acting factors necessary for packaging, reverse transcription, and integration; and (iii) an envelope-encoding plasmid, in most cases the glycoprotein of vesicular stomatitis virus (VSV.G), a protein that allows the formation of mixed particles (pseudotypes) that can target a wide variety of cells, especially major histocompatibility (MHC) antigen-presenting cells (APCs), including DCs.
Such a method allows producing a recombinant vector particle according to the invention, comprising the following steps of:
i) transfecting a suitable host cell with a lentiviral vector according to the invention;
ii) transfecting said host cell with a packaging plasmid vector, containing viral DNA sequences encoding at least structural and polymerase activities of a retrovirus (preferably lentivirus); Such packaging plasmids are for example described in the art (Dull et al., 1998, J Virol, 72(11):8463-71; Zufferey et al., 1998, J Virol 72(12):9873-80).
iii) culturing said transfected host cell in order to obtain expression and packaging of said lentiviral vector into lentiviral vector particles; and iv) harvesting the lentiviral vector particles resulting from the expression and packaging of step iii) in said cultured host cells.
In order to pseudotype the retroviral particles of the invention, the host cell can be further transfected with one or several envelope DNA plasmid(s) encoding viral envelope protein(s), preferably a VSV-G envelope protein.
This procedure allows obtaining transient production of lentiviral particle vectors by the transfected cells. However, the lentiviral particle vectors may also be continuously produced by cells by stably inserting the packaging genes, the proviral coding DNA, and the envelope gene into the cellular genome. This allows the continuous production of lentiviral particle vectors by the cells without the need for transient transfection. Of course, a combination of these procedures can be used, with some of the DNAs/plasmids integrated into the cellular genome and others provided by transient transfection.
A lentiviral vector particle may be a non-integrating lentiviral vector particle.
Non-integrating vector particles have one or more mutations that eliminate most or all of the integrating capacity of the lentiviral vector particles. For, example, a non-integrating vector particle can contain mutation(s) in the integrase encoded by the lentiviral pol gene that cause a reduction in integrating capacity.
A lentiviral vector particle according to the invention in particular comprises a non-integrating lentiviral vector of the invention.
A lentiviral vector particle according to the invention may comprise a vesicular stomatitis virus glycoprotein (VSVG), in particular a VSV-G Indiana serotype or a VSV-G
New Jersey serotype.
In matter of vaccination strategy, pseudotyped lentiviral vector particles are more likely to escape the immune system, when this latter already developed immunity against lentiviruses. This is particularly helpful when successive injections of similar particle vectors are required for immunizing a patient against a disease.
The lentiviral vector particle may comprise HIV-1 Gag and Pol proteins, and in particular HIV-1 subtype D Gag and Pol proteins.
A further object of the present invention relates to an isolated cell comprising (i.e. transformed with) a lentiviral vector according to the invention or a lentiviral vector particle of the invention.
A cell according to the invention is preferably a mammalian cell, particularly a 5 human cell. Particularly preferred are human non-dividing cells.
Another object of the present invention relates to a vaccine composition comprising a lentiviral vector according to the invention, a lentiviral vector particle according to the invention or a cell according to the invention.
10 A vaccine composition according to the invention comprises a pharmaceutically acceptable medium.
By "pharmaceutically acceptable medium" is meant any solution used to solubilize and deliver a lentiviral vector, a lentiviral vector particle or a cell according to the invention to an individual. A desirable pharmaceutically acceptable carrier is saline. In 15 desirable embodiments, a pharmaceutically acceptable medium includes an adjuvant.
Appropriate physiologically acceptable mediums and their formulations are known to one skilled in the art and described, for example, in Remington's Pharmaceutical Sciences, (20th edition), ed. A. Gennaro, 2003, Lippincott Williams & Wilkins.
20 Implementations according to the invention An object of the present invention relates to a lentiviral vector of the invention, a lentiviral vector particle of the invention or an isolated cell of the invention for use as a medicament or vaccine.
In particular, an object of the present invention relates to a lentiviral vector of 25 the invention, a lentiviral vector particle of the invention or an isolated cell of the invention, in particular in the form of a vaccine composition according to the invention, for use in the treatment or prevention of an HPV induced cancer and metastases thereof, in particular of an HPV-induced cancer.
As previously indicated, HPV induced cancers are cancers induced by an 30 infection by HPV. Methods for the detection of HPV in cancers are known in the art (Aldo Venuti and Francesca Paolini; Head Neck Pathol. 2012 Jul; 6(Suppl 1): 63-74).
HPV induced cancers can in particular be selected from the group consisting of cervical cancer, vaginal cancer, vulvar cancer, penile cancer, anal cancer and oropharyngeal cancer.
Metastases of such cancers according to the invention may in particular be pulmonary metastasis.
Such prevention and/or treatment implies the administration of the considered active, in particular a vaccine composition of the invention as defined above, to an individual in need thereof.
An individual in need thereof is an animal, in particular a mammal, and may more particularly be a human being.
Lentiviral vectors, lentiviral vector particles, cells and vaccine compositions according to the invention are administered to an individual in need thereof by conventional methods, in dosages which are sufficient to elicit an immunological response, which can be easily determined by those skilled in the art.
Lentiviral vectors, lentiviral vector particles, cells and vaccine compositions according to the invention may accordingly be administered intravenously or intramuscularly as indicted below.
Lentiviral vectors, lentiviral vector particles, cells and vaccine compositions according to the invention may alternatively be administered intranasally.
This route of administration is particularly useful in the treatment or prevention of oropharyngeal cancers and/or pulmonary metastases.
Lentiviral vectors, lentiviral vector particles, cells and vaccine compositions according to the invention are administered in a therapeutically effective amount, and may in particular be administered in a dose corresponding to at least 1 x 106, 2 x 106, 5 x 106, 107, 2 x 107, 5 x 107, 1 x 108, 2 x 108, 5 x 108, or at least 1 x 109 TU (Transduction units) of lentiviral vectors according to the invention, in particular in a dose corresponding to at least 1 x 107, 2 x 107, 5 x 107, 1 x 108 TU or at least 1 x 109 TU of lentiviral vectors according to the invention.
In a preferred embodiment, the lentiviral vectors, lentiviral vector particles, cells and vaccine compositions according to the invention are administered in a dose corresponding to at least 1 x 107 TU of lentiviral vectors according to the invention, more particularly at least 1 x 108 TU
of lentiviral vectors according to the invention and in particular at least 1 x 109 TU of lentiviral vectors according to the invention.
By a "therapeutically effective amount" is for example meant the amount of a lentiviral vector or lentiviral vector particle, cell or vaccine composition according to the invention required to generate in a subject one or more of the following effects: an immune response against an HPV induced tumor; a decrease in the size of the HPV
induced tumor, i.e.
a reduction of at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or of 100% of the tumor size in 15 to 45 days compared to the size of the tumor at the time of administration); an increase in the CD8+ and/or CD4+ infiltration in the HPV
induced tumor in 5 to 45 days following the administration; a decrease of CD25+FoxP3+CD4+
Regulatory T
cells (Tregs) in the HPV induced tumor in 5 to 45 days following the administration.
Administration can be performed using well known routes including, for example, intravenous, intramuscular, intranasal, intraperitoneal or sub-cutaneous injection, and in particular intravenous, intranasal or intramuscular, and may be intravenous or intramuscular.
The appropriate dose and regimen will obviously vary between species and individuals depending on many factors. For example, higher doses will generally be required for an effective immune response in a human compared with a mouse.
Lentiviral vectors, lentiviral vector particles, cells and vaccine compositions according to the invention may for example be administered in a single dose, as illustrated in the examples, or in two or more administrations. Practitioners will determine, in each case, the appropriate regimen and dosage for the administration of actives according to the invention.
Lentiviral vectors, lentiviral vector particles, cells and vaccine compositions according to the invention may advantageously be administered in combination with at least one immune checkpoint inhibitor (WI).
An immune checkpoint inhibitor (ICI) according to the invention may in particular be an antibody, in particular an anti-PD-1, an anti-PD-Li (PD-1 Ligand), an anti-CTLA-4 (Cytotoxic T-Lymphocyte-Associated protein 4), an anti-NKG2A, an anti-TIM-3 (T-cell immunoglobulin and mucin-domain containing-3), an anti-TIGIT (T cell immunoreceptor with Ig and ITIM domains) or an anti-LAG-3 (Lymphocyte-activation gene 3) antibody. More particularly, the at least one immune checkpoint inhibitor according to the invention may be a monoclonal antibody selected from the group consisting of anti-PD-1, anti-PD-L1, anti-CTLA-4, anti-NKG2A, anti-TIM-3, anti-TIGIT and anti-LAG-3 monoclonal antibodies. Even more particularly, the at least one immune checkpoint inhibitor according to the invention may be a monoclonal antibody selected from the group consisting of anti-PD-1, anti-PD-L1, anti-CTLA-4, anti-NKG2A, anti-TIM-3 and anti-TIGIT monoclonal antibodies.
An immune checkpoint inhibitor (ICI) according to the invention may more particularly be an antibody, in particular an anti-PD-1, an anti-PD-Li (PD-1 Ligand), an anti-CTLA-4 (Cytotoxic T-Lymphocyte-Associated protein 4), an anti-NKG2A, an anti-TIM-3 (T-cell immunoglobulin and mucin-domain containing-3), an anti-TIGIT (T cell immunoreceptor with Ig and ITIM domains) or an anti-LAG-3 (Lymphocyte-activation gene 3) antibody and even more particularly be an antibody, in particular an anti-PD-1, an anti-PD-Li (PD-1 Ligand), an anti-CTLA-4 (Cytotoxic T-Lymphocyte-Associated protein 4), an anti-NKG2A, an anti-TIM-3 (T-cell immunoglobulin and mucin-domain containing-3) or an anti-TIGIT (T
cell immunoreceptor with Ig and ITIM domains) antibody. More particularly, the at least one immune checkpoint inhibitor according to the invention may be a monoclonal antibody selected from the group consisting of anti-PD-1, anti-PD-L1, anti-CTLA-4, anti-NKG2A, anti-TIM-3, anti-TIGIT and anti-LAG-3 monoclonal antibodies and in particular may be a monoclonal antibody selected from the group consisting of anti-PD-1, anti-PD-L1, anti-CTLA-4, anti-NKG2A, anti-TIM-3 and anti-TIGIT monoclonal antibodies.
An anti-PD-1 monoclonal antibody may for example be selected from the group consisting of Nivolumab, Pembrolizumab and Cemiplimab.
An anti-PD-Li monoclonal antibody may for example be selected from the group consisting of Atezolizumab, Avelumab and Durvalumab.
An anti-CTLA-4 monoclonal antibody may for example be selected from the group consisting of ipilimumab, tremelimumab and quavonlimab.
An anti-NKG2A monoclonal antibody may for example be monalizumab.
An anti-TIM-3 monoclonal antibody may for example be selected from the group consisting of Sym023 and sabatolimab.
An anti-TIGIT monoclonal antibody may for example be tiragolumab.
An anti-LAG-3 monoclonal antibody may for example be relatlimab.
In particular, the ICI may be an anti-PD-Li or an anti-PD-1 monoclonal antibody, and in particular be an anti-PD-1 monoclonal antibody.
The vaccine composition, lentiviral vector, lentiviral vector particle or cell for use according to the invention and the immune checkpoint inhibitor may be administered simultaneously or separately.
Considering the unexpected synergistic advantageous properties obtained when combining a lentiviral vector according to the invention with an immune checkpoint inhibitor as demonstrated in the examples, it can be anticipated that vaccination with a lentiviral vector according to the invention may increase the number of patients eligible for immune checkpoint inhibitor therapy, especially anti-PD-1.
By simultaneously, it is understood that (i) the vaccine composition, lentiviral vector, lentiviral vector particle or cell and (ii) the immune checkpoint inhibitor, may be administered at the same moment or up to the same day or couple of days. In this case, they can be administered in the same composition or in separate compositions.
By separately, it is understood that (i) the vaccine composition, lentiviral vector, lentiviral vector particle or cell according to the invention and (ii) the immune checkpoint inhibitor may be administered with at least several days, for example at least two days of difference.
In particular, when (i) the vaccine composition, lentiviral vector, lentiviral vector particle or cell and (ii) the immune checkpoint inhibitor are administered separately, the vaccine composition, lentiviral vector, lentiviral vector particle or cell according to the invention may be administered before the immune checkpoint inhibitor.
Advantageously, the vaccine composition, lentiviral vector, lentiviral vector particle or cell according to the invention may be administered at least 2 and in particular at least 4 days before the administration of the immune checkpoint inhibitor.
Accordingly, the immune checkpoint inhibitor may advantageously be administered at least 2 and in particular at least 4 days after the vaccine composition, lentiviral vector, lentiviral vector particle or cell according to the invention. The immune checkpoint inhibitor may more particularly be administered 4 days to 1 month after the vaccine composition, lentiviral vector, lentiviral vector particle or cell according to the invention, in particular 4 days to 15 days, and more particularly 4 days to 10 days after the vaccine composition, lentiviral vector, lentiviral vector particle or cell according to the invention.
The vaccine composition, lentiviral vector, lentiviral vector particle or cell for use according to the invention and the immune checkpoint inhibitor may be administered by the same route or through different routes.
The at least one immune checkpoint inhibitor herein is administered in a therapeutically effective dose, i.e. a dose that produces the effects for which it is administered.
The exact dose of immune checkpoint inhibitor will depend on the purpose of the treatment and will be ascertainable by one skilled in the art using known techniques.
The invention further relates to a method for the treatment and/or prevention of an HPV induced cancer in an individual in need thereof, comprising the administration to said 5 individual of at least one lentiviral vector of the invention, lentiviral vector particle of the invention or isolated cell of the invention, in particular in the form of a vaccine composition according to the invention.
The invention further relates to the use of at least one lentiviral vector of the invention, lentiviral vector particle of the invention or isolated cell of the invention, in 10 particular in the form of a vaccine composition according to the invention for the treatment and/or prevention of an HPV induced cancer in an individual in need thereof.
The examples and figures which follow are presented by way of illustration and 15 without implied limitation of the invention.
EXAMPLES
Materials and methods Mice C57BL6jRj mice were purchased from Janvier Labs (Le Genest-Saint-Isle, France). All animals were maintained under specific pathogen-free conditions, and all procedures were performed according to an approved animal protocol and in accordance with recommendations for the proper use and care of laboratory animals. All animal experiments were conducted in accordance with guidelines established by the French and European regulations for the care and use of laboratory animal.
Peptides, antibodies, and reagents To test reactivity of the vaccines according to the invention, 15mer overlapping peptides were ordered from GenScript Biotech (Netherlands) at a purity of >80 %. Anti CD4-VioBlue (Clone REA604), anti-CD45-VioGreen (Clone REA737), Anti-FoxP3-Vio515 (clone REA788), anti-CD279 (PD1)-PE (clone REA802), anti-CD8a-PE-Vio770 (clone REA601), antiCD25-APC (clone REA568), anti CD11c-FITC (clone REA754), anti CD1 lb-APC-Vio770 (clone REA592) were purchased from Miltenyi Biotec. Anti anti-mouse H-2kb (Clone AF6-88.5), anti-CD274 (PD-L1)-APC (Clone MIH5) and anti CD16/CD32 (Clone 2.4G2) were purchased from BD Biosciences.
Antibodies were mixed together with PBS containing 1% FCS (Gibco).
Cyclophosphamide was purchased from Sigma, resuspended in PBS (Gibco) and stored at ¨20 C before use.
Cells HPV-16 E6 and E7-expressing TC-1 tumor cells were generated as previously described (Lin et al. Cancer Res. 1996 Jan 1;56(1):21-6): Primary lung cells of C57BL6 mice were transformed with HPV-16 E6 and E7 genes and with pVEJB-expressing activated human c-Ha-ras oncogene. TC-1 cell line was cultured in Glutamax RPMI medium (Gibco supplemented with 100 U/ml penicillin, 100 1.1g/m1 streptomycin, and 10 %
fetal bovine serum).
Lentiviral vector construction The antigen (Ag) constructs were cloned in a pFlap-B2m-Ag-WPREMutee backbone (see for example W02016012623 for the backbone). The antigen plasmid contains the cPPT/CTS sequence (sequence SEQ ID NO: 37), mandatory for transduction of non-mitotic cells. The U3 promoter sequence was deleted from the 3' long terminal repeat (LTR) to avoid vector replication. The Beta-2microglobuline (02m) promoter controls vaccine antigen expression in all transduced cells, thereby, antigen will preferentially be expressed in APC (Antigen Presenting Cells). In addition, it is devoid of any known enhancer sequence, likely to induce mutagenesis and/or genotoxic effects. The antigen plasmid contains a mutant form of the woodchuck hepatitis B virus (WHV) post-transcriptional regulatory element (WPRE) (sequence SEQ ID NO: 38). The wild-type WPRE region contains a truncated form of the WHV X protein that may have oncogenic properties (Kingsman et al., Gene Ther. 2005 Jan;12(1):3-4). The mutant form of the WPRE used in our construct precludes expression of the truncated X protein by the inclusion of point mutations within the X
protein start codon.
Such mutant WPRE sequence appears not to have oncogenic properties (Themis et al., Mol Ther. 2005 Oct;12(4):763-71).
The packaging plasmid (pNDK) contains the gag-pol sequences from HIV-1 subtype NDK (GenBank acc n : A34828). The proteins nef, vif, vpr, env are not expressed.
Moreover, aspartic acid (D) to valine (V) replacement at position 64 (D64V) in the HIV-1 integrase protein sequence (pol gene) is sufficient to inhibit integration without disturbing the transgene expression in vitro. The lentiviral particles according to the invention are non-integrative particles.
Envelope plasmid: pCMV-VSV-G INDco (Indiana) et pCMV-VSV-G NJco (New Jersey) vectors were constructed by subcloning the Vesicular stomatitis virus (VSV) G
protein (VSV-G) Indiana (GenBank acc. n J02428) and New Jersey (GenBank acc.
n P04882) serotype inserts into the pVAX1 expression vector (Invitrogen).
Mammalian codon-optimized synthetic genes (GeneArt) encoding glycoproteins from the following Vesiculovirus were cloned into a pVAX1 plasmid (Invitrogen): Vesicular Stomatitis Virus Indiana serotype (GenBank FW591952), New Jersey serotype (GenBank FW591956) and Cocal virus (GenBank: AF045556.1).
Lentiviral Vector Particles Production After amplification of HEK 293 T cells (ATCC) in DMEM with 1%
penicillin/streptomycin and 10% FCS, non integrative lentiviral particles were produced by transient calcium phosphate co-transfection of HEK 293 T cells (ATCC) with 3 plasmids (The viral antigen plasmid, an envelope expression plasmid and packaging plasmid) following the method well-known in the art. Culture medium is replaced by serum free medium after 24h. Supernatant is harvested and clarified 48h after transfection by 2500rpm centrifugation.
Viral particles are concentrated by ultracentrifugation (lh at 22000 rpm/88250g 4oC) and resuspended in preservative buffer (20mM Pipes, 75mM NaC1 and 2.5% sucrose).
Vector titration Lentiviral vector titer was determined by quantitative PCR after transduction of cells (HEK 293 T). Aphidicolin is added to HEK293T cells 24h before transduction and is maintained during the whole titration process. Cells are incubated 30 min with lysis buffer (200mM Tris, 1% NP40 and 1% Tween20), containing 50 g/m1 RNase A (sigma).
Proteinase K (0.2mg/m1) is added to suspension and incubated 4h at 56 C. Pairs of primers specific for RRE (element of Ag vector) and GAPDH (in host cell) are used for quantitative PCR. Titer are Titer are expressed as transduction unit (TU)/mL of vector.
Design of HPV vaccine The implemented non-oncogenic immunogenic E6 and E7 protein sequences were selected and modified as previously discussed herein.
In particular, 4 different vaccines were designed comprising the following lentiviral vectors:
- the lentiviral vector filed at the Collection Nationale de Cultures de Microorganismes (CNCM) on October 21, 2021 under accession number 1-5759;
- the lentiviral vector filed at the Collection Nationale de Cultures de Microorganismes (CNCM) on October 21, 2021 under accession number 1-5760;
- the lentiviral vector filed at the Collection Nationale de Cultures de Microorganismes (CNCM) on October 21, 2021 under accession number 1-5761; or - the lentiviral vector filed at the Collection Nationale de Cultures de Microorganismes (CNCM) on October 21, 2021 under accession number 1-5762.
These lentiviral vector particles comprising these functionals lentivirals vectors quantified by vector titration and expressed as transduction units (TU) were implemented in the following exemples.
In vivo Immunogenicity of Lentiviral Vector vaccine (LV vaccine) Naïve C57BL6 female mice were vaccinated with a LV vaccine according to the invention (i.e. lentiviral vector particules of the invention comprising functionnal lentiviral vector of the invention) via intramuscular (i.m.) injection in 50 L of diluent. 14 days later, splenocytes were prepared and restimulated overnight for IFNg ELISPOT with 4 distinct HPV peptide pools (each peptide is 2 g/mL final). Each peptide pools correspond to one of the following non-oncogenic antigen variants: non-oncogenic variant of E6 protein of HPV16, non-oncogenic variant of E7 protein of HPV16, non-oncogenic variant of E6 protein of HPV17 and non-oncogenic variant of E7 protein of HPV17. They are composed of overlapant mers (with overlaps of 11 a.a.) corresponding to the full selected antigen.
In vivo tumor vaccination treatment For in vivo tumor experiments, 1.106 TC-1 cells were injected into 7- to 9-week-old C57BL/6 mice subcutaneously (s.c.) in the right flank (mice were shaved with electric shaver device before injection). When average tumor volume reaches expected range, mice were randomized and injected with the LV vaccine of the invention via intramuscular (i.m.) injection. Mice were monitored for tumor growth by measuring tumor diameter with calipers 3 times a week. Due to ethical reasons, mice with tumors >1500mm3 had to be euthanized.
Immunogenicity of LV vaccine of the invention in human PBMC
Frozen human PBMC (StemCell) were gently thawed, stained during 10min at 37 C with 0.5 M of CFSE (Thennofischer). Cells were then cultured in rond bottom 96 wells plate (0.2x106 cells per well) in complete RPMI : 10% FCS, 10mM Hepes (Gibco), 100 U/ml Penicilline, 100 jig/nil Streptomycine, 0.1mM Non-Essential Amino acids (Gibco) and 1mM
Sodium Pyruvate (Gibco). After 7 days, cells are centrifuged and new complete RPMI
(prewarmed) is added. After another 7 days (14 days total), cells are stained with fluorescent antibodies and data are acquired by flow cytometry (MACSQuant analyzer) Cytometric analysis of tumor immune infiltrates Tumors were treated with the Mouse Tumor Dissociation kit (Miltenyi). Cell suspensions were then filtered through 70 pm-pore filters, treated with Red Blood Cell lysis buffer (Sigma), then washed and centrifuged at 1200 rpm for 5 minutes. The recovered cells 5 were stained as follows.
To detect NK, Near IR LD (Invitrogen), Fc7II/III receptor blocking anti-CD16/CD32 (clone 2.4G2, BD Biosciences), APC-anti-CD11b (clone N418, BD
Biosciences), BV421-anti-NKp46 (clone 29A1.4, Biolegend) were used.
Samples were acquired in an Attune NxT cytometer (Invitrogen) and data 10 analyzed by FlowJo software (Treestar, OR, USA).
Intracellular cytokine staining Splenocytes from immunized mice were obtained by tissue homogenization and passage through 100-pm nylon filters (Cell Strainer, BD Biosciences) and were plated at 4 x 15 106 cells/well in 24-well plates. Splenocytes were stimulated during 6h in the presence of 10 ttg/mL of homologous or control peptide, 1 mg/mL of anti-CD28 (clone 37.51) and 1 pgimL
of anti-CD49d (clone 9C10-MFR4.B) mAbs (BD Biosciences). During the last 3h of incubation, cells were treated with a mixture of Golgi Plug and Golgi Stop, both from BD
Biosciences. PE-Cy7-anti-CD107a (clone 1D4B, BioLegend) mAb was also added to the 20 cultures at this step. Cells were then collected, washed with PBS
containing 3% FBS and 0.1% NaN3 (FACS buffer) and incubated for 25 min at 4 C with a mixture of Near IR
Live/Dead (Invitrogen), Fc7II/III receptor blocking anti-CD16/CD32 (clone 2.4G2), PerCP-Cy5.5-anti-CD3e (clone 145-2C11), PE-Cy7-anti-CD4 (clone RM4-5) and BV711-anti-CD$
(clone 53-6.7) mAbs (BD Biosciences or eBioscience). Cells were washed twice in FACS
25 buffer, then permeabilized by use of Cytofix/Cytoperm kit (BD
Bioscience). Cells were then washed twice with PermWash 1X buffer from the Cytofix/Cytoperm kit and incubated with a mixture of BV421-anti-IL-2 (clone JES6-5H4), FITC-anti-TNF (MP6-XT22), APC-anti-IFN-7 (clone XMG1.2) and BV605-anti-IL-17A (Clone TC11-18H10) mAbs (BD
Biosciences) or a mixture of appropriate control Ig isotypes, during 30 min at 4 C. Cells were 30 then washed twice in PermWash and once in FACS buffer, then fixed with Cytofix (BD
Biosciences) overnight at 4 C. Cells were acquired in an Attune NxT cytometer system (Invitrogen) and data analysis was perfointed using FlowJo software (Treestar, OR, USA).
Example 1: HPV vaccines of the invention are immuno2enic in vivo In order to measure the capacity of vaccines of the invention to induce an immune response, recipient mice were immunized with the 4 vaccines (1 group of 5 mice per tested vaccine and control group).
Mice were injected i.m. with 1x107TU of lentiviral vector particles comprising the lentiviral vector filed at the CNCM under accession number 1-5759, the lentiviral vector filed at the CNCM under accession number 1-5760, the lentiviral vector filed at the CNCM
under accession number 1-5761 or the lentiviral vector filed at the CNCM under accession number 1-5762 or 50 viL of diluent. 14 days later, splenocytes were prepared and restimulated overnight for IFNg ELISPOT with 4 distinct peptide pools (each peptide is 2 g/mL final).
The results obtained are represented in Figure 1.
Example 2: HPV vaccines of the invention vaccine fully eliminates well implanted tumors in vivo TC-1 tumors cells have been extensively used as a preclinical model to study HPV induced Tumors (Kim, J W et al. Gene therapy vol. 11,12 (2004): 1011-8).
These lung tumor cells were modified to express E6 and E7 from HPV16 (Lin et al. Cancer Res. 1996 Jan 1;56(1):21-6).
After s.c. (subcutaneous) injection of TC-1 cells to the mice, solid tumors are rapidly found at injection site and untreated animal tumors grow to reach ethical endpoint in 30-40 days. In order to test the efficacy of lentiviral vector particles of the invention, TC-1 cells were injected s.c. and tumor volume was measured every other day (caliper measurement). When average tumor volume is 70 mm3, mice were randomized and vaccinated with 1x108 TU i.m. of LV-GFP Indiana (as a control), Indiana lentiviral vector particles comprising 1-5759, Indiana lentiviral vector particles comprising 1-5760, Indiana lentiviral vector particles comprising 1-5761 or Indiana lentiviral vector particles comprising 1-5762.
The results obtained are represented in Figure 2.
A rapid and very efficient elimination of tumors is observed in 100% of animals vaccinated with lentiviral vector particles comprising the lentiviral vector filed at the CNCM
under accession number 1-5762 and the lentiviral vector filed at the CNCM
under accession number 1-5759, 87.5% of animals vaccinated with the lentiviral vector filed at the CNCM
under accession number 1-5760 and 75% of animals vaccinated with the lentiviral vector filed at the CNCM under accession number 1-5761.
Vaccines comprising lentiviral vector particles comprising the lentiviral vector filed at the CNCM under accession number 1-5759 and lentiviral vector particles comprising the lentiviral vector filed at the CNCM under accession number 1-5762 show equivalent tumor elimination rates (higher than 1-5760 and 1-5761) but 1-5759 vaccination allows full elimination of tumors in 37.5 days (-F/- 7.4 SD) on average whereas it takes 54.7 days after I-5762 vaccination.
We surprisingly observed that the most immunogenic vector was not the most protective and that the ranking in irnmunogenicity did not apply for anti-tumor efficacy.
Indeed, the lentiviral vector particle comprising the lentiviral vector filed at the CNCM under accession number 1-5759 was the most efficient anti tumoral vaccine whereas the lentiviral vector particles comprising the lentiviral vector filed at the CNCM under accession number I-5760 and 1-5762 were more immunogenic vectors when measuring IFN-y production.
Example 3: A single HPV Vaccine of the invention administration is efficient against tumor relapse Relapse is commonly observed in most cancer type and is defined as a return of the disease after a period of improvement. It is often due to a few tumor cells that survived the initial treatment and form new tumors weeks, month or even years after treatment.
A. In order to mimic a relapse in our model, mice who eliminated primary tumor were rechallenged on the other flank at day 60. Control mice (untreated) were also injected s.c. in order to check on the tumor cell injection.
The results obtained are represented in Figure 3.
This Figure shows that s.c. injection of TC-1 cells in control mice allows formation of solid tumors reaching ethical limits of size in less than 30 days. Tumor growth in rechallenged mice (that previously eliminated right flank tumors after vaccination) were strongly reduced. Tumor growth was observed during the first 6 days and tumor elimination begins afterwards.
Tumors are even fully eliminated 13-16 days after implantation. Single dose vaccination administered on tumor bearing mice allowed full elimination of primary tumor and a strong protection against relapse as these mice rapidly eliminated secondary tumors.
B. A additional experiment was performed with a rechallenge of the mice who eliminated primary tumor on the other flank with 1.106 TC-1 tumor cells 119 days after the first engraftment and were maintained without any therapy. Control mice (untreated) were also injected s.c. in order to check on the tumor cell injection.
The results obtained are represented in Figure 11.
All re-challenged mice were still alive 145 days after the initial tumor challenge, sustaining that a single injection of a vaccine according to the invention effectively promoted a strong antitumor memory protective immune response which efficiently shaped T-cell responses to new challenges.
Example 4: Therapeutic effect of anti HPV vaccine of the invention is dose dependent In order to determine the effect of a lower dose of vaccine, an efficacy study was performed on mice bearing TC1 tumor. Mice were vaccinated with the vaccine according to .. the invention comprising lentiviral vector particles comprising the lentiviral vector filed at the CNCM under accession number 1-5759, at 1x108 or 1x107 TU/mouse.
In particular, 1x106 TC-1 cells were injected in the flank of animals and tumor volume was measured twice a week (caliper measurement). When average tumor volume was 80mm3, mice were randomized and vaccinated with diluent (control), 1x107TU or 1x108TU
(i.m.) of 1-5759 vaccine The results obtained are represented in Figure 4.
Whereas vaccination with 1x108 TU allows total and rapid elimination of tumors (in less than 20 days after vaccination), we observed that 1 x107 TU
vaccination dose had a partial effect on tumor growth. 3/6 (50%) mice were tumor free 22 days after vaccination, and the others first showed a decline 15-18 days post vaccination (during 5-10 days) but tumor growth couldn't be controlled afterwards.
A single low dose (1x107) of a vaccine according to the invention showed a partial inhibition comparable to what is observed with 3 injections of Adenoviral vector based vaccines (Rice,AE et al. Cancer gene therapy vol. 22,9 (2015): 454-62). This suggests that a vaccine according to the invention at optimal dose would be more efficient than adenoviral plateform. Moreover, low dose efficacy would most likely be increased by a second injection of vaccine.
Example 5: Vaccination according to the invention increases CD4+ and CD8+ T cell infiltration and reduces T reg in the treated tumors Tumor infiltration was investigated to understand further the anti-tumoral mechanisms induced after vaccination with a lentiviral vector according to the invention.
.. 1x106 TC1 tumor cells were injected (s.c.) on the flank of animal, and the tumor volume was measured twice a week (caliper measurement). When average tumor volume was 80mm3, mice were randomized and vaccinated with either diluent (control), or 1x107TU
of 1-5759 or 1x108TU (i.m.) of 1-5759.
Ten days after vaccination, tumors were collected, digested and analyzed by flow cytometry. FACS staining was performed and data were acquired on Macsquant facs according to methods well known in the art.
The results obtained are represented in Figure 5.
Tumors from vaccinated mice were infiltrated with more CD8+ and CD4+ T cells compared to control tumors. The percentage of CDS+ T cells and CD4+ T cell in the tumors are increased respectively by about 4 and 3 times. On the other hand, the percentage of CD25+FoxP3+CD4+ Regulatory T cells (Tregs) in tumors is strongly reduced in treated animals.
These observations are of major importance as they suggest that vaccines comprising lentiviral vectors of the invention improve CD8+ T cells and CD4+ T
cell .. recruitment to the tumor but also reduces the percentage of Tregs in the tumors.
Example 6: HPV vaccine of the invention fully eliminates large tumors in vivo Well established tumors are known to be more difficult to eliminate than small and early-stage tumors. Most vaccines tested on TC1 model have weaker effect when administered at latter time point (Rice,AE et al. Cancer gene therapy vol.
22,9 (2015): 454-62; Berraondo, Pedro et al. Cancer research vol. 67,18 (2007): 8847-55). 1x106 TC1 tumors were injected (s.c.) on the flank of animal. When average tumor volume was around 300 rnm3, mice were randomized and vaccinated with diluent (control), or 1x108TU
(i.m.) of the vaccine according to the invention comprising lentiviral vector particles comprising the lentiviral vector filed at the CNCM under accession number 1-5759. Tumor volume was measured twice a week with a caliper.
The results obtained are represented in Figure 6.
It can be seen that a vaccine according to the invention is highly efficient in completely eliminating well-established HPV induced tumors.
Example 7: HPV vaccine of the invention induces human PBMC activation 5 in vitro In order to verify that a vaccine according to the invention can induce a T
cell response in human cells, human PBMC (StemCell) were labelled with CFSE and cultured in absence (unstimulated condition) or presence of a vaccine according to the invention (1-5759).
Cell proliferation and activation were measured after 2 weeks of culture.
CD8+ T cells and CD4+ T cells proliferation (measured by CFSE dilution) and expression of CD25 activation marker were increased by addition of lentiviral vectors of the invention in the culture.
The results obtained are represented in Figure 7.
It can thereby be concluded that antigen presenting cells from the PBMC are able to be transduced by an HPV vaccine according to the invention and to process the antigens to activate T cells.
Example 8: Systemic T-cell immunity induced by HPV vaccine of the invention and phenotype of effector T cells To gain further insight into the quality of the T-cell responses induced, splenocytes from mice injected with a Ctrl Lenti (LV-empty Indiana) or with a vaccine according to the invention comprising lentiviral vector particles comprising the lentiviral vector filed at the CNCM under accession number 1-5759 were left untreated or were stimulated in vitro with a mixture of ETTDPDRAHYNIVTF and PDRAHYNIVTFCCKC
25 E7Hpv16-derived peptides which contain the immunodominant Fl-2Db-restricted RAHYNIVTF epitope (Feltkamp MC et al.. Eur J Immunol 1993;23:2242-9) and were analyzed by IntraCellular Staining (ICS) for IL-2, and TNF-a and IFN-y.
The results obtained are represented in Figure 9A.
Stimulation with these peptides detected CD8+ T-cell responses, in mice vaccinated with a lentiviral vector according to the invention. The functional CD8 T-cell effectors were mainly distributed among IFN-y (single positive), TNF-a+ IFN-y or IL-2+
IFN-y+ (double positive), and IL-2+ TNF-a+ IFN-y+ (triple positive) subsets (voir Figure 9B).
The majority of IFN-y+ CD8 T cells also expressed the surface CD107a degranulating marker, showing the effector properties of these T cells (voir Figure 9B).
Example 9: Features of tumor cells and tumor infiltrating innate immune cells in mice vaccinated with an HPV vaccine of the invention Characterization by cytometry of the intra-tumoral infiltrates at day 11 post-vaccination and thus during the tumor regression phase showed a significant increase in the proportion of Natural Killer (NK) cells in the regressing tumors from mice vaccinated with a vaccine according to the invention comprising lentiviral vector particles comprising the lentiviral vector filed at the CNCM under accession number 1-5759.
Results are shown in Figure 10.
Example 10: Suboptimal Lenti-HPV-07 vaccination acts synergistically with anti-PD1 immunotheraPY
The inventors further investigated the potential synergy between a suboptimal dose of Lenti-HPV-07 (1-5759) vaccination and anti-PD-1 therapy.
The anti-PD-1 treatment began four days (D17, i.e. 17 days after s.c.
administration of the TC-1 cells to the mice) after the injection of the vaccine according to the invention comprising lentiviral vector particles comprising the lentiviral vector filed at the CNCM under accession number 1-5759 (D13, i.e. 13 days after s.c.
administration of the TC-1 cells to the mice). Several injections of anti-PD-1 were performed (D17 as mentioned above, then D20, D22, D24, D28 and D31).
In particular, experiments were performed on three identical groups of tumor-engrafted mice. In the first group (10 mice - group control), the mice were administered a LV-empty Indiana (D13) (as a control) and four days later with an anti-PD-1 monoclonal antibody (D17, then D20, D22, D24, D28 and D31). In the second group (12 mice - group control), the mice were administered a vaccine according to the invention (1-5759) (D13) and four days later with a control antibody (isotype ctrl) (D17, then D20, D22, D24, D28 and D31). In the third group (14 mice), the mice were administered a vaccine according to the invention (D13) (1-5759) and four days later with a mAb anti-PD-1 (D17, then D20, D22, D24, D28 and D31).
The results are presented in Figures 12A and 12B.
A suboptimal dose of the vaccine, which induces an insufficient antitumor T-cell response, acted synergistically with anti-PD-1 to increase the tumor regression rate.
Six mice out of 14 achieved a complete tumor regression, and 2 others showed a partial tumor regression. In the latter, tumor volume decreased by 67 % and then the tumor relapsed 6 to 7 days after the end of anti-PD-1 treatment, highlighting the need for repeated injections of anti-PD-1 until the tumor has completely disappeared. Only 3 out of 12 mice treated with the suboptimal dose of vaccine of the invention alone showed partial tumor regression. Accordingly, mice survival was significantly increased in the group of combo treatment, compared to the mice treated with suboptimal dose of Lenti-HPV-07 (Figure 12B).
Therefore, a synergistic anti-tumor effect can be achieved when Lenti-HPV-07 vaccine candidate is combined with the anti-PD1 checkpoint inhibitory treatment.
Example 11: A single injection of vaccine according to the invention cures mice with pulmonory metastatic foci induced by intravenous injection of TC1-nLuc cells TC1 parental cell line was stably transduced with an integrative lentiviral vector encoding for nanoluciferase reporter and puromycin N-acetyl-transferase (for selection), under the ubiquitin (UBC) promoter. After selection on puromycin, cells were subcloned to obtain TC1-nLuc cell line.
Six-week-old C57BL/6JRj mice, purchased from Janvier Laboratory, were intravenously injected with 150 000 TC1-nLuc cells. At day 5, mice were injected with a single dose of 1.109 TU / mouse of Lenti-HPV-07 or Control Lenti (empty vector) via intramuscular route.
Bioluminescence imaging on live animals was performed using the IVIS
Imaging System (IVIS Spectrum, Perkin Elmer) coupled to a charged-couple device camera.
Prior to bioluminescence imaging, mice were anesthetized with 2% isoflurane in oxygen and maintained in a control flow of 1.5% isoflurane in oxygen through a nose cone during imaging. The substrate furimazine (Z108) (provided by Dr. Yves Janin, Institut Pasteur) was dissolved at 2 mg/ml in acidic ethanol. Z108 was further diluted in sterile D-PBS to the desired concentration (0.4 mg/kg) prior to intravenous injection. Mice were then immediately placed in the imaging chamber and imaged. Sequential images were captured under the auto-exposure settings with a maximum exposure time of 2 minutes.
Images from each experimental set were analyzed using Living Image Software (Ver. 2.50.1 Xenogen). Measurements from regions of interest were performed and the luminescence values were evaluated as total flux (photons/second). Mice bellies and torsos were shaved to enhance signals to noise ratio. The baseline signals were obtained from untreated mice, i.e., injected with neither TC1-nLuc cells, nor lentiviral vectors, yet injected with Z108.
The results obtained are represented in Figures 13A and 13B.
The inventors had firmly established that a single intramuscular injection of Lenti-HPV-07 vaccine (1-5759) according to the invention completely eradicates, in 100% of animals, subcutaneously engrafted TC1 tumors. However, in human, many cancers, including HPV-induced cancers, are located in mucosa' sites.
Therefore, the present experiment evaluated the capacity of Lenti-HPV-07 to inhibit tumor growth in a mucosal site.
To address this question, a TC1 cell line expressing stably the nanoluciferase reporter gene (TC1-nLuc) was developed. After TC1-nLuc intravenous injection, mice readily developed lung metastatic foci.
Longitudinal tumor outgrowth was followed on live animals by bioluminescence imaging.
Five days after tumor injection, mice received a single intramuscular injection of Lenti-HPV-07 (1.109 TU / mouse) or a Control Lenti (empty vector) (Figure 13A).
All mice having received the Lenti-HPV-07 were cured at day 22 post tumor injection, whereas pulmonary metastatic foci continued to grow in the control group. The difference observed between the average of the bioluminescence signal in the two groups was largely statistically significant (Figures 13 A and B).
This observation indicates in a clear-cut manner that a vaccine according to the invention is able to eradicate lung tumors, as efficiently as subcutaneously established tumors.
SEQUENCES
SEQ ID NO: 1 is a nucleic acid sequence encoding the E6 protein from HPV 16 (NC_001526.4) ATGCACCAAAAGAGAACTGCAATGTTTCAGGACCCACAGGAGCGACCCAGAAAGTTACC
AC AGTTATGC ACAGAGCTGCAAACAACTATACATGATATAATATTAGAATGTGTGTACTG
CAAGCAACAGTTACTGCGACGTGAGGTATATGACTTTGCTTTTCGGGATTTATGCATAGT
ATATAGAGATGGGAATCCATATGCTGTATGTGATAAATGTTTAAAGTTTTATTCTAAAATT
AGTGAGTATAGACATTATTGTTATAGTTTGTATGGAACAACATTAGAACAGCAATACAAC
AAACCGTTGTGTGATTTGTTAATTAGGTGTATTAACTGTCAAAAGCCACTGTGTCCTGAAG
AAAAGCAAAGAC ATCTGGACAAAAAGCAAAGATTCCATAATATAAGGGGTCGGTGGACC
GGTCGATGTATGTCTTGTTGCAGATCATCAAGAACACGTAGAGAAACCCAGCTGTA A
SEQ ID NO: 2 is the nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 16 GACCCCCAAGAACGGCCCAGAAAGCTGCCCCAGCTGTGCACCGAGCTGCAGACCACCAT
CCACGACATCATCCTGGAATGCGTGTACTGCAAGC AGCAGCTGCTGAGAAGAGAGGTGT
ACGACTTCGCCTTCCGGGACCTGTGCATCGTGTACCGGAACCCCTACGCCGTGTGCGACA
AGTGCCTGAAGTTCTACAGCAAGATCAGCGAGTACCGGCACTACTGCTACAGCCTGTACG
GCACCACCCTGGAACAGCAGTACAACAAGCCCCTGTGCGACCTGCTGATCAGATGCATCA
ACTGCC AGAAGCCCCTGCGGTTCCACA ACATCCGGGGCAGATGGACCGGCCGGTGCATG
AGCTGCTGCAGA
SEQ ID NO: 3 is the nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 16 ATGGGCACCCTGGGCATCGTGTGCCCCATCGACCCCCAAGAACGGCCCAGAAAGCTGCCC
CAGCTGTGCACCGAGCTGCAGACCACCATCCACGACATCATCCTGGAATGCGTGTACTGC
AAGCAGCAGCTGCTGAGAAGAGAGGTGTACGACTTCGCCTTCCGGGACCTGTGCATCGTG
TACCGGAACCCCTACGCCGTGTGCGACAAGTGCCTGAAGTTCTACAGCAAGATCAGCGAG
TACCGGCACTACTGCTACAGCCTGTACGGCACCACCCTGGAACAGCAGTACAACAAGCCC
CTGTGCGACCTGCTGATCAGATGCATCAACTGCCAGAAGCCCCTGCGGTTCCACAACATC
CGGGGCAGATGGACCGGCCGGTGCATGAGCTGCTGCAGA
SEQ ID NO: 4 is the nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 16 ATGGACCCCCAAGAACGGCCCAGAAAGCTGCCCCAGCTGTGCACCGAGCTGCAGACCAC
CATCCACGACATCATCCTGGAATGCGTGTACTGCAAGCAGCAGCTGCTGAGAAGAGAGG
TGTACGACTTCGCCTTCCGGGACCTGTGCATCGTGTACCGGAACCCCTACGCCGTGTGCG
ACAAGTGCCTGAAGTTCTACAGCAAGATCAGCGAGTACCGGCACTACTGCTACAGCCTGT
ATCAACTGCCAGAAGCCCCTGCGGTTCCACAACATCCGGGGCAGATGGACCGGCCGGTG
CATGAGCTGCTGCAGA
SEO ID NO: 5 is the nucleic acid sequence encoding a non-oncogenic variant of the E6 10 protein from HPV 16 TTTCAGGACCCCCAGGAAAGGCCCAGGAAGTTGCCCCAGCTCTGCACCGAACTGCAGACC
ACCATTCATGACATCATCCTCGAATGCGTGTACTGCAAGCAGCAGCTCCTGAGGAGGGAG
GTGTACGATTTCGCCTTCAGAGACGGCTGTATCGTCTACAGGAACCCCTATGCCGTCTGC
GACAAATGCCTGAAGTTTTATTCCAAGATCTCCGAGTACAGGCACTATTGCTACAGCCTG
ATCAACTGCCAGAAGCCCCTGAGGTTCCACAACATCCGCGGCAGGTGGACCGGAAGGTG
CATGTCCTGCTGCAGG
SEO ID NO: 6 is the nucleic acid sequence encoding a non-oncogenic variant of the E6 20 protein from HPV 16 TTCCAGGACCCCCAGGAGAGGCCCAGGAAACTGCCCCAGTTGTGCACCGAGCTCCAGAC
AACCATCCACGACATCATCCTGGAGTGCGTGTACTGTAAGCAGCAGTTGCTGAGGAGAGA
GGTGTATGACTTCGCCTTCAGAGACGGATGCATTGTCTATAGGAACCCCTACGCCGTGTG
CGACAAGTGCCTGAAGTTCTACTCCAAGATCAGTGAGTACAGGCATTACTGCTACAGCCT
CATCAACTGCCAGAAGCCCCTCAGGTTCCACAACATCCGGGGCAGGTGGACCGGAAGGT
GCATGTCCTGCTGCAGGTCC
SE0 ID NO: 7 is the amino acid sequence of the Wild Type (WT) E6 protein from GNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHL
DKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL
SEC/ ID NO: 8 is the amino acid sequence of a non-oncogenic variant of the E6 protein from DPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRNPYAVCDKCLKF
YSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLRFHNIRGRWTGRCMSCCR
SEQ ID NO: 9 is the amino acid sequence of a non-oncogenic variant of the E6 protein from MGTLGIVCPIDPQERPRKLPQLCTELQTTIHDIILECV YCKQQLLRREVYDFAFRDLCIV YRNPY
AVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLRFHNIRGRWTGRC
MSCCR
SEQ ID NO: 10 is the amino acid sequence of a non-oncogenic variant of the E6 protein from HPV 16 MDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRNPYAVCDKCL
KFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLRFHNIRGRWTGRCMSCCR
.. SEQ ID NO: 11 is the amino acid sequence of a non-oncogenic variant of the E6 protein from HPV 16 FQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDGCIVYRNPYAVCDKC
LKFYSKISEYRRYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLRFHNIRGRWTGRCMSCCR
SEQ ID NO: 12 is the amino acid sequence of a non-oncogenic variant of the E6 protein from HPV 16 FQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDGCIVYRNPYAVCDKC
LKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLRFHNIRGRWTGRCMSCCRS
.. SEQ ID NO: 13 is the nucleic acid sequence encoding the E7 protein from HPV
(iii) does not comprise a constitutive enhancer sequence;
(iv) comprises an MHC Class I promoter, and in particular a 32-microglobulin promoter;
(v) comprises a cPPT/CTS sequence, having in particular the sequence set forth 20 as sequence SEQ ID NO: 37; and (vi) comprises a mutant form of the woodchuck hepatitis B virus (WHY) post-transcriptional regulatory element (WPRE), having in particular the nucleic acid sequence set forth as sequence SEQ ID NO: 38.
25 As previously mentioned, a lentiviral vector according to the invention is characterized in that it comprises:
- at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen, - at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen, - at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen, and - at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen.
The at least four, and in particular the four, distinct nucleic acid sequences encoding HPV antigens of a lentiviral vector of the invention may in particular be fused together, forming a single antigenic nucleic acid sequence encoding a single antigenic fusion protein under the control of a single promoter sequence, in particular (i) in the absence of any linking sequence (also termed spacer herein) between each of the at least four distinct nucleic acid sequences or (ii) with a linking sequence (or spacer) between at least two of the at least four distinct nucleic acid sequences, and more particularly with a a linking sequence (or spacer) between each of the at least four distinct nucleic acid sequences.
A nucleic acid sequence encoding a non-oncogenic Human papillomavirus 16 (HPV16) protein E6 antigen may in particular have a nucleic acid sequence encoding an amino acid sequence having at least 80 % sequence identity with the amino acid sequence set forth as SEQ ID NO: 7.
As described herein, an amino acid sequence having at least 80 % amino acid identity with a reference amino acid sequence encompasses amino acid sequences having at least 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% and 99% amino acid identity with the said reference amino acid sequence.
In particular, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 16 (HPV16) protein E6 antigen may in particular have a nucleic acid sequence having at least 80% sequence identity with a nucleic acid sequence selected from the group consisting of the nucleic acid sequences set forth as SEQ ID NO: 2, SEQ ID NO:
3, SEQ ID
NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6.
As described herein, a nucleic acid sequence having at least 80% nucleotide identity with a reference nucleic acid sequence encompasses nucleic acid sequences having at least 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% and 99% nucleotide identity with the said reference nucleic acid sequence.
In a particular embodiment, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 16 (HPV16) protein E6 antigen may in particular have a nucleic acid sequence selected from the group consisting of the nucleic acid sequences set forth as SEQ ID
NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6.
A nucleic acid sequence encoding a non-oncogenic Human papillomavirus 16 (HPV16) protein E6 antigen may in particular have a nucleic acid sequence encoding an amino acid sequence having at least 80% sequence identity with an amino acid sequence selected from the group consisting of the amino acid sequences set forth as SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 and SEQ ID NO: 12.
In a particular embodiment, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 16 (HPV16) protein E6 antigen may in particular have a nucleic acid sequence encoding an amino acid sequence selected from the group consisting of the amino acid sequences set forth as SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID
NO: 11 and SEQ ID NO: 12.
A nucleic acid sequence encoding a non-oncogenic Human papillomavirus 16 (HPV16) protein E7 antigen may in particular have a nucleic acid sequence encoding an amino acid sequence having at least 68 % sequence identity with the amino acid sequence set forth as SEQ ID NO: 16.
As described herein, an amino acid sequence having at least 68 % amino acid identity with a reference amino acid sequence encompasses amino acid sequences having at least 69 %, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% and 99% amino acid identity with the said reference amino acid sequence.
In particular, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 16 (HPV16) protein E7 antigen may in particular have a nucleic acid sequence having at least 80% sequence identity with a nucleic acid sequence selected from the group consisting of the nucleic acid sequences set forth as SEQ ID NO: 14 and SEQ ID
NO: 15.
As described herein, a nucleic acid sequence having at least 80% nucleotide identity with a reference nucleic acid sequence encompasses nucleic acid sequences having at least 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% and 99% nucleotide identity with the said reference nucleic acid sequence.
In a particular embodiment, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 16 (HPV16) protein E7 antigen may in particular have a nucleic acid sequence selected from the group consisting of the nucleic acid sequences set forth as SEQ ID
NO: 14 and SEQ ID NO: 15.
A nucleic acid sequence encoding a non-oncogenic Human papillomavirus 16 (HPV16) protein E7 antigen may in particular have a nucleic acid sequence encoding an amino acid sequence having at least 80% sequence identity with an amino acid sequence selected from the group consisting of the amino acid sequences set forth as SEQ ID NO: 17 and SEQ ID NO: 18.
In a particular embodiment, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 16 (HPV16) protein E7 antigen may in particular have a nucleic acid sequence encoding an amino acid sequence selected from the group consisting of the amino acid sequences set forth as SEQ ID NO: 17 and SEQ ID NO: 18.
A nucleic acid sequence encoding a non-oncogenic Human papillomavirus 18 (HPV18) protein E6 antigen may in particular have a nucleic acid sequence encoding an amino acid sequence having at least 60 % sequence identity with the amino acid sequence set forth as SEQ ID NO: 24.
As described herein, an amino acid sequence having at least 60 % amino acid identity with a reference amino acid sequence encompasses amino acid sequences having at least 61 %, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% and 99% amino acid identity with the said reference amino acid sequence.
In particular, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 18 (HPV18) protein E6 antigen may in particular have a nucleic acid sequence having at least 80% sequence identity with a nucleic acid sequence selected from the group consisting of the nucleic acid sequences set forth as SEQ ID NO: 20, SEQ ID
NO: 21, SEQ
ID NO: 22 and SEQ ID NO: 23.
As described herein, a nucleic acid sequence having at least 80% nucleotide identity with a reference nucleic acid sequence encompasses nucleic acid sequences having at least 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% and 99% nucleotide identity with the said reference nucleic acid sequence.
In a particular embodiment, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 18 (HPV18) protein E6 antigen may in particular have a nucleic acid sequence selected from the group consisting of the nucleic acid sequences set forth as SEQ ID
NO: 20, SEQ ID NO: 21, SEQ ID NO: 22 and SEQ ID NO: 23.
A nucleic acid sequence encoding a non-oncogenic Human papillomavirus 18 (HPV18) protein E6 antigen may in particular have a nucleic acid sequence encoding an amino acid sequence having at least 80% sequence identity with an amino acid sequence selected from the group consisting of the amino acid sequences set forth as SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27 and SEQ ID NO: 28.
In a particular embodiment, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 18 (HPV18) protein E6 antigen may in particular have a nucleic acid sequence encoding an amino acid sequence selected from the group consisting of the amino acid sequences set forth as SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27 and SEQ ID
NO: 28.
A nucleic acid sequence encoding a non-oncogenic Human papillomavirus 18 (HPV18) protein E7 antigen may in particular have a nucleic acid sequence encoding an amino acid sequence having at least 83% sequence identity with the amino acid sequence set forth as SEQ ID NO: 33.
As described herein, an amino acid sequence having at least 83% amino acid identity with a reference amino acid sequence encompasses amino acid sequences having at least 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%
and 99% amino acid identity with the said reference amino acid sequence.
In particular, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 18 (HPV18) protein E7 antigen may in particular have a nucleic acid sequence having at least 80% sequence identity with a nucleic acid sequence selected from the group consisting of the nucleic acid sequences set forth as SEQ ID NO: 30, SEQ ID NO: 31 and SEQ ID NO: 32.
As described herein, a nucleic acid sequence having at least 80% nucleotide identity with a reference nucleic acid sequence encompasses nucleic acid sequences having at least 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% and 99% nucleotide identity with the said reference nucleic acid sequence.
In a particular embodiment, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 18 (HPV18) protein E7 antigen may in particular have a nucleic acid sequence selected from the group consisting of the nucleic acid sequences set forth as SEQ ID
NO: 30, SEQ ID NO: 31 and SEQ ID NO: 32.
A nucleic acid sequence encoding a non-oncogenic Human papillomavirus 18 (HPV18) protein E7 antigen may in particular have a nucleic acid sequence encoding an amino acid sequence having at least 80% sequence identity with an amino acid sequence selected from the group consisting of the amino acid sequences set forth as SEQ ID NO: 34, 5 SEQ ID NO: 35 and SEQ ID NO: 36.
In a particular embodiment, a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 18 (HPV18) protein E7 antigen may in particular have a nucleic acid sequence encoding an amino acid sequence selected from the group consisting of the amino acid sequences set forth as SEQ ID NO: 34, SEQ ID NO: 35 and SEQ ID NO: 36.
As indicated above, a lentiviral vector according to the invention comprises:
- at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen (also termed herein noE6-HPV16), - at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen (also termed herein noE7-HPV16), - at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen (also termed herein noE6-HPV18), and - at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen (also termed herein noE7-HPV18).
In a particular embodiment, a lentiviral vector according to the invention, and in particular a non-integrative lentiviral vector of the invention:
(i) comprises a nucleic acid sequence encoding a non-oncogenic Human papillomavirus 16 (HPV16) protein E6 antigen; a nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen; a nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen and a nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen;
the nucleic acid sequences encoding non-oncogenic HPV antigens being in particular fused together, forming a single antigenic nucleic acid sequence encoding a single antigenic fusion protein; under the control of a single promoter sequence, more particularly in the absence of any linking sequence between each of them;
(ii) comprises a 3' long terminal repeat (LTR) which is devoid of its U3 promoter sequence;
(iii) does not comprise a constitutive enhancer sequence;
(iv) comprises an MHC Class I promoter, and in particular a 132-microglobulin promoter;
(v) comprises a cPPT/CTS sequence, having in particular the sequence set forth as sequence SEQ ID NO: 37; and (vi) comprises a mutant form of the woodchuck hepatitis B virus (WHV) post-transcriptional regulatory element (WPRE), having in particular the nucleic acid sequence set forth as sequence SEQ ID NO: 38.
A lentiviral vector according to the invention may more particularly comprise:
- a nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen, the nucleic acid sequence having at least 80%
sequence identity with a nucleic acid sequence selected from the group consisting of the nucleic acid sequences set forth as SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID
NO:
6, the nucleic acid sequence being in particular selected from the group consisting of the nucleic acid sequences set forth as SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID
NO: 5 and SEQ ID NO: 6;
- at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen, the nucleic acid sequence having at least 80%
sequence identity with a nucleic acid sequence selected from the group consisting of the nucleic acid sequences set forth as SEQ ID NO: 14 and SEQ ID NO: 15, the nucleic acid sequence being in particular selected from the group consisting of the nucleic acid sequences set forth as SEQ ID NO: 14 and SEQ ID NO: 15;
- at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen, the nucleic acid sequence having at least 80%
sequence identity with a nucleic acid sequence selected from the group consisting of the nucleic acid sequences set forth as SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO:
22 and SEQ ID NO: 23, the nucleic acid sequence being in particular selected from the group consisting of the nucleic acid sequences set forth as SEQ ID NO: 20, SEQ ID
NO: 21, SEQ
ID NO: 22 and SEQ ID NO: 23; and - at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen, the nucleic acid sequence having at least 80%
sequence identity with a nucleic acid sequence selected from the group consisting of the nucleic acid sequences set forth as SEQ ID NO: 30, SEQ ID NO: 31 and SEQ ID NO: 32, the nucleic acid sequence being in particular selected from the group consisting of the nucleic acid sequences set forth as SEQ ID NO: 30, SEQ ID
NO: 31 and SEQ ID NO: 32;
the nucleic acid sequences encoding non-oncogenic HPV antigens being in particular fused together, forming a single antigenic nucleic acid sequence encoding a single antigenic fusion protein; under the control of a single promoter sequence, more particularly in the absence of any linking sequence between each of them.
The at least four, and in particular the four, distinct nucleic acid sequences encoding HPV antigens in a lentiviral vector according to the invention, and in particular a non-integrative lentiviral vector of the invention, may be in any order in the traditional 5' to 3' reading direction (from 5' end to 3' end).
In particular, the four distinct nucleic acid sequences encoding HPV antigens noE6-HPV16, noE7-HPV16, noE6-HPV18 and noE7-HPV18 as defined above may be in any order, in the traditional 5' end to 3' end reading direction, among the 24 possible combinations in lentiviral vectors according to the invention, and in particular non-integrative lentiviral vectors according to the invention.
In a particular embodiment, the order of the at least four distinct nucleic acid sequences, from 5' end to 3' end, is selected from the group consisting of:
(a) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen;
(b) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen;
(c) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen; and (d) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen, the nucleic acid sequences encoding non-oncogenic HPV antigens being in particular fused together, forming a single antigenic nucleic acid sequence encoding a single antigenic fusion protein; under the control of a single promoter sequence, more particularly in the absence of any linking sequence between each of them.
These orders are represented in Figures 8A to 8D.
The order of the at least four distinct nucleic acid sequences, from 5' end to 3' end, in a lentiviral vector according to the invention may more particularly be:
(d) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen, the nucleic acid sequences encoding non-oncogenic HPV antigens being in particular fused together, forming a single antigenic nucleic acid sequence encoding a single antigenic fusion protein; under the control of a single promoter sequence, more particularly in the absence of any linking sequence between each of them.
Preferably, the order of the at least four distinct nucleic acid sequences, from 5' end to 3' end, in a lentiviral vector according to the invention is:
(a) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen, the nucleic acid sequences encoding non-oncogenic HPV antigens being in particular fused together, forming a single antigenic nucleic acid sequence encoding a single antigenic fusion protein; under the control of a single promoter sequence, more particularly in the absence of any linking sequence between each of them.
More preferably, the order of the at least four distinct nucleic acid sequences, from 5' end to 3' end, in a lentiviral vector according to the invention is:
(a) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen, the nucleic acid sequences encoding non-oncogenic HPV antigens being fused together and forming a single antigenic nucleic acid sequence encoding a single antigenic fusion protein; under the control of a single promoter sequence, in the absence of any linking sequence between each of them.
These four different groups of antigens constructs have been respectively implemented in the present examples in:
- the lentiviral vector filed at the Collection Nationale de Cultures de Microorganismes (CNCM) on October 21, 2021 under accession number 1-5759 (above order (a));
- the lentiviral vector filed at the Collection Nationale de Cultures de Microorganismes (CNCM) on October 21, 2021 under accession number 1-5760 (above order (b));
- the lentiviral vector filed at the Collection Nationale de Cultures de Microorganismes (CNCM) on October 21, 2021 under accession number 1-5761 (above order (c)); or - the lentiviral vector filed at the Collection Nationale de Cultures de Microorganismes (CNCM) on October 21, 2021 under accession number 1-5762 (above order (d)).
Accordingly, the antigen construct of the lentiviral vector filed at the CNCM
under accession number 1-5759 has the following nucleotidic sequence set forth as SEQ ID
NO: 41:
atgcccggagacacccccaccctgcacgaatacatgctggacctgcagcccgaaaccaccgaccccgaccgcg ctcactacaacatcgttacattctgttgtaaatgcgactccaccctgagaagatgcgtgcagtccacccacgtggacat caggaccctgg aggacctcctcatgggaaccctgggtatcgtctgccccatcgcctcccaggcattcaggacccccaggaaaggcccagg aagttgcc ccagctctgcaccgaactgcagaccaccattcatgacatcatcctcgaatgcgtgtactgcaagcagcagctcctgagg agggaggtg tacg atttcg ccttc ag ag acggctgtatcgtctac agg aaccc ctatgccgtctgcg ac aaatgcctg aagttttattcc aag atctccg a gtacaggcactattgctacagcctgtatgggaccaccctggagcagcagtacaacaagcccctgtgcgacctcctgatc aggtgcatc aactgccagaagcccctgaggttccacaacatccgcggcaggtggaccggaaggtgcatgtcctgctgcaggtccgccg gccccgg acctaaagccaccctccaggacatcgttctccacctggagccccagaacgagatccccgtggactcagaagaggagaac gacgaga tcgacggcgtcaaccaccagcacctgcccgctcgcagagccgaaccccagagacacaccatgctctgcatgtgctgcaa atgcgaa gcccggattaagttggtggtggaaagcagcgccgacgatctgagggccttccagcagctcttcctcaacaccctgtcat cgtgtgccc ctgggtgggcgagcccggtagaaccatcccctacaagctgcccgatctgtgcacagagctgaacacctccctgcaggac atcgagat cacctgcgtctactgcaagaccgtgctggaactgaccgaggtgttcgaattcgcclicaaggacggcttcgtggtgtac agggacagc attccccacgccgcctgccataagctggagaaactgaccaacaccggactgtataacctgctgatcaggtgtctgaggt gccagaagg cagagaaactgagacatctgaacgagaaaaggaggttccacaatattgccgggcactgataa (SEQ ID NO: 41) and encodes the following amino acid sequence set forth as SEQ ID NO: 42:
MPGDTPTLHEYMLDLQPETTDPDRAHYNIVTFCCKCDSTLRRCVQSTHV
RREVYDFAFRDGCIVYRNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLC
DLLIRCINCQKPLRFHNIRGRWTGRCMS CCRS AGPGPKATLQDIVLHLEPQNEIPVDS E
EENDEIDGVNHQHLPARRAEPQRHTMLCMCCKCEARIKLVVESS ADDLRAFQQLFLN
TLSFVCPWVGEPGRTIPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDGF
(SEQ ID NO: 42) The antigen construct of the lentiviral vector filed at the CNCM under accession number 1-5760 has the following nucleotidic sequence set forth as SEQ ID NO:
43:
atgttccaggacccccaggagaggccccggaagttgccccagctgtgcaccgagctgcagaccaccatccacga catcatcctcgaatgcgtgtactgcaagcagcagctgctgaggagggaggtgtatgactttgccacagagacggatgca ttgtctaca ggaacccctacgccgtgtgcgacaaatgcctgaagttctactccaagatcagcgagtacaggcactactgctactccct gtacggcac caccctcgaacagcagtacaacaaacccctgtgcgacctcctgattaggtgcatcaactgccagaagcccctcaggttc cacaacatc cgcggccgctggaccggccgatgcatgtcttgctgcaggggccccgacgacccctacaagctccccgacctgtgcaccg aactcaa cacctccctgcaggacatcgagatcacctgcgtgtattgcaagaccgtgctggagctgaccgaggttttcgaatttgcc tttaaggacgg cttcgtcgtgtatagggactccatcccccacgccgcctgccataagctggagaagctcaccaacaccggactgtataat ctgctgatca ggtgcctcaggtgccagaaggcagaaaagctgaggcatctcaacg agaagcgccggttccacaatattgccggccccggagac ac ccccacactccatgagtacatgctcgacctgcagcccgaaaccaccgaccccgacagagcccactacaacatcgtgacc ttctgctgc aagtgcgactccaccctgagaagatgcgtgcagtccacccacgtggacatccgcacactcgaagacctgctgatgggaa ccctggg catcgtgtgccccatcggccccgatgacaaggccaccttgcaggacatcgtgctgcacctggaaccacagaacgagatc cccgtcga ctccgaagaagaaaacgacgaaatcgacggagtgaatcaccagcacctgcccgccagaagggccgagcctcagagacac accat gctctgcatgtgctgcaaatgcgaagccaggattaagctggtggtggagagcagcgccgacgacctgagggccaccagc agctctt cctgaacacactgtccttcgtgtgcccctgggcctgataa (SEQ ID NO: 43) and encodes the following amino acid sequence set forth as SEQ ID NO: 44:
MFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDG
CIVYRNPYAVCDKCL KFYS KIS EYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPL
RFHNIRGRWTGRCMSCCRGPDDPYKLPDLCTELNTS LQDIEITCVYCKTVLELTEVFE
FAFKDGFVVYRDS IPHAACHKLEKLTNT GLYNLLIRCLRCQKAEKLRHLNEKRRFHNI
AGPGDTPTLHEYMLDLQPETTDPDRAHYNIVTFCCKCDSTLRRCVQSTHVDIRTLEDL
LMGTLGIVCPIGPDDKATLQDIVLHLEPQNEIPVDSEEENDEIDGVNHQHLPARRAEP
QRHTMLCMCCKCEARIKLVVESSADDLRAFQQLFLNTLSFVCPWA (SEQ ID NO: 44) The antigen construct of the lentiviral vector filed at the CNCM under accession number 1-5761 has the following nucleotidic sequence set forth as SEQ ID NO:
45:
atgaggcggccctacaagctgcccgacctgtgcaccgagctgaacacctccctgcaggacatcgagatcacctg cgtgtactgcaagaccgtgctggagctgaccgaggtgttcgaattcgcattcaaggacggattcgtcgtgtatagggac agcattccac acgccgcctgccacaagctggagaaattgactaac accggactgtataatctgctgatccggtgcctgaggtgtcagaaggccgaga agctgaggcatctgaacgagaaaaggagattccacaatatcgccggacacttccaggacccccaggagaggcccaggaa actgcc ccagttgtgcaccgagctccagacaaccatccacgacatcatcctggagtgcgtgtactgtaagcagcagttgctgagg agagaggtg tatgacttcgccttcagagacggatgcattgtctataggaacccctacgccgtgtgcgacaagtgcctgaagttctact ccaagatcagt gagtacaggcattactgctacagcctgtatggaaccacactggaacagcagtacaacaagcccctgtgcgacctcctga ttaggtgcat caactgccagaagcccctcaggaccacaacatccggggcaggtggaccggaaggtgcatgtcctgctgcaggtccgccg gccccg gacctaaagccaccctccaggacatcgtgctgcacctggagccccagaacgagatccccgtcgactcagaggaggagaa cgacga aattgacggcgtcaaccaccagcacctgcccgctcgcagagccgaaccccagagacacaccatgctctgcatgtgctgc aaatgcga ggcccggattaagctggtggtggagagctccgccgacgatctgagagccttccagcagctcttcctgaacaccctgtcc ttcgtgtgcc cctgggccggtcccggtgacacacctaccctgcacgagtacatgctcgatctgcagcccgagaccaccgaccccgatcg cgcacac tacaacatcgtgaccttctgctgcaaatgtgacagcaccctgagacggtgcgtccagtccacccacgttgacatccgca ccctcgaaga cctgctcatgggaaccctgggcatcgtgtgccccatcgcctgataa (SEQ ID NO: 45) and encodes the following amino acid sequence set forth as SEQ ID NO: 46:
MRRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDGFVVYR
DSIPHAACHKLEKLTNTGLYNLLIRCLRCQKAEKLRHLNEKRRFHNIAGHFQDPQERP
RKLPQLCTELQTTIHDIILECVYC KQQLLRREVYDFAI-RDGCIVYRNPYAVCDKCLKF
YS KIS EYRHYCYSLY GTTLEQQYNKPLCDLLIRCINCQKPLRFHNIRGRWTGRCMSCC
RSAGPGPKATLQDIVLHLEPQNEIPVDSEEENDEIDGVNHQHLPARRAEPQRHTMLC
MCCKCEARIKLVVES S ADDLRAFQQLFLNTLS FVCPWAGPGDTPTLHEYMLDLQPET
TDPDRAHYNIVTFCCKCDSTLRRCVQSTHVDIRTLEDLLMGTLGIVCPIA (SEQ ID
NO: 46) The antigen construct of the lentiviral vector filed at the CNCM under accession number 1-5762 has the following nucleotidic sequence set forth as SEQ ID NO:
47:
atgggccctaaggccaccctgcaggacatcgtgctgcacttggagccccagaacgagatccccgtggacagcga ggaggagaacgacgaaatcgacggcgtgaaccaccagcacctgcccgcaagaagggccgaaccccagaggcacaccatg ctctg ..
catgtgctgcaaatgcgaggccaggatcaagctggtggtggaaagcagcgccgacgatctgagggcattccagcagctg ttcctgaa caccctctccttcgtgtgccctggggaacccggcaggaccatcccctataaactgcccgacctctgcaccgagctgaac acctccctg caggacattgagatcacctgcgtctactgcaaaaccgtcctggaactgaccgaggtgttcgagttcgccttcaaagacg gcttcgtcgt gtacagggacagcatcccccacgccgcctgccataagctggagaaactgaccaacaccggcctgtacaacctgctgatc cggtgcct gagatgtcagaaggccgagaaactgaggcacctcaacgagaaaaggagattccacaatattgccgggcccggcgacacc ccaacc ..
ctgcacgaatacatgctcgacctgcagcccgaaaccaccgaccccgacagagcccactacaacatcgtgaccttctgct gcaagtgc gactccaccctgagaagatgcgtgcagtccacccacgtggacatccgcacactcgaagacctgctgatgggaaccctgg gcatcgtg tgccccatcgcacccaggccatcaggacccccaggaacggccaagaaagctgccccagctctgcaccgaactgcagacc accatc cacgacatcatcctggaatgcgtctactgtaagcagcagttgctgaggagggaggtgtatgatttcgccttcagagacg gctgcatcgt ctacaggaacccctacgccgtgtgcgacaaatgcctgaagttctactccaagatctccgaatacagacactattgctac agcctgtacg gcaccaccctcgaacagcagtacaacaaacccctgtgcgacctcctgatcaggtgcatcaactgccagaagcccctccg gaccaca acatccgaggaagatggaccggccggtgcatgtcctgctgcaggtcctgataa (SEQ ID NO: 47) and encodes the following amino acid sequence set forth as SEQ ID NO: 48:
MGPKATLQDIVLHLEPQNEIPVDSEEENDEIDGVNHQHLPARRAEPQRH
TMLCMCCKCEARIKLVVESSADDLRAFQQLFLNTLSFVCPGEPGRTIPYKLPDLCTEL
NTSLQDIEITCVYCKTVLELTEVFEFAFKDGFVVYRDSIPHAACHKLEKLTNTGLYNL
LIRCLRCQKAEKLRHLNEKRRFHNIAGPGDTPTLHEYMLDLQPETTDPDRAHYNIVTF
CCKCDSTLRRCVQSTHVDIRTLEDLLMGTLGIVCPIASQAFQDPQERPRKLPQLCTEL
QTTIHDIILECVYCKQQLLRREVYDFAFRDGCIVYRNPYAVCDKCLKFYSKISEYRHY
CYSLYGTTLEQQYNKPLCDLL1RCINCQKPLRFHNIRGRWTGRCMSCCRS (SEQ ID
NO: 48) A lentiviral vector according to the invention may in particular comprise a nucleic acid sequence which encodes an amino acid sequence having at least 90%
sequence identity with the amino acid sequence set forth as SEQ ID NO: 42, the nucleic acid sequence being in particular the nucleic acid sequence SEQ ID NO: 41.
As described herein, a amino acid sequence having at least 90% identity with a reference amino acid sequence encompasses amino acid sequences having at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% and 100% identity with the said reference amino acid sequence.
Accordingly, a lentiviral vector according to the invention may more particularly be selected from the group consisting of lentiviral vectors filed at the CNCM
under accession numbers I-5759, 1-5760, 1-5761 and 1-5762, and is in particular lentiviral vector filed at the CNCM under accession number 1-5762. A lentiviral vector according to the invention may preferably be the lentiviral vector filed at the CNCM under accession number 1-5759 and accordingly preferably comprises the nucleic acid sequence SEQ ID NO: 41.
Lentiviral vector particles according to the invention Another object of the present invention relates to a lentiviral vector particle comprising at least one lentiviral vector according to the invention, and in particular at least one lentirival vector as defined above.
A lentiviral vector particle according to the invention, which contains a lentiviral vector according to the invention, can be produced by recombinant technology known in the art upon transient transfection of cells, for example HEK 293T human cultured cells, by different DNA plasmids:
(i) a packaging plasmid, which expresses at least the Gag, Pol, Rev, Tat and, in some cases, structural and enzymatic proteins necessary for the packaging of the transfer construct;
(ii) a lentiviral vector according to the invention, containing an expression cassette (antigens) and HIV cis-acting factors necessary for packaging, reverse transcription, and integration; and (iii) an envelope-encoding plasmid, in most cases the glycoprotein of vesicular stomatitis virus (VSV.G), a protein that allows the formation of mixed particles (pseudotypes) that can target a wide variety of cells, especially major histocompatibility (MHC) antigen-presenting cells (APCs), including DCs.
Such a method allows producing a recombinant vector particle according to the invention, comprising the following steps of:
i) transfecting a suitable host cell with a lentiviral vector according to the invention;
ii) transfecting said host cell with a packaging plasmid vector, containing viral DNA sequences encoding at least structural and polymerase activities of a retrovirus (preferably lentivirus); Such packaging plasmids are for example described in the art (Dull et al., 1998, J Virol, 72(11):8463-71; Zufferey et al., 1998, J Virol 72(12):9873-80).
iii) culturing said transfected host cell in order to obtain expression and packaging of said lentiviral vector into lentiviral vector particles; and iv) harvesting the lentiviral vector particles resulting from the expression and packaging of step iii) in said cultured host cells.
In order to pseudotype the retroviral particles of the invention, the host cell can be further transfected with one or several envelope DNA plasmid(s) encoding viral envelope protein(s), preferably a VSV-G envelope protein.
This procedure allows obtaining transient production of lentiviral particle vectors by the transfected cells. However, the lentiviral particle vectors may also be continuously produced by cells by stably inserting the packaging genes, the proviral coding DNA, and the envelope gene into the cellular genome. This allows the continuous production of lentiviral particle vectors by the cells without the need for transient transfection. Of course, a combination of these procedures can be used, with some of the DNAs/plasmids integrated into the cellular genome and others provided by transient transfection.
A lentiviral vector particle may be a non-integrating lentiviral vector particle.
Non-integrating vector particles have one or more mutations that eliminate most or all of the integrating capacity of the lentiviral vector particles. For, example, a non-integrating vector particle can contain mutation(s) in the integrase encoded by the lentiviral pol gene that cause a reduction in integrating capacity.
A lentiviral vector particle according to the invention in particular comprises a non-integrating lentiviral vector of the invention.
A lentiviral vector particle according to the invention may comprise a vesicular stomatitis virus glycoprotein (VSVG), in particular a VSV-G Indiana serotype or a VSV-G
New Jersey serotype.
In matter of vaccination strategy, pseudotyped lentiviral vector particles are more likely to escape the immune system, when this latter already developed immunity against lentiviruses. This is particularly helpful when successive injections of similar particle vectors are required for immunizing a patient against a disease.
The lentiviral vector particle may comprise HIV-1 Gag and Pol proteins, and in particular HIV-1 subtype D Gag and Pol proteins.
A further object of the present invention relates to an isolated cell comprising (i.e. transformed with) a lentiviral vector according to the invention or a lentiviral vector particle of the invention.
A cell according to the invention is preferably a mammalian cell, particularly a 5 human cell. Particularly preferred are human non-dividing cells.
Another object of the present invention relates to a vaccine composition comprising a lentiviral vector according to the invention, a lentiviral vector particle according to the invention or a cell according to the invention.
10 A vaccine composition according to the invention comprises a pharmaceutically acceptable medium.
By "pharmaceutically acceptable medium" is meant any solution used to solubilize and deliver a lentiviral vector, a lentiviral vector particle or a cell according to the invention to an individual. A desirable pharmaceutically acceptable carrier is saline. In 15 desirable embodiments, a pharmaceutically acceptable medium includes an adjuvant.
Appropriate physiologically acceptable mediums and their formulations are known to one skilled in the art and described, for example, in Remington's Pharmaceutical Sciences, (20th edition), ed. A. Gennaro, 2003, Lippincott Williams & Wilkins.
20 Implementations according to the invention An object of the present invention relates to a lentiviral vector of the invention, a lentiviral vector particle of the invention or an isolated cell of the invention for use as a medicament or vaccine.
In particular, an object of the present invention relates to a lentiviral vector of 25 the invention, a lentiviral vector particle of the invention or an isolated cell of the invention, in particular in the form of a vaccine composition according to the invention, for use in the treatment or prevention of an HPV induced cancer and metastases thereof, in particular of an HPV-induced cancer.
As previously indicated, HPV induced cancers are cancers induced by an 30 infection by HPV. Methods for the detection of HPV in cancers are known in the art (Aldo Venuti and Francesca Paolini; Head Neck Pathol. 2012 Jul; 6(Suppl 1): 63-74).
HPV induced cancers can in particular be selected from the group consisting of cervical cancer, vaginal cancer, vulvar cancer, penile cancer, anal cancer and oropharyngeal cancer.
Metastases of such cancers according to the invention may in particular be pulmonary metastasis.
Such prevention and/or treatment implies the administration of the considered active, in particular a vaccine composition of the invention as defined above, to an individual in need thereof.
An individual in need thereof is an animal, in particular a mammal, and may more particularly be a human being.
Lentiviral vectors, lentiviral vector particles, cells and vaccine compositions according to the invention are administered to an individual in need thereof by conventional methods, in dosages which are sufficient to elicit an immunological response, which can be easily determined by those skilled in the art.
Lentiviral vectors, lentiviral vector particles, cells and vaccine compositions according to the invention may accordingly be administered intravenously or intramuscularly as indicted below.
Lentiviral vectors, lentiviral vector particles, cells and vaccine compositions according to the invention may alternatively be administered intranasally.
This route of administration is particularly useful in the treatment or prevention of oropharyngeal cancers and/or pulmonary metastases.
Lentiviral vectors, lentiviral vector particles, cells and vaccine compositions according to the invention are administered in a therapeutically effective amount, and may in particular be administered in a dose corresponding to at least 1 x 106, 2 x 106, 5 x 106, 107, 2 x 107, 5 x 107, 1 x 108, 2 x 108, 5 x 108, or at least 1 x 109 TU (Transduction units) of lentiviral vectors according to the invention, in particular in a dose corresponding to at least 1 x 107, 2 x 107, 5 x 107, 1 x 108 TU or at least 1 x 109 TU of lentiviral vectors according to the invention.
In a preferred embodiment, the lentiviral vectors, lentiviral vector particles, cells and vaccine compositions according to the invention are administered in a dose corresponding to at least 1 x 107 TU of lentiviral vectors according to the invention, more particularly at least 1 x 108 TU
of lentiviral vectors according to the invention and in particular at least 1 x 109 TU of lentiviral vectors according to the invention.
By a "therapeutically effective amount" is for example meant the amount of a lentiviral vector or lentiviral vector particle, cell or vaccine composition according to the invention required to generate in a subject one or more of the following effects: an immune response against an HPV induced tumor; a decrease in the size of the HPV
induced tumor, i.e.
a reduction of at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or of 100% of the tumor size in 15 to 45 days compared to the size of the tumor at the time of administration); an increase in the CD8+ and/or CD4+ infiltration in the HPV
induced tumor in 5 to 45 days following the administration; a decrease of CD25+FoxP3+CD4+
Regulatory T
cells (Tregs) in the HPV induced tumor in 5 to 45 days following the administration.
Administration can be performed using well known routes including, for example, intravenous, intramuscular, intranasal, intraperitoneal or sub-cutaneous injection, and in particular intravenous, intranasal or intramuscular, and may be intravenous or intramuscular.
The appropriate dose and regimen will obviously vary between species and individuals depending on many factors. For example, higher doses will generally be required for an effective immune response in a human compared with a mouse.
Lentiviral vectors, lentiviral vector particles, cells and vaccine compositions according to the invention may for example be administered in a single dose, as illustrated in the examples, or in two or more administrations. Practitioners will determine, in each case, the appropriate regimen and dosage for the administration of actives according to the invention.
Lentiviral vectors, lentiviral vector particles, cells and vaccine compositions according to the invention may advantageously be administered in combination with at least one immune checkpoint inhibitor (WI).
An immune checkpoint inhibitor (ICI) according to the invention may in particular be an antibody, in particular an anti-PD-1, an anti-PD-Li (PD-1 Ligand), an anti-CTLA-4 (Cytotoxic T-Lymphocyte-Associated protein 4), an anti-NKG2A, an anti-TIM-3 (T-cell immunoglobulin and mucin-domain containing-3), an anti-TIGIT (T cell immunoreceptor with Ig and ITIM domains) or an anti-LAG-3 (Lymphocyte-activation gene 3) antibody. More particularly, the at least one immune checkpoint inhibitor according to the invention may be a monoclonal antibody selected from the group consisting of anti-PD-1, anti-PD-L1, anti-CTLA-4, anti-NKG2A, anti-TIM-3, anti-TIGIT and anti-LAG-3 monoclonal antibodies. Even more particularly, the at least one immune checkpoint inhibitor according to the invention may be a monoclonal antibody selected from the group consisting of anti-PD-1, anti-PD-L1, anti-CTLA-4, anti-NKG2A, anti-TIM-3 and anti-TIGIT monoclonal antibodies.
An immune checkpoint inhibitor (ICI) according to the invention may more particularly be an antibody, in particular an anti-PD-1, an anti-PD-Li (PD-1 Ligand), an anti-CTLA-4 (Cytotoxic T-Lymphocyte-Associated protein 4), an anti-NKG2A, an anti-TIM-3 (T-cell immunoglobulin and mucin-domain containing-3), an anti-TIGIT (T cell immunoreceptor with Ig and ITIM domains) or an anti-LAG-3 (Lymphocyte-activation gene 3) antibody and even more particularly be an antibody, in particular an anti-PD-1, an anti-PD-Li (PD-1 Ligand), an anti-CTLA-4 (Cytotoxic T-Lymphocyte-Associated protein 4), an anti-NKG2A, an anti-TIM-3 (T-cell immunoglobulin and mucin-domain containing-3) or an anti-TIGIT (T
cell immunoreceptor with Ig and ITIM domains) antibody. More particularly, the at least one immune checkpoint inhibitor according to the invention may be a monoclonal antibody selected from the group consisting of anti-PD-1, anti-PD-L1, anti-CTLA-4, anti-NKG2A, anti-TIM-3, anti-TIGIT and anti-LAG-3 monoclonal antibodies and in particular may be a monoclonal antibody selected from the group consisting of anti-PD-1, anti-PD-L1, anti-CTLA-4, anti-NKG2A, anti-TIM-3 and anti-TIGIT monoclonal antibodies.
An anti-PD-1 monoclonal antibody may for example be selected from the group consisting of Nivolumab, Pembrolizumab and Cemiplimab.
An anti-PD-Li monoclonal antibody may for example be selected from the group consisting of Atezolizumab, Avelumab and Durvalumab.
An anti-CTLA-4 monoclonal antibody may for example be selected from the group consisting of ipilimumab, tremelimumab and quavonlimab.
An anti-NKG2A monoclonal antibody may for example be monalizumab.
An anti-TIM-3 monoclonal antibody may for example be selected from the group consisting of Sym023 and sabatolimab.
An anti-TIGIT monoclonal antibody may for example be tiragolumab.
An anti-LAG-3 monoclonal antibody may for example be relatlimab.
In particular, the ICI may be an anti-PD-Li or an anti-PD-1 monoclonal antibody, and in particular be an anti-PD-1 monoclonal antibody.
The vaccine composition, lentiviral vector, lentiviral vector particle or cell for use according to the invention and the immune checkpoint inhibitor may be administered simultaneously or separately.
Considering the unexpected synergistic advantageous properties obtained when combining a lentiviral vector according to the invention with an immune checkpoint inhibitor as demonstrated in the examples, it can be anticipated that vaccination with a lentiviral vector according to the invention may increase the number of patients eligible for immune checkpoint inhibitor therapy, especially anti-PD-1.
By simultaneously, it is understood that (i) the vaccine composition, lentiviral vector, lentiviral vector particle or cell and (ii) the immune checkpoint inhibitor, may be administered at the same moment or up to the same day or couple of days. In this case, they can be administered in the same composition or in separate compositions.
By separately, it is understood that (i) the vaccine composition, lentiviral vector, lentiviral vector particle or cell according to the invention and (ii) the immune checkpoint inhibitor may be administered with at least several days, for example at least two days of difference.
In particular, when (i) the vaccine composition, lentiviral vector, lentiviral vector particle or cell and (ii) the immune checkpoint inhibitor are administered separately, the vaccine composition, lentiviral vector, lentiviral vector particle or cell according to the invention may be administered before the immune checkpoint inhibitor.
Advantageously, the vaccine composition, lentiviral vector, lentiviral vector particle or cell according to the invention may be administered at least 2 and in particular at least 4 days before the administration of the immune checkpoint inhibitor.
Accordingly, the immune checkpoint inhibitor may advantageously be administered at least 2 and in particular at least 4 days after the vaccine composition, lentiviral vector, lentiviral vector particle or cell according to the invention. The immune checkpoint inhibitor may more particularly be administered 4 days to 1 month after the vaccine composition, lentiviral vector, lentiviral vector particle or cell according to the invention, in particular 4 days to 15 days, and more particularly 4 days to 10 days after the vaccine composition, lentiviral vector, lentiviral vector particle or cell according to the invention.
The vaccine composition, lentiviral vector, lentiviral vector particle or cell for use according to the invention and the immune checkpoint inhibitor may be administered by the same route or through different routes.
The at least one immune checkpoint inhibitor herein is administered in a therapeutically effective dose, i.e. a dose that produces the effects for which it is administered.
The exact dose of immune checkpoint inhibitor will depend on the purpose of the treatment and will be ascertainable by one skilled in the art using known techniques.
The invention further relates to a method for the treatment and/or prevention of an HPV induced cancer in an individual in need thereof, comprising the administration to said 5 individual of at least one lentiviral vector of the invention, lentiviral vector particle of the invention or isolated cell of the invention, in particular in the form of a vaccine composition according to the invention.
The invention further relates to the use of at least one lentiviral vector of the invention, lentiviral vector particle of the invention or isolated cell of the invention, in 10 particular in the form of a vaccine composition according to the invention for the treatment and/or prevention of an HPV induced cancer in an individual in need thereof.
The examples and figures which follow are presented by way of illustration and 15 without implied limitation of the invention.
EXAMPLES
Materials and methods Mice C57BL6jRj mice were purchased from Janvier Labs (Le Genest-Saint-Isle, France). All animals were maintained under specific pathogen-free conditions, and all procedures were performed according to an approved animal protocol and in accordance with recommendations for the proper use and care of laboratory animals. All animal experiments were conducted in accordance with guidelines established by the French and European regulations for the care and use of laboratory animal.
Peptides, antibodies, and reagents To test reactivity of the vaccines according to the invention, 15mer overlapping peptides were ordered from GenScript Biotech (Netherlands) at a purity of >80 %. Anti CD4-VioBlue (Clone REA604), anti-CD45-VioGreen (Clone REA737), Anti-FoxP3-Vio515 (clone REA788), anti-CD279 (PD1)-PE (clone REA802), anti-CD8a-PE-Vio770 (clone REA601), antiCD25-APC (clone REA568), anti CD11c-FITC (clone REA754), anti CD1 lb-APC-Vio770 (clone REA592) were purchased from Miltenyi Biotec. Anti anti-mouse H-2kb (Clone AF6-88.5), anti-CD274 (PD-L1)-APC (Clone MIH5) and anti CD16/CD32 (Clone 2.4G2) were purchased from BD Biosciences.
Antibodies were mixed together with PBS containing 1% FCS (Gibco).
Cyclophosphamide was purchased from Sigma, resuspended in PBS (Gibco) and stored at ¨20 C before use.
Cells HPV-16 E6 and E7-expressing TC-1 tumor cells were generated as previously described (Lin et al. Cancer Res. 1996 Jan 1;56(1):21-6): Primary lung cells of C57BL6 mice were transformed with HPV-16 E6 and E7 genes and with pVEJB-expressing activated human c-Ha-ras oncogene. TC-1 cell line was cultured in Glutamax RPMI medium (Gibco supplemented with 100 U/ml penicillin, 100 1.1g/m1 streptomycin, and 10 %
fetal bovine serum).
Lentiviral vector construction The antigen (Ag) constructs were cloned in a pFlap-B2m-Ag-WPREMutee backbone (see for example W02016012623 for the backbone). The antigen plasmid contains the cPPT/CTS sequence (sequence SEQ ID NO: 37), mandatory for transduction of non-mitotic cells. The U3 promoter sequence was deleted from the 3' long terminal repeat (LTR) to avoid vector replication. The Beta-2microglobuline (02m) promoter controls vaccine antigen expression in all transduced cells, thereby, antigen will preferentially be expressed in APC (Antigen Presenting Cells). In addition, it is devoid of any known enhancer sequence, likely to induce mutagenesis and/or genotoxic effects. The antigen plasmid contains a mutant form of the woodchuck hepatitis B virus (WHV) post-transcriptional regulatory element (WPRE) (sequence SEQ ID NO: 38). The wild-type WPRE region contains a truncated form of the WHV X protein that may have oncogenic properties (Kingsman et al., Gene Ther. 2005 Jan;12(1):3-4). The mutant form of the WPRE used in our construct precludes expression of the truncated X protein by the inclusion of point mutations within the X
protein start codon.
Such mutant WPRE sequence appears not to have oncogenic properties (Themis et al., Mol Ther. 2005 Oct;12(4):763-71).
The packaging plasmid (pNDK) contains the gag-pol sequences from HIV-1 subtype NDK (GenBank acc n : A34828). The proteins nef, vif, vpr, env are not expressed.
Moreover, aspartic acid (D) to valine (V) replacement at position 64 (D64V) in the HIV-1 integrase protein sequence (pol gene) is sufficient to inhibit integration without disturbing the transgene expression in vitro. The lentiviral particles according to the invention are non-integrative particles.
Envelope plasmid: pCMV-VSV-G INDco (Indiana) et pCMV-VSV-G NJco (New Jersey) vectors were constructed by subcloning the Vesicular stomatitis virus (VSV) G
protein (VSV-G) Indiana (GenBank acc. n J02428) and New Jersey (GenBank acc.
n P04882) serotype inserts into the pVAX1 expression vector (Invitrogen).
Mammalian codon-optimized synthetic genes (GeneArt) encoding glycoproteins from the following Vesiculovirus were cloned into a pVAX1 plasmid (Invitrogen): Vesicular Stomatitis Virus Indiana serotype (GenBank FW591952), New Jersey serotype (GenBank FW591956) and Cocal virus (GenBank: AF045556.1).
Lentiviral Vector Particles Production After amplification of HEK 293 T cells (ATCC) in DMEM with 1%
penicillin/streptomycin and 10% FCS, non integrative lentiviral particles were produced by transient calcium phosphate co-transfection of HEK 293 T cells (ATCC) with 3 plasmids (The viral antigen plasmid, an envelope expression plasmid and packaging plasmid) following the method well-known in the art. Culture medium is replaced by serum free medium after 24h. Supernatant is harvested and clarified 48h after transfection by 2500rpm centrifugation.
Viral particles are concentrated by ultracentrifugation (lh at 22000 rpm/88250g 4oC) and resuspended in preservative buffer (20mM Pipes, 75mM NaC1 and 2.5% sucrose).
Vector titration Lentiviral vector titer was determined by quantitative PCR after transduction of cells (HEK 293 T). Aphidicolin is added to HEK293T cells 24h before transduction and is maintained during the whole titration process. Cells are incubated 30 min with lysis buffer (200mM Tris, 1% NP40 and 1% Tween20), containing 50 g/m1 RNase A (sigma).
Proteinase K (0.2mg/m1) is added to suspension and incubated 4h at 56 C. Pairs of primers specific for RRE (element of Ag vector) and GAPDH (in host cell) are used for quantitative PCR. Titer are Titer are expressed as transduction unit (TU)/mL of vector.
Design of HPV vaccine The implemented non-oncogenic immunogenic E6 and E7 protein sequences were selected and modified as previously discussed herein.
In particular, 4 different vaccines were designed comprising the following lentiviral vectors:
- the lentiviral vector filed at the Collection Nationale de Cultures de Microorganismes (CNCM) on October 21, 2021 under accession number 1-5759;
- the lentiviral vector filed at the Collection Nationale de Cultures de Microorganismes (CNCM) on October 21, 2021 under accession number 1-5760;
- the lentiviral vector filed at the Collection Nationale de Cultures de Microorganismes (CNCM) on October 21, 2021 under accession number 1-5761; or - the lentiviral vector filed at the Collection Nationale de Cultures de Microorganismes (CNCM) on October 21, 2021 under accession number 1-5762.
These lentiviral vector particles comprising these functionals lentivirals vectors quantified by vector titration and expressed as transduction units (TU) were implemented in the following exemples.
In vivo Immunogenicity of Lentiviral Vector vaccine (LV vaccine) Naïve C57BL6 female mice were vaccinated with a LV vaccine according to the invention (i.e. lentiviral vector particules of the invention comprising functionnal lentiviral vector of the invention) via intramuscular (i.m.) injection in 50 L of diluent. 14 days later, splenocytes were prepared and restimulated overnight for IFNg ELISPOT with 4 distinct HPV peptide pools (each peptide is 2 g/mL final). Each peptide pools correspond to one of the following non-oncogenic antigen variants: non-oncogenic variant of E6 protein of HPV16, non-oncogenic variant of E7 protein of HPV16, non-oncogenic variant of E6 protein of HPV17 and non-oncogenic variant of E7 protein of HPV17. They are composed of overlapant mers (with overlaps of 11 a.a.) corresponding to the full selected antigen.
In vivo tumor vaccination treatment For in vivo tumor experiments, 1.106 TC-1 cells were injected into 7- to 9-week-old C57BL/6 mice subcutaneously (s.c.) in the right flank (mice were shaved with electric shaver device before injection). When average tumor volume reaches expected range, mice were randomized and injected with the LV vaccine of the invention via intramuscular (i.m.) injection. Mice were monitored for tumor growth by measuring tumor diameter with calipers 3 times a week. Due to ethical reasons, mice with tumors >1500mm3 had to be euthanized.
Immunogenicity of LV vaccine of the invention in human PBMC
Frozen human PBMC (StemCell) were gently thawed, stained during 10min at 37 C with 0.5 M of CFSE (Thennofischer). Cells were then cultured in rond bottom 96 wells plate (0.2x106 cells per well) in complete RPMI : 10% FCS, 10mM Hepes (Gibco), 100 U/ml Penicilline, 100 jig/nil Streptomycine, 0.1mM Non-Essential Amino acids (Gibco) and 1mM
Sodium Pyruvate (Gibco). After 7 days, cells are centrifuged and new complete RPMI
(prewarmed) is added. After another 7 days (14 days total), cells are stained with fluorescent antibodies and data are acquired by flow cytometry (MACSQuant analyzer) Cytometric analysis of tumor immune infiltrates Tumors were treated with the Mouse Tumor Dissociation kit (Miltenyi). Cell suspensions were then filtered through 70 pm-pore filters, treated with Red Blood Cell lysis buffer (Sigma), then washed and centrifuged at 1200 rpm for 5 minutes. The recovered cells 5 were stained as follows.
To detect NK, Near IR LD (Invitrogen), Fc7II/III receptor blocking anti-CD16/CD32 (clone 2.4G2, BD Biosciences), APC-anti-CD11b (clone N418, BD
Biosciences), BV421-anti-NKp46 (clone 29A1.4, Biolegend) were used.
Samples were acquired in an Attune NxT cytometer (Invitrogen) and data 10 analyzed by FlowJo software (Treestar, OR, USA).
Intracellular cytokine staining Splenocytes from immunized mice were obtained by tissue homogenization and passage through 100-pm nylon filters (Cell Strainer, BD Biosciences) and were plated at 4 x 15 106 cells/well in 24-well plates. Splenocytes were stimulated during 6h in the presence of 10 ttg/mL of homologous or control peptide, 1 mg/mL of anti-CD28 (clone 37.51) and 1 pgimL
of anti-CD49d (clone 9C10-MFR4.B) mAbs (BD Biosciences). During the last 3h of incubation, cells were treated with a mixture of Golgi Plug and Golgi Stop, both from BD
Biosciences. PE-Cy7-anti-CD107a (clone 1D4B, BioLegend) mAb was also added to the 20 cultures at this step. Cells were then collected, washed with PBS
containing 3% FBS and 0.1% NaN3 (FACS buffer) and incubated for 25 min at 4 C with a mixture of Near IR
Live/Dead (Invitrogen), Fc7II/III receptor blocking anti-CD16/CD32 (clone 2.4G2), PerCP-Cy5.5-anti-CD3e (clone 145-2C11), PE-Cy7-anti-CD4 (clone RM4-5) and BV711-anti-CD$
(clone 53-6.7) mAbs (BD Biosciences or eBioscience). Cells were washed twice in FACS
25 buffer, then permeabilized by use of Cytofix/Cytoperm kit (BD
Bioscience). Cells were then washed twice with PermWash 1X buffer from the Cytofix/Cytoperm kit and incubated with a mixture of BV421-anti-IL-2 (clone JES6-5H4), FITC-anti-TNF (MP6-XT22), APC-anti-IFN-7 (clone XMG1.2) and BV605-anti-IL-17A (Clone TC11-18H10) mAbs (BD
Biosciences) or a mixture of appropriate control Ig isotypes, during 30 min at 4 C. Cells were 30 then washed twice in PermWash and once in FACS buffer, then fixed with Cytofix (BD
Biosciences) overnight at 4 C. Cells were acquired in an Attune NxT cytometer system (Invitrogen) and data analysis was perfointed using FlowJo software (Treestar, OR, USA).
Example 1: HPV vaccines of the invention are immuno2enic in vivo In order to measure the capacity of vaccines of the invention to induce an immune response, recipient mice were immunized with the 4 vaccines (1 group of 5 mice per tested vaccine and control group).
Mice were injected i.m. with 1x107TU of lentiviral vector particles comprising the lentiviral vector filed at the CNCM under accession number 1-5759, the lentiviral vector filed at the CNCM under accession number 1-5760, the lentiviral vector filed at the CNCM
under accession number 1-5761 or the lentiviral vector filed at the CNCM under accession number 1-5762 or 50 viL of diluent. 14 days later, splenocytes were prepared and restimulated overnight for IFNg ELISPOT with 4 distinct peptide pools (each peptide is 2 g/mL final).
The results obtained are represented in Figure 1.
Example 2: HPV vaccines of the invention vaccine fully eliminates well implanted tumors in vivo TC-1 tumors cells have been extensively used as a preclinical model to study HPV induced Tumors (Kim, J W et al. Gene therapy vol. 11,12 (2004): 1011-8).
These lung tumor cells were modified to express E6 and E7 from HPV16 (Lin et al. Cancer Res. 1996 Jan 1;56(1):21-6).
After s.c. (subcutaneous) injection of TC-1 cells to the mice, solid tumors are rapidly found at injection site and untreated animal tumors grow to reach ethical endpoint in 30-40 days. In order to test the efficacy of lentiviral vector particles of the invention, TC-1 cells were injected s.c. and tumor volume was measured every other day (caliper measurement). When average tumor volume is 70 mm3, mice were randomized and vaccinated with 1x108 TU i.m. of LV-GFP Indiana (as a control), Indiana lentiviral vector particles comprising 1-5759, Indiana lentiviral vector particles comprising 1-5760, Indiana lentiviral vector particles comprising 1-5761 or Indiana lentiviral vector particles comprising 1-5762.
The results obtained are represented in Figure 2.
A rapid and very efficient elimination of tumors is observed in 100% of animals vaccinated with lentiviral vector particles comprising the lentiviral vector filed at the CNCM
under accession number 1-5762 and the lentiviral vector filed at the CNCM
under accession number 1-5759, 87.5% of animals vaccinated with the lentiviral vector filed at the CNCM
under accession number 1-5760 and 75% of animals vaccinated with the lentiviral vector filed at the CNCM under accession number 1-5761.
Vaccines comprising lentiviral vector particles comprising the lentiviral vector filed at the CNCM under accession number 1-5759 and lentiviral vector particles comprising the lentiviral vector filed at the CNCM under accession number 1-5762 show equivalent tumor elimination rates (higher than 1-5760 and 1-5761) but 1-5759 vaccination allows full elimination of tumors in 37.5 days (-F/- 7.4 SD) on average whereas it takes 54.7 days after I-5762 vaccination.
We surprisingly observed that the most immunogenic vector was not the most protective and that the ranking in irnmunogenicity did not apply for anti-tumor efficacy.
Indeed, the lentiviral vector particle comprising the lentiviral vector filed at the CNCM under accession number 1-5759 was the most efficient anti tumoral vaccine whereas the lentiviral vector particles comprising the lentiviral vector filed at the CNCM under accession number I-5760 and 1-5762 were more immunogenic vectors when measuring IFN-y production.
Example 3: A single HPV Vaccine of the invention administration is efficient against tumor relapse Relapse is commonly observed in most cancer type and is defined as a return of the disease after a period of improvement. It is often due to a few tumor cells that survived the initial treatment and form new tumors weeks, month or even years after treatment.
A. In order to mimic a relapse in our model, mice who eliminated primary tumor were rechallenged on the other flank at day 60. Control mice (untreated) were also injected s.c. in order to check on the tumor cell injection.
The results obtained are represented in Figure 3.
This Figure shows that s.c. injection of TC-1 cells in control mice allows formation of solid tumors reaching ethical limits of size in less than 30 days. Tumor growth in rechallenged mice (that previously eliminated right flank tumors after vaccination) were strongly reduced. Tumor growth was observed during the first 6 days and tumor elimination begins afterwards.
Tumors are even fully eliminated 13-16 days after implantation. Single dose vaccination administered on tumor bearing mice allowed full elimination of primary tumor and a strong protection against relapse as these mice rapidly eliminated secondary tumors.
B. A additional experiment was performed with a rechallenge of the mice who eliminated primary tumor on the other flank with 1.106 TC-1 tumor cells 119 days after the first engraftment and were maintained without any therapy. Control mice (untreated) were also injected s.c. in order to check on the tumor cell injection.
The results obtained are represented in Figure 11.
All re-challenged mice were still alive 145 days after the initial tumor challenge, sustaining that a single injection of a vaccine according to the invention effectively promoted a strong antitumor memory protective immune response which efficiently shaped T-cell responses to new challenges.
Example 4: Therapeutic effect of anti HPV vaccine of the invention is dose dependent In order to determine the effect of a lower dose of vaccine, an efficacy study was performed on mice bearing TC1 tumor. Mice were vaccinated with the vaccine according to .. the invention comprising lentiviral vector particles comprising the lentiviral vector filed at the CNCM under accession number 1-5759, at 1x108 or 1x107 TU/mouse.
In particular, 1x106 TC-1 cells were injected in the flank of animals and tumor volume was measured twice a week (caliper measurement). When average tumor volume was 80mm3, mice were randomized and vaccinated with diluent (control), 1x107TU or 1x108TU
(i.m.) of 1-5759 vaccine The results obtained are represented in Figure 4.
Whereas vaccination with 1x108 TU allows total and rapid elimination of tumors (in less than 20 days after vaccination), we observed that 1 x107 TU
vaccination dose had a partial effect on tumor growth. 3/6 (50%) mice were tumor free 22 days after vaccination, and the others first showed a decline 15-18 days post vaccination (during 5-10 days) but tumor growth couldn't be controlled afterwards.
A single low dose (1x107) of a vaccine according to the invention showed a partial inhibition comparable to what is observed with 3 injections of Adenoviral vector based vaccines (Rice,AE et al. Cancer gene therapy vol. 22,9 (2015): 454-62). This suggests that a vaccine according to the invention at optimal dose would be more efficient than adenoviral plateform. Moreover, low dose efficacy would most likely be increased by a second injection of vaccine.
Example 5: Vaccination according to the invention increases CD4+ and CD8+ T cell infiltration and reduces T reg in the treated tumors Tumor infiltration was investigated to understand further the anti-tumoral mechanisms induced after vaccination with a lentiviral vector according to the invention.
.. 1x106 TC1 tumor cells were injected (s.c.) on the flank of animal, and the tumor volume was measured twice a week (caliper measurement). When average tumor volume was 80mm3, mice were randomized and vaccinated with either diluent (control), or 1x107TU
of 1-5759 or 1x108TU (i.m.) of 1-5759.
Ten days after vaccination, tumors were collected, digested and analyzed by flow cytometry. FACS staining was performed and data were acquired on Macsquant facs according to methods well known in the art.
The results obtained are represented in Figure 5.
Tumors from vaccinated mice were infiltrated with more CD8+ and CD4+ T cells compared to control tumors. The percentage of CDS+ T cells and CD4+ T cell in the tumors are increased respectively by about 4 and 3 times. On the other hand, the percentage of CD25+FoxP3+CD4+ Regulatory T cells (Tregs) in tumors is strongly reduced in treated animals.
These observations are of major importance as they suggest that vaccines comprising lentiviral vectors of the invention improve CD8+ T cells and CD4+ T
cell .. recruitment to the tumor but also reduces the percentage of Tregs in the tumors.
Example 6: HPV vaccine of the invention fully eliminates large tumors in vivo Well established tumors are known to be more difficult to eliminate than small and early-stage tumors. Most vaccines tested on TC1 model have weaker effect when administered at latter time point (Rice,AE et al. Cancer gene therapy vol.
22,9 (2015): 454-62; Berraondo, Pedro et al. Cancer research vol. 67,18 (2007): 8847-55). 1x106 TC1 tumors were injected (s.c.) on the flank of animal. When average tumor volume was around 300 rnm3, mice were randomized and vaccinated with diluent (control), or 1x108TU
(i.m.) of the vaccine according to the invention comprising lentiviral vector particles comprising the lentiviral vector filed at the CNCM under accession number 1-5759. Tumor volume was measured twice a week with a caliper.
The results obtained are represented in Figure 6.
It can be seen that a vaccine according to the invention is highly efficient in completely eliminating well-established HPV induced tumors.
Example 7: HPV vaccine of the invention induces human PBMC activation 5 in vitro In order to verify that a vaccine according to the invention can induce a T
cell response in human cells, human PBMC (StemCell) were labelled with CFSE and cultured in absence (unstimulated condition) or presence of a vaccine according to the invention (1-5759).
Cell proliferation and activation were measured after 2 weeks of culture.
CD8+ T cells and CD4+ T cells proliferation (measured by CFSE dilution) and expression of CD25 activation marker were increased by addition of lentiviral vectors of the invention in the culture.
The results obtained are represented in Figure 7.
It can thereby be concluded that antigen presenting cells from the PBMC are able to be transduced by an HPV vaccine according to the invention and to process the antigens to activate T cells.
Example 8: Systemic T-cell immunity induced by HPV vaccine of the invention and phenotype of effector T cells To gain further insight into the quality of the T-cell responses induced, splenocytes from mice injected with a Ctrl Lenti (LV-empty Indiana) or with a vaccine according to the invention comprising lentiviral vector particles comprising the lentiviral vector filed at the CNCM under accession number 1-5759 were left untreated or were stimulated in vitro with a mixture of ETTDPDRAHYNIVTF and PDRAHYNIVTFCCKC
25 E7Hpv16-derived peptides which contain the immunodominant Fl-2Db-restricted RAHYNIVTF epitope (Feltkamp MC et al.. Eur J Immunol 1993;23:2242-9) and were analyzed by IntraCellular Staining (ICS) for IL-2, and TNF-a and IFN-y.
The results obtained are represented in Figure 9A.
Stimulation with these peptides detected CD8+ T-cell responses, in mice vaccinated with a lentiviral vector according to the invention. The functional CD8 T-cell effectors were mainly distributed among IFN-y (single positive), TNF-a+ IFN-y or IL-2+
IFN-y+ (double positive), and IL-2+ TNF-a+ IFN-y+ (triple positive) subsets (voir Figure 9B).
The majority of IFN-y+ CD8 T cells also expressed the surface CD107a degranulating marker, showing the effector properties of these T cells (voir Figure 9B).
Example 9: Features of tumor cells and tumor infiltrating innate immune cells in mice vaccinated with an HPV vaccine of the invention Characterization by cytometry of the intra-tumoral infiltrates at day 11 post-vaccination and thus during the tumor regression phase showed a significant increase in the proportion of Natural Killer (NK) cells in the regressing tumors from mice vaccinated with a vaccine according to the invention comprising lentiviral vector particles comprising the lentiviral vector filed at the CNCM under accession number 1-5759.
Results are shown in Figure 10.
Example 10: Suboptimal Lenti-HPV-07 vaccination acts synergistically with anti-PD1 immunotheraPY
The inventors further investigated the potential synergy between a suboptimal dose of Lenti-HPV-07 (1-5759) vaccination and anti-PD-1 therapy.
The anti-PD-1 treatment began four days (D17, i.e. 17 days after s.c.
administration of the TC-1 cells to the mice) after the injection of the vaccine according to the invention comprising lentiviral vector particles comprising the lentiviral vector filed at the CNCM under accession number 1-5759 (D13, i.e. 13 days after s.c.
administration of the TC-1 cells to the mice). Several injections of anti-PD-1 were performed (D17 as mentioned above, then D20, D22, D24, D28 and D31).
In particular, experiments were performed on three identical groups of tumor-engrafted mice. In the first group (10 mice - group control), the mice were administered a LV-empty Indiana (D13) (as a control) and four days later with an anti-PD-1 monoclonal antibody (D17, then D20, D22, D24, D28 and D31). In the second group (12 mice - group control), the mice were administered a vaccine according to the invention (1-5759) (D13) and four days later with a control antibody (isotype ctrl) (D17, then D20, D22, D24, D28 and D31). In the third group (14 mice), the mice were administered a vaccine according to the invention (D13) (1-5759) and four days later with a mAb anti-PD-1 (D17, then D20, D22, D24, D28 and D31).
The results are presented in Figures 12A and 12B.
A suboptimal dose of the vaccine, which induces an insufficient antitumor T-cell response, acted synergistically with anti-PD-1 to increase the tumor regression rate.
Six mice out of 14 achieved a complete tumor regression, and 2 others showed a partial tumor regression. In the latter, tumor volume decreased by 67 % and then the tumor relapsed 6 to 7 days after the end of anti-PD-1 treatment, highlighting the need for repeated injections of anti-PD-1 until the tumor has completely disappeared. Only 3 out of 12 mice treated with the suboptimal dose of vaccine of the invention alone showed partial tumor regression. Accordingly, mice survival was significantly increased in the group of combo treatment, compared to the mice treated with suboptimal dose of Lenti-HPV-07 (Figure 12B).
Therefore, a synergistic anti-tumor effect can be achieved when Lenti-HPV-07 vaccine candidate is combined with the anti-PD1 checkpoint inhibitory treatment.
Example 11: A single injection of vaccine according to the invention cures mice with pulmonory metastatic foci induced by intravenous injection of TC1-nLuc cells TC1 parental cell line was stably transduced with an integrative lentiviral vector encoding for nanoluciferase reporter and puromycin N-acetyl-transferase (for selection), under the ubiquitin (UBC) promoter. After selection on puromycin, cells were subcloned to obtain TC1-nLuc cell line.
Six-week-old C57BL/6JRj mice, purchased from Janvier Laboratory, were intravenously injected with 150 000 TC1-nLuc cells. At day 5, mice were injected with a single dose of 1.109 TU / mouse of Lenti-HPV-07 or Control Lenti (empty vector) via intramuscular route.
Bioluminescence imaging on live animals was performed using the IVIS
Imaging System (IVIS Spectrum, Perkin Elmer) coupled to a charged-couple device camera.
Prior to bioluminescence imaging, mice were anesthetized with 2% isoflurane in oxygen and maintained in a control flow of 1.5% isoflurane in oxygen through a nose cone during imaging. The substrate furimazine (Z108) (provided by Dr. Yves Janin, Institut Pasteur) was dissolved at 2 mg/ml in acidic ethanol. Z108 was further diluted in sterile D-PBS to the desired concentration (0.4 mg/kg) prior to intravenous injection. Mice were then immediately placed in the imaging chamber and imaged. Sequential images were captured under the auto-exposure settings with a maximum exposure time of 2 minutes.
Images from each experimental set were analyzed using Living Image Software (Ver. 2.50.1 Xenogen). Measurements from regions of interest were performed and the luminescence values were evaluated as total flux (photons/second). Mice bellies and torsos were shaved to enhance signals to noise ratio. The baseline signals were obtained from untreated mice, i.e., injected with neither TC1-nLuc cells, nor lentiviral vectors, yet injected with Z108.
The results obtained are represented in Figures 13A and 13B.
The inventors had firmly established that a single intramuscular injection of Lenti-HPV-07 vaccine (1-5759) according to the invention completely eradicates, in 100% of animals, subcutaneously engrafted TC1 tumors. However, in human, many cancers, including HPV-induced cancers, are located in mucosa' sites.
Therefore, the present experiment evaluated the capacity of Lenti-HPV-07 to inhibit tumor growth in a mucosal site.
To address this question, a TC1 cell line expressing stably the nanoluciferase reporter gene (TC1-nLuc) was developed. After TC1-nLuc intravenous injection, mice readily developed lung metastatic foci.
Longitudinal tumor outgrowth was followed on live animals by bioluminescence imaging.
Five days after tumor injection, mice received a single intramuscular injection of Lenti-HPV-07 (1.109 TU / mouse) or a Control Lenti (empty vector) (Figure 13A).
All mice having received the Lenti-HPV-07 were cured at day 22 post tumor injection, whereas pulmonary metastatic foci continued to grow in the control group. The difference observed between the average of the bioluminescence signal in the two groups was largely statistically significant (Figures 13 A and B).
This observation indicates in a clear-cut manner that a vaccine according to the invention is able to eradicate lung tumors, as efficiently as subcutaneously established tumors.
SEQUENCES
SEQ ID NO: 1 is a nucleic acid sequence encoding the E6 protein from HPV 16 (NC_001526.4) ATGCACCAAAAGAGAACTGCAATGTTTCAGGACCCACAGGAGCGACCCAGAAAGTTACC
AC AGTTATGC ACAGAGCTGCAAACAACTATACATGATATAATATTAGAATGTGTGTACTG
CAAGCAACAGTTACTGCGACGTGAGGTATATGACTTTGCTTTTCGGGATTTATGCATAGT
ATATAGAGATGGGAATCCATATGCTGTATGTGATAAATGTTTAAAGTTTTATTCTAAAATT
AGTGAGTATAGACATTATTGTTATAGTTTGTATGGAACAACATTAGAACAGCAATACAAC
AAACCGTTGTGTGATTTGTTAATTAGGTGTATTAACTGTCAAAAGCCACTGTGTCCTGAAG
AAAAGCAAAGAC ATCTGGACAAAAAGCAAAGATTCCATAATATAAGGGGTCGGTGGACC
GGTCGATGTATGTCTTGTTGCAGATCATCAAGAACACGTAGAGAAACCCAGCTGTA A
SEQ ID NO: 2 is the nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 16 GACCCCCAAGAACGGCCCAGAAAGCTGCCCCAGCTGTGCACCGAGCTGCAGACCACCAT
CCACGACATCATCCTGGAATGCGTGTACTGCAAGC AGCAGCTGCTGAGAAGAGAGGTGT
ACGACTTCGCCTTCCGGGACCTGTGCATCGTGTACCGGAACCCCTACGCCGTGTGCGACA
AGTGCCTGAAGTTCTACAGCAAGATCAGCGAGTACCGGCACTACTGCTACAGCCTGTACG
GCACCACCCTGGAACAGCAGTACAACAAGCCCCTGTGCGACCTGCTGATCAGATGCATCA
ACTGCC AGAAGCCCCTGCGGTTCCACA ACATCCGGGGCAGATGGACCGGCCGGTGCATG
AGCTGCTGCAGA
SEQ ID NO: 3 is the nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 16 ATGGGCACCCTGGGCATCGTGTGCCCCATCGACCCCCAAGAACGGCCCAGAAAGCTGCCC
CAGCTGTGCACCGAGCTGCAGACCACCATCCACGACATCATCCTGGAATGCGTGTACTGC
AAGCAGCAGCTGCTGAGAAGAGAGGTGTACGACTTCGCCTTCCGGGACCTGTGCATCGTG
TACCGGAACCCCTACGCCGTGTGCGACAAGTGCCTGAAGTTCTACAGCAAGATCAGCGAG
TACCGGCACTACTGCTACAGCCTGTACGGCACCACCCTGGAACAGCAGTACAACAAGCCC
CTGTGCGACCTGCTGATCAGATGCATCAACTGCCAGAAGCCCCTGCGGTTCCACAACATC
CGGGGCAGATGGACCGGCCGGTGCATGAGCTGCTGCAGA
SEQ ID NO: 4 is the nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 16 ATGGACCCCCAAGAACGGCCCAGAAAGCTGCCCCAGCTGTGCACCGAGCTGCAGACCAC
CATCCACGACATCATCCTGGAATGCGTGTACTGCAAGCAGCAGCTGCTGAGAAGAGAGG
TGTACGACTTCGCCTTCCGGGACCTGTGCATCGTGTACCGGAACCCCTACGCCGTGTGCG
ACAAGTGCCTGAAGTTCTACAGCAAGATCAGCGAGTACCGGCACTACTGCTACAGCCTGT
ATCAACTGCCAGAAGCCCCTGCGGTTCCACAACATCCGGGGCAGATGGACCGGCCGGTG
CATGAGCTGCTGCAGA
SEO ID NO: 5 is the nucleic acid sequence encoding a non-oncogenic variant of the E6 10 protein from HPV 16 TTTCAGGACCCCCAGGAAAGGCCCAGGAAGTTGCCCCAGCTCTGCACCGAACTGCAGACC
ACCATTCATGACATCATCCTCGAATGCGTGTACTGCAAGCAGCAGCTCCTGAGGAGGGAG
GTGTACGATTTCGCCTTCAGAGACGGCTGTATCGTCTACAGGAACCCCTATGCCGTCTGC
GACAAATGCCTGAAGTTTTATTCCAAGATCTCCGAGTACAGGCACTATTGCTACAGCCTG
ATCAACTGCCAGAAGCCCCTGAGGTTCCACAACATCCGCGGCAGGTGGACCGGAAGGTG
CATGTCCTGCTGCAGG
SEO ID NO: 6 is the nucleic acid sequence encoding a non-oncogenic variant of the E6 20 protein from HPV 16 TTCCAGGACCCCCAGGAGAGGCCCAGGAAACTGCCCCAGTTGTGCACCGAGCTCCAGAC
AACCATCCACGACATCATCCTGGAGTGCGTGTACTGTAAGCAGCAGTTGCTGAGGAGAGA
GGTGTATGACTTCGCCTTCAGAGACGGATGCATTGTCTATAGGAACCCCTACGCCGTGTG
CGACAAGTGCCTGAAGTTCTACTCCAAGATCAGTGAGTACAGGCATTACTGCTACAGCCT
CATCAACTGCCAGAAGCCCCTCAGGTTCCACAACATCCGGGGCAGGTGGACCGGAAGGT
GCATGTCCTGCTGCAGGTCC
SE0 ID NO: 7 is the amino acid sequence of the Wild Type (WT) E6 protein from GNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHL
DKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL
SEC/ ID NO: 8 is the amino acid sequence of a non-oncogenic variant of the E6 protein from DPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRNPYAVCDKCLKF
YSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLRFHNIRGRWTGRCMSCCR
SEQ ID NO: 9 is the amino acid sequence of a non-oncogenic variant of the E6 protein from MGTLGIVCPIDPQERPRKLPQLCTELQTTIHDIILECV YCKQQLLRREVYDFAFRDLCIV YRNPY
AVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLRFHNIRGRWTGRC
MSCCR
SEQ ID NO: 10 is the amino acid sequence of a non-oncogenic variant of the E6 protein from HPV 16 MDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRNPYAVCDKCL
KFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLRFHNIRGRWTGRCMSCCR
.. SEQ ID NO: 11 is the amino acid sequence of a non-oncogenic variant of the E6 protein from HPV 16 FQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDGCIVYRNPYAVCDKC
LKFYSKISEYRRYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLRFHNIRGRWTGRCMSCCR
SEQ ID NO: 12 is the amino acid sequence of a non-oncogenic variant of the E6 protein from HPV 16 FQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDGCIVYRNPYAVCDKC
LKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLRFHNIRGRWTGRCMSCCRS
.. SEQ ID NO: 13 is the nucleic acid sequence encoding the E7 protein from HPV
16 (NP-041326.1) ATGCATGGAGATACACCTACATTGCATGAATATATGTTAGATTTGCAACCAGAGACAACT
GATCTCTACTGTTATGAGCAATTAAATGACAGCTCAGAGGAGGAGGATGAAATAGATGG
TCCAGCTGGACAAGCAGAACCGGACAGAGCCCATTACAATATTGTAACCTTTTGTTGCAA
GTGTGACTCTACGCTTCGGTTGTGCGTACAAAGCACACACGTAGACATTCGTACTTTGGA
AGACCTGTTAATGGGCACACTAGGAATTGTGTGCCCCATCTGTTCTCAGAAACCATAA
SEQ ID NO: 14 is a nucleic acid sequence encoding a non-oncogenic variant of the E7 protein from HPV 16 ACCCCCACCCTGCACGAGTACATGCTGGACCTGCAGCCCGAGACAACCGACCCCGACCG
GGCCCACTACAATATCGTGACCTTCTGCTGCAAGTGCGACAGCACCCTGCGGCTGTGCGT
GCAGAGCACCCACGTGGACATCCGGACCCTGGAAGATCTGCTGATGGGCACCCTGGGCA
TCGTGTGCCCCATT
SEO ID NO: 15 is a nucleic acid sequence encoding a non-oncogenic variant of the E7 protein from HPV 16 CCCGGAGACACCCCCACCCTGCACGAATACATGCTGGACCTGCAGCCCGAAACCACCGA
CCCCGACCGCGCTCACTACAACATCGTTACATTCTGTTGTAAATGCGACTCCACCCTGAG
AAGATGCGTGCAGTCCACCCACGTGGACATCAGGACCCTGGAGGACCTCCTCATGGGAA
CCCTGGGTATCGTCTGCCCCATC
SEO ID NO: 16 is the amino acid sequence of the Wild Type (WT) E7 protein from MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCD
STLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
SE() ID NO: 17 is the amino acid sequence of a non-oncogenic variant of the E7 protein from HPV 16 TPTLHEYMLDLQPETTDPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPI
SEO ID NO: 18 is the amino acid sequence of a non-oncogenic variant of the E7 protein from HPV 16 PGDTPTLHEYMLDLQPETTDPDRAHYNIVTFCCKCDSTLRRCVQSTHVDIRTLEDLLMGTLGI
VCPI
SEO ID NO: 19 is the nucleic acid sequence encoding the E6 protein from HPV 18 (MF288727.1) ATGGCGCGCTTTGAGGATCCAACACGGCGACCCTACAAGCTACCTGATCTGTGCACGGAA
CTGAACACTTCACTGCAAGACATAGAAATAACCTGTGTATATTGCAAGACAGTATTGGAA
CTTACAGAGGTATTTGAATTTGCATTTAAAGATTTATTTGTGGTGTATAGAGACAGTATAC
CGCATGCTGCATGCCATAAATGTATAGATTTTTATTCTAGAATTAGAGAATTAAGACATT
ATTCAGACTCTGTGTATGGAGACACATTGGAGAAACTAACTAACACTGGGTTATACAATT
TATTAATAAGGTGCCTGCGGTGCCAGAAACCGTTGAATCCAGCAGAAAAACTTAGACACC
TTAATGAAAAACGACGATTCCACAACATAGCTGGGCACTATAGAGGCCAGTGCCATTCGT
GCTGCAACCGAGCACGACAGGAAAGACTCCAACGACGCAGAGAAACACAAGTATAA
SEO ID NO: 20 is the nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 18 CCCTACAAGCTGCCTGACCTGTGTACAGAGCTGAACACCTCCCTGCAGGACATCGAGATC
ACCTGTGTGTATTGCAAGACCGTGCTGGAACTGACCGAGGTGTTCGAGTTTGCCTTCAAG
GATCTGTTCGTGGTGTACCGGGACAGCATCCCCCACGCCGCCTGCCACAAGCTGGAAAAG
CTGACCAACACCGGCCTGTACAACCTGCTGATTCGGTGCCTGCGGTGTCAGAAGCCTCTG
AACCCCGCCGAGAAGCTGCGGCACCTGAACGAGAAGCGGAGATTCCACAATATCGCC
SE0 ID NO: 21 is the nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 18 CCCTACAAGCTGCCTGACCTGTGTACAGAGCTGAACACCTCCCTGCAGGACATCGAGATC
ACCTGTGTGTATTGCAAGACCGTGCTGGAACTGACCGAGGTGTTCGAGTTTGCCTTCAAG
GATCTGTTCGTGGTGTACCGGGACAGCATCCCCCACGCCGCCTGCCACAAG
SEO ID NO: 22 is the nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 18 CCCTACAAGCTGCCCGATCTGTGCACAGAGCTGAACACCTCCCTGCAGGACATCGAGATC
ACCTGCGTCTACTGCAAGACCGTGCTGGAACTGACCGAGGTGTTCGAATTCGCCTTCAAG
GACGGCTTCGTGGTGTACAGGGACAGCATTCCCCACGCCGCCTGCCATAAGCTGGAGAAA
CTGACCAACACCGGACTGTATAACCTGCTGATCAGGTGTCTGAGGTGCCAGAAGGCAGA
GAAACTGAGACATCTGAACGAGAAAAGGAGGTTCCACAATATTGCCGGGCACTGATAA
SEO ID NO: 23 is the nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 18 ATGAGGCGGCCCTACAAGCTGCCCGACCTGTGCACCGAGCTGAACACCTCCCTGCAGGAC
ATCGAGATCACCTGCGTGTACTGCAAGACCGTGCTGGAGCTGACCGAGGTGTTCGAATTC
GCATTCAAGGACGGATTCGTCGTGTATAGGGACAGCATTCCACACGCCGCCTGCCACAAG
CTGGAGAAATTGACTAACACCGGACTGTATAATCTGCTGATCCGGTGCCTGAGGTGTCAG
AAGGCCGAGAAGCTGAGGCATCTGAACGAGAAAAGGAGATTCCACAATATCGCCGGACA
C
SEO ID NO: 24 is the amino acid sequence of the Wild Type (WT) E6 protein from MARFEDPTRRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDLFVVYRDSIPHAA
CHKCIDFYSRIRELRHYSDSVYGDTLEKLTNTGLYNLLIRCLRC QKPLNPAEKLRHLNEKRRF
HNIAGHYRGQCHSCCNRARQERLQRRRETQV
SEO ID NO: 25 is the amino acid sequence of a non-oncogenic variant of the E6 protein from HPV 18 PYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDLFVVYRDSIPHAACHKLEKLTNT
GLYNLLIRCLRCQKPLNPAEKLRHLNEKRRFHNIA
SEO ID NO: 26 is the amino acid sequence of a non-oncogenic variant of the E6 protein from HPV 18 PYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDLFVVYRDSIPHAACHK
SEO ID NO: 27 is the amino acid sequence of a non-oncogenic variant of the E6 protein from HPV 18 PYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDGFVVYRDSIPHAACHKLEKLTNT
GLYNLLIRCLRCQKAEKLRHLNEKRRFHNIAGH
SEO ID NO: 28 is the amino acid sequence of a non-oncogenic variant of the E6 protein from HPV 18 MRRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDGFVVYRDSIPHAACHKLEKL
TNTGLYNLLIRCLRCQKAEKLRHLNEKRRFHNIAGH
SE0 ID NO: 29 is the nucleic acid sequence encoding the E7 protein from HPV 18 (NC_001357.1) ATGCATGGACCTAAGGCAACATTGCAAGACATTGTATTGCATTTAGAGCCCCAAAATGAA
ATTCCGGTTGACCTTCTATGTCACGAGCAATTAAGCGACTCAGAGGAAGAAAACGATGAA
ATAGATGGAGTTAATCATCAACATTTACCAGCCCGACGAGCCGAACCACAACGTCACACA
ATGTTGTGTATGTGTTGTAAGTGTGAAGCCAGAATTGAGCTAGTAGTAGAAAGCTCAGCA
GACGACCTTCGAGCATTCCAGCAGCTGTTTCTGAACACCCTGTCCTTTGTGTGTCCGTGGT
GTGCATCCCAGCAGTAA
SEO ID NO: 30 is the nucleic acid sequence encoding a non-oncogenic variant of the E7 protein from HPV 18 AAGGCCACACTGCAGGATATCGTGCTGCACCTGGAACCCCAGAACGAGATCCCCGTGGA
CAGCGAGGAAGAGAACGACGAGATCGACGGCGTGAACCACCAGCATCTGCCCGCCAGAA
GGGCCGAGCCCCAGAGACACACCATGCTGTGCATGTGTTGCAAATGCGAGGCCCGGATC
AAGCTGGTGGTGGAAAGCAGCGCCGACGACCTGCGGGCCTTCCAGCAGCTGTTCCTGAAC
ACCCTGTCCTTCGTGTGCCCTTGG
SEO ID NO: 31 is the nucleic acid sequence encoding a non-oncogenic variant of the E7 5 protein from HPV 18 GGACCTAAAGCCACCCTCCAGGACATCGTGCTGCACCTGGAGCCCCAGAACGAGATCCCC
GTCGACTCAGAGGAGGAGAACGACGAAATTGACGGCGTCAACCACCAGCACCTGCCCGC
TCGCAGAGCCGAACCCCAGAGACACACCATGCTCTGCATGTGCTGCAAATGCGAGGCCC
GGATTAAGCTGGTGGTGGAGAGCTCCGCCGACGATCTGAGAGCCTTCCAGCAGCTCTTCC
SEO ID NO: 32 is the nucleic acid sequence encoding a non-oncogenic variant of the E7 protein from HPV 18 GGACCTAAAGCCACCCTCCAGGACATCCGTCTGGAGCCCCAGAACGAGATCCCCGTCGAC
CGAACCCCAGAGACACACCATGCTCTGCATGTGCTGCAAATGCGAGGCCCGGATTAAGCT
GGTGGTGGAGAGCTCCGCCGACGATCTGAGAGCCTTCCAGCAGCTCTTCCTGGATTCCTT
CGTGTGCCCCTGG
20 SEO ID NO: 33 is the amino acid sequence of the Wild Type (WT) E7 protein from HPV 18 MHGPKATLQDIVLHLEPQNEIPVDLLCHEQLSDSEEENDEIDGVNHQHLPARRAEPQRHTMLC
MCCKCEARIELVVESSADDLRAFQQLFLNTLSFVCPWCAS QQ
SE() ID NO: 34 is the amino acid sequence of a non-oncogenic variant of the E7 protein 25 from HPV 18 KATLQDIVLHLEPQNEIPVDSEEENDEIDGVNHQHLPARRAEPQRHTMLCMCCKCEARIKLVV
ESSADDLRAFQQLFLNTLSFVCPW
SEC/ ID NO: 35 is the amino acid sequence of a non-oncogenic variant of the E7 protein 30 from HPV 18 GPKATLQDI VLHLEPQNEIPVDSEEENDEIDGVNHQHLPARRAEPQRHTMLCMCCKCEARIKL
VVESSADDLRAFQQLFLNTLSFVCPW
SEO ID NO: 36 is the amino acid sequence of a non-oncogenic variant of the E7 protein 35 from HPV 18 GPKATLQDIRLEPQNEIPVDSEEENDEIDGNHQHLPARRAEPQRHTMLCMCCKCEARIKLVVE
SSADDLRAFQQLFLDSFVCPW
SEO ID NO: 37 is the nucleic acid sequence encoding the cPPT/CTS sequence AATTTTAAAAGAAAAGGGGGGATTGGGGGGTACAGTGCAGGGGAAAGAATAGTAGACAT
AATAGCAACAGACATACAAACTAAAGAATTACAAAAACAAATTACAAAAATTCAAAATT
TT
SEO ID NO: 38 is the nucleic acid sequence encoding a mutant form of the woodchuck hepatitis B virus (WHV) post-transcriptional regulatory element (WPRE) TTCCCGATAATCAACCTCTGGATTACAAAATTTGTGAAAGATTGACTGGTATTCTTAACTA
TGTTGCTCCTTTTACGCTATGTGGATACGCTGCTTTAATGCCTTTGTATCATGCTATTGCTT
CCCGTATGGCTTTCATTTTCTCCTCCTTGTATAAATCCTGGTTGCTGTCTCTTTATGAGGAG
TTGTGGCCCGTTGTCAGGCAACGTGGCGTGGTGTGCACTGTGTTTGCTGACGCAACCCCC
ACTGGTTGGGGCATTGCCACCACCTGTCAGCTCCTTTCCGGGACTTTCGCTTTCCCCCTCC
CTATTGCCACGGCGGAACTCATCGCCGCCTGCCTTGCCCGCTGCTGGACAGGGGCTCGGC
TGTTGGGCACTGACAATTCCGTGGTGTTGTCGGGGAAGCTGACGTCCTTTCCGCGGCTGCT
CGCCTGTGTTGCCACCTGGATTCTGCGCGGGACGTCCTTCTGCTACGTCCCTTCGGCCCTC
AATCCAGCGGACCTTCCTTCCCGCGGCCTGCTGCCGGCTCTGCGGCCTCTTCCGCGTCTTC
GCCTTCGCCCTCAGACGAGTCGGATCTCCCTTTGGGCCGCCTCCCCGC
SEO ID NO: 39 is a synthetic E7hpv16-derived peptide containing the RAHYNIVTF
H-2Db-restricted T-cell epitope ETTDPDRAHYNIVTF
SE0 ID NO: 40 is a synthetic E7HPv16-derived peptide containing the RAHYNIVTF
H-2Db-restricted T-cell epitope PDRAHYNIVTFCCKC
SEO ID NO: 41 is the nucleic acid sequence encoding an antigen construct of the lentiviral vector filed at the CNCM under accession number 1-5759 ATGCCC GGAGACAC CCCC ACCCTGC ACGAATACATGC TGGAC C TGCAGC CC GAA
ACCACCGACCCCGACCGCGCTCACTACAACATCGTTACATTCTGTTGTAAATGCG
ACTCCACCCTGAGAAGATGCGTGCAGTCCACCCACGTGGACATCAGGACCCTGGA
GGACCTCCTCATGGGAACCCTGGGTATC GTCTGCCCCATC GCCTCCCAGGCTTTTC
AGGACCCCCAGGAAAGGCCCAGGAAGTTGCCCCAGCTCTGCACC GAACTGC AGA
CCACCATTCATGACATCATCCTCGAATGC GTGTACTGCAAGCAGCAGCTCCTGAG
GAGGGAGGTGTAC GATTTC GCCTTCAGAGACGGCTGTATC GTCTACAGGAACCCC
TATGCC GTCTGCGACAAATGCCTGAAGTTTTATTCCAAGATCTCCGAGTACAGGC
ACTATTGCTACAGCCTGTATGGGACCACCCTGGAGCAGCAGTACAACAAGCCCCT
GTGCGACCTCCTGATCAGGTGCATCAACTGCCAGAAGCCCCTGAGGTTCCACAAC
ATCCGC GGCAGGTGGACCGGAAGGTGCATGTCCTGCTGCAGGTCCGCCGGCCCC G
GACCTAAAGCCACCCTCCAGGACATCGTTCTCCACCTGGAGCCCCAGAACGAGAT
CCCCGTGGACTCAGAAGAGGAGAACGAC GAGATCGACGGCGTCAACCACCAGCA
CCTGCCCGCTCGCAGAGCCGAACCCCAGAGACACACCATGCTCTGCATGTGCTGC
AAATGC GAAGCCC GGATTAAGTTGGTGGTGGAAAGCAGC GCCGACGATCTGAGG
GCCTTCCAGCAGCTCTTCCTCAACACCCTGTCCTTC GTGTGCC CCTGGGTGG GC GA
GCCCGGTAGAACCATCCCCTACAAGCTGCCCGATCTGTGCACAGAGCTGAACACC
TCCCTGCAGGACATCGAGATCACCTGCGTCTACTGCAAGACCGTGCTGGAACTGA
CCGAGGTGTTCGAATTCGCCTTCAAGGACGGCTTCGTGGTGTACAGGGACAGCAT
TCCCCACGCCGCCTGCCATAAGCTGGAGAAACTGACCAACACC GGACTGTATAAC
CTGCTGATCAGGTGTCTGAGGTGCCAGAAGGCAGAGAAACTGAGACATCTGAAC
GAGAAAAGGAGGTTCCACAATATTGCCGGGCACTGATAA
SEO ID NO: 42 is the amino acid sequence of the antigen construct encoded by the lentiviral vector filed at the CNCM under accession number 1-5759 MPGDTPTLHEYMLDLQPETTDPDRAHYNIVTFCCKCDSTLRRCVQSTHVDIRTLEDL
LMGTLGIVCPIAS QAFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDF
AFRDGC IVYRNPYAVC D KCLKFYS KIS EYRHYCYS LYGTTLEQQYNKPLC DLLIRCIN
CQKPLRFHNIRGRWTGRCMSCCRSAGPGPKATLQDIVLHLEPQNEIPVDSEEENDEID
GVNHQHLPARRAEPQRHTMLCMCCKCEARIKLVVESS ADDLRAFQQLFLNTLSFVCP
WVGEPGRTIPYKLPDLCTELNTSLQDIEITC VYC KTVLELTEVFEFAFKDGFVVYRDS I
PHAACHKLEKLTNTGLYNLLIRCLRCQKAEKLRHLNEKRRFHNIAGH
SEO ID NO: 43 is the nucleic acid sequence encoding an antigen construct of the lentiviral vector filed at the CNCM under accession number 1-5760 ATGTTCCAGGACCCCCAGGAGAGGCCCCGGAAGTTGCCCCAGCTGTGCACCGAG
CTGCAGACCACCATCCACGACATCATCCTCGAATGCGTGTACTGCAAGCAGCAGC
TGCTGAGGAGGGAGGTGTATGACTTTGCCTTCAGAGACGGATGCATTGTCTACAG
GAACCCCTACGCC GTGTGCGACAAATGCCTGAAGTTCTACTCCAAGATCAGC GAG
TACAGGCACTACTGCTACTCCCTGTAC GGCACCACCCTC GAACAGCAGTACAACA
AACCCCTGTGCGACCTCCTGATTAGGTGCATCAACTGCCAGAAGCCCCTCAGGTT
CCACAACATCCGC GGCCGC TGGAC C GGCCGATGCATGTCTTGCTGCAGGGGC CC C
GACGACCCCTACAAGCTCCCCGACCTGTGCACCGAACTCAACACCTCCCTGCAGG
ACATCGAGATCACCTGCGTGTATTGCAAGACCGTGCTGGAGCTGACCGAGGTTTT
CGAATTTGCCTTTAAGGACGGCTTCGTCGTGTATAGGGACTCCATCCCCCACGCC
GCCTGCC ATAAGCTGGAGAAGCTC ACC AAC ACC GGACTGTATAATCT GCTGATC A
GGTGCCTCAGGTGCCAGAAGGCAGAAAAGCTGAGGCATCTCAAC GAGAAGCGCC
GGTTCCACAATATTGCCGGCCCCGGAGACACCCCCACACTCCATGAGTACATGCT
CGACCTGCAGCCCGAAACCACCGACCCCGACAGAGCCCACTACAACATCGTGAC
CTTCTGCTGCAAGTGCGACTCCACCCTGAGAAGATGCGTGCAGTCCACCCACGTG
GACATCC GCACACTCGAAGACCTGCTGAT GGGAACC CTGGGCATC GTGTGCCCC A
TCGGCCCCGATGACAAGGCCACCTTGCAGGACATCGTGCTGCACCTGGAACCACA
GAACGAGATCCCCGTCGACTCCGAAGAAGAAAACGACGAAATCGACGGAGTGAA
TCACCAGCACCTGCCCGCCAGAAGGGCCGAGCCTCAGAGACACACCATGCTCTGC
ATGTGCTGCAAATGCGAAGCCAGGATTAAGCTGGTGGTGGAGAGCAGCGCCGAC
GACCTGAGGGCCTTCCAGCAGCTCTTCCTGAACACACTGTCCTTCGTGTGCCCCTG
GGCCTGATAA
SEO ID NO: 44 is the amino acid sequence of the antigen construct encoded by the lentiviral vector filed at the CNCM under accession number 1-5760 MFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDGCIVYRNPY
AVCDKCLKFYS KIS EYRHYC YSLYGTTLEQ QYNKPLCDLLIRC INC QKPLRFHNIRGR
WTGRCMS CC RGPDDPYKLPDLC TELNT S LQDIEITCVYCKTVLELTEVFEFAFKDGFV
VYRDSIPHAACHKLEKLTNTGLYNLLIRCLRCQKAEKLRHLNEKRRFHNIAGPGDTPT
LHEYMLDLQPETTDPDRAHYNIVTFCCKCDSTLRRCVQS THVDIRTLEDLLMGTLGIV
CPIGPDDKATLQDIVLHLEPQNEIPVDSEEENDEIDGVNHQHLPARRAEPQRHTMLCM
CCKCEARIKLVVES SADDLRAFQQLFLNTLSFVCPWA
SEO ID NO: 45 is the nucleic acid sequence encoding an antigen construct of the lentiviral vector filed at the CNCM under accession number 1-5761 ATGAGGC GGCCCTACAAGCTGCCC GACCTGTGCACC GAGCTGAACACCTCCCTGC
AGGACATCGAGATCACCTGCGTGTACTGCAAGACCGTGCTGGAGCTGACCGAGG
TGTTCGAATTC GCATTCAAGGAC GGATTC GTCGTGTATAGGGACAGCATTCCACA
CGCCGCCTGCCACAAGCTGGAGAAATTGACTAACACC GGACTGTATAATCTGCTG
ATCCGGTGCCTGAGGTGTCAGAAGGCCGAGAAGCTGAGGCATCTGAACGAGAAA
AGGAGATTCCACAATATC GCCGGACACTTCCAGGACCCCCAGGAGAGGCCCAGG
AAACTGCCCCAGTTGTGCACCGAGCTCCAGACAACCATCCAC GACATCATCCTGG
AGTGCGTGTACTGTAAGCAGCAGTTGCTGAGGAGAGAGGTGTATGACTTCGCCTT
CAGAGAC GGATGC ATTGTC TATAGGAACCC CT ACGC CGTGTGC G ACAAGTGCCT G
AAGTTCTACTCCAAGATCAGTGAGTACAGGCATTACTGCTACAGCCTGTATGGAA
CCACAC TGGAAC AGCAGTACAACAAGCCCCTGTGC GACCTCCTGATTAGGTGC AT
CAACTGCCAGAAGCCCCTCAGGTTCCACAACATCC GGGGCAGGTGGACCGGAAG
GTGCATGTCCTGCTGCAGGTCCGCCGGCCCCGGACCTAAAGCCACCCTCCAGGAC
ATCGTGCTGCACCTGGAGCCCCAGAACGAGATCCCCGTCGACTCAGAGGAGGAG
AACGAC GAAATTGACGGCGTCAACCACCAGCACCTGCCCGCTCGCAGAGCCGAA
CCCCAGAGACACACCATGCTCTGCATGTGCTGCAAATGCGAGGCCCGGATTAAGC
TGGTGGTGGAGAGCTCCGCCGACGATCTGAGAGCCTTCCAGCAGCTCTTCCTGAA
CACCCT GTCCTTC GTGTGCCC CTGGGCC GGTC CC GGTGACACAC CTACC CTGCAC
GAGTAC ATGCTC GATCTGC AGCC C GAGAC CACCGAC CCCGATCGCGC ACACTAC A
ACATCGT GACC TTCTGC TGCAAATGTGAC AGCAC CCTGAGAC GGTGC GTCCAGTC
CACCCAC GTTGACATCC GCACCCTCGAAGACCTGCTC ATGGGAACCCTGGGCATC
GTGTGCCCCATCGCCTGATAA
SEO ID NO: 46 is the amino acid sequence of the antigen construct encoded by the lentiviral vector filed at the CNCM under accession number 1-5761 MRRPYKLPDLC TELNTS LQDIEITCVYC KTVLELTEVFEFAFKD GFVVYRD S IPHAAC
HKLEKLTNTGLYNLLIRCLRCQKAEKLRHLNEKRRFHNIAGHFQDPQERPRKLPQLC
.. TELQTTIHDIILEC VYC KQQLLRREVYDFAFRDGC IVYRNPYAVCD KCLKFYS KIS EYR
HYCYS LYGTTLEQQYNKPLCDLLIRC INCQ KPLRFHNIRGRWT GRCMS CC RS AGPGP
KATLQDIVLHLEPQNEIPVDS EEENDEID GVNHQHLPARRAEPQRHTMLCMCC KCEA
RIKLVVES SADDLRAFQQLFLNTLSFVCPWAGPGDTPTLHEYMLDLQPETTDPDRAH
YNIVTFCCKCDSTLRRCVQSTHVDIRTLEDLLMGTLGIVCPIA
SEO ID NO: 47 is the nucleic acid sequence encoding an antigen construct of the lentiyiral 5 vector filed at the CNCM under accession number 1-5762 ATGGGCCCTAAGGCCACCCTGCAGGACATCGTGCTGCACTTGGAGCCCCAGAACG
AGATCCCCGTGGACAGCGAGGAGGAGAACGACGAAATCGACGGCGTGAACCACC
AGCACCTGCCCGCAAGAAGGGCCGAACCCCAGAGGCACACCATGCTCTGCATGT
GCTGCAAATGCGAGGCCAGGATCAAGCTGGTGGTGGAAAGCAGCGCCGACGATC
ACCCGGCAGGACCATCCCCTATAAACTGCCCGACCTCTGCACCGAGCTGAACACC
TCCCTGCAGGACATTGAGATCACCTGCGTCTACTGCAAAACCGTCCTGGAACTGA
CCGAGGTGTTCGAGTTCGCCTTCAAAGACGGCTTCGTCGTGTACAGGGACAGCAT
CCCCCACGCCGCCTGCCATAAGCTGGAGAAACTGACCAACACCGGCCTGTACAAC
GAGAAAAGGAGATTCCACAATATTGCCGGGCCCGGCGACACCCCAACCCTGCAC
GAATAC ATGCTC GACCTGCAGCC C GAAACC ACC GACC CCGACAGAGCCC ACTAC
AACATCGTGACCTTCTGCTGCAAGTGCGACTCCACCCTGAGAAGATGCGTGCAGT
CCACCCAC GTGGACATCC GCACACTC GAAGACCTGC TGATGGGAACCC TGGGC AT
CTGCCCCAGCTCTGCACCGAACTGCAGACCACCATCCACGACATCATCCTGGAAT
GCGTCTACTGTAAGCAGCAGTTGCTGAGGAGGGAGGTGTATGATTTCGCCTTCAG
AGACGGCTGC ATCGTCTACAGGAACCCCTACGCCGTGTGCGACAAATGCCTGAAG
TTCTACTCCAAGATCTCCGAATACAGACACTATTGCTACAGCCTGTACGGCACCA
CTGCCAGAAGCCCCTCCGGTTCCACAACATCCGAGGAAGATGGACCGGCCGGTG
CATGTCCTGCTGCAGGTCCTGATAA
SW) ID NO: 48 is the amino acid sequence of the antigen construct encoded by the lentiviral 30 vector filed at the CNCM under accession number 1-5762 MGPKATLQDIVLHLEPQNEIPVDSEEENDEIDGVNHQHLPARRAEPQRHTMLCMCCK
CEARIKLVVESSADDLRAFQQLFLNTLSFVCPGEPGRTIPYKLPDLCTELNTSLQDIEIT
CVYCKTVLELTEVFEFAFKDGFVVYRDSIPHAACHKLEKLTNTGLYNLLIRCLRCQK
AEKLRHLNEKRRFHNIAGPGDTPTLHEYMLDLQPETTDPDRAHYNIVTFCCKCDSTL
RRCVQSTHVDIRTLEDLLMGTLGIVCPIASQAFQDPQERPRKLPQLCTELQTTIHDIILE
CVYCKQQLLRREVYDFAFRDGCIVYRNPYAVCDKCLKFYS KIS EYRHYCYSLYGTTL
EQQYNKPLCDLL IRCINCQKPLRF HNIRGRWTGRC MSCCRS
TRAITE DE BUDAPEST SUR LA RECONNAISSANCE
INTERNATIONALE DU DEPOT DES MICRO-ORGANISMES
AUX FINS DE LA PROCEDURE EN MATIERE DE BREVETS
FORMULE INTERNATIONALE
DESTINATAIRE
RECEPISSE EN CAS DE DEPOT INITIAL
INSTITUT PASTEUR d6livr6 en vertu de la r6gle 7.1 par 25-28, RUE DU DOCTEUR ROUX l'AUTORITE DE DEPOT INTERNATIONALE
75724 PARIS CEDEX 15 identifite au bas de cette page NOM ET ADRESSE
DU DEPOSANT
I. IDENTIFICATION DU MICRO-ORGANISME
Reference d'identification dorm& par le NumCro d'ordre attribue par DEPOSANT : l'AUTORITE DE DEPOT INTERNATIONALE:
pFlap-beta2m-HPV7-WPREm CNCM 1-5759 H. DESCRIPTION SCIENTIFIQUE ET/OU DESIGNATION TAXONOMIQUE PROPOSEE
Le micro-organisme identifie sous chiffre I &tit accompagne :
Eld'une description scientifique d'une designation taxonomiquc proposes (Cocher cc qui convient).
RECEPTION ET ACCEPTATION
La presente autorite de depot Internationale acccptc lc micro-organismc identifie sous chiffre I, qu'clIc a re&
lc 21 OCTOBRE 2021 (date du depot initial) IV. RECEPTION D'UNE REQUETE EN CONVERSION
La presente autorite de depot Internationale a Teo lc micro-organismc identifie sous chiffre I lc (date du depot initial)' at a Teen une Torquato en conversion du depot initial en depot conforme au Traite de Budapest to (date de reception de la requete en conversion).
V. AUTORITE DE DEPOT INTERNATIONALE
Nom : COLLECTION NATIONALE Signature(s) de Is (des) personnc(s) competente(s)ponr_.
DE CULTURES DE MICROORGANISMES reprosenter l'autorite de depot Internationale ou, '(de (CNCM) employe(s = = RAQUEL HURT. 0-'o Adresse :
INSTITUT PASTEUR
col 11(1N \
.,OZALP
75724 PARIS CEDEX 15 DatcLE 0)CEMBRE 202 rst$
*
risCrufie, t,E4usias 4,*
En cas &application de la regle 6.4.d), cote date est la date a laquelle lc statut d'autorite de depot interne*, Wetequ' . µ411, Fonnule BP/4 (page unique) TRAITE DE BUDAPEST SUR LA RECONNAISSANCE
INTERNATIONALE DU DEPOT DES MICRO-ORGANISMES
AUX FINS DE LA PROCEDURE EN MATIERE DE BREVETS
FORMULE INTERNATIONALE
DESTINATAIRE
RECEPISSE EN CAS DE DEPOT INITIAL
INSTITUT PASTEUR delivre en vertu de la regle 7.1 par 25-28, RUE DU DOCTEUR ROUX l'AUTORITE DE DEPOT INTERNATIONALE
75724 PARIS CEDEX 15 identifiee au bas de cette page L_ NOM ET ADRESSE
DU DEPOSANT
I. IDENTIFICATION DU MICRO-ORGANISME
Reference d'identification donnee par le Numero d'ordrc attribue par DEPOSANT : l'AUTORITE DE DEPOT INTERNATIONALE:
pFlap-beta2m-HPV8-WPREm CNCM 1-5760 IL DESCRIPTION SCIENTIFIQUE ET/OU DESIGNATION TAXONOMIQUE PROPOSER
Lc micro-organismc identifie sous chiffre I etait accompagne d'une description scientifique d'une designation taxonomique propos&
(Cochcr cc qui convient).
III. RECEPTION ET ACCEPTATION
La presente autorite de depth internationale acceptc le micro-organismc identifie sous chime I, qu'elle a revs lc 21 OCTOBRE 2021 (date du depot initial)'.
IV. RECEPTION D'UNE REQUETE EN CONVERSION
La presente autorite de depot internationale a men lc micro-organisme identifie sous chiffre lie (date du depot initial) eta reeu une requete en conversion du depot initial en depot conforme au Traite de Budapest lc (date de reception de la requete en conversion).
V. AUTORITE DE DEPOT INTERNATIONALE
Nom: COLLECTION NATIONALE Signature(s) de la (des) personne(s) competente(s)pour. õ
DE CULTURES DE NICROORGANISMES representer l'autorite de depot intemationale ou dsP i4r) (CmCm) employe(s) autorise(s : RAQUEL
HURTADOLO
Adresse :
INSTITUT PASTEUR ECU N
\
25 RUE DU DOCTEUR ROUX r 75724 PARIS CEDEX 15 Date: PAµ 20LE 9 D __ 1 ____________________________________________________________________ rtn DE Ja I En cas d'application de la regle 6.4.d), cote date est la date a laquellc lc statut d'autorite de depot intemationte /NWT"
.
______________________________________________________________________________ 4N. =
Fonnule BP/4 (page unique) it RI V.
TRAITE DE BUDAPEST SUR LA RECONNAISSANCE
INTERNATIONALE DU DEPOT DES MICRO-ORGANISMES
AUX FINS DE LA PROCEDURE EN MATIERE DE BREVETS
FORM ULE INTERNATIONALE
INSTITUT PASTEUR delivre en vertu de la regle 7.1 par 25-28, RUE DU DOCTEUR ROUX l'AUTORITE DE DEPOT INTERNATIONALE
75724 PARIS CEDEX 15 identifiee au bas de cette page NOM ET ADRESSE
DU DEPOSANT
I, IDENTIFICATION DU MICRO-ORGANISME
Reference d'identification donnee par le Numero d'ordre attribue par DEPOSANT : l'AUTORITE DE DEPOT INTERNATIONALE:
pRap-beta2m-HPV9-WPREm CNCM 1-5761 II. DESCRIPTION SCIENTIFIQUE ET/OU DESIGNATION TAXONOMIQUE PROPOSEE
Le micro-organisme identifie sous chiffic 1 etait accompagne :
d'unc description scientifique d'unc designation taxonomique propos&
(Cocher cc qui convient).
III. RECEPTION ET ACCEPTATION
La presente autorite de depot Internationale acccptc lc micro-organisme identifie sous chiffrc I, qu'elle a rect.' le 21 OCTOBRE 2021 (date du depot initial)'.
IV. RECEPTION D'UNE REQUETE EN CONVERSION
La present autorite de depot international a rccu lc micro-organismc identifie sous chiffre lie (date du depot initial) ' eta recu une requete en conversion du depot initial en depot confonne au Traite de Budapest lc (date de reception de la requete on conversion).
V. AUTORITE DE DEPOT INTERNATIONALE
Nom: COLLECTION NATIONALE Signature(s) dc la (dcs)personnc(s) compotcnte(s)pour DE CULTURES DE MICROORGANISMES repthsenter l'autorite de depot intemationale ou de l' s) r (CNCM) employe(s) au ' = RAQUEL HURTADQ-0 = 4.0 Adresse : IljVC11 INSTITUT PASTEUR
= ,R.taiONA
75724 PARIS CEDEX 15 Date : PARIS, LE 09 EMBRE 2024 ".
oa CUL Wel S
=0 IlleritISISth En cas d'application dc la regle 6.4.d), cello date cst la date a laquelle le statut d'autorite de depot intemationnle t acquis Formulc BP/4 (page unique) ttNt Vv./
TRAITE DE BUDAPEST SUR LA RECONNAISSANCE
INTERNATIONALE DU DEPOT DES MICRO-ORGANISMES
AUX FINS DE LA PROCEDURE EN MATIERE DE BREVETS
FORMULE INTERNATIONALE
DESTINATAIRE
RECEPISSE. EN CAS DE DEPOT INITIAL
INSTITUT PASTEUR davit en vertu de la regle 7.1 par 25-28, RUE DU DOCTEUR ROUX l'AUTORITE DE DEPOT INTERNATIONALE
75724 PARIS CEDEX 15 identifiee au bas de cette page NOM ET ADRESSE
DU DEPOSANT
I. IDENTIFICATION DU MICRO-ORGANISME
Reference d'identification donnee par le Numero d'ordre attribue par DEPOSANT : l'AUTORITE DE DEPOT INTERNATIONALE:
pFlap-beta2m-HPV10-WPREm CNCM I-5762 II. DESCRIPTION SCIENTIFIQUE ET/OU DESIGNATION TAXONOMIQUE PROPOSEE
Le micro-organisme identifie sous chiffre I etait accompagne :
d'une description scientifique d'une designation taxonomique propos&
(Cocher co qui convient).
HI. RECEPTION ET ACCEPTATION
La presente autorite de depot intemationale accepte le micro-organismc identifie sous chiffre I, qu'elle a recu k 21 OCTOBRE 2021 (date du depot initial)'.
IV. RECEPTION D'UNE REQUETE EN CONVERSION
La presente autorite de &pet intemationak a recu le micro-organisme identifie sous chiffre I le (date du depot initial)Ict a recu une rcquete en conversion du depot initial en depot conformc au Tmite de Budapest le (date de reception de Is requete en conversion).
V. AUTORITE DE DEPOT INTERNATIONALE
Nom: COLLECTION NATIONALE Signature(s) de la (des) personne(s) competcntc(s)pour DE CULTURES DE MICROORGANISMES representer l'autorite de depot intcrnationale ou de I(des) (CNCM) employe(s QUEL HURTADO,R
Adresse : INSTITUT RIS PASTEUR 15 75724 PA CEDEX Date : PARIS, LE 09 Di MBRE 2 tONA1 _______________________________________________________________________ 05 GUL1Uftlr.) En cas d'application de la regle 6.4.d), cone data eat la date a laquelle le statut d'autorite de depot interriatio lea ete Akins.
uo) Illtt060111411.1 414 Permute BP/4 (page unique) . __ N A
gat vmb
GATCTCTACTGTTATGAGCAATTAAATGACAGCTCAGAGGAGGAGGATGAAATAGATGG
TCCAGCTGGACAAGCAGAACCGGACAGAGCCCATTACAATATTGTAACCTTTTGTTGCAA
GTGTGACTCTACGCTTCGGTTGTGCGTACAAAGCACACACGTAGACATTCGTACTTTGGA
AGACCTGTTAATGGGCACACTAGGAATTGTGTGCCCCATCTGTTCTCAGAAACCATAA
SEQ ID NO: 14 is a nucleic acid sequence encoding a non-oncogenic variant of the E7 protein from HPV 16 ACCCCCACCCTGCACGAGTACATGCTGGACCTGCAGCCCGAGACAACCGACCCCGACCG
GGCCCACTACAATATCGTGACCTTCTGCTGCAAGTGCGACAGCACCCTGCGGCTGTGCGT
GCAGAGCACCCACGTGGACATCCGGACCCTGGAAGATCTGCTGATGGGCACCCTGGGCA
TCGTGTGCCCCATT
SEO ID NO: 15 is a nucleic acid sequence encoding a non-oncogenic variant of the E7 protein from HPV 16 CCCGGAGACACCCCCACCCTGCACGAATACATGCTGGACCTGCAGCCCGAAACCACCGA
CCCCGACCGCGCTCACTACAACATCGTTACATTCTGTTGTAAATGCGACTCCACCCTGAG
AAGATGCGTGCAGTCCACCCACGTGGACATCAGGACCCTGGAGGACCTCCTCATGGGAA
CCCTGGGTATCGTCTGCCCCATC
SEO ID NO: 16 is the amino acid sequence of the Wild Type (WT) E7 protein from MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCD
STLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
SE() ID NO: 17 is the amino acid sequence of a non-oncogenic variant of the E7 protein from HPV 16 TPTLHEYMLDLQPETTDPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPI
SEO ID NO: 18 is the amino acid sequence of a non-oncogenic variant of the E7 protein from HPV 16 PGDTPTLHEYMLDLQPETTDPDRAHYNIVTFCCKCDSTLRRCVQSTHVDIRTLEDLLMGTLGI
VCPI
SEO ID NO: 19 is the nucleic acid sequence encoding the E6 protein from HPV 18 (MF288727.1) ATGGCGCGCTTTGAGGATCCAACACGGCGACCCTACAAGCTACCTGATCTGTGCACGGAA
CTGAACACTTCACTGCAAGACATAGAAATAACCTGTGTATATTGCAAGACAGTATTGGAA
CTTACAGAGGTATTTGAATTTGCATTTAAAGATTTATTTGTGGTGTATAGAGACAGTATAC
CGCATGCTGCATGCCATAAATGTATAGATTTTTATTCTAGAATTAGAGAATTAAGACATT
ATTCAGACTCTGTGTATGGAGACACATTGGAGAAACTAACTAACACTGGGTTATACAATT
TATTAATAAGGTGCCTGCGGTGCCAGAAACCGTTGAATCCAGCAGAAAAACTTAGACACC
TTAATGAAAAACGACGATTCCACAACATAGCTGGGCACTATAGAGGCCAGTGCCATTCGT
GCTGCAACCGAGCACGACAGGAAAGACTCCAACGACGCAGAGAAACACAAGTATAA
SEO ID NO: 20 is the nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 18 CCCTACAAGCTGCCTGACCTGTGTACAGAGCTGAACACCTCCCTGCAGGACATCGAGATC
ACCTGTGTGTATTGCAAGACCGTGCTGGAACTGACCGAGGTGTTCGAGTTTGCCTTCAAG
GATCTGTTCGTGGTGTACCGGGACAGCATCCCCCACGCCGCCTGCCACAAGCTGGAAAAG
CTGACCAACACCGGCCTGTACAACCTGCTGATTCGGTGCCTGCGGTGTCAGAAGCCTCTG
AACCCCGCCGAGAAGCTGCGGCACCTGAACGAGAAGCGGAGATTCCACAATATCGCC
SE0 ID NO: 21 is the nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 18 CCCTACAAGCTGCCTGACCTGTGTACAGAGCTGAACACCTCCCTGCAGGACATCGAGATC
ACCTGTGTGTATTGCAAGACCGTGCTGGAACTGACCGAGGTGTTCGAGTTTGCCTTCAAG
GATCTGTTCGTGGTGTACCGGGACAGCATCCCCCACGCCGCCTGCCACAAG
SEO ID NO: 22 is the nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 18 CCCTACAAGCTGCCCGATCTGTGCACAGAGCTGAACACCTCCCTGCAGGACATCGAGATC
ACCTGCGTCTACTGCAAGACCGTGCTGGAACTGACCGAGGTGTTCGAATTCGCCTTCAAG
GACGGCTTCGTGGTGTACAGGGACAGCATTCCCCACGCCGCCTGCCATAAGCTGGAGAAA
CTGACCAACACCGGACTGTATAACCTGCTGATCAGGTGTCTGAGGTGCCAGAAGGCAGA
GAAACTGAGACATCTGAACGAGAAAAGGAGGTTCCACAATATTGCCGGGCACTGATAA
SEO ID NO: 23 is the nucleic acid sequence encoding a non-oncogenic variant of the E6 protein from HPV 18 ATGAGGCGGCCCTACAAGCTGCCCGACCTGTGCACCGAGCTGAACACCTCCCTGCAGGAC
ATCGAGATCACCTGCGTGTACTGCAAGACCGTGCTGGAGCTGACCGAGGTGTTCGAATTC
GCATTCAAGGACGGATTCGTCGTGTATAGGGACAGCATTCCACACGCCGCCTGCCACAAG
CTGGAGAAATTGACTAACACCGGACTGTATAATCTGCTGATCCGGTGCCTGAGGTGTCAG
AAGGCCGAGAAGCTGAGGCATCTGAACGAGAAAAGGAGATTCCACAATATCGCCGGACA
C
SEO ID NO: 24 is the amino acid sequence of the Wild Type (WT) E6 protein from MARFEDPTRRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDLFVVYRDSIPHAA
CHKCIDFYSRIRELRHYSDSVYGDTLEKLTNTGLYNLLIRCLRC QKPLNPAEKLRHLNEKRRF
HNIAGHYRGQCHSCCNRARQERLQRRRETQV
SEO ID NO: 25 is the amino acid sequence of a non-oncogenic variant of the E6 protein from HPV 18 PYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDLFVVYRDSIPHAACHKLEKLTNT
GLYNLLIRCLRCQKPLNPAEKLRHLNEKRRFHNIA
SEO ID NO: 26 is the amino acid sequence of a non-oncogenic variant of the E6 protein from HPV 18 PYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDLFVVYRDSIPHAACHK
SEO ID NO: 27 is the amino acid sequence of a non-oncogenic variant of the E6 protein from HPV 18 PYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDGFVVYRDSIPHAACHKLEKLTNT
GLYNLLIRCLRCQKAEKLRHLNEKRRFHNIAGH
SEO ID NO: 28 is the amino acid sequence of a non-oncogenic variant of the E6 protein from HPV 18 MRRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDGFVVYRDSIPHAACHKLEKL
TNTGLYNLLIRCLRCQKAEKLRHLNEKRRFHNIAGH
SE0 ID NO: 29 is the nucleic acid sequence encoding the E7 protein from HPV 18 (NC_001357.1) ATGCATGGACCTAAGGCAACATTGCAAGACATTGTATTGCATTTAGAGCCCCAAAATGAA
ATTCCGGTTGACCTTCTATGTCACGAGCAATTAAGCGACTCAGAGGAAGAAAACGATGAA
ATAGATGGAGTTAATCATCAACATTTACCAGCCCGACGAGCCGAACCACAACGTCACACA
ATGTTGTGTATGTGTTGTAAGTGTGAAGCCAGAATTGAGCTAGTAGTAGAAAGCTCAGCA
GACGACCTTCGAGCATTCCAGCAGCTGTTTCTGAACACCCTGTCCTTTGTGTGTCCGTGGT
GTGCATCCCAGCAGTAA
SEO ID NO: 30 is the nucleic acid sequence encoding a non-oncogenic variant of the E7 protein from HPV 18 AAGGCCACACTGCAGGATATCGTGCTGCACCTGGAACCCCAGAACGAGATCCCCGTGGA
CAGCGAGGAAGAGAACGACGAGATCGACGGCGTGAACCACCAGCATCTGCCCGCCAGAA
GGGCCGAGCCCCAGAGACACACCATGCTGTGCATGTGTTGCAAATGCGAGGCCCGGATC
AAGCTGGTGGTGGAAAGCAGCGCCGACGACCTGCGGGCCTTCCAGCAGCTGTTCCTGAAC
ACCCTGTCCTTCGTGTGCCCTTGG
SEO ID NO: 31 is the nucleic acid sequence encoding a non-oncogenic variant of the E7 5 protein from HPV 18 GGACCTAAAGCCACCCTCCAGGACATCGTGCTGCACCTGGAGCCCCAGAACGAGATCCCC
GTCGACTCAGAGGAGGAGAACGACGAAATTGACGGCGTCAACCACCAGCACCTGCCCGC
TCGCAGAGCCGAACCCCAGAGACACACCATGCTCTGCATGTGCTGCAAATGCGAGGCCC
GGATTAAGCTGGTGGTGGAGAGCTCCGCCGACGATCTGAGAGCCTTCCAGCAGCTCTTCC
SEO ID NO: 32 is the nucleic acid sequence encoding a non-oncogenic variant of the E7 protein from HPV 18 GGACCTAAAGCCACCCTCCAGGACATCCGTCTGGAGCCCCAGAACGAGATCCCCGTCGAC
CGAACCCCAGAGACACACCATGCTCTGCATGTGCTGCAAATGCGAGGCCCGGATTAAGCT
GGTGGTGGAGAGCTCCGCCGACGATCTGAGAGCCTTCCAGCAGCTCTTCCTGGATTCCTT
CGTGTGCCCCTGG
20 SEO ID NO: 33 is the amino acid sequence of the Wild Type (WT) E7 protein from HPV 18 MHGPKATLQDIVLHLEPQNEIPVDLLCHEQLSDSEEENDEIDGVNHQHLPARRAEPQRHTMLC
MCCKCEARIELVVESSADDLRAFQQLFLNTLSFVCPWCAS QQ
SE() ID NO: 34 is the amino acid sequence of a non-oncogenic variant of the E7 protein 25 from HPV 18 KATLQDIVLHLEPQNEIPVDSEEENDEIDGVNHQHLPARRAEPQRHTMLCMCCKCEARIKLVV
ESSADDLRAFQQLFLNTLSFVCPW
SEC/ ID NO: 35 is the amino acid sequence of a non-oncogenic variant of the E7 protein 30 from HPV 18 GPKATLQDI VLHLEPQNEIPVDSEEENDEIDGVNHQHLPARRAEPQRHTMLCMCCKCEARIKL
VVESSADDLRAFQQLFLNTLSFVCPW
SEO ID NO: 36 is the amino acid sequence of a non-oncogenic variant of the E7 protein 35 from HPV 18 GPKATLQDIRLEPQNEIPVDSEEENDEIDGNHQHLPARRAEPQRHTMLCMCCKCEARIKLVVE
SSADDLRAFQQLFLDSFVCPW
SEO ID NO: 37 is the nucleic acid sequence encoding the cPPT/CTS sequence AATTTTAAAAGAAAAGGGGGGATTGGGGGGTACAGTGCAGGGGAAAGAATAGTAGACAT
AATAGCAACAGACATACAAACTAAAGAATTACAAAAACAAATTACAAAAATTCAAAATT
TT
SEO ID NO: 38 is the nucleic acid sequence encoding a mutant form of the woodchuck hepatitis B virus (WHV) post-transcriptional regulatory element (WPRE) TTCCCGATAATCAACCTCTGGATTACAAAATTTGTGAAAGATTGACTGGTATTCTTAACTA
TGTTGCTCCTTTTACGCTATGTGGATACGCTGCTTTAATGCCTTTGTATCATGCTATTGCTT
CCCGTATGGCTTTCATTTTCTCCTCCTTGTATAAATCCTGGTTGCTGTCTCTTTATGAGGAG
TTGTGGCCCGTTGTCAGGCAACGTGGCGTGGTGTGCACTGTGTTTGCTGACGCAACCCCC
ACTGGTTGGGGCATTGCCACCACCTGTCAGCTCCTTTCCGGGACTTTCGCTTTCCCCCTCC
CTATTGCCACGGCGGAACTCATCGCCGCCTGCCTTGCCCGCTGCTGGACAGGGGCTCGGC
TGTTGGGCACTGACAATTCCGTGGTGTTGTCGGGGAAGCTGACGTCCTTTCCGCGGCTGCT
CGCCTGTGTTGCCACCTGGATTCTGCGCGGGACGTCCTTCTGCTACGTCCCTTCGGCCCTC
AATCCAGCGGACCTTCCTTCCCGCGGCCTGCTGCCGGCTCTGCGGCCTCTTCCGCGTCTTC
GCCTTCGCCCTCAGACGAGTCGGATCTCCCTTTGGGCCGCCTCCCCGC
SEO ID NO: 39 is a synthetic E7hpv16-derived peptide containing the RAHYNIVTF
H-2Db-restricted T-cell epitope ETTDPDRAHYNIVTF
SE0 ID NO: 40 is a synthetic E7HPv16-derived peptide containing the RAHYNIVTF
H-2Db-restricted T-cell epitope PDRAHYNIVTFCCKC
SEO ID NO: 41 is the nucleic acid sequence encoding an antigen construct of the lentiviral vector filed at the CNCM under accession number 1-5759 ATGCCC GGAGACAC CCCC ACCCTGC ACGAATACATGC TGGAC C TGCAGC CC GAA
ACCACCGACCCCGACCGCGCTCACTACAACATCGTTACATTCTGTTGTAAATGCG
ACTCCACCCTGAGAAGATGCGTGCAGTCCACCCACGTGGACATCAGGACCCTGGA
GGACCTCCTCATGGGAACCCTGGGTATC GTCTGCCCCATC GCCTCCCAGGCTTTTC
AGGACCCCCAGGAAAGGCCCAGGAAGTTGCCCCAGCTCTGCACC GAACTGC AGA
CCACCATTCATGACATCATCCTCGAATGC GTGTACTGCAAGCAGCAGCTCCTGAG
GAGGGAGGTGTAC GATTTC GCCTTCAGAGACGGCTGTATC GTCTACAGGAACCCC
TATGCC GTCTGCGACAAATGCCTGAAGTTTTATTCCAAGATCTCCGAGTACAGGC
ACTATTGCTACAGCCTGTATGGGACCACCCTGGAGCAGCAGTACAACAAGCCCCT
GTGCGACCTCCTGATCAGGTGCATCAACTGCCAGAAGCCCCTGAGGTTCCACAAC
ATCCGC GGCAGGTGGACCGGAAGGTGCATGTCCTGCTGCAGGTCCGCCGGCCCC G
GACCTAAAGCCACCCTCCAGGACATCGTTCTCCACCTGGAGCCCCAGAACGAGAT
CCCCGTGGACTCAGAAGAGGAGAACGAC GAGATCGACGGCGTCAACCACCAGCA
CCTGCCCGCTCGCAGAGCCGAACCCCAGAGACACACCATGCTCTGCATGTGCTGC
AAATGC GAAGCCC GGATTAAGTTGGTGGTGGAAAGCAGC GCCGACGATCTGAGG
GCCTTCCAGCAGCTCTTCCTCAACACCCTGTCCTTC GTGTGCC CCTGGGTGG GC GA
GCCCGGTAGAACCATCCCCTACAAGCTGCCCGATCTGTGCACAGAGCTGAACACC
TCCCTGCAGGACATCGAGATCACCTGCGTCTACTGCAAGACCGTGCTGGAACTGA
CCGAGGTGTTCGAATTCGCCTTCAAGGACGGCTTCGTGGTGTACAGGGACAGCAT
TCCCCACGCCGCCTGCCATAAGCTGGAGAAACTGACCAACACC GGACTGTATAAC
CTGCTGATCAGGTGTCTGAGGTGCCAGAAGGCAGAGAAACTGAGACATCTGAAC
GAGAAAAGGAGGTTCCACAATATTGCCGGGCACTGATAA
SEO ID NO: 42 is the amino acid sequence of the antigen construct encoded by the lentiviral vector filed at the CNCM under accession number 1-5759 MPGDTPTLHEYMLDLQPETTDPDRAHYNIVTFCCKCDSTLRRCVQSTHVDIRTLEDL
LMGTLGIVCPIAS QAFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDF
AFRDGC IVYRNPYAVC D KCLKFYS KIS EYRHYCYS LYGTTLEQQYNKPLC DLLIRCIN
CQKPLRFHNIRGRWTGRCMSCCRSAGPGPKATLQDIVLHLEPQNEIPVDSEEENDEID
GVNHQHLPARRAEPQRHTMLCMCCKCEARIKLVVESS ADDLRAFQQLFLNTLSFVCP
WVGEPGRTIPYKLPDLCTELNTSLQDIEITC VYC KTVLELTEVFEFAFKDGFVVYRDS I
PHAACHKLEKLTNTGLYNLLIRCLRCQKAEKLRHLNEKRRFHNIAGH
SEO ID NO: 43 is the nucleic acid sequence encoding an antigen construct of the lentiviral vector filed at the CNCM under accession number 1-5760 ATGTTCCAGGACCCCCAGGAGAGGCCCCGGAAGTTGCCCCAGCTGTGCACCGAG
CTGCAGACCACCATCCACGACATCATCCTCGAATGCGTGTACTGCAAGCAGCAGC
TGCTGAGGAGGGAGGTGTATGACTTTGCCTTCAGAGACGGATGCATTGTCTACAG
GAACCCCTACGCC GTGTGCGACAAATGCCTGAAGTTCTACTCCAAGATCAGC GAG
TACAGGCACTACTGCTACTCCCTGTAC GGCACCACCCTC GAACAGCAGTACAACA
AACCCCTGTGCGACCTCCTGATTAGGTGCATCAACTGCCAGAAGCCCCTCAGGTT
CCACAACATCCGC GGCCGC TGGAC C GGCCGATGCATGTCTTGCTGCAGGGGC CC C
GACGACCCCTACAAGCTCCCCGACCTGTGCACCGAACTCAACACCTCCCTGCAGG
ACATCGAGATCACCTGCGTGTATTGCAAGACCGTGCTGGAGCTGACCGAGGTTTT
CGAATTTGCCTTTAAGGACGGCTTCGTCGTGTATAGGGACTCCATCCCCCACGCC
GCCTGCC ATAAGCTGGAGAAGCTC ACC AAC ACC GGACTGTATAATCT GCTGATC A
GGTGCCTCAGGTGCCAGAAGGCAGAAAAGCTGAGGCATCTCAAC GAGAAGCGCC
GGTTCCACAATATTGCCGGCCCCGGAGACACCCCCACACTCCATGAGTACATGCT
CGACCTGCAGCCCGAAACCACCGACCCCGACAGAGCCCACTACAACATCGTGAC
CTTCTGCTGCAAGTGCGACTCCACCCTGAGAAGATGCGTGCAGTCCACCCACGTG
GACATCC GCACACTCGAAGACCTGCTGAT GGGAACC CTGGGCATC GTGTGCCCC A
TCGGCCCCGATGACAAGGCCACCTTGCAGGACATCGTGCTGCACCTGGAACCACA
GAACGAGATCCCCGTCGACTCCGAAGAAGAAAACGACGAAATCGACGGAGTGAA
TCACCAGCACCTGCCCGCCAGAAGGGCCGAGCCTCAGAGACACACCATGCTCTGC
ATGTGCTGCAAATGCGAAGCCAGGATTAAGCTGGTGGTGGAGAGCAGCGCCGAC
GACCTGAGGGCCTTCCAGCAGCTCTTCCTGAACACACTGTCCTTCGTGTGCCCCTG
GGCCTGATAA
SEO ID NO: 44 is the amino acid sequence of the antigen construct encoded by the lentiviral vector filed at the CNCM under accession number 1-5760 MFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDGCIVYRNPY
AVCDKCLKFYS KIS EYRHYC YSLYGTTLEQ QYNKPLCDLLIRC INC QKPLRFHNIRGR
WTGRCMS CC RGPDDPYKLPDLC TELNT S LQDIEITCVYCKTVLELTEVFEFAFKDGFV
VYRDSIPHAACHKLEKLTNTGLYNLLIRCLRCQKAEKLRHLNEKRRFHNIAGPGDTPT
LHEYMLDLQPETTDPDRAHYNIVTFCCKCDSTLRRCVQS THVDIRTLEDLLMGTLGIV
CPIGPDDKATLQDIVLHLEPQNEIPVDSEEENDEIDGVNHQHLPARRAEPQRHTMLCM
CCKCEARIKLVVES SADDLRAFQQLFLNTLSFVCPWA
SEO ID NO: 45 is the nucleic acid sequence encoding an antigen construct of the lentiviral vector filed at the CNCM under accession number 1-5761 ATGAGGC GGCCCTACAAGCTGCCC GACCTGTGCACC GAGCTGAACACCTCCCTGC
AGGACATCGAGATCACCTGCGTGTACTGCAAGACCGTGCTGGAGCTGACCGAGG
TGTTCGAATTC GCATTCAAGGAC GGATTC GTCGTGTATAGGGACAGCATTCCACA
CGCCGCCTGCCACAAGCTGGAGAAATTGACTAACACC GGACTGTATAATCTGCTG
ATCCGGTGCCTGAGGTGTCAGAAGGCCGAGAAGCTGAGGCATCTGAACGAGAAA
AGGAGATTCCACAATATC GCCGGACACTTCCAGGACCCCCAGGAGAGGCCCAGG
AAACTGCCCCAGTTGTGCACCGAGCTCCAGACAACCATCCAC GACATCATCCTGG
AGTGCGTGTACTGTAAGCAGCAGTTGCTGAGGAGAGAGGTGTATGACTTCGCCTT
CAGAGAC GGATGC ATTGTC TATAGGAACCC CT ACGC CGTGTGC G ACAAGTGCCT G
AAGTTCTACTCCAAGATCAGTGAGTACAGGCATTACTGCTACAGCCTGTATGGAA
CCACAC TGGAAC AGCAGTACAACAAGCCCCTGTGC GACCTCCTGATTAGGTGC AT
CAACTGCCAGAAGCCCCTCAGGTTCCACAACATCC GGGGCAGGTGGACCGGAAG
GTGCATGTCCTGCTGCAGGTCCGCCGGCCCCGGACCTAAAGCCACCCTCCAGGAC
ATCGTGCTGCACCTGGAGCCCCAGAACGAGATCCCCGTCGACTCAGAGGAGGAG
AACGAC GAAATTGACGGCGTCAACCACCAGCACCTGCCCGCTCGCAGAGCCGAA
CCCCAGAGACACACCATGCTCTGCATGTGCTGCAAATGCGAGGCCCGGATTAAGC
TGGTGGTGGAGAGCTCCGCCGACGATCTGAGAGCCTTCCAGCAGCTCTTCCTGAA
CACCCT GTCCTTC GTGTGCCC CTGGGCC GGTC CC GGTGACACAC CTACC CTGCAC
GAGTAC ATGCTC GATCTGC AGCC C GAGAC CACCGAC CCCGATCGCGC ACACTAC A
ACATCGT GACC TTCTGC TGCAAATGTGAC AGCAC CCTGAGAC GGTGC GTCCAGTC
CACCCAC GTTGACATCC GCACCCTCGAAGACCTGCTC ATGGGAACCCTGGGCATC
GTGTGCCCCATCGCCTGATAA
SEO ID NO: 46 is the amino acid sequence of the antigen construct encoded by the lentiviral vector filed at the CNCM under accession number 1-5761 MRRPYKLPDLC TELNTS LQDIEITCVYC KTVLELTEVFEFAFKD GFVVYRD S IPHAAC
HKLEKLTNTGLYNLLIRCLRCQKAEKLRHLNEKRRFHNIAGHFQDPQERPRKLPQLC
.. TELQTTIHDIILEC VYC KQQLLRREVYDFAFRDGC IVYRNPYAVCD KCLKFYS KIS EYR
HYCYS LYGTTLEQQYNKPLCDLLIRC INCQ KPLRFHNIRGRWT GRCMS CC RS AGPGP
KATLQDIVLHLEPQNEIPVDS EEENDEID GVNHQHLPARRAEPQRHTMLCMCC KCEA
RIKLVVES SADDLRAFQQLFLNTLSFVCPWAGPGDTPTLHEYMLDLQPETTDPDRAH
YNIVTFCCKCDSTLRRCVQSTHVDIRTLEDLLMGTLGIVCPIA
SEO ID NO: 47 is the nucleic acid sequence encoding an antigen construct of the lentiyiral 5 vector filed at the CNCM under accession number 1-5762 ATGGGCCCTAAGGCCACCCTGCAGGACATCGTGCTGCACTTGGAGCCCCAGAACG
AGATCCCCGTGGACAGCGAGGAGGAGAACGACGAAATCGACGGCGTGAACCACC
AGCACCTGCCCGCAAGAAGGGCCGAACCCCAGAGGCACACCATGCTCTGCATGT
GCTGCAAATGCGAGGCCAGGATCAAGCTGGTGGTGGAAAGCAGCGCCGACGATC
ACCCGGCAGGACCATCCCCTATAAACTGCCCGACCTCTGCACCGAGCTGAACACC
TCCCTGCAGGACATTGAGATCACCTGCGTCTACTGCAAAACCGTCCTGGAACTGA
CCGAGGTGTTCGAGTTCGCCTTCAAAGACGGCTTCGTCGTGTACAGGGACAGCAT
CCCCCACGCCGCCTGCCATAAGCTGGAGAAACTGACCAACACCGGCCTGTACAAC
GAGAAAAGGAGATTCCACAATATTGCCGGGCCCGGCGACACCCCAACCCTGCAC
GAATAC ATGCTC GACCTGCAGCC C GAAACC ACC GACC CCGACAGAGCCC ACTAC
AACATCGTGACCTTCTGCTGCAAGTGCGACTCCACCCTGAGAAGATGCGTGCAGT
CCACCCAC GTGGACATCC GCACACTC GAAGACCTGC TGATGGGAACCC TGGGC AT
CTGCCCCAGCTCTGCACCGAACTGCAGACCACCATCCACGACATCATCCTGGAAT
GCGTCTACTGTAAGCAGCAGTTGCTGAGGAGGGAGGTGTATGATTTCGCCTTCAG
AGACGGCTGC ATCGTCTACAGGAACCCCTACGCCGTGTGCGACAAATGCCTGAAG
TTCTACTCCAAGATCTCCGAATACAGACACTATTGCTACAGCCTGTACGGCACCA
CTGCCAGAAGCCCCTCCGGTTCCACAACATCCGAGGAAGATGGACCGGCCGGTG
CATGTCCTGCTGCAGGTCCTGATAA
SW) ID NO: 48 is the amino acid sequence of the antigen construct encoded by the lentiviral 30 vector filed at the CNCM under accession number 1-5762 MGPKATLQDIVLHLEPQNEIPVDSEEENDEIDGVNHQHLPARRAEPQRHTMLCMCCK
CEARIKLVVESSADDLRAFQQLFLNTLSFVCPGEPGRTIPYKLPDLCTELNTSLQDIEIT
CVYCKTVLELTEVFEFAFKDGFVVYRDSIPHAACHKLEKLTNTGLYNLLIRCLRCQK
AEKLRHLNEKRRFHNIAGPGDTPTLHEYMLDLQPETTDPDRAHYNIVTFCCKCDSTL
RRCVQSTHVDIRTLEDLLMGTLGIVCPIASQAFQDPQERPRKLPQLCTELQTTIHDIILE
CVYCKQQLLRREVYDFAFRDGCIVYRNPYAVCDKCLKFYS KIS EYRHYCYSLYGTTL
EQQYNKPLCDLL IRCINCQKPLRF HNIRGRWTGRC MSCCRS
TRAITE DE BUDAPEST SUR LA RECONNAISSANCE
INTERNATIONALE DU DEPOT DES MICRO-ORGANISMES
AUX FINS DE LA PROCEDURE EN MATIERE DE BREVETS
FORMULE INTERNATIONALE
DESTINATAIRE
RECEPISSE EN CAS DE DEPOT INITIAL
INSTITUT PASTEUR d6livr6 en vertu de la r6gle 7.1 par 25-28, RUE DU DOCTEUR ROUX l'AUTORITE DE DEPOT INTERNATIONALE
75724 PARIS CEDEX 15 identifite au bas de cette page NOM ET ADRESSE
DU DEPOSANT
I. IDENTIFICATION DU MICRO-ORGANISME
Reference d'identification dorm& par le NumCro d'ordre attribue par DEPOSANT : l'AUTORITE DE DEPOT INTERNATIONALE:
pFlap-beta2m-HPV7-WPREm CNCM 1-5759 H. DESCRIPTION SCIENTIFIQUE ET/OU DESIGNATION TAXONOMIQUE PROPOSEE
Le micro-organisme identifie sous chiffre I &tit accompagne :
Eld'une description scientifique d'une designation taxonomiquc proposes (Cocher cc qui convient).
RECEPTION ET ACCEPTATION
La presente autorite de depot Internationale acccptc lc micro-organismc identifie sous chiffre I, qu'clIc a re&
lc 21 OCTOBRE 2021 (date du depot initial) IV. RECEPTION D'UNE REQUETE EN CONVERSION
La presente autorite de depot Internationale a Teo lc micro-organismc identifie sous chiffre I lc (date du depot initial)' at a Teen une Torquato en conversion du depot initial en depot conforme au Traite de Budapest to (date de reception de la requete en conversion).
V. AUTORITE DE DEPOT INTERNATIONALE
Nom : COLLECTION NATIONALE Signature(s) de Is (des) personnc(s) competente(s)ponr_.
DE CULTURES DE MICROORGANISMES reprosenter l'autorite de depot Internationale ou, '(de (CNCM) employe(s = = RAQUEL HURT. 0-'o Adresse :
INSTITUT PASTEUR
col 11(1N \
.,OZALP
75724 PARIS CEDEX 15 DatcLE 0)CEMBRE 202 rst$
*
risCrufie, t,E4usias 4,*
En cas &application de la regle 6.4.d), cote date est la date a laquelle lc statut d'autorite de depot interne*, Wetequ' . µ411, Fonnule BP/4 (page unique) TRAITE DE BUDAPEST SUR LA RECONNAISSANCE
INTERNATIONALE DU DEPOT DES MICRO-ORGANISMES
AUX FINS DE LA PROCEDURE EN MATIERE DE BREVETS
FORMULE INTERNATIONALE
DESTINATAIRE
RECEPISSE EN CAS DE DEPOT INITIAL
INSTITUT PASTEUR delivre en vertu de la regle 7.1 par 25-28, RUE DU DOCTEUR ROUX l'AUTORITE DE DEPOT INTERNATIONALE
75724 PARIS CEDEX 15 identifiee au bas de cette page L_ NOM ET ADRESSE
DU DEPOSANT
I. IDENTIFICATION DU MICRO-ORGANISME
Reference d'identification donnee par le Numero d'ordrc attribue par DEPOSANT : l'AUTORITE DE DEPOT INTERNATIONALE:
pFlap-beta2m-HPV8-WPREm CNCM 1-5760 IL DESCRIPTION SCIENTIFIQUE ET/OU DESIGNATION TAXONOMIQUE PROPOSER
Lc micro-organismc identifie sous chiffre I etait accompagne d'une description scientifique d'une designation taxonomique propos&
(Cochcr cc qui convient).
III. RECEPTION ET ACCEPTATION
La presente autorite de depth internationale acceptc le micro-organismc identifie sous chime I, qu'elle a revs lc 21 OCTOBRE 2021 (date du depot initial)'.
IV. RECEPTION D'UNE REQUETE EN CONVERSION
La presente autorite de depot internationale a men lc micro-organisme identifie sous chiffre lie (date du depot initial) eta reeu une requete en conversion du depot initial en depot conforme au Traite de Budapest lc (date de reception de la requete en conversion).
V. AUTORITE DE DEPOT INTERNATIONALE
Nom: COLLECTION NATIONALE Signature(s) de la (des) personne(s) competente(s)pour. õ
DE CULTURES DE NICROORGANISMES representer l'autorite de depot intemationale ou dsP i4r) (CmCm) employe(s) autorise(s : RAQUEL
HURTADOLO
Adresse :
INSTITUT PASTEUR ECU N
\
25 RUE DU DOCTEUR ROUX r 75724 PARIS CEDEX 15 Date: PAµ 20LE 9 D __ 1 ____________________________________________________________________ rtn DE Ja I En cas d'application de la regle 6.4.d), cote date est la date a laquellc lc statut d'autorite de depot intemationte /NWT"
.
______________________________________________________________________________ 4N. =
Fonnule BP/4 (page unique) it RI V.
TRAITE DE BUDAPEST SUR LA RECONNAISSANCE
INTERNATIONALE DU DEPOT DES MICRO-ORGANISMES
AUX FINS DE LA PROCEDURE EN MATIERE DE BREVETS
FORM ULE INTERNATIONALE
INSTITUT PASTEUR delivre en vertu de la regle 7.1 par 25-28, RUE DU DOCTEUR ROUX l'AUTORITE DE DEPOT INTERNATIONALE
75724 PARIS CEDEX 15 identifiee au bas de cette page NOM ET ADRESSE
DU DEPOSANT
I, IDENTIFICATION DU MICRO-ORGANISME
Reference d'identification donnee par le Numero d'ordre attribue par DEPOSANT : l'AUTORITE DE DEPOT INTERNATIONALE:
pRap-beta2m-HPV9-WPREm CNCM 1-5761 II. DESCRIPTION SCIENTIFIQUE ET/OU DESIGNATION TAXONOMIQUE PROPOSEE
Le micro-organisme identifie sous chiffic 1 etait accompagne :
d'unc description scientifique d'unc designation taxonomique propos&
(Cocher cc qui convient).
III. RECEPTION ET ACCEPTATION
La presente autorite de depot Internationale acccptc lc micro-organisme identifie sous chiffrc I, qu'elle a rect.' le 21 OCTOBRE 2021 (date du depot initial)'.
IV. RECEPTION D'UNE REQUETE EN CONVERSION
La present autorite de depot international a rccu lc micro-organismc identifie sous chiffre lie (date du depot initial) ' eta recu une requete en conversion du depot initial en depot confonne au Traite de Budapest lc (date de reception de la requete on conversion).
V. AUTORITE DE DEPOT INTERNATIONALE
Nom: COLLECTION NATIONALE Signature(s) dc la (dcs)personnc(s) compotcnte(s)pour DE CULTURES DE MICROORGANISMES repthsenter l'autorite de depot intemationale ou de l' s) r (CNCM) employe(s) au ' = RAQUEL HURTADQ-0 = 4.0 Adresse : IljVC11 INSTITUT PASTEUR
= ,R.taiONA
75724 PARIS CEDEX 15 Date : PARIS, LE 09 EMBRE 2024 ".
oa CUL Wel S
=0 IlleritISISth En cas d'application dc la regle 6.4.d), cello date cst la date a laquelle le statut d'autorite de depot intemationnle t acquis Formulc BP/4 (page unique) ttNt Vv./
TRAITE DE BUDAPEST SUR LA RECONNAISSANCE
INTERNATIONALE DU DEPOT DES MICRO-ORGANISMES
AUX FINS DE LA PROCEDURE EN MATIERE DE BREVETS
FORMULE INTERNATIONALE
DESTINATAIRE
RECEPISSE. EN CAS DE DEPOT INITIAL
INSTITUT PASTEUR davit en vertu de la regle 7.1 par 25-28, RUE DU DOCTEUR ROUX l'AUTORITE DE DEPOT INTERNATIONALE
75724 PARIS CEDEX 15 identifiee au bas de cette page NOM ET ADRESSE
DU DEPOSANT
I. IDENTIFICATION DU MICRO-ORGANISME
Reference d'identification donnee par le Numero d'ordre attribue par DEPOSANT : l'AUTORITE DE DEPOT INTERNATIONALE:
pFlap-beta2m-HPV10-WPREm CNCM I-5762 II. DESCRIPTION SCIENTIFIQUE ET/OU DESIGNATION TAXONOMIQUE PROPOSEE
Le micro-organisme identifie sous chiffre I etait accompagne :
d'une description scientifique d'une designation taxonomique propos&
(Cocher co qui convient).
HI. RECEPTION ET ACCEPTATION
La presente autorite de depot intemationale accepte le micro-organismc identifie sous chiffre I, qu'elle a recu k 21 OCTOBRE 2021 (date du depot initial)'.
IV. RECEPTION D'UNE REQUETE EN CONVERSION
La presente autorite de &pet intemationak a recu le micro-organisme identifie sous chiffre I le (date du depot initial)Ict a recu une rcquete en conversion du depot initial en depot conformc au Tmite de Budapest le (date de reception de Is requete en conversion).
V. AUTORITE DE DEPOT INTERNATIONALE
Nom: COLLECTION NATIONALE Signature(s) de la (des) personne(s) competcntc(s)pour DE CULTURES DE MICROORGANISMES representer l'autorite de depot intcrnationale ou de I(des) (CNCM) employe(s QUEL HURTADO,R
Adresse : INSTITUT RIS PASTEUR 15 75724 PA CEDEX Date : PARIS, LE 09 Di MBRE 2 tONA1 _______________________________________________________________________ 05 GUL1Uftlr.) En cas d'application de la regle 6.4.d), cone data eat la date a laquelle le statut d'autorite de depot interriatio lea ete Akins.
uo) Illtt060111411.1 414 Permute BP/4 (page unique) . __ N A
gat vmb
Claims (25)
1. A lentiviral vector, in particular a non-integrative lentiviral vector, comprising at least four distinct nucleic acid sequences selected from the group consisting of:
- at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen, - at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen, - at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen, and - at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen.
- at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen, - at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen, - at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen, and - at least one nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen.
2. The lentiviral vector according to claim 1, wherein the nucleic acid sequence encoding the non-oncogenic Human papillomavirus (HPV16) protein E6 antigen encodes an amino acid sequence having at least 80% sequence identity with the amino acid sequence set forth as SEQ ID NO: 7, the nucleic acid sequence being in particular selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5 and SEQ
ID NO:
6.
ID NO:
6.
3. The lentiviral vector according to claim 1 or 2, wherein the nucleic acid sequence encoding the non-oncogenic Human papillomavirus (HPV16) protein E7 antigen encodes an amino acid sequence having at least 68% sequence identity with the amino acid sequence set forth as SEQ ID NO: 16, the nucleic acid sequence being in particular selected from the group consisting of SEQ ID NO: 14 and SEQ ID NO: 15.
4. The lentiviral vector according to any one of claims 1 to 3, wherein the nucleic acid sequence encoding the non-oncogenic Human papillomavirus (HPV18) protein E6 antigen encodes an amino acid sequence having at least 60% sequence identity with the amino acid sequence set forth as SEQ ID NO: 24, the nucleic acid sequence being in particular selected from the group consisting of SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22 and SEQ ID
NO: 23 .
NO: 23 .
5. The lentiviral vector according to any one of claims 1 to 4, wherein the nucleic acid sequence encoding the non-oncogenic Human papillomavirus (HPV18) protein E7 antigen encodes an amino acid sequence having at least 83% sequence identity with the amino acid sequence set forth as SEQ ID NO: 33, the nucleic acid sequence being in particular selected from the group consisting of SEQ ID NO: 30, SEQ ID NO: 31 and SEQ ID NO: 32.
6. The lentiviral vector according to any one of claims 1 to 5, wherein the at least four distinct nucleic acid sequences encoding antigens are fused together, forming a single antigenic nucleic acid sequence encoding a single antigenic fusion protein under the control of a single promoter sequence.
7. The lentiviral vector according to any one of claims 1 to 6, wherein the order of the at least four distinct nucleic acid sequences, from 5' end to 3' end, is selected from the group consisting of:
(a) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen;
(b) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen;
(c) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen; and (d) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen - nucleic acid sequence encoding a non-oncogcnic Human papillomavirus (HPV18) protein E6 antigen - nucleic acid sequence encoding a non-oncogcnic Human papillomavirus (HPV16) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen.
(a) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen;
(b) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen;
(c) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen; and (d) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen - nucleic acid sequence encoding a non-oncogcnic Human papillomavirus (HPV18) protein E6 antigen - nucleic acid sequence encoding a non-oncogcnic Human papillomavirus (HPV16) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen.
8. The lentiviral vector according to any one of claims 1 to 7, wherein the order of the at least four distinct nucleic acid sequences, from 5' end to 3' end, is (a) nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E7 antigen -nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV16) protein E6 antigen -nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E7 antigen - nucleic acid sequence encoding a non-oncogenic Human papillomavirus (HPV18) protein E6 antigen.
9. The lentiviral vector according to any one of claims 1 to 8, comprising a nucleic acid sequence which encodes an amino acid sequence having at least 90% sequence identity with the amino acid sequence set forth as SEQ ID NO: 42, the nucleic acid sequence being in particular the nucleic acid sequence SEQ ID NO: 41.
10. The lentiviral vector according to any one of claims 1 to 9. being selected from the group consisting of the non-integrative lentiviral vectors filed at the CNCM
under accession numbers 1-5759, 1-5760, 1-5761 and 1-5762, and is in particular the non-integrative lentiviral vector filed at the CNCM under accession number 1-5759.
under accession numbers 1-5759, 1-5760, 1-5761 and 1-5762, and is in particular the non-integrative lentiviral vector filed at the CNCM under accession number 1-5759.
11. The lentiviral vector according to any one of claims 1 to 10, wherein the lentiviral vector comprises a MHC Class I promoter, and in particular a 02-microg1obu1in promoter.
12. The lentiviral vector according to any one of claims 1 to 11, wherein the lentiviral vector comprises a cPPT/CTS sequence, in particular the cPPT/CTS sequence set forth as sequence SEQ ID NO: 37.
13. The lentiviral vector according to any one of claims 1 to 12, wherein the lentiviral vector comprises a 3' long terminal repeat (LTR) which is devoid of its U3 promoter sequence.
14. The lentiviral vector according to any one of claims 1 to 13, wherein the lentiviral vector does not comprise a constitutive enhancer sequence.
15. The non-integrative lentiviral vector according to any one of claims 1 to 14, wherein the lentiviral vector comprises a mutant form of the woodchuck hepatitis B
virus (WHV) post-transcriptional regulatory element (WPRE), and in particular having the sequence set forth as sequence SEQ ID NO: 38.
virus (WHV) post-transcriptional regulatory element (WPRE), and in particular having the sequence set forth as sequence SEQ ID NO: 38.
16. A lentiviral vector particle, in particular a non-integrative lentiviral vector particle, comprising at least one lentiviral vector as defined in any one of claims 1 to 15.
17. The lentiviral vector particle according to claim 16, wherein the lentiviral vector particle comprises a functional lentiviral integrase protein.
18. The lentiviral vector particle according to claim 16 or 17, wherein the lentiviral vector particle comprises a vesicular stomatitis virus glycoprotein (VSVG), in particular a VS V-G Indiana serotype or a VS V-G New Jersey serotype.
19. The lentiviral vector particle according to any one of claims 16 to 18, wherein the lentiviral vector particle comprises HIV-1 subtype D Gag and Pol proteins.
20. An isolated cell comprising the lentiviral vector according to any one of claims 1 to or the lentiviral vector particle according to any of claims 16 to 19.
21. A vaccine composition comprising a lentiviral vector according to any one of claims 1 to 15, a lentiviral vector particle according to any one of claims 16 to 19, or a cell according to claim 20.
22. The vaccine composition according to claim 21, for use in the treatment or prevention of an HPV induced cancer, in particular selected from the group consisting of cervical cancer, vaginal cancer, vulvar cancer, penile cancer, anal cancer, oropharyngeal cancer, and metastases thereof, in particular pulmonary metastasis thereof.
23. A lentiviral vector according to any one of claims 1 to 15, a lentiviral vector particle according to any one of claims 16 to 19, or a cell according to claim 20, for use as a medicament or vaccine.
24. The lentiviral vector, lentiviral vector particle or cell, according to claim 23, for use in the treatment or prevention of an HPV induced cancer, in particular selected from the group consisting of cervical cancer, vaginal cancer, vulvar cancer, penile cancer, anal cancer, oropharyngeal cancer, and metastases thereof, in particular pulmonary metastasis thereof.
25. The vaccine composition for use according to claim 22, or the lentiviral vector, lentiviral vector particle or cell for use according to claim 23 or 24, wherein said vaccine composition, lentiviral vector, lentiviral vector particle or cell is administered in combination with at least one immune checkpoint inhibitor, in particular at least one monoclonal antibody selected from the group consisting of anti-PD-1, anti-PD-Ll, anti-CTLA-4, anti-NKG2A, anti-TIM-3, anti-TIGIT and anti-LAG-3 monoclonal antibodies and more particularly with at least one anti-PD-1 monoclonal antibody.
5 26. The vaccine composition, lentiviral vector, lentiviral vector particle or cell for use according to claim 25, wherein the at least one immune checkpoint inhibitor is administered simultaneously or separately, and in particular the at least one immune checkpoint inhibitor is administered at least 2, and in particular at least 4 days after the administration of the said vaccine composition, lentiviral vector, lentiviral vector particle or cell.
5 26. The vaccine composition, lentiviral vector, lentiviral vector particle or cell for use according to claim 25, wherein the at least one immune checkpoint inhibitor is administered simultaneously or separately, and in particular the at least one immune checkpoint inhibitor is administered at least 2, and in particular at least 4 days after the administration of the said vaccine composition, lentiviral vector, lentiviral vector particle or cell.
Applications Claiming Priority (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP21306581.6 | 2021-11-15 | ||
| EP21306581 | 2021-11-15 | ||
| US202163279945P | 2021-11-16 | 2021-11-16 | |
| US63/279,945 | 2021-11-16 | ||
| EP22306119 | 2022-07-27 | ||
| EP22306119.3 | 2022-07-27 | ||
| PCT/EP2022/081839 WO2023084094A1 (en) | 2021-11-15 | 2022-11-14 | Lentiviral vectors for expression of human papillomavirus (hpv) antigens and its implementation in the treatment of hpv induced cancers |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CA3238020A1 true CA3238020A1 (en) | 2023-05-19 |
Family
ID=84536137
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CA3238020A Pending CA3238020A1 (en) | 2021-11-15 | 2022-11-14 | Lentiviral vectors for expression of human papillomavirus (hpv) antigens and its implementation in the treatment of hpv induced cancers |
Country Status (5)
| Country | Link |
|---|---|
| EP (1) | EP4433081A1 (en) |
| KR (1) | KR20240124919A (en) |
| AU (1) | AU2022386715A1 (en) |
| CA (1) | CA3238020A1 (en) |
| WO (1) | WO2023084094A1 (en) |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN116286982B (en) * | 2022-09-09 | 2024-01-30 | 广州凯普医药科技有限公司 | HPV genotyping detection positive reference, preparation method and application thereof |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| ATE449858T1 (en) | 1999-10-11 | 2009-12-15 | Pasteur Institut | LENTIVIRAL VECTORS FOR THE PRODUCTION OF IMMUNOTHERAPEUTIC COMPOSITIONS |
| PT2185192T (en) * | 2007-08-03 | 2019-02-12 | Pasteur Institut | Lentiviral gene transfer vectors and their medicinal applications |
| CA2956385A1 (en) | 2014-07-25 | 2016-01-28 | Theravectys | Lentiviral vectors for regulated expression of a chimeric antigen receptor molecule |
-
2022
- 2022-11-14 AU AU2022386715A patent/AU2022386715A1/en active Pending
- 2022-11-14 CA CA3238020A patent/CA3238020A1/en active Pending
- 2022-11-14 KR KR1020247019939A patent/KR20240124919A/en unknown
- 2022-11-14 EP EP22823328.4A patent/EP4433081A1/en active Pending
- 2022-11-14 WO PCT/EP2022/081839 patent/WO2023084094A1/en active Application Filing
Also Published As
| Publication number | Publication date |
|---|---|
| EP4433081A1 (en) | 2024-09-25 |
| AU2022386715A1 (en) | 2024-05-16 |
| KR20240124919A (en) | 2024-08-19 |
| WO2023084094A1 (en) | 2023-05-19 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP6688535B2 (en) | Vaccine composition | |
| CN107921117B (en) | HPV vaccine | |
| CN107921110B (en) | Therapeutic HPV18 vaccine | |
| JP6655051B2 (en) | Polynucleotides for treating carcinogenic virus polypeptide-positive tumors | |
| JP5178196B2 (en) | Recombinant MVA virus expressing the clade A / G, clade B, and clade C modified HIVenv, gag, and pol genes | |
| WO2012053646A1 (en) | Virus vector for prime/boost vaccines, which comprises vaccinia virus vector and sendai virus vector | |
| Wyatt et al. | Enhanced cell surface expression, immunogenicity and genetic stability resulting from a spontaneous truncation of HIV Env expressed by a recombinant MVA | |
| Ku et al. | Lentiviral vector induces high-quality memory T cells via dendritic cells transduction | |
| CA2675257A1 (en) | Hiv combination vaccine and prime boost method | |
| CA3238020A1 (en) | Lentiviral vectors for expression of human papillomavirus (hpv) antigens and its implementation in the treatment of hpv induced cancers | |
| JP2023548786A (en) | Lentiviral vectors capable of delivering antigens to the MHC-II pathway and inducing CD4+ and CD8+ T cell responses in the host | |
| US10052377B2 (en) | Cellular vaccine and method of inducing an immune response in a subject | |
| WO2024023135A1 (en) | Lentiviral vectors for expression of human papillomavirus (hpv) antigens and its implementation in the treatment of hpv induced cancers | |
| CN109923212B (en) | Lentiviral vector for expression of Hepatitis B Virus (HBV) antigen | |
| CN118354790A (en) | Lentiviral vectors for expression of Human Papilloma Virus (HPV) antigens and their use in the treatment of HPV-induced cancers | |
| KR20150021088A (en) | Vaccination with interleukin-4 antagonists | |
| WO2023034828A1 (en) | Novel epstein barr virus immunotherapies | |
| JP2024509976A (en) | A lentiviral vector that targets antigens to the MHC-II pathway and induces protective immunity by CD8+ and CD4+ T cells in the host. | |
| de Mare et al. | Viral vector-based immunization regimens: evidence for a central role of T cell competition | |
| de Mare | Immunotherapy based on influenza virosomes and recombinant Semliki Forest virus: novel strategies for the treatment of cervical cancer |