US20170121374A1 - Computationally optimized broadly reactive antigens for h1n1 influenza - Google Patents
Computationally optimized broadly reactive antigens for h1n1 influenza Download PDFInfo
- Publication number
- US20170121374A1 US20170121374A1 US15/407,502 US201715407502A US2017121374A1 US 20170121374 A1 US20170121374 A1 US 20170121374A1 US 201715407502 A US201715407502 A US 201715407502A US 2017121374 A1 US2017121374 A1 US 2017121374A1
- Authority
- US
- United States
- Prior art keywords
- seq
- influenza
- amino acid
- residues
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
- A61K39/145—Orthomyxoviridae, e.g. influenza virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/16—Antivirals for RNA viruses for influenza or rhinoviruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/525—Virus
- A61K2039/5258—Virus-like particles
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55505—Inorganic adjuvants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/16011—Orthomyxoviridae
- C12N2760/16111—Influenzavirus A, i.e. influenza A virus
- C12N2760/16122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/16011—Orthomyxoviridae
- C12N2760/16111—Influenzavirus A, i.e. influenza A virus
- C12N2760/16123—Virus like particles [VLP]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/16011—Orthomyxoviridae
- C12N2760/16111—Influenzavirus A, i.e. influenza A virus
- C12N2760/16134—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Definitions
- This disclosure concerns optimized influenza hemagglutinin proteins that elicit broadly reactive immune responses to H1N1 virus isolates and their use as vaccines.
- Influenza virus is a member of Orthomyxoviridae family. There are three subtypes of influenza viruses, designated influenza A, influenza B, and influenza C.
- the influenza virion contains a segmented negative-sense RNA genome, which encodes the following proteins: hemagglutinin (HA), neuraminidase (NA), matrix (M1), proton ion-channel protein (M2), nucleoprotein (NP), polymerase basic protein 1 (PB 1), polymerase basic protein 2 (PB2), polymerase acidic protein (PA), and nonstructural protein 2 (NS2).
- HA, NA, M1, and M2 are membrane associated, whereas NP, PB 1, PB2, PA, and NS2 are nucleocapsid associated proteins.
- the M1 protein is the most abundant protein in influenza particles.
- the HA and NA proteins are envelope glycoproteins, responsible for virus attachment and penetration of the viral particles into the cell, and the sources of the major immunodominant epitopes for virus neutralization and protective immunity. Both HA and NA proteins are considered the most important components for prophylactic influenza vaccines.
- influenza vaccine approaches There are currently two influenza vaccine approaches licensed in the United States—the inactivated, split vaccine and the live-attenuated virus vaccine.
- the inactivated vaccines can efficiently induce humoral immune responses but generally only poor cellular immune responses.
- Live virus vaccines cannot be administered to immunocompromised or pregnant patients due to their increased risk of infection. Thus, a need exists for a broadly protective influenza virus vaccine.
- H1N1 influenza HA polypeptides for eliciting a broadly reactive immune response to H1N1 influenza virus isolates.
- the optimized HA polypeptides were developed through a series of HA protein alignments, and subsequent generation of consensus sequences, based on selected H1N1 viruses isolated from 1918-2011.
- the HA polypeptide comprises an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10 or SEQ ID NO: 11.
- the amino acid sequence of the polypeptide comprises no more than 5, no more than 6, no more than 7, no more than 8, no more than 9 or no more than 10 amino acid substitutions relative to SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10 or SEQ ID NO: 11.
- the influenza HA polypeptide lacks the N-terminal methionine residue.
- Isolated nucleic acid molecules and vectors encoding the recombinant HA polypeptides are also provided by the present disclosure. Further provided are isolated cells comprising such vectors.
- influenza virus-like particles VLPs
- fusion proteins comprising the optimized HA polypeptides disclosed herein.
- compositions that include the optimized influenza HA polypeptides, fusion proteins or VLPs disclosed herein in a pharmaceutically acceptable carrier.
- Methods of eliciting an immune response against influenza virus in a subject by administering the disclosed compositions, fusion proteins or VLPs is also provided by the present disclosure.
- FIG. 1 is a schematic of the process used to generate an H1N1 HA consensus sequence according to Method 1.
- FIG. 2 is a schematic of the process used to generate an H1N1 HA consensus sequence according to Method 2.
- FIG. 3 is a schematic of the process used to generate an H1N1 HA consensus sequence according to Method 4.
- FIG. 4 is a schematic of the process used to generate an H1N1 HA consensus sequence according to Method 5.
- FIG. 5 is a schematic of the process used to generate an H1N1 HA consensus sequence according to Method 6.
- FIG. 6 is a graph showing hemagglutination-inhibition (HAI) serum antibody titers induced by COBRA H1N1 infection of mice.
- HAI serum antibody titers were determined in mice infected with COBRA H1N1 influenza VLPs (COBRA Method 1). Antisera were tested against the seasonal H1N1 influenza virus, A/New Caledonia/20/1999. The results are represented as the log2 transformed geometric mean titer ( ⁇ S.E.M.) from antisera collected at weeks 3, 5, 8 and 12 post-infection.
- ⁇ S.E.M. log2 transformed geometric mean titer
- FIG. 7 is Western blot showing expression of COBRA HA protein (Method 1 consensus sequence).
- COBRA H1N1 HA was translated in vitro and the cell culture lysates were analyzed by SDS-PAGE and Western blot.
- Lane 1 A/New Caledonia/20/1999 virus;
- Lane 2 H1N1 COBRA secreted HA;
- Lane 4 COBRA 10 ⁇ g VLP.
- the COBRA HA (lane 2) migrates at its expected molecular weight confirming expression of the synthetic protein.
- nucleic and amino acid sequences listed in the accompanying sequence listing are shown using standard letter abbreviations for nucleotide bases, and three letter code for amino acids, as defined in 37 C.F.R. 1.822. Only one stand of each nucleic acid sequence is shown, but the complementary strand is understood as included by any reference to the displayed strand.
- sequence Listing is submitted as an ASCII text file, created on Dec. 20, 2016, 67.6 KB, which is incorporated by reference herein. In the accompanying sequence listing:
- SEQ ID NOs: 1-11 are the amino acid sequences of optimized H1N1 HA proteins.
- SEQ ID NO: 12 is a consensus amino acid sequence of the optimized H1N1 HA proteins.
- SEQ ID NO: 13 is the nucleic acid sequence of a codon-optimized H1N1 HA.
- HA hemagglutinin
- HAI hemagglutination inhibition
- VLP virus-like particle
- Adjuvant A substance or vehicle that non-specifically enhances the immune response to an antigen.
- Adjuvants can include a suspension of minerals (alum, aluminum hydroxide, or phosphate) on which antigen is adsorbed; or water-in-oil emulsion in which antigen solution is emulsified in mineral oil (for example, Freund's incomplete adjuvant), sometimes with the inclusion of killed mycobacteria (Freund's complete adjuvant) to further enhance antigenicity.
- Immunostimulatory oligonucleotides (such as those including a CpG motif) can also be used as adjuvants (for example, see U.S. Pat. Nos.
- Adjuvants also include biological molecules, such as costimulatory molecules.
- exemplary biological adjuvants include IL-2, RANTES, GM-CSF, TNF- ⁇ , IFN- ⁇ , G-CSF, LFA-3, CD72, B7-1, B7-2, OX-40L and 41 BBL.
- administering a composition to a subject means to give, apply or bring the composition into contact with the subject.
- Administration can be accomplished by any of a number of routes, such as, for example, topical, oral, subcutaneous, intramuscular, intraperitoneal, intravenous, intrathecal and intradermal.
- Antibody An immunoglobulin molecule produced by B lymphoid cells with a specific amino acid sequence. Antibodies are evoked in humans or other animals by a specific antigen (immunogen). Antibodies are characterized by reacting specifically with the antigen in some demonstrable way, antibody and antigen each being defined in terms of the other. “Eliciting an antibody response” refers to the ability of an antigen or other molecule to induce the production of antibodies.
- Antigen A compound, composition, or substance that can stimulate the production of antibodies or a T-cell response in an animal, including compositions that are injected or absorbed into an animal.
- An antigen reacts with the products of specific humoral or cellular immunity, including those induced by heterologous immunogens.
- the antigen is an influenza HA protein.
- Codon-optimized nucleic acid refers to a nucleic acid sequence that has been altered such that the codons are optimal for expression in a particular system (such as a particular species of group of species).
- a nucleic acid sequence can be optimized for expression in mammalian cells. Codon optimization does not alter the amino acid sequence of the encoded protein.
- Fusion protein A protein generated by expression of a nucleic acid sequence engineered from nucleic acid sequences encoding at least a portion of two different (heterologous) proteins. To create a fusion protein, the nucleic acid sequences must be in the same reading frame and contain to internal stop codons. For example, a fusion protein includes an influenza HA fused to a heterologous protein.
- Hemagglutinin An influenza virus surface glycoprotein. HA mediates binding of the virus particle to a host cells and subsequent entry of the virus into the host cell.
- the nucleotide and amino acid sequences of numerous influenza HA proteins are known in the art and are publically available, such as those deposited with GenBank.
- HA (along with NA) is one of the two major influenza virus antigenic determinants.
- Immune response A response of a cell of the immune system, such as a B-cell, T-cell, macrophage or polymorphonucleocyte, to a stimulus such as an antigen or vaccine.
- An immune response can include any cell of the body involved in a host defense response, including for example, an epithelial cell that secretes an interferon or a cytokine.
- An immune response includes, but is not limited to, an innate immune response or inflammation.
- a protective immune response refers to an immune response that protects a subject from infection (prevents infection or prevents the development of disease associated with infection). Methods of measuring immune responses are well known in the art and include, for example, measuring proliferation and/or activity of lymphocytes (such as B or T cells), secretion of cytokines or chemokines, inflammation, antibody production and the like.
- Immunogen A compound, composition, or substance which is capable, under appropriate conditions, of stimulating an immune response, such as the production of antibodies or a T-cell response in an animal, including compositions that are injected or absorbed into an animal.
- an “immunogenic composition” is a composition comprising an immunogen (such as an HA polypeptide).
- Immunize To render a subject protected from an infectious disease, such as by vaccination.
- Influenza virus A segmented negative-strand RNA virus that belongs to the Orthomyxoviridae family. There are three types of Influenza viruses, A, B and C. Influenza A viruses infect a wide variety of birds and mammals, including humans, horses, marine mammals, pigs, ferrets, and chickens. In animals, most influenza A viruses cause mild localized infections of the respiratory and intestinal tract. However, highly pathogenic influenza A strains, such as H5N1, cause systemic infections in poultry in which mortality may reach 100%. In 2009, H1N1 influenza was the most common cause of human influenza. A new strain of swine-origin H1N1 emerged in 2009 and was declared pandemic by the World Health Organization. This strain was referred to as “swine flu.” H1N1 influenza A viruses were also responsible for the Spanish flu pandemic in 1918, the Fort Dix outbreak in 1976, and the Russian flu epidemic in 1977-1978.
- Isolated An “isolated” biological component (such as a nucleic acid, protein or virus) has been substantially separated or purified away from other biological components (such as cell debris, or other proteins or nucleic acids).
- Biological components that have been “isolated” include those components purified by standard purification methods. The term also embraces recombinant nucleic acids, proteins or viruses (or VLPs), as well as chemically synthesized nucleic acids or peptides.
- Linker One or more amino acids that serve as a spacer between two polypeptides of a fusion protein.
- Matrix (M1) protein An influenza virus structural protein found within the viral envelope. M1 is thought to function in assembly and budding.
- NA Neuraminidase
- An influenza virus membrane glycoprotein An influenza virus membrane glycoprotein. NA is involved in the destruction of the cellular receptor for the viral HA by cleaving terminal sialic acid residues from carbohydrate moieties on the surfaces of infected cells. NA also cleaves sialic acid residues from viral proteins, preventing aggregation of viruses. NA (along with HA) is one of the two major influenza virus antigenic determinants.
- a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence.
- a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence.
- operably linked DNA sequences are contiguous and, where necessary to join two protein-coding regions, in the same reading frame.
- Optimized influenza HA protein refers to the HA protein consensus sequence generated by sequence alignments of selected H1N1 influenza viruses isolated between 1918 and 2011 (as described in Example 1 below). The nucleotide sequences encoding optimized HA proteins were (or can be) further optimized for expression in mammalian cells via codon-optimization and RNA optimization (such as to increase RNA stability). Optimized influenza HA proteins disclosed herein (and set forth herein as SEQ ID NOs: 1-11) are also referred to as “COBRA” sequences. Optimized HA polypeptides are designed to elicit broadly reactive immune responses in a subject.
- “broadly reactive” means the protein sequence elicits an immune response in a subject that is sufficient to inhibit, neutralize or prevent infection of a broad range of influenza viruses (such as most or all influenza viruses within a specific subtype).
- the optimized influenza HA protein is capable of eliciting an immune response, such as a protective immune response, against most or all H1N1 influenza virus isolates.
- an influenza virus “outbreak” refers to a collection of virus isolates from within a single country in a given year.
- parenteral formulations usually comprise injectable fluids that include pharmaceutically and physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like as a vehicle.
- pharmaceutically and physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like as a vehicle.
- physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like
- solid compositions for example, powder, pill, tablet, or capsule forms
- conventional non-toxic solid carriers can include, for example, pharmaceutical grades of mannitol, lactose, starch, or magnesium stearate.
- compositions to be administered can contain minor amounts of non-toxic auxiliary substances, such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like, for example sodium acetate or sorbitan monolaurate.
- non-toxic auxiliary substances such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like, for example sodium acetate or sorbitan monolaurate.
- Polypeptide A polymer in which the monomers are amino acid residues which are joined together through amide bonds. When the amino acids are alpha-amino acids, either the L-optical isomer or the D-optical isomer can be used.
- polypeptide or protein as used herein are intended to encompass any amino acid sequence and include modified sequences such as glycoproteins.
- polypeptide is specifically intended to cover naturally occurring proteins, as well as those which are recombinantly or synthetically produced.
- the term “residue” or “amino acid residue” includes reference to an amino acid that is incorporated into a protein, polypeptide, or peptide.
- Conservative amino acid substitutions are those substitutions that, when made, least interfere with the properties of the original protein, that is, the structure and especially the function of the protein is conserved and not significantly changed by such substitutions. Examples of conservative substitutions are shown below.
- Conservative substitutions generally maintain (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain.
- substitutions which in general are expected to produce the greatest changes in protein properties will be non-conservative, for instance changes in which (a) a hydrophilic residue, for example, seryl or threonyl, is substituted for (or by) a hydrophobic residue, for example, leucyl, isoleucyl, phenylalanyl, valyl or alanyl; (b) a cysteine or proline is substituted for (or by) any other residue; (c) a residue having an electropositive side chain, for example, lysyl, arginyl, or histadyl, is substituted for (or by) an electronegative residue, for example, glutamyl or aspartyl; or (d) a residue having a bulky side chain, for example, phenylalanine, is substituted for (or by) one not having a side chain, for example, glycine.
- a hydrophilic residue for example, seryl or threonyl
- Preventing a disease refers to inhibiting the full development of a disease. “Treating” refers to a therapeutic intervention that ameliorates a sign or symptom of a disease or pathological condition after it has begun to develop. “Ameliorating” refers to the reduction in the number or severity of signs or symptoms of a disease.
- a promoter is an array of nucleic acid control sequences which direct transcription of a nucleic acid.
- a promoter includes necessary nucleic acid sequences near the start site of transcription.
- a promoter also optionally includes distal enhancer or repressor elements.
- a “constitutive promoter” is a promoter that is continuously active and is not subject to regulation by external signals or molecules. In contrast, the activity of an “inducible promoter” is regulated by an external signal or molecule (for example, a transcription factor). In some embodiments herein, the promoter is a CMV promoter.
- purified does not require absolute purity; rather, it is intended as a relative term.
- a purified peptide, protein, virus, VLP or other active compound is one that is isolated in whole or in part from naturally associated proteins and other contaminants.
- substantially purified refers to a peptide, protein, virus, VLP or other active compound that has been isolated from a cell, cell culture medium, or other crude preparation and subjected to fractionation to remove various components of the initial preparation, such as proteins, cellular debris, and other components.
- a recombinant nucleic acid, protein, virus or VLP is one that has a sequence that is not naturally occurring or has a sequence that is made by an artificial combination of two otherwise separated segments of sequence. This artificial combination is often accomplished by chemical synthesis or, more commonly, by the artificial manipulation of isolated segments of nucleic acids, for example, by genetic engineering techniques.
- Sequence identity The similarity between amino acid or nucleic acid sequences is expressed in terms of the similarity between the sequences, otherwise referred to as sequence identity. Sequence identity is frequently measured in terms of percentage identity (or similarity or homology); the higher the percentage, the more similar the two sequences are. Homologs or variants of a given gene or protein will possess a relatively high degree of sequence identity when aligned using standard methods.
- NCBI Basic Local Alignment Search Tool (BLASTTM) (Altschul et al., J. Mol. Biol. 215:403-410, 1990) is available from several sources, including the National Center for Biotechnology Information (NCBI, Bethesda, Md.) and on the Internet, for use in connection with the sequence analysis programs blastp, blastn, blastx, tblastn and tblastx.
- Subject Living multi-cellular vertebrate organisms, a category that includes both human and non-human mammals, such as non-human primates.
- Therapeutically effective amount A quantity of a specified agent sufficient to achieve a desired effect in a subject being treated with that agent. For example, this may be the amount of an influenza virus vaccine useful for eliciting an immune response in a subject and/or for preventing infection or disease caused by influenza virus.
- a therapeutically effective amount of an influenza vaccine is an amount sufficient to increase resistance to, prevent, ameliorate, and/or treat infection caused by influenza virus in a subject without causing a substantial cytotoxic effect in the subject.
- the effective amount of an influenza vaccine useful for increasing resistance to, preventing, ameliorating, and/or treating infection in a subject will be dependent on, for example, the subject being treated, the manner of administration of the therapeutic composition and other factors.
- a transformed cell is a cell into which has been introduced a nucleic acid molecule by molecular biology techniques.
- transformation encompasses all techniques by which a nucleic acid molecule might be introduced into such a cell, including transfection with viral vectors, transformation with plasmid vectors, and introduction of naked DNA by electroporation, lipofection, and particle gun acceleration.
- Vaccine A preparation of immunogenic material capable of stimulating an immune response, administered for the prevention, amelioration, or treatment of disease, such as an infectious disease.
- the immunogenic material may include, for example, attenuated or killed microorganisms (such as attenuated viruses), or antigenic proteins, peptides or DNA derived from them.
- Vaccines may elicit both prophylactic (preventative) and therapeutic responses.
- Methods of administration vary according to the vaccine, but may include inoculation, ingestion, inhalation or other forms of administration. Inoculations can be delivered by any of a number of routes, including parenteral, such as intravenous, subcutaneous or intramuscular.
- Vaccines may be administered with an adjuvant to boost the immune response.
- a vector is a nucleic acid molecule allowing insertion of foreign nucleic acid without disrupting the ability of the vector to replicate and/or integrate in a host cell.
- a vector can include nucleic acid sequences that permit it to replicate in a host cell, such as an origin of replication.
- An insertional vector is capable of inserting itself into a host nucleic acid.
- a vector can also include one or more selectable marker genes and other genetic elements.
- An expression vector is a vector that contains the necessary regulatory sequences to allow transcription and translation of an inserted gene or genes.
- the vector encodes an influenza HA, NA or M1 protein.
- the vector is the pTR600 expression vector (U.S. Patent Application Publication No. 2002/0106798; Ross et al., Nat Immunol. 1(2):102-103, 2000; Green et al., Vaccine 20:242-248, 2001).
- Virus-like particle Virus particles made up of one of more viral structural proteins, but lacking the viral genome. Because VLPs lack a viral genome, they are non-infectious. In addition, VLPs can often be produced by heterologous expression and can be easily purified. Most VLPs comprise at least a viral core protein that drives budding and release of particles from a host cell.
- a viral core protein is influenza M1.
- influenza VLP comprises the HA, NA and/or M1 proteins. Influenza VLPs can be produced by transfection of host cells with plasmids encoding the HA and NA proteins, and optionally the M1 protein.
- VLPs can be isolated from cell culture supernatants.
- Example 2 provides an exemplary protocol for purifying influenza VLPs from cell supernatants.
- VLPs are isolated by low speed centrifugation (to remove cell debris), vacuum filtration and ultracentrifugation through 20% glycerol.
- Other methods of producing influenza VLPs are known in the art (see, for example, U.S. Patent Application Publication Nos. 2006/0263804; 2008/0031895; 2010/0166769; and 2010/0239610).
- H1N1 influenza HA polypeptides for eliciting a broadly reactive immune response to H1N1 influenza.
- the optimized HA polypeptides were developed through a series of HA protein alignments, and subsequent generation of consensus sequences, based on selected H1N1 viruses isolated from 1918-2011.
- the methods used to generate the 11 HA consensus sequences are described in Example 1 and FIGS. 1-5 .
- the amino acid sequences of the 11 consensus HA polypeptides are set forth herein as SEQ ID NOs: 1-11.
- an amino acid consensus sequence of SEQ ID NOs: 1-11 is provided herein as SEQ ID NO: 12.
- the HA polypeptide comprises an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10 or SEQ ID NO: 11.
- the amino acid sequence of the polypeptide comprises no more than 5, no more than 6, no more than 7, no more than 8, no more than 9 or no more than 10 amino acid substitutions relative to SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10 or SEQ ID NO: 11.
- a recombinant influenza HA polypeptide comprising an amino acid sequence at least 99% identical to SEQ ID NO: 1; at least 99.2% identical to SEQ ID NO: 2; at least 99% identical to SEQ ID NO: 3; at least 99% identical to SEQ ID NO: 4; at least 98% or at least 99% identical to SEQ ID NO: 5; at least 99% identical to SEQ ID NO: 6; at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 7; at least 99% identical to SEQ ID NO: 8; comprising SEQ ID NO: 9; at least 99% identical to SEQ ID NO: 10; or at least 99% identical to SEQ ID NO: 11.
- the recombinant influenza HA polypeptide comprises an amino acid sequence at least 99% identical to residues 2-566 of SEQ ID NO: 1; at least 99.2% identical to residues 2-566 of SEQ ID NO: 2; at least 99% identical to residues 2-566 of SEQ ID NO: 3; at least 99% identical to residues 2-566 of SEQ ID NO: 4; at least 98% or at least 99% identical to residues 2-566 of SEQ ID NO: 5; at least 99% identical to residues 2-566 of SEQ ID NO: 6; at least 97%, at least 98% or at least 99% identical to residues 2-566 of SEQ ID NO: 7; at least 99% identical to residues 2-566 of SEQ ID NO: 8; comprising residues 2-566 of SEQ ID NO: 9; at least 99% identical to residues 2-566 of SEQ ID NO: 10; or at least 99% identical to residues 2-566 of SEQ ID NO: 11.
- the amino acid sequence of the HA polypeptide comprises (i) no more than 5, nor more than 4, no more than 3, no more than 2 or no more than 1 amino acid substitution(s) relative to SEQ ID NO: 1; (ii) no more than 4, no more than 3, no more than 2 or no more than 1 amino acid substitution(s) relative to SEQ ID NO: 2; (iii) no more than 6, no more than 5, nor more than 4, no more than 3, no more than 2 or no more than 1 amino acid substitution(s) relative to SEQ ID NO: 3; (iv) no more than 8, no more than 7, no more than 6, no more than 5, nor more than 4, no more than 3, no more than 2 or no more than 1 amino acid substitution(s) relative to SEQ ID NO: 4; (v) no more than 10, no more than 9, no more than 8, no more than 7, no more than 6, no more than 5, nor more than 4, no more than 3, no more than 2 or no more than 1 amino acid substitution(s) relative to SEQ ID NO: 5; (vi) no more than 8,
- influenza HA polypeptide comprises or consists of the amino acid sequence of residues 2-566 of SEQ ID NO: 1, residues 2-566 of SEQ ID NO: 2, residues 2-566 of SEQ ID NO: 3, residues 2-566 of SEQ ID NO: 4, residues 2-566 of SEQ ID NO: 5, residues 2-566 of SEQ ID NO: 6, residues 2-566 of SEQ ID NO: 7, residues 2-566 of SEQ ID NO: 8, residues 2-566 of SEQ ID NO: 9, residues 2-566 of SEQ ID NO: 10 or residues 2-566 of SEQ ID NO: 11.
- the recombinant HA polypeptide comprises or consists of the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10 or SEQ ID NO: 11.
- the recombinant HA polypeptide comprises or consists of the amino acid sequence of SEQ ID NO: 12. In yet another example, the recombinant HA polypeptide comprises or consists of the amino acid sequence of residues 2-566 of SEQ ID NO: 12.
- nucleic acid molecules encoding the recombinant HA polypeptides disclosed herein.
- the nucleic acid molecule is codon-optimized for expression in mammalian cells.
- the nucleic acid molecule is optionally further optimized for RNA stability.
- the sequence of the nucleic acid molecule is at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 13.
- sequence of the nucleic acid molecule comprises or consists of SEQ ID NO: 13.
- Vectors comprising the nucleic acid molecules encoding recombinant HA polypeptides are also provided by the present disclosure.
- the vector can be any suitable vector for expression of the HA polypeptide, such as a mammalian expression vector.
- the vector is the pTR600 expression vector (U.S. Patent Application Publication No. 2002/0106798, herein incorporated by reference; Ross et al., Nat Immunol. 1(2):102-103, 2000; Green et al., Vaccine 20:242-248, 2001).
- the vector includes a promoter operably linked to the nucleic acid sequence encoding the HA polypeptide.
- the promoter is a CMV promoter.
- isolated cells comprising the disclosed vectors.
- the cell is any suitable cell type for production and expression of VLPs, such as a mammalian cell.
- influenza VLPs comprising an optimized HA polypeptide disclosed herein.
- the influenza VLPs can further include any additional influenza proteins necessary to form the virus particle.
- influenza VLPs further include influenza neuraminidase (NA) protein, influenza matrix (M1) protein, or both.
- NA influenza neuraminidase
- M1 influenza matrix
- influenza VLPs comprising an influenza HA polypeptide disclosed herein, produced by transfecting a host cell with a vector encoding the HA polypeptide, a vector encoding an influenza NA protein and a vector encoding an influenza M1 protein under conditions sufficient to allow for expression of the HA, M1 and NA proteins.
- Fusion proteins comprising an optimized influenza HA polypeptide are further provided by the present disclosure.
- compositions comprising an optimized influenza HA protein as disclosed herein, or a fusion protein or VLP comprising the optimized influenza HA protein.
- the compositions further comprise a pharmaceutically acceptable carrier and/or an adjuvant.
- the adjuvant can be alum, Freund's complete adjuvant, a biological adjuvant or immunostimulatory oligonucleotides (such as CpG oligonucleotides).
- the influenza virus is an H1N1 influenza virus.
- the HA protein, HA fusion protein or VLP can be administered using any suitable route of administration, such as, for example, intramuscular.
- the HA protein, fusion protein or VLP is administered as a composition further comprising a pharmaceutically acceptable carrier and/or an adjuvant.
- the adjuvant can be alum, Freund's complete adjuvant, a biological adjuvant or immunostimulatory oligonucleotides (such as CpG oligonucleotides).
- the composition further comprises a pharmaceutically acceptable carrier and/ or an adjuvant.
- the adjuvant can be alum, Freund's complete adjuvant, a biological adjuvant or immunostimulatory oligonucleotides (such as CpG oligonucleotides).
- the VLPs (or compositions thereof) are administered intramuscularly.
- the subject is administered about 1 to about 25 ⁇ g of the VLPs containing an optimized HA protein.
- the subject is administered about 5 to about 20 ⁇ g of the VLPs, or about 10 to about 15 ⁇ g of the VLPs.
- the subject is administered about 15 ⁇ g of the VLPs.
- a therapeutically effective amount for example an amount that provides protection against H1N1 influenza virus infection
- H1N1 HA amino acid sequences were downloaded from the NCBI Influenza Virus Resource database.
- H1N1 HA proteins from 1134 isolates from 1918-2011 were used for generating consensus sequences.
- Example 1 describes the methods that were used to generate each consensus sequence (see also FIGS. 1-5 ).
- the HA polypeptides lack the N-terminal methionine residue.
- HA polypeptides comprising residues 2-566 of any one of SEQ ID NOs: 1-12.
- the COBRA amino acid sequences can be reverse translated and optimized for expression in mammalian cells, including codon usage and RNA optimization (GeneArt; Regensburg, Germany).
- the optimized nucleic acid sequences can be inserted into an appropriate expression vector, such as the pTR600 expression vector (U.S. Patent Application Publication No. 2002/0106798; Ross et al., Nat Immunol. 1(2):102-103, 2000; Green et al., Vaccine 20:242-248, 2001).
- the optimized nucleic acid sequence of the COBRA HA sequence of Method 1 is (SEQ ID NO: 13):
- Influenza viruses are segmented negative-strand RNA viruses that belong to the Orthomyxoviridae family. There are three types of Influenza viruses, A, B and C. Influenza A viruses infect a wide variety of birds and mammals, including humans, horses, marine mammals, pigs, ferrets, and chickens. In animals, most influenza A viruses cause mild localized infections of the respiratory and intestinal tract. However, highly pathogenic influenza A strains, such as H5N1, cause systemic infections in poultry in which mortality may reach 100%. Animals infected with influenza A often act as a reservoir for the influenza viruses and certain subtypes have been shown to cross the species barrier to humans.
- Influenza A viruses can be classified into subtypes based on allelic variations in antigenic regions of two genes that encode surface glycoproteins, namely, hemagglutinin (HA) and neuraminidase (NA) which are required for viral attachment and cellular release.
- HA hemagglutinin
- NA neuraminidase
- sixteen subtypes of HA (H1-H16) and nine NA (N1-N9) antigenic variants are known for influenza A virus.
- H1N1, H1N2, and H3N2 only three subtypes were known to circulate in humans.
- the pathogenic H5N1 subtype of avian influenza A has been reported to cross the species barrier and infect humans as documented in Hong Kong in 1997 and 2003, leading to the death of several patients.
- influenza A viruses In animals, most influenza A viruses cause mild localized infections of the respiratory and intestinal tract. However, highly pathogenic influenza A strains, such as H5N1, cause systemic infections in poultry in which mortality may reach 100%. In 2009, H1N1 influenza was the most common cause of human influenza. A new strain of swine-origin H1N1 emerged in 2009 and was declared pandemic by the World Health Organization. This strain was referred to as “swine flu.” H1N1 influenza A viruses were also responsible for the Spanish flu pandemic in 1918, the Fort Dix outbreak in 1976, and the Russian flu epidemic in 1977-1978.
- the influenza A virus genome encodes nine structural proteins and one nonstructural (NS 1) protein with regulatory functions.
- the influenza virus segmented genome contains eight negative-sense RNA (nsRNA) gene segments (PB2, PB1, PA, NP, M, NS, HA and NA) that encode at least ten polypeptides, including RNA-directed RNA polymerase proteins (PB2, PB 1 and PA), nucleoprotein (NP), neuraminidase (NA), hemagglutinin (subunits HA1 and HA2), the matrix proteins (M1 and M2) and the non-structural proteins (NS 1 and NS2) (Krug et al., In “The Influenza Viruses,” R. M. Krug, ed., Plenum Press, N.Y., 1989, pp. 89 152).
- Influenza virus' ability to cause widespread disease is due to its ability to evade the immune system by undergoing antigenic change, which is believed to occur when a host is infected simultaneously with both an animal influenza virus and a human influenza virus.
- the virus may incorporate an HA and/or NA surface protein gene from another virus into its genome, thereby producing a new influenza subtype and evading the immune system.
- HA is a viral surface glycoprotein generally comprising approximately 560 amino acids and representing 25% of the total virus protein. It is responsible for adhesion of the viral particle to, and its penetration into, a host cell in the early stages of infection. Cleavage of the virus HA0 precursor into the HA1 and HA2 sub-fragments is a necessary step in order for the virus to infect a cell. Thus, cleavage is required in order to convert new virus particles in a host cell into virions capable of infecting new cells. Cleavage is known to occur during transport of the integral HA0 membrane protein from the endoplasmic reticulum of the infected cell to the plasma membrane.
- hemagglutinin undergoes a series of co- and post-translational modifications including proteolytic cleavage of the precursor HA into the amino-terminal fragment HAI and the carboxy terminal HA2.
- One of the primary difficulties in growing influenza strains in primary tissue culture or established cell lines arises from the requirement for proteolytic cleavage activation of the influenza hemagglutinin in the host cell.
- Proteolytic activation of HA involves cleavage at an arginine residue by a trypsin-like endoprotease, which is often an intracellular enzyme that is calcium dependent and has a neutral pH optimum. Since the activating proteases are cellular enzymes, the infected cell type determines whether the HA is cleaved.
- the HA of the mammalian influenza viruses and the nonpathogenic avian influenza viruses are susceptible to proteolytic cleavage only in a restricted number of cell types.
- HA of pathogenic avian viruses among the H5 and H7 subtypes are cleaved by proteases present in a broad range of different host cells. Thus, there are differences in host range resulting from differences in hemagglutinin cleavability which are correlated with the pathogenic properties of the virus.
- NA Neuraminidase
- N1 N2, N3, N4, N5, N6, N7, N8 and N9
- NA is involved in the destruction of the cellular receptor for the viral HA by cleaving terminal neuraminic acid (also called sialic acid) residues from carbohydrate moieties on the surfaces of infected cells.
- NA also cleaves sialic acid residues from viral proteins, preventing aggregation of viruses. Using this mechanism, it is hypothesized that NA facilitates release of viral progeny by preventing newly formed viral particles from accumulating along the cell membrane, as well as by promoting transportation of the virus through the mucus present on the mucosal surface. NA is an important antigenic determinant that is subject to antigenic variation.
- influenza virus comprises six additional internal genes, which give rise to eight different proteins, including polymerase genes PB 1, PB2 and PA, matrix proteins M1 and M2, nucleoprotein (NP), and non-structural proteins NS 1 and NS2 (Horimoto et al., Clin Microbiol Rev. 14(1):129-149, 2001).
- viral RNA is transported from the nucleus as a ribonucleoprotein (RNP) complex composed of the three influenza virus polymerase proteins, the nucleoprotein (NP), and the viral RNA, in association with the influenza virus matrix 1 (M1) protein and nuclear export protein (Marsh et al., J Virol, 82:2295-2304, 2008).
- RNP ribonucleoprotein
- M1 protein and nuclear export protein Marsh et al., J Virol, 82:2295-2304, 2008.
- M1 protein that lies within the envelope is thought to function in assembly and budding.
- a limited number of M2 proteins are integrated into the virions (Zebedee, J. Virol. 62:2762-2772, 1988).
- Amantadine is an anti-influenza drug that prevents viral infection by interfering with M2 ion channel activity, thus inhibiting virus uncoating.
- NS 1 a nonstructural protein, has multiple functions, including regulation of splicing and nuclear export of cellular mRNAs as well as stimulation of translation.
- the major function of NS 1 seems to be to counteract the interferon activity of the host, since an NS 1 knockout virus was viable although it grew less efficiently than the parent virus in interferon-nondefective cells (Garcia-Sastre, Virology 252:324-330, 1998).
- NS2 has been detected in virus particles (Richardson et al., Arch. Virol. 116:69-80, 1991; Yasuda et al., Virology 196:249-255, 1993). The average number of NS2 proteins in a virus particle was estimated to be 130-200 molecules.
- An in vitro binding assay shows direct protein-protein contact between M1 and NS2.
- NS2-M1 complexes have also been detected by immunoprecipitation in virus-infected cell lysates. The NS2 protein is thought to play a role in the export of RNP from the nucleus through interaction with M1 protein (Ward et al., Arch. Virol. 140:2067-2073, 1995).
- Influenza VLPs comprising an optimized HA (such as the HA having the amino acid sequence set forth as any one of SEQ ID NOs: 1-11) are provided herein.
- the influenza VLPs are generally made up of the HA, NA and M1 proteins.
- the production of influenza VLPs has been described in the art and is within the abilities of one of ordinary skill in the art.
- influenza VLPs can be produced by transfection of host cells with plasmids encoding the HA, NA and M1 proteins. After incubation of the transfected cells for an appropriate time to allow for protein expression (such as for approximately 72 hours), VLPs can be isolated from cell culture supernatants.
- Example 2 below provides an exemplary protocol for purifying influenza VLPs from cell supernatants.
- VLPs are isolated by low speed centrifugation (to remove cell debris), vacuum filtration and ultracentrifugation through 20% glycerol.
- influenza VLPs disclosed herein can be used as influenza vaccines to elicit a protective immune response against H1N1 influenza viruses.
- Influenza VLPs, or compositions thereof can be administered to a subject by any of the routes normally used for introducing recombinant virus into a subject.
- Methods of administration include, but are not limited to, intradermal, intramuscular, intraperitoneal, parenteral, intravenous, subcutaneous, vaginal, rectal, intranasal, inhalation or oral.
- Parenteral administration such as subcutaneous, intravenous or intramuscular administration, is generally achieved by injection.
- Injectables can be prepared in conventional forms, either as liquid solutions or suspensions, solid forms suitable for solution or suspension in liquid prior to injection, or as emulsions.
- Injection solutions and suspensions can be prepared from sterile powders, granules, and tablets of the kind previously described. Administration can be systemic or local.
- Influenza VLPs, or compositions thereof are administered in any suitable manner, such as with pharmaceutically acceptable carriers.
- Pharmaceutically acceptable carriers are determined in part by the particular composition being administered, as well as by the particular method used to administer the composition. Accordingly, there is a wide variety of suitable formulations of pharmaceutical compositions of the present disclosure.
- Preparations for parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, and emulsions.
- non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate.
- Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media.
- Parenteral vehicles include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils.
- Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers (such as those based on Ringer's dextrose), and the like. Preservatives and other additives may also be present such as, for example, antimicrobials, anti-oxidants, chelating agents, and inert gases and the like.
- compositions may potentially be administered as a pharmaceutically acceptable acid- or base-addition salt, formed by reaction with inorganic acids such as hydrochloric acid, hydrobromic acid, perchloric acid, nitric acid, thiocyanic acid, sulfuric acid, and phosphoric acid, and organic acids such as formic acid, acetic acid, propionic acid, glycolic acid, lactic acid, pyruvic acid, oxalic acid, malonic acid, succinic acid, maleic acid, and fumaric acid, or by reaction with an inorganic base such as sodium hydroxide, ammonium hydroxide, potassium hydroxide, and organic bases such as mono-, di-, trialkyl and aryl amines and substituted ethanolamines.
- inorganic acids such as hydrochloric acid, hydrobromic acid, perchloric acid, nitric acid, thiocyanic acid, sulfuric acid, and phosphoric acid
- organic acids such as formic acid, acetic acid, propionic acid
- Administration can be accomplished by single or multiple doses.
- the dose administered to a subject in the context of the present disclosure should be sufficient to induce a beneficial therapeutic response in a subject over time, or to inhibit or prevent H1N1 influenza virus infection.
- the dose required will vary from subject to subject depending on the species, age, weight and general condition of the subject, the severity of the infection being treated, the particular composition being used and its mode of administration. An appropriate dose can be determined by one of ordinary skill in the art using only routine experimentation.
- compositions which include a therapeutically effective amount of the influenza VLPs alone or in combination with a pharmaceutically acceptable carrier.
- Pharmaceutically acceptable carriers include, but are not limited to, saline, buffered saline, dextrose, water, glycerol, ethanol, and combinations thereof.
- the carrier and composition can be sterile, and the formulation suits the mode of administration.
- the composition can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents.
- the composition can be a liquid solution, suspension, emulsion, tablet, pill, capsule, sustained release formulation, or powder.
- the composition can be formulated as a suppository, with traditional binders and carriers such as triglycerides.
- Oral formulations can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, and magnesium carbonate. Any of the common pharmaceutical carriers, such as sterile saline solution or sesame oil, can be used.
- the medium can also contain conventional pharmaceutical adjunct materials such as, for example, pharmaceutically acceptable salts to adjust the osmotic pressure, buffers, preservatives and the like.
- Other media that can be used with the compositions and methods provided herein are normal saline and sesame oil.
- influenza VLPs described herein can be administered alone or in combination with other therapeutic agents to enhance antigenicity.
- influenza VLPs can be administered with an adjuvant, such as Freund incomplete adjuvant or Freund's complete adjuvant.
- one or more cytokines such as IL-2, IL-6, IL-12, RANTES, GM-CSF, TNF- ⁇ , or IFN- ⁇ , one or more growth factors, such as GM-CSF or G-CSF; one or more molecules such as OX-40L or 41 BBL, or combinations of these molecules, can be used as biological adjuvants (see, for example, Salgaller et al., 1998, J. Surg. Oncol. 68(2):122-38; Lotze et al., 2000, Cancer J. Sci. Am.
- Lipids have been identified as agents capable of assisting in priming CTL in vivo against various antigens.
- palmitic acid residues can be attached to the alpha and epsilon amino groups of a lysine residue and then linked (for example, via one or more linking residues, such as glycine, glycine-glycine, serine, serine-serine, or the like) to an immunogenic peptide.
- the lipidated peptide can then be injected directly in a micellar form, incorporated in a liposome, or emulsified in an adjuvant.
- E. coli lipoproteins such as tripalmitoyl-S-glycerylcysteinlyseryl-serine can be used to prime tumor specific CTL when covalently attached to an appropriate peptide (see, Deres et al., Nature 342:561, 1989).
- induction of neutralizing antibodies can also be primed with the same molecule conjugated to a peptide which displays an appropriate epitope, two compositions can be combined to elicit both humoral and cell-mediated responses where that is deemed desirable.
- VLPs containing an optimized HA protein are exemplified herein, one of skill in the art would understand that it is also possible to administer the optimized influenza HA protein itself (in the absence of a viral particle) or as a fusion protein to elicit an immune response in a subject.
- H1N1 HA amino acid sequences were downloaded from the NCBI Influenza Virus Resource database.
- H1N1 HA proteins from 1134 isolates from 1918-2011 were used for generating consensus sequences.
- Eleven different consensus sequences (SEQ ID NOs: 1-11) were generated using the following methods:
- Sequences (456) were organized by date of isolation and eight primary consensus sequences were generated using isolates from 1918-1934 (8), 1935-1947 (13), 1948-1957 (12), 1977-1983 (68), 1984-1986 (9), 1987-1991 (12), 1992-1999 (59) and 2000-2005 (263).
- Four secondary consensus sequences were generated by grouping the primary consensus sequences by date, as shown in FIG. 1 .
- the final consensus sequence (the third layer consensus; SEQ ID NO: 1) was generated by alignment of the four secondary consensus sequences.
- sequences (456) were organized by date of isolation to generate eight primary consensus sequences.
- the final consensus sequence (SEQ ID NO: 2) was generated by aligning the eight primary consensus sequences, as illustrated in FIG. 2 .
- the consensus sequence (SEQ ID NO: 3) was generated by alignment of 456 H1N1 virus isolates from 1918-2005.
- Sequences (456) were organized by date of isolation and ten primary consensus sequences were generated using isolates from 1918-1933 (6), 1934-1946 (15), 1947-1956 (12), 1957-1977 (8), 1978-1980 (17), 1981-1985 (49), 1986-1990 (14), 1991-1995 (27), 1996-1998 (27) and 1999-2005 (281), as shown in FIG. 3 .
- the final consensus sequence (SEQ ID NO: 4) was generated by alignment of the ten primary consensus sequences.
- Sequences (1134) were organized by date of isolation and 12 primary consensus sequences were generated using isolates from 1918 (1), 1976 (4), 2009-2011 (123), 1933-1934 (8), 1935-1947 (13), 1948-1957 (12), 1977-1983 (68), 1984-1986 (9), 1987-1991 (12), 1992-1999 (27), 2000-2005 (59) and 2006-2008 (798).
- Four secondary consensus sequences were generated by grouping the primary consensus sequences according to “swine” sequences or by date, as shown in FIG. 4 .
- the final consensus sequence (the third layer consensus; SEQ ID NO: 5) was generated by alignment of the four secondary consensus sequences.
- Sequences (1134) were organized by date of isolation and 13 primary consensus sequences were generated using isolates from 1918 (1), 1933-1934 (8), 1935-1947 (13), 1948-1957 (12), 1976 (4), 1977-1983 (68), 1984-1986 (9), 1987-1991 (12), 1992-1999 (27), 2000-2005 (59), 2006 (76), 2007-2008 (722) and 2009-2011 (123), as shown in FIG. 5 .
- the final consensus sequence (SEQ ID NO: 6) was generated by alignment of the 13 primary consensus sequences.
- This sequence was generated by altering the Method 5 consensus sequence (SEQ ID NO: 5) to remove predicted glycosylation sites.
- This sequence was generated by alignment of H1N1 isolates from 1918-1957.
- This sequence was generated by alignment of H1N1 isolates from 1977-2005.
- This sequence (SEQ ID NO: 10) was generated by alignment of H1N1 human swine influenza isolates. This sequence was aligned using consensus sequences from 1918, 1976 and 2009-2011.
- This sequence (SEQ ID NO: 11) was generated by alignment of H1N1 swine influenza isolates. This sequence was aligned using swine sequences from 1930-2010.
- the COBRA amino acid sequence generated according to Method 1 was reverse translated and optimized for expression in mammalian cells, including codon usage and RNA optimization (GeneArt; Regensburg, Germany).
- the optimized nucleic acid sequence is set forth herein as SEQ ID NO: 13.
- the remaining COBRA sequences will also be reverse translated and optimized for expression in mammalian cells.
- the optimized nucleic acid sequences will be inserted into the pTR600 expression vector (U.S. Patent Application Publication No. 2002/0106798; Ross et al., Nat Immunol. 1(2):102-103, 2000; Green et al., Vaccine 20:242-248, 2001).
- influenza VLPs comprising an optimized HA.
- Exemplary methods for immunization of mice, ferrets and macaques are also described below (see also, Giles and Ross, Vaccine 29(16):3043-3054, 2011).
- 293T cells are transiently transfected with plasmids expressing M1, NA and an optimized HA, and incubated for 72 hours at 37° C.
- the M1, NA and HA coding sequences can be codon-optimized for expression in mammalian cells.
- Supernatants are collected and cell debris is removed by low speed centrifugation followed by vacuum filtration through a 0.22 ⁇ m sterile filter.
- VLPs are purified via ultracentrifugation (100,000 ⁇ g through 20% glycerol, weight per volume) for 4 hours at 4° C. The pellets are subsequently resuspended in PBS pH 7.2 and stored in single use aliquots at ⁇ 80° C. until use. Total protein concentration is determined by Micro BCATM Protein Assay Reagent Kit (Pierce Biotechnology, Rockford, Ill., USA).
- HA specific content can be determined by western blot and densitometry.
- Purified recombinant COBRA HA and purified VLPs are prepared in standard total protein amounts and are electrophoresed on a 10% SDS-PAGE gel and transferred to a PVDF membrane. The blot is probed with mouse polyclonal antisera from influenza infected mice and the HA-antibody complexes are detected using a goat anti-mouse IgG conjugated to horseradish peroxidase (HRP) (Southern Biotech; Birmingham, Ala., USA).
- HRP horseradish peroxidase
- HRP is detected by chemiluminescent substrate (Pierce Biotechnology; Rockford Ill., USA) and exposed to X-ray film (ThermoFisher; Pittsburgh, Pa., USA). Density of bands is determined using ImageJ software (NIH). Density of recombinant HA bands is used to calculate a standard curve and the density of the purified VLPs is interpolated using the results from the recombinant HA.
- mice (Mus musculis, females, 6-8 weeks old) can be purchased from Harlan Sprague Dawley (Indianapolis, Ind., USA). Mice are housed in microisolator units and allowed free access to food and water and are cared for under USDA guidelines for laboratory animals. Mice are vaccinated with one of three doses of purified COBRA HA VLPs (1.5 ⁇ g, 0.3 ⁇ g or 0.06 ⁇ g), based upon HA content from a densitometry assay, via intramuscular injection at week 0 and then boosted with the same dose at week 3.
- purified COBRA HA VLPs 1.5 ⁇ g, 0.3 ⁇ g or 0.06 ⁇ g
- Vaccines at each dose are formulated with alum adjuvant (Imject Alum, Pierce Biotechnology; Rockford, Ill., USA), CpG oligonucleotides, or vehicle alone.
- alum adjuvant Imject Alum, Pierce Biotechnology; Rockford, Ill., USA
- CpG oligonucleotides or vehicle alone.
- blood is collected from anesthetized mice via the retro-orbital plexus and transferred to a microfuge tube. Tubes are centrifuged and sera is removed and frozen at ⁇ 80 ⁇ 5° C.
- Hemagglutination inhibition (HAI) serum antibody titer for each vaccine group is determined at week 5 using representative reassortant viruses or COBRA HA VLPs.
- mice are challenged intranasally with a highly pathogenic H1N1 virus in a volume of 50 ⁇ l. After infection, mice are monitored daily for weight loss, disease signs and death for 14 days after infection. Individual body weights, sickness scores (Toapanta and Ross, Respiratory Research 10(1):112, 2009) and death are recorded for each group on each day after inoculation.
- Fitch ferrets Mustela putorius faro , female, 6-12-months of age
- influenza na ⁇ ve and de-scented can be purchased from Marshall Farms (Sayre, Pa., USA).
- Ferrets are pair housed in stainless steel cages (Shor-line, Kansas City, Kans., USA) containing Sani-chips Laboratory Animal Bedding (P.J. Murphy Forest Products, Montville, N.J., USA).
- Ferrets are provided with Teklad Global Ferret Diet (Harlan Teklad, Madison, Wis., USA) and fresh water ad libitum.
- the COBRA HA VLPs are diluted in PBS, pH 7.2 to achieve final concentration.
- Ferrets are vaccinated with one of two doses of purified COBRA VLPs (15 ⁇ g, 3 ⁇ g), based upon HA content as determined by densitometry assay, via intramuscular injection in the quadriceps muscle in a volume of 0.25 ml at week 0 and then boosted with the same dose at week 3.
- Vaccines are stored at ⁇ 80° C. prior to use and formulated with alum adjuvant (Imject Alum; Pierce Biotechnology, Rockford, Ill., USA) immediately prior to use. Animals are monitored for adverse events including weight loss, temperature, decrease in activity, nasal discharge, sneezing and diarrhea weekly during the vaccination regimen.
- HAI assay Prior to vaccination, animals are confirmed by HAI assay to be seronegative for circulating influenza A and influenza B viruses. Fourteen to twenty-one days after each vaccination, blood is collected from anesthetized ferrets via the anterior vena cava and transferred to a microfuge tube. Tubes are centrifuged and sera is removed and frozen at ⁇ 80 ⁇ 5° C. HAI serum antibody titer for each vaccine group is determined at week 5 using representative reassortant viruses or COBRA HA VLPs.
- ferrets are challenged intranasally with a highly pathogenic H1N1 virus in a volume of 1 ml. After infection, ferrets are monitored daily for weight loss, disease signs and death for 14 days after infection. Individual body weights, sickness scores, and death are recorded for each group on each day after inoculation. Nasal washes are performed by instilling 3 ml of PBS into the nares of anesthetized ferrets each day for 7 days after inoculation. Washes are collected and stored at ⁇ 80° C. until use.
- Cynomolgus macaques ( Macaca fascicularis , male, 3-5 years old) can be purchased from Harlan Sprague Dawley (Indianapolis, IN, USA). Macaques are vaccinated with purified COBRA HA VLPs (15 ⁇ g), based upon HA content from a densitometry assay, via intramuscular injection at week 0 and then boosted with the same dose at weeks 3 and 6. Vaccines are formulated with alum adjuvant (Imject Alum, Pierce Biotechnology; Rockford, Ill., USA) immediately prior to use. Twenty-one days after each vaccination, blood is collected from anesthetized macaques via the femoral vein and transferred to a serum separator tube.
- COBRA HA VLPs 15 ⁇ g
- Vaccines are formulated with alum adjuvant (Imject Alum, Pierce Biotechnology; Rockford, Ill., USA) immediately prior to use. Twenty-one days after each vaccination, blood is collected from anest
- Tubes are allowed to activate clotting followed by centrifugation and sera is removed and frozen at ⁇ 80 ⁇ 5° C. End point IgG titers and HAI serum antibody titer for each vaccine group is determined at week 5 using representative reassortant viruses or COBRA HA VLPs.
- macaques are challenged by intranasal, intratracheal, and orbital inoculation with a highly pathogenic H1N1 virus in a volume of 1 ml. After infection, macaques are monitored daily for weight loss, disease signs and death for 5 days after infection. Individual body weights, sickness scores and death are recorded for each group on each day after inoculation.
- This example describes the finding that inoculation of mice with COBRA H1N1 influenza VLPs induces significant HAI serum antibody titers, and further shows that translation of COBRA H1N1 HA in vitro results in expression of the protein at the expected molecular weight.
- VLPs comprising the COBRA Method 1 HA (SEQ ID NO: 1) were generated as described in Example 2. Mice were inoculated with the VLPs and serum was collected at weeks 3, 5, 8 and 12 post-infection for determination of HAI serum antibody titers. Antisera were tested against the seasonal H1N1 influenza virus, A/New Caledonia/20/1999. As shown in FIG. 6 , HAI titers were detected starting at 5 weeks post-infection and increased at weeks 8 and 12.
- the COBRA HA Method 1 amino acid sequence was reverse translated and optimized for expression in mammalian cells.
- the optimized nucleic acid sequence (SEQ ID NO: 13) encoding COBRA HA was inserted into the pTR600 expression vector.
- cells were transfected with the pTR600 expression vector encoding COBRA H1N1 HA.
- Cell culture lysates were analyzed by SDS-PAGE, followed by Western blot for detection of influenza HA. As shown in FIG. 7 , COBRA HA migrated to its expected molecular weight, confirming expression of the synthetic protein in vitro.
Abstract
Described herein is the generation of optimized H1N1 influenza HA polypeptides for eliciting a broadly reactive immune response to H1N1 influenza virus isolates. The optimized HA polypeptides were developed through a series of HA protein alignments, and subsequent generation of consensus sequences, based on selected H1N1 viruses isolated from 1918-2011. Provided herein are optimized H1N1 HA polypeptides, and compositions, fusion proteins and VLPs comprising the HA polypeptides. Further provided are codon-optimized nucleic acid sequences encoding the HA polypeptides. Methods of eliciting an immune response against influenza virus in a subject are also provided by the present disclosure.
Description
- This is a divisional of U.S. application Ser. No. 14/126,550, filed Dec. 16, 2013, which is the U.S. National Stage of International Application No. PCT/US2012/043347, filed Jun. 20, 2012, published in English under PCT Article 21(2), which claims the benefit of U.S. Provisional Application No. 61/498,800, filed Jun. 20, 2011. The above-listed applications are herein incorporated by reference in their entirety.
- This disclosure concerns optimized influenza hemagglutinin proteins that elicit broadly reactive immune responses to H1N1 virus isolates and their use as vaccines.
- Influenza virus is a member of Orthomyxoviridae family. There are three subtypes of influenza viruses, designated influenza A, influenza B, and influenza C. The influenza virion contains a segmented negative-sense RNA genome, which encodes the following proteins: hemagglutinin (HA), neuraminidase (NA), matrix (M1), proton ion-channel protein (M2), nucleoprotein (NP), polymerase basic protein 1 (PB 1), polymerase basic protein 2 (PB2), polymerase acidic protein (PA), and nonstructural protein 2 (NS2). The HA, NA, M1, and M2 are membrane associated, whereas NP,
PB 1, PB2, PA, and NS2 are nucleocapsid associated proteins. The M1 protein is the most abundant protein in influenza particles. The HA and NA proteins are envelope glycoproteins, responsible for virus attachment and penetration of the viral particles into the cell, and the sources of the major immunodominant epitopes for virus neutralization and protective immunity. Both HA and NA proteins are considered the most important components for prophylactic influenza vaccines. - Each year, seasonal influenza causes over 300,000 hospitalizations and 36,000 deaths in the U.S. alone (Simonsen et al., Lancet Infect Dis 7:658-66, 2007). The emergence of the novel H1N1 influenza virus in 2009 demonstrated how quickly a new influenza pandemic can sweep across the world.
- There are currently two influenza vaccine approaches licensed in the United States—the inactivated, split vaccine and the live-attenuated virus vaccine. The inactivated vaccines can efficiently induce humoral immune responses but generally only poor cellular immune responses. Live virus vaccines cannot be administered to immunocompromised or pregnant patients due to their increased risk of infection. Thus, a need exists for a broadly protective influenza virus vaccine.
- Disclosed herein is the generation of optimized H1N1 influenza HA polypeptides for eliciting a broadly reactive immune response to H1N1 influenza virus isolates. The optimized HA polypeptides were developed through a series of HA protein alignments, and subsequent generation of consensus sequences, based on selected H1N1 viruses isolated from 1918-2011.
- Provided herein are recombinant influenza HA polypeptides having an optimized amino acid sequence for eliciting a broadly reactive immune response against H1N1 influenza. In some embodiments, the HA polypeptide comprises an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10 or SEQ ID NO: 11. In some embodiments, the amino acid sequence of the polypeptide comprises no more than 5, no more than 6, no more than 7, no more than 8, no more than 9 or no more than 10 amino acid substitutions relative to SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10 or SEQ ID NO: 11. In some embodiments, the influenza HA polypeptide lacks the N-terminal methionine residue.
- Isolated nucleic acid molecules and vectors encoding the recombinant HA polypeptides are also provided by the present disclosure. Further provided are isolated cells comprising such vectors.
- Also provided are influenza virus-like particles (VLPs) and fusion proteins comprising the optimized HA polypeptides disclosed herein.
- Further provided are compositions that include the optimized influenza HA polypeptides, fusion proteins or VLPs disclosed herein in a pharmaceutically acceptable carrier. Methods of eliciting an immune response against influenza virus in a subject by administering the disclosed compositions, fusion proteins or VLPs is also provided by the present disclosure.
- Also provided are methods of immunizing a subject against influenza virus by administering to the subject a composition comprising a VLP that contains an optimized HA polypeptide.
- The foregoing and other objects, features, and advantages of the disclosure will become more apparent from the following detailed description, which proceeds with reference to the accompanying figures.
-
FIG. 1 is a schematic of the process used to generate an H1N1 HA consensus sequence according toMethod 1. -
FIG. 2 is a schematic of the process used to generate an H1N1 HA consensus sequence according toMethod 2. -
FIG. 3 is a schematic of the process used to generate an H1N1 HA consensus sequence according toMethod 4. -
FIG. 4 is a schematic of the process used to generate an H1N1 HA consensus sequence according toMethod 5. -
FIG. 5 is a schematic of the process used to generate an H1N1 HA consensus sequence according toMethod 6. -
FIG. 6 is a graph showing hemagglutination-inhibition (HAI) serum antibody titers induced by COBRA H1N1 infection of mice. HAI serum antibody titers were determined in mice infected with COBRA H1N1 influenza VLPs (COBRA Method 1). Antisera were tested against the seasonal H1N1 influenza virus, A/New Caledonia/20/1999. The results are represented as the log2 transformed geometric mean titer (±S.E.M.) from antisera collected atweeks -
FIG. 7 is Western blot showing expression of COBRA HA protein (Method 1 consensus sequence). COBRA H1N1 HA was translated in vitro and the cell culture lysates were analyzed by SDS-PAGE and Western blot. Lane 1, A/New Caledonia/20/1999 virus; Lane 2, H1N1 COBRA secreted HA; Lane 3, H1N1 COBRA 5μg VLP; Lane 4, COBRA 10 μg VLP. The COBRA HA (lane 2) migrates at its expected molecular weight confirming expression of the synthetic protein. - The nucleic and amino acid sequences listed in the accompanying sequence listing are shown using standard letter abbreviations for nucleotide bases, and three letter code for amino acids, as defined in 37 C.F.R. 1.822. Only one stand of each nucleic acid sequence is shown, but the complementary strand is understood as included by any reference to the displayed strand. The Sequence Listing is submitted as an ASCII text file, created on Dec. 20, 2016, 67.6 KB, which is incorporated by reference herein. In the accompanying sequence listing:
- SEQ ID NOs: 1-11 are the amino acid sequences of optimized H1N1 HA proteins.
- SEQ ID NO: 12 is a consensus amino acid sequence of the optimized H1N1 HA proteins.
- SEQ ID NO: 13 is the nucleic acid sequence of a codon-optimized H1N1 HA.
- COBRA: computationally optimized broadly reactive antigen
- HA: hemagglutinin
- HAI: hemagglutination inhibition
- HRP: horseradish peroxidase
- M1:
matrix protein 1 - NA: neuraminidase
- PFU: plaque form unit
- VLP: virus-like particle
- Unless otherwise noted, technical terms are used according to conventional usage. Definitions of common terms in molecular biology may be found in Benjamin Lewin, Genes V, published by Oxford University Press, 1994 (ISBN 0-19-854287-9); Kendrew et al. (eds.), The Encyclopedia of Molecular Biology, published by Blackwell Science Ltd., 1994 (ISBN 0-632-02182-9); and Robert A. Meyers (ed.), Molecular Biology and Biotechnology: a Comprehensive Desk Reference, published by VCH Publishers, Inc., 1995 (ISBN 1-56081-569-8).
- In order to facilitate review of the various embodiments of the disclosure, the following explanations of specific terms are provided:
- Adjuvant: A substance or vehicle that non-specifically enhances the immune response to an antigen. Adjuvants can include a suspension of minerals (alum, aluminum hydroxide, or phosphate) on which antigen is adsorbed; or water-in-oil emulsion in which antigen solution is emulsified in mineral oil (for example, Freund's incomplete adjuvant), sometimes with the inclusion of killed mycobacteria (Freund's complete adjuvant) to further enhance antigenicity. Immunostimulatory oligonucleotides (such as those including a CpG motif) can also be used as adjuvants (for example, see U.S. Pat. Nos. 6,194,388; 6,207,646; 6,214,806; 6,218,371; 6,239,116; 6,339,068; 6,406,705; and 6,429,199). Adjuvants also include biological molecules, such as costimulatory molecules. Exemplary biological adjuvants include IL-2, RANTES, GM-CSF, TNF-α, IFN-γ, G-CSF, LFA-3, CD72, B7-1, B7-2, OX-40L and 41 BBL.
- Administer: As used herein, administering a composition to a subject means to give, apply or bring the composition into contact with the subject. Administration can be accomplished by any of a number of routes, such as, for example, topical, oral, subcutaneous, intramuscular, intraperitoneal, intravenous, intrathecal and intradermal.
- Antibody: An immunoglobulin molecule produced by B lymphoid cells with a specific amino acid sequence. Antibodies are evoked in humans or other animals by a specific antigen (immunogen). Antibodies are characterized by reacting specifically with the antigen in some demonstrable way, antibody and antigen each being defined in terms of the other. “Eliciting an antibody response” refers to the ability of an antigen or other molecule to induce the production of antibodies.
- Antigen: A compound, composition, or substance that can stimulate the production of antibodies or a T-cell response in an animal, including compositions that are injected or absorbed into an animal. An antigen reacts with the products of specific humoral or cellular immunity, including those induced by heterologous immunogens. In some embodiments of the disclosed compositions and methods, the antigen is an influenza HA protein.
- Codon-optimized: A “codon-optimized” nucleic acid refers to a nucleic acid sequence that has been altered such that the codons are optimal for expression in a particular system (such as a particular species of group of species). For example, a nucleic acid sequence can be optimized for expression in mammalian cells. Codon optimization does not alter the amino acid sequence of the encoded protein.
- Fusion protein: A protein generated by expression of a nucleic acid sequence engineered from nucleic acid sequences encoding at least a portion of two different (heterologous) proteins. To create a fusion protein, the nucleic acid sequences must be in the same reading frame and contain to internal stop codons. For example, a fusion protein includes an influenza HA fused to a heterologous protein.
- Hemagglutinin (HA): An influenza virus surface glycoprotein. HA mediates binding of the virus particle to a host cells and subsequent entry of the virus into the host cell. The nucleotide and amino acid sequences of numerous influenza HA proteins are known in the art and are publically available, such as those deposited with GenBank. HA (along with NA) is one of the two major influenza virus antigenic determinants.
- Immune response: A response of a cell of the immune system, such as a B-cell, T-cell, macrophage or polymorphonucleocyte, to a stimulus such as an antigen or vaccine. An immune response can include any cell of the body involved in a host defense response, including for example, an epithelial cell that secretes an interferon or a cytokine. An immune response includes, but is not limited to, an innate immune response or inflammation. As used herein, a protective immune response refers to an immune response that protects a subject from infection (prevents infection or prevents the development of disease associated with infection). Methods of measuring immune responses are well known in the art and include, for example, measuring proliferation and/or activity of lymphocytes (such as B or T cells), secretion of cytokines or chemokines, inflammation, antibody production and the like.
- Immunogen: A compound, composition, or substance which is capable, under appropriate conditions, of stimulating an immune response, such as the production of antibodies or a T-cell response in an animal, including compositions that are injected or absorbed into an animal. As used herein, an “immunogenic composition” is a composition comprising an immunogen (such as an HA polypeptide).
- Immunize: To render a subject protected from an infectious disease, such as by vaccination.
- Influenza virus: A segmented negative-strand RNA virus that belongs to the Orthomyxoviridae family. There are three types of Influenza viruses, A, B and C. Influenza A viruses infect a wide variety of birds and mammals, including humans, horses, marine mammals, pigs, ferrets, and chickens. In animals, most influenza A viruses cause mild localized infections of the respiratory and intestinal tract. However, highly pathogenic influenza A strains, such as H5N1, cause systemic infections in poultry in which mortality may reach 100%. In 2009, H1N1 influenza was the most common cause of human influenza. A new strain of swine-origin H1N1 emerged in 2009 and was declared pandemic by the World Health Organization. This strain was referred to as “swine flu.” H1N1 influenza A viruses were also responsible for the Spanish flu pandemic in 1918, the Fort Dix outbreak in 1976, and the Russian flu epidemic in 1977-1978.
- Isolated: An “isolated” biological component (such as a nucleic acid, protein or virus) has been substantially separated or purified away from other biological components (such as cell debris, or other proteins or nucleic acids). Biological components that have been “isolated” include those components purified by standard purification methods. The term also embraces recombinant nucleic acids, proteins or viruses (or VLPs), as well as chemically synthesized nucleic acids or peptides.
- Linker: One or more amino acids that serve as a spacer between two polypeptides of a fusion protein.
- Matrix (M1) protein: An influenza virus structural protein found within the viral envelope. M1 is thought to function in assembly and budding.
- Neuraminidase (NA): An influenza virus membrane glycoprotein. NA is involved in the destruction of the cellular receptor for the viral HA by cleaving terminal sialic acid residues from carbohydrate moieties on the surfaces of infected cells. NA also cleaves sialic acid residues from viral proteins, preventing aggregation of viruses. NA (along with HA) is one of the two major influenza virus antigenic determinants.
- Operably linked: A first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence. For instance, a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence. Generally, operably linked DNA sequences are contiguous and, where necessary to join two protein-coding regions, in the same reading frame.
- Optimized influenza HA protein: As used herein, “optimized influenza HA protein” refers to the HA protein consensus sequence generated by sequence alignments of selected H1N1 influenza viruses isolated between 1918 and 2011 (as described in Example 1 below). The nucleotide sequences encoding optimized HA proteins were (or can be) further optimized for expression in mammalian cells via codon-optimization and RNA optimization (such as to increase RNA stability). Optimized influenza HA proteins disclosed herein (and set forth herein as SEQ ID NOs: 1-11) are also referred to as “COBRA” sequences. Optimized HA polypeptides are designed to elicit broadly reactive immune responses in a subject. In the context of the present disclosure, “broadly reactive” means the protein sequence elicits an immune response in a subject that is sufficient to inhibit, neutralize or prevent infection of a broad range of influenza viruses (such as most or all influenza viruses within a specific subtype). In some instances, the optimized influenza HA protein is capable of eliciting an immune response, such as a protective immune response, against most or all H1N1 influenza virus isolates.
- Outbreak: As used herein, an influenza virus “outbreak” refers to a collection of virus isolates from within a single country in a given year.
- Pharmaceutically acceptable vehicles: The pharmaceutically acceptable carriers (vehicles) useful in this disclosure are conventional. Remington's Pharmaceutical Sciences, by E. W. Martin, Mack Publishing Co., Easton, Pa., 15th Edition (1975), describes compositions and formulations suitable for pharmaceutical delivery of one or more therapeutic compositions, such as one or more influenza vaccines, and additional pharmaceutical agents.
- In general, the nature of the carrier will depend on the particular mode of administration being employed. For instance, parenteral formulations usually comprise injectable fluids that include pharmaceutically and physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like as a vehicle. For solid compositions (for example, powder, pill, tablet, or capsule forms), conventional non-toxic solid carriers can include, for example, pharmaceutical grades of mannitol, lactose, starch, or magnesium stearate. In addition to biologically-neutral carriers, pharmaceutical compositions to be administered can contain minor amounts of non-toxic auxiliary substances, such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like, for example sodium acetate or sorbitan monolaurate.
- Polypeptide: A polymer in which the monomers are amino acid residues which are joined together through amide bonds. When the amino acids are alpha-amino acids, either the L-optical isomer or the D-optical isomer can be used. The terms “polypeptide” or “protein” as used herein are intended to encompass any amino acid sequence and include modified sequences such as glycoproteins. The term “polypeptide” is specifically intended to cover naturally occurring proteins, as well as those which are recombinantly or synthetically produced. The term “residue” or “amino acid residue” includes reference to an amino acid that is incorporated into a protein, polypeptide, or peptide.
- Conservative amino acid substitutions are those substitutions that, when made, least interfere with the properties of the original protein, that is, the structure and especially the function of the protein is conserved and not significantly changed by such substitutions. Examples of conservative substitutions are shown below.
-
Original Residue Conservative Substitutions Ala Ser Arg Lys Asn Gln, His Asp Glu Cys Ser Gln Asn Glu Asp His Asn; Gln Ile Leu, Val Leu Ile; Val Lys Arg; Gln; Glu Met Leu; Ile Phe Met; Leu; Tyr Ser Thr Thr Ser Trp Tyr Tyr Trp; Phe Val Ile; Leu - Conservative substitutions generally maintain (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain.
- The substitutions which in general are expected to produce the greatest changes in protein properties will be non-conservative, for instance changes in which (a) a hydrophilic residue, for example, seryl or threonyl, is substituted for (or by) a hydrophobic residue, for example, leucyl, isoleucyl, phenylalanyl, valyl or alanyl; (b) a cysteine or proline is substituted for (or by) any other residue; (c) a residue having an electropositive side chain, for example, lysyl, arginyl, or histadyl, is substituted for (or by) an electronegative residue, for example, glutamyl or aspartyl; or (d) a residue having a bulky side chain, for example, phenylalanine, is substituted for (or by) one not having a side chain, for example, glycine.
- Preventing, treating or ameliorating a disease: “Preventing” a disease refers to inhibiting the full development of a disease. “Treating” refers to a therapeutic intervention that ameliorates a sign or symptom of a disease or pathological condition after it has begun to develop. “Ameliorating” refers to the reduction in the number or severity of signs or symptoms of a disease.
- Promoter: A promoter is an array of nucleic acid control sequences which direct transcription of a nucleic acid. A promoter includes necessary nucleic acid sequences near the start site of transcription. A promoter also optionally includes distal enhancer or repressor elements. A “constitutive promoter” is a promoter that is continuously active and is not subject to regulation by external signals or molecules. In contrast, the activity of an “inducible promoter” is regulated by an external signal or molecule (for example, a transcription factor). In some embodiments herein, the promoter is a CMV promoter.
- Purified: The term “purified” does not require absolute purity; rather, it is intended as a relative term. Thus, for example, a purified peptide, protein, virus, VLP or other active compound is one that is isolated in whole or in part from naturally associated proteins and other contaminants. In certain embodiments, the term “substantially purified” refers to a peptide, protein, virus, VLP or other active compound that has been isolated from a cell, cell culture medium, or other crude preparation and subjected to fractionation to remove various components of the initial preparation, such as proteins, cellular debris, and other components.
- Recombinant: A recombinant nucleic acid, protein, virus or VLP is one that has a sequence that is not naturally occurring or has a sequence that is made by an artificial combination of two otherwise separated segments of sequence. This artificial combination is often accomplished by chemical synthesis or, more commonly, by the artificial manipulation of isolated segments of nucleic acids, for example, by genetic engineering techniques.
- Sequence identity: The similarity between amino acid or nucleic acid sequences is expressed in terms of the similarity between the sequences, otherwise referred to as sequence identity. Sequence identity is frequently measured in terms of percentage identity (or similarity or homology); the higher the percentage, the more similar the two sequences are. Homologs or variants of a given gene or protein will possess a relatively high degree of sequence identity when aligned using standard methods.
- Methods of alignment of sequences for comparison are well known in the art. Various programs and alignment algorithms are described in: Smith and Waterman, Adv. Appl. Math. 2:482, 1981; Needleman and Wunsch, J. Mol. Biol. 48:443, 1970; Pearson and Lipman, Proc. Natl. Acad. Sci. U.S.A. 85:2444, 1988; Higgins and Sharp, Gene 73:237-244, 1988; Higgins and Sharp, CABIOS 5:151-153, 1989; Corpet et al., Nucleic Acids Research 16:10881-10890, 1988; and Pearson and Lipman, Proc. Natl. Acad. Sci. U.S.A. 85:2444, 1988. Altschul et al., Nature Genet. 6:119-129, 1994.
- The NCBI Basic Local Alignment Search Tool (BLAST™) (Altschul et al., J. Mol. Biol. 215:403-410, 1990) is available from several sources, including the National Center for Biotechnology Information (NCBI, Bethesda, Md.) and on the Internet, for use in connection with the sequence analysis programs blastp, blastn, blastx, tblastn and tblastx.
- Subject: Living multi-cellular vertebrate organisms, a category that includes both human and non-human mammals, such as non-human primates.
- Therapeutically effective amount: A quantity of a specified agent sufficient to achieve a desired effect in a subject being treated with that agent. For example, this may be the amount of an influenza virus vaccine useful for eliciting an immune response in a subject and/or for preventing infection or disease caused by influenza virus. Ideally, in the context of the present disclosure, a therapeutically effective amount of an influenza vaccine is an amount sufficient to increase resistance to, prevent, ameliorate, and/or treat infection caused by influenza virus in a subject without causing a substantial cytotoxic effect in the subject. The effective amount of an influenza vaccine useful for increasing resistance to, preventing, ameliorating, and/or treating infection in a subject will be dependent on, for example, the subject being treated, the manner of administration of the therapeutic composition and other factors.
- Transformed: A transformed cell is a cell into which has been introduced a nucleic acid molecule by molecular biology techniques. As used herein, the term transformation encompasses all techniques by which a nucleic acid molecule might be introduced into such a cell, including transfection with viral vectors, transformation with plasmid vectors, and introduction of naked DNA by electroporation, lipofection, and particle gun acceleration.
- Vaccine: A preparation of immunogenic material capable of stimulating an immune response, administered for the prevention, amelioration, or treatment of disease, such as an infectious disease. The immunogenic material may include, for example, attenuated or killed microorganisms (such as attenuated viruses), or antigenic proteins, peptides or DNA derived from them. Vaccines may elicit both prophylactic (preventative) and therapeutic responses. Methods of administration vary according to the vaccine, but may include inoculation, ingestion, inhalation or other forms of administration. Inoculations can be delivered by any of a number of routes, including parenteral, such as intravenous, subcutaneous or intramuscular. Vaccines may be administered with an adjuvant to boost the immune response.
- Vector: A vector is a nucleic acid molecule allowing insertion of foreign nucleic acid without disrupting the ability of the vector to replicate and/or integrate in a host cell. A vector can include nucleic acid sequences that permit it to replicate in a host cell, such as an origin of replication. An insertional vector is capable of inserting itself into a host nucleic acid. A vector can also include one or more selectable marker genes and other genetic elements. An expression vector is a vector that contains the necessary regulatory sequences to allow transcription and translation of an inserted gene or genes. In some embodiments of the present disclosure, the vector encodes an influenza HA, NA or M1 protein. In some embodiments, the vector is the pTR600 expression vector (U.S. Patent Application Publication No. 2002/0106798; Ross et al., Nat Immunol. 1(2):102-103, 2000; Green et al., Vaccine 20:242-248, 2001).
- Virus-like particle (VLP): Virus particles made up of one of more viral structural proteins, but lacking the viral genome. Because VLPs lack a viral genome, they are non-infectious. In addition, VLPs can often be produced by heterologous expression and can be easily purified. Most VLPs comprise at least a viral core protein that drives budding and release of particles from a host cell. One example of such a core protein is influenza M1. In some embodiments herein, an influenza VLP comprises the HA, NA and/or M1 proteins. Influenza VLPs can be produced by transfection of host cells with plasmids encoding the HA and NA proteins, and optionally the M1 protein. After incubation of the transfected cells for an appropriate time to allow for protein expression (such as for approximately 72 hours), VLPs can be isolated from cell culture supernatants. Example 2 provides an exemplary protocol for purifying influenza VLPs from cell supernatants. In this example, VLPs are isolated by low speed centrifugation (to remove cell debris), vacuum filtration and ultracentrifugation through 20% glycerol. Other methods of producing influenza VLPs are known in the art (see, for example, U.S. Patent Application Publication Nos. 2006/0263804; 2008/0031895; 2010/0166769; and 2010/0239610).
- Unless otherwise explained, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. The singular terms “a,” “an,” and “the” include plural referents unless context clearly indicates otherwise. Similarly, the word “or” is intended to include “and” unless the context clearly indicates otherwise. Hence “comprising A or B” means including A, or B, or A and B. It is further to be understood that all base sizes or amino acid sizes, and all molecular weight or molecular mass values, given for nucleic acids or polypeptides are approximate, and are provided for description. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present disclosure, suitable methods and materials are described below. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including explanations of terms, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.
- Disclosed herein is the generation of optimized H1N1 influenza HA polypeptides for eliciting a broadly reactive immune response to H1N1 influenza. The optimized HA polypeptides were developed through a series of HA protein alignments, and subsequent generation of consensus sequences, based on selected H1N1 viruses isolated from 1918-2011. The methods used to generate the 11 HA consensus sequences are described in Example 1 and
FIGS. 1-5 . The amino acid sequences of the 11 consensus HA polypeptides are set forth herein as SEQ ID NOs: 1-11. In addition, an amino acid consensus sequence of SEQ ID NOs: 1-11 is provided herein as SEQ ID NO: 12. - Provided herein are recombinant influenza HA polypeptides having an optimized amino acid sequence for eliciting a broadly reactive immune response against H1N1 influenza. In some embodiments, the HA polypeptide comprises an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10 or SEQ ID NO: 11. In other embodiments, the amino acid sequence of the polypeptide comprises no more than 5, no more than 6, no more than 7, no more than 8, no more than 9 or no more than 10 amino acid substitutions relative to SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10 or SEQ ID NO: 11.
- In particular embodiments, provided is a recombinant influenza HA polypeptide comprising an amino acid sequence at least 99% identical to SEQ ID NO: 1; at least 99.2% identical to SEQ ID NO: 2; at least 99% identical to SEQ ID NO: 3; at least 99% identical to SEQ ID NO: 4; at least 98% or at least 99% identical to SEQ ID NO: 5; at least 99% identical to SEQ ID NO: 6; at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 7; at least 99% identical to SEQ ID NO: 8; comprising SEQ ID NO: 9; at least 99% identical to SEQ ID NO: 10; or at least 99% identical to SEQ ID NO: 11.
- In other particular embodiments, the recombinant influenza HA polypeptide comprises an amino acid sequence at least 99% identical to residues 2-566 of SEQ ID NO: 1; at least 99.2% identical to residues 2-566 of SEQ ID NO: 2; at least 99% identical to residues 2-566 of SEQ ID NO: 3; at least 99% identical to residues 2-566 of SEQ ID NO: 4; at least 98% or at least 99% identical to residues 2-566 of SEQ ID NO: 5; at least 99% identical to residues 2-566 of SEQ ID NO: 6; at least 97%, at least 98% or at least 99% identical to residues 2-566 of SEQ ID NO: 7; at least 99% identical to residues 2-566 of SEQ ID NO: 8; comprising residues 2-566 of SEQ ID NO: 9; at least 99% identical to residues 2-566 of SEQ ID NO: 10; or at least 99% identical to residues 2-566 of SEQ ID NO: 11.
- In other embodiments, the amino acid sequence of the HA polypeptide comprises (i) no more than 5, nor more than 4, no more than 3, no more than 2 or no more than 1 amino acid substitution(s) relative to SEQ ID NO: 1; (ii) no more than 4, no more than 3, no more than 2 or no more than 1 amino acid substitution(s) relative to SEQ ID NO: 2; (iii) no more than 6, no more than 5, nor more than 4, no more than 3, no more than 2 or no more than 1 amino acid substitution(s) relative to SEQ ID NO: 3; (iv) no more than 8, no more than 7, no more than 6, no more than 5, nor more than 4, no more than 3, no more than 2 or no more than 1 amino acid substitution(s) relative to SEQ ID NO: 4; (v) no more than 10, no more than 9, no more than 8, no more than 7, no more than 6, no more than 5, nor more than 4, no more than 3, no more than 2 or no more than 1 amino acid substitution(s) relative to SEQ ID NO: 5; (vi) no more than 8, no more than 7, no more than 6, no more than 5, nor more than 4, no more than 3, no more than 2 or no more than 1 amino acid substitution(s) relative to SEQ ID NO: 6; (vii) no more than 10, no more than 9, no more than 8, no more than 7, no more than 6, no more than 5, nor more than 4, no more than 3, no more than 2 or no more than 1 amino acid substitution(s) relative to SEQ ID NO: 7; (viii) no more than 10, no more than 9, no more than 8, no more than 7, no more than 6, no more than 5, nor more than 4, no more than 3, no more than 2 or no more than 1 amino acid substitution(s) relative to SEQ ID NO: 8; (ix) no more than 8, no more than 7, no more than 6, no more than 5, nor more than 4, no more than 3, no more than 2 or no more than 1 amino acid substitution(s) relative to SEQ ID NO: 10; or (x) no more than 5, nor more than 4, no more than 3, no more than 2 or no more than 1 amino acid substitution(s) relative to SEQ ID NO: 11.
- In some examples, the influenza HA polypeptide comprises or consists of the amino acid sequence of residues 2-566 of SEQ ID NO: 1, residues 2-566 of SEQ ID NO: 2, residues 2-566 of SEQ ID NO: 3, residues 2-566 of SEQ ID NO: 4, residues 2-566 of SEQ ID NO: 5, residues 2-566 of SEQ ID NO: 6, residues 2-566 of SEQ ID NO: 7, residues 2-566 of SEQ ID NO: 8, residues 2-566 of SEQ ID NO: 9, residues 2-566 of SEQ ID NO: 10 or residues 2-566 of SEQ ID NO: 11.
- In other examples, the recombinant HA polypeptide comprises or consists of the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10 or SEQ ID NO: 11.
- In another example, the recombinant HA polypeptide comprises or consists of the amino acid sequence of SEQ ID NO: 12. In yet another example, the recombinant HA polypeptide comprises or consists of the amino acid sequence of residues 2-566 of SEQ ID NO: 12.
- Further provided are isolated nucleic acid molecules encoding the recombinant HA polypeptides disclosed herein. In some embodiments, the nucleic acid molecule is codon-optimized for expression in mammalian cells. The nucleic acid molecule is optionally further optimized for RNA stability. In some embodiments, the sequence of the nucleic acid molecule is at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 13. In particular examples, the sequence of the nucleic acid molecule comprises or consists of SEQ ID NO: 13.
- Vectors comprising the nucleic acid molecules encoding recombinant HA polypeptides are also provided by the present disclosure. The vector can be any suitable vector for expression of the HA polypeptide, such as a mammalian expression vector. In particular examples, the vector is the pTR600 expression vector (U.S. Patent Application Publication No. 2002/0106798, herein incorporated by reference; Ross et al., Nat Immunol. 1(2):102-103, 2000; Green et al., Vaccine 20:242-248, 2001).
- In some examples, the vector includes a promoter operably linked to the nucleic acid sequence encoding the HA polypeptide. In particular examples, the promoter is a CMV promoter.
- Also provided are isolated cells comprising the disclosed vectors. In some cases, the cell is any suitable cell type for production and expression of VLPs, such as a mammalian cell.
- Further provided are influenza VLPs comprising an optimized HA polypeptide disclosed herein. The influenza VLPs can further include any additional influenza proteins necessary to form the virus particle. In some embodiments, the influenza VLPs further include influenza neuraminidase (NA) protein, influenza matrix (M1) protein, or both.
- Also provided are influenza VLPs comprising an influenza HA polypeptide disclosed herein, produced by transfecting a host cell with a vector encoding the HA polypeptide, a vector encoding an influenza NA protein and a vector encoding an influenza M1 protein under conditions sufficient to allow for expression of the HA, M1 and NA proteins.
- Fusion proteins comprising an optimized influenza HA polypeptide are further provided by the present disclosure.
- Also provided herein are compositions comprising an optimized influenza HA protein as disclosed herein, or a fusion protein or VLP comprising the optimized influenza HA protein. In some embodiments, the compositions further comprise a pharmaceutically acceptable carrier and/or an adjuvant. For example, the adjuvant can be alum, Freund's complete adjuvant, a biological adjuvant or immunostimulatory oligonucleotides (such as CpG oligonucleotides).
- Further provided is a method of eliciting an immune response to influenza virus in a subject by administering an optimized influenza HA protein, fusion proteins containing an optimized influenza HA, VLPs containing an optimized influenza HA, or compositions thereof, as disclosed herein. In some embodiments, the influenza virus is an H1N1 influenza virus. In some embodiments, the HA protein, HA fusion protein or VLP can be administered using any suitable route of administration, such as, for example, intramuscular. In some embodiments, the HA protein, fusion protein or VLP is administered as a composition further comprising a pharmaceutically acceptable carrier and/or an adjuvant. For example, the adjuvant can be alum, Freund's complete adjuvant, a biological adjuvant or immunostimulatory oligonucleotides (such as CpG oligonucleotides).
- Also provided is a method of immunizing a subject against influenza virus by administering to the subject VLPs containing an optimized influenza HA protein disclosed herein, or administering a composition thereof. In some embodiments of the method, the composition further comprises a pharmaceutically acceptable carrier and/ or an adjuvant. For example, the adjuvant can be alum, Freund's complete adjuvant, a biological adjuvant or immunostimulatory oligonucleotides (such as CpG oligonucleotides). In some embodiments, the VLPs (or compositions thereof) are administered intramuscularly.
- In some embodiments of the methods of eliciting an immune response or immunizing a subject, the subject is administered about 1 to about 25 μg of the VLPs containing an optimized HA protein. In particular examples, the subject is administered about 5 to about 20 μg of the VLPs, or about 10 to about 15 μg of the VLPs. In one specific non-limiting example, the subject is administered about 15 μg of the VLPs. However, one of skill in the art is capable of determining a therapeutically effective amount (for example an amount that provides protection against H1N1 influenza virus infection) of VLPs to administer to a subject.
- Provided herein are 11 different optimized H1N1 HA polypeptide sequences. H1N1 HA amino acid sequences were downloaded from the NCBI Influenza Virus Resource database. H1N1 HA proteins from 1134 isolates from 1918-2011 were used for generating consensus sequences. Example 1 describes the methods that were used to generate each consensus sequence (see also
FIGS. 1-5 ). -
COBRA METHOD 1 (SEQ ID NO: 1) MKAKLLVLLCAFTATYADTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCRL KGIAPLQLGNCSIAGWILGNPECESLFSKESWSYIVETPNSENGTCYPGYFADYEELREQLSS VSSFERFEIFPKESSWPNHTVTKGVTASCSHNGKSSFYRNLLWLTEKNGSYPNLSKSYVNNK EKEVLVLWGVHHPSNIGDQRAIYHTENAYVSVVSSHYSRRFTPEIAKRPKVRDQEGRINYY WTLLEPGDTIIFEANGNLIAPWYAFALSRGFGSGIITSNASMDECDAKCQTPQGAINSSLPFQ NVHPVTIGECPKYVRSTKLRMVTGLRNIPSIQSRGLFGAIAGFIEGGWTGMIDGWYGYHHQ NEQGSGYAADQKSTQNAINGITNKVNSVIEKMNTQFTAVGKEFNKLERRMENLNKKVDDG FLDIWTYNAELLVLLENERTLDFHDSNVKNLYEKVKSQLKNNAKEIGNGCFEFYHKCNNEC MESVKNGTYDYPKYSEESKLNREKIDGVKLESMGVYQILAIYSTVASSLVLLVSLGAISFW MCSNGSLQCRICI COBRA METHOD 2 (SEQ ID NO: 2) MKAKLLVLLCALTATDADTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCRL KGIAPLQLGNCSIAGWILGNPECESLFSKKSWSYIAETPNSENGTCYPGYFADYEELREQLSS VSSFERFEIFPKESSWPNHTVTKGVTAACSHKGKSSFYRNLLWLTEKNGSYPNLSKSYVNN KEKEVLVLWGVHHPSNIGDQRAIYHTENAYVSVVSSHYNRRFTPEIAKRPKVRDQEGRINY YWTLLEPGDTIIFEANGNLIAPWYAFALSRGFGSGIITSNASMDECDAKCQTPQGAINSSLPF QNVHPVTIGECPKYVRSTKLRMVTGLRNIPSIQSRGLFGAIAGFIEGGWTGMIDGWYGYHH QNEQGSGYAADQKSTQNAINGITNKVNSVIEKMNTQFTAVGKEFNKLEKRMENLNKKVDD GFLDIWTYNAELLVLLENERTLDFHDSNVKNLYEKVKSQLKNNAKEIGNGCFEFYHKCNNE CMESVKNGTYDYPKYSEESKLNREKIDGVKLESMGVYQILAIYSTVASSLVLLVSLGAISFW MCSNGSLQCRICI COBRA METHOD 3 (SEQ ID NO: 3) MKAKLLVLLCAFTATYADTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCRL KGIAPLQLGNCSVAGWILGNPECESLISKESWSYIVETPNPENGTCYPGYFADYEELREQLSS VSSFERFEIFPKESSWPNHTVTKGVTASCSHNGKSSFYRNLLWLTEKNGLYPNLSKSYVNNK EKEVLVLWGVHHPSNIGDQRALYHTENAYVSVVSSHYSRRFTPEIAKRPKVRDQEGRINYY WTLLEPGDTIIFEANGNLIAPWYAFALSRGFGSGIITSNASMDECDAKCQTPQGAINSSLPFQ NVHPVTIGECPKYVRSTKLRMVTGLRNIPSIQSRGLFGAIAGFIEGGWTGMIDGWYGYHHQ NEQGSGYAADQKSTQNAINGITNKVNSVIEKMNTQFTAVGKEFNKLERRMENLNKKVDDG FLDIWTYNAELLVLLENERTLDFHDSNVKNLYEKVKSQLKNNAKEIGNGCFEFYHKCNNEC MESVKNGTYDYPKYSEESKLNREKIDGVKLESMGVYQILAIYSTVASSLVLLVSLGAISFW MCSNGSLQCRICI COBRA METHOD 4 (SEQ ID NO: 4) MKAKLLVLLCALTATDADTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCRL KGIAPLQLGKCSIAGWILGNPECESLLSKKSWSYIAETPNSENGTCYPGYFADYEELREQLSS VSSFERFEIFPKESSWPNHNVTKGVTASCSHKGKSSFYRNLLWLTEKNGSYPNLSKSYVNNK EKEVLVLWGVHHPSNIGDQRTIYRTENAYVSVVSSNYNRRFTPEIAKRPKVRDQEGRINYY WTLLEPGDTIIFEANGNLIAPWYAFALSRGFGSGIITSNASMDECDTKCQTPQGAINSSLPFQ NVHPVTIGECPKYVRSTKLRMVTGLRNIPSIQSRGLFGAIAGFIEGGWTGMIDGWYGYHHQ NEQGSGYAADQKSTQNAINGITNKVNSVIEKMNTQFTAVGKEFNKLEKRMENLNKKVDDG FLDIWTYNAELLVLLENERTLDFHDSNVKNLYEKVKSQLKNNAKEIGNGCFEFYHKCNNEC MESVKNGTYDYPKYSEESKLNREKIDGVKLESMGVYQILAIYSTVASSLVLLVSLGAISFW MCSNGSLQCRICI COBRA METHOD 5 (SEQ ID NO: 5) MKAKLLVLLCTFTATDADTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCRL KGIAPLQLGNCSIAGWILGNPECESLLSKKSWSYIVETPNSENGTCYPGDFIDYEELREQLSS VSSFERFEIFPKESSWPNHTVTKGVTAACSHAGKSSFYRNLLWLTEKNGSYPNLSKSYVNN KGKEVLVLWGVHHPSNIGDQQALYQTENAYVSVVSSHYNRKFTPEIAKRPKVRDQEGRIN YYWTLLEPGDTIIFEANGNLIAPWYAFALSRGFGSGIITSNASMHECDTKCQTPQGAINSSLP FQNIHPVTIGECPKYVRSTKLRMVTGLRNIPSIQSRGLFGAIAGFIEGGWTGMIDGWYGYHH QNEQGSGYAADQKSTQNAINGITNKVNSVIEKMNTQFTAVGKEFNKLEKRMENLNKKVDD GFLDIWTYNAELLVLLENERTLDFHDSNVKNLYEKVKSQLKNNAKEIGNGCFEFYHKCNNE CMESVKNGTYDYPKYSEESKLNREKIDGVKLESMGVYQILAIYSTVASSLVLLVSLGAISFW MCSNGSLQCRICI COBRA METHOD 6 (SEQ ID NO: 6) MKAKLLVLLCAFTATDADTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCKL KGIAPLQLGKCSIAGWILGNPECESLLSKKSWSYIVETPNSENGTCYPGDFADYEELREQLSS VSSFERFEIFPKESSWPNHTVTKGVTAACSHAGKSSFYRNLLWLTEKNGSYPNLSKSYVNN KEKEVLVLWGVHHPSNIGDQRALYHTENAYVSVVSSHYNRRFTPEIAKRPKVRDQEGRINY YWTLLEPGDTIIFEANGNLIAPWYAFALSRGFGSGIITSNASMDECDAKCQTPQGAINSSLPF QNVHPVTIGECPKYVRSTKLRMVTGLRNIPSIQSRGLFGAIAGFIEGGWTGMIDGWYGYHH QNEQGSGYAADQKSTQNAINGITNKVNSVIEKMNTQFTAVGKEFNKLERRMENLNKKVDD GFLDIWTYNAELLVLLENERTLDFHDSNVKNLYEKVKSQLKNNAKEIGNGCFEFYHKCNNE CMESVKNGTYDYPKYSEESKLNREKIDGVKLESMGVYQILAIYSTVASSLVLLVSLGAISFW MCSNGSLQCRICI COBRA METHOD 5 DEGLYCOSYLATED (SEQ ID NO: 7) MKAKLLVLLCTFTATDADTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCRL KGIAPLQLGNCAIAGWILGNPECESLLSKKSWSYIVETPNSENGTCYPGDFIDYEELREQLSS VSSFERFEIFPKESSWPNHAVTKGVTAACSHAGKSSFYRNLLWLTEKNGSYPNLAKSYVNN KGKEVLVLWGVHHPSNIGDQQALYQTENAYVSVVSSHYNRKFTPEIAKRPKVRDQEGRIN YYWTLLEPGDTIIFEANGNLIAPWYAFALSRGFGSGIITSNAAMHECDTKCQTPQGAINSSLP FQNIHPVTIGECPKYVRSTKLRMVTGLRNIPSIQSRGLFGAIAGFIEGGWTGMIDGWYGYHH QNEQGSGYAADQKSTQNAINGITNKVNSVIEKMNTQFTAVGKEFNKLEKRMENLNKKVDD GFLDIWTYNAELLVLLENERTLDFHDSNVKNLYEKVKSQLKNNAKEIGNGCFEFYHKCNNE CMESVKNGTYDYPKYSEESKLNREKIDGVKLESMGVYQILAIYSTVASSLVLLVSLGAISFW MCSNGSLQCRICI 1918-1957 COBRA (SEQ ID NO: 8) MKARLLVLLCALAATDADTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCR LKGIAPLQLGKCNIAGWILGNPECESLLSNRSWSYIVETPNSENGTCYPGDFIDYEELREQLS SVSSFERFEIFPKESSWPKHNTTKGVTAACSHAGKSSFYRNLLWLTEKNGSYPNLSNSYVNN KGKEVLVLWGVHHPSNIDDQQTLYQKENAYVSVVSSNYNRRFTPEIAERPKVRGQAGRMN YYWTLLEPGDTIIFEANGNLIAPWYAFALSRGFGSGIITSNASMHECDTKCQTPQGAINSSLP FQNIHPVTIGECPKYVRSTKLRMVTGLRNIPSIQSRGLFGAIAGFIEGGWTGMIDGWYGYHH QNEQGSGYAADQKSTQNAINGITNKVNSVIEKMNTQFTAVGKEFNNLEKRMENLNKKVDD GFLDIWTYNAELLVLLENERTLDFHDSNVKNLYEKVKSQLRNNAKEIGNGCFEFYHKCDNE CMESVKNGTYDYPKYSEESKLNREKIDGVKLESMGVYQILAIYSTVASSLVLLVSLGAISFW MCSNGSLQCRICI 1977-2005 COBRA (SEQ ID NO: 9) MKAKLLVLLCAFTATDADTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCRL KGIAPLQLGNCSIAGWILGNPECESLFSKKSWSYIAETPNSENGTCYPGYFADYEELREQLSS VSSFERFEIFPKESSWPNHTVTKGVTASCSHKGKSSFYRNLLWLTEKNGSYPNLSKSYVNNK EKEVLVLWGVHHPSNIGDQRAIYHTENAYVSVVSSHYNRRFTPEIAKRPKVRDQEGRINYY WTLLEPGDTIIFEANGNLIAPWYAFALSRGFGSGIITSNASMDECDAKCQTPQGAINSSLPFQ NVHPVTIGECPKYVRSTKLRMVTGLRNIPSIQSRGLFGAIAGFIEGGWTGMIDGWYGYHHQ NEQGSGYAADQKSTQNAINGITNKVNSVIEKMNTQFTAVGKEFNKLERRMENLNKKVDDG FLDIWTYNAELLVLLENERTLDFHDSNVKNLYEKVKSQLKNNAKEIGNGCFEFYHKCNNEC MESVKNGTYDYPKYSEESKLNREKIDGVKLESMGVYQILAIYSTVASSLVLLVSLGAISFW MCSNGSLQCRICI HUMAN SWINE COBRA (SEQ ID NO: 10) MKAILLVLLCTFAATNADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK LKGIAPLHLGKCNIAGWLLGNPECELLLTASSWSYIVETSNSDNGTCYPGDFIDYEELREQLS SVSSFERFEIFPKTSSWPNHETNKGVTAACPYAGASSFYRNLIWLVKKGNSYPKLSKSYVNN KGKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNRKFKPEIAARPKVRDQAGRMN YYWTLIEPGDTITFEATGNLVVPRYAFAMNRGSGSGIIISDAPVHDCNTKCQTPKGAINTSLP FQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTGMIDGWYGYHH QNEQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKRIENLNKKVDD GFLDIWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDDT CMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTVASSLVLLVSLGAISFWM CSNGSLQCRICI SWINE COBRA (SEQ ID NO: 11) MKAILLVLLCTFTAANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDRHNGKLCKL GGIAPLHLGKCNIAGWLLGNPECELLLTASSWSYIVETSNSDNGTCYPGDFINYEELREQLSS VSSFERFEIFPKASSWPNHETNRGVTAACPYAGANSFYRNLIWLVKKGNSYPKLSKSYVNN KGKEVLVLWGIHHPPTSTDQQSLYQNADAYVFVGSSKYNRKFKPEIAARPKVRGQAGRMN YYWTLLEPGDTITFEATGNLVVPRYAFAMNRGSGSGIIISDAPVHDCNTKCQTPKGAINTSLP FQNIHPVTIGECPKYVKSTKLRMATGLRNIPSIQSRGLFGAIAGFIEGGWTGMIDGWYGYHH QNEQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNHLEKRIENLNKKVDD GFLDVWTYNAELLVLLENERTLDFHDSNVKNLYEKVRSQLRNNAKEIGNGCFEFYHKCDD TCMESVKNGTYDYPKYSEESKLNREEIDGVKLESTRIYQILAIYSTVASSLVLLVSLGAISFW MCSNGSLQCRICI Consensus of SEQ ID NOs: 1-11 (SEQ ID NO: 12) MKAXLLVLLCXXXAXXADTXCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDXHNGKLC XLXGIAPLXLGXCXXAGWXLGNPECEXLXXXXSWSYIXETXNXXNGTCYPGXFXXYEELR EQLSSVSSFERFEIFPKXSSWPXHXXXXGVTAXCXXXGXXSFYRNLXWLXXKXXXYPXLX XSYVNNKXKEVLVLWGXHHPXXXXDQXXXYXXXXAYVXVXSSXYXRXFXPEIAXRPKV RXQXGRXNYYWTLXEPGDTIXFEAXGNLXXPXYAFAXXRGXGSGIIXSXAXXXXCXXKCQ TPXGAINXSLPFQNXHPVTIGECPKYVXSTKLRMXTGLRNIPSIQSRGLFGAIAGFIEGGWTG MIDGWYGYHHQNEQGSGYAADQKSTQNAIXGITNKVNSVIEKMNTQFTAVGKEFNXLEXR XENLNKKVDDGFLDXWTYNAELLVLLENERTLDFHDSNVKNLYEKVXSQLXNNAKEIGN GCFEFYHKCXXXCMESVKNGTYDYPKYSEESKLNREXIDGVKLESXXXYQILAIYSTVASS LVLLVSLGAISFWMCSNGSLQCRICI - In some embodiments disclosed herein, the HA polypeptides lack the N-terminal methionine residue. Thus, in some examples, provided are HA polypeptides comprising residues 2-566 of any one of SEQ ID NOs: 1-12.
- The COBRA amino acid sequences can be reverse translated and optimized for expression in mammalian cells, including codon usage and RNA optimization (GeneArt; Regensburg, Germany). The optimized nucleic acid sequences can be inserted into an appropriate expression vector, such as the pTR600 expression vector (U.S. Patent Application Publication No. 2002/0106798; Ross et al., Nat Immunol. 1(2):102-103, 2000; Green et al., Vaccine 20:242-248, 2001).
- The optimized nucleic acid sequence of the COBRA HA sequence of
Method 1 is (SEQ ID NO: 13): -
AAGCTTATGAAGGCCAAGCTGCTGGTGCTGCTGTGCGCCTTCACAGCCACCTACGCCGA CACCATCTGCATCGGCTACCACGCCAACAACAGCACCGACACCGTGGATACCGTGCTGG AAAAGAACGTGACCGTGACCCACAGCGTGAACCTGCTGGAAGATAGCCACAACGGCAA GCTGTGCCGGCTGAAGGGAATCGCCCCTCTGCAGCTGGGCAACTGCTCTATCGCCGGCT GGATTCTGGGCAACCCCGAGTGCGAGAGCCTGTTCAGCAAAGAGTCCTGGTCCTACATC GTGGAAACCCCCAACAGCGAGAACGGCACCTGTTACCCCGGCTACTTCGCCGACTACG AGGAACTGCGGGAACAGCTGAGCAGCGTGTCCAGCTTCGAGAGATTCGAGATTTTCCCC AAAGAGAGCAGCTGGCCCAACCACACCGTGACCAAAGGCGTGACCGCCTCCTGCTCCC ACAATGGCAAGAGCAGCTTCTACAGAAACCTGCTGTGGCTGACCGAGAAGAACGGCAG CTACCCCAACCTGAGCAAGAGCTACGTGAACAACAAAGAAAAAGAGGTGCTGGTGCTG TGGGGCGTGCACCACCCTAGCAACATCGGCGACCAGCGGGCCATCTACCACACCGAGA ATGCCTACGTGTCCGTGGTGTCCAGCCACTACAGCAGACGGTTCACCCCCGAGATCGCC AAGAGGCCCAAAGTGCGGGACCAGGAAGGCCGGATCAACTACTACTGGACACTGCTGG AACCCGGCGATACCATCATCTTCGAGGCCAACGGCAACCTGATCGCCCCTTGGTACGCC TTCGCCCTGAGCAGAGGCTTTGGCAGCGGCATCATCACCAGCAACGCCAGCATGGACG AGTGCGACGCCAAGTGCCAGACACCTCAGGGCGCCATCAATAGCAGCCTGCCCTTCCA GAACGTGCACCCCGTGACCATCGGCGAGTGCCCCAAATACGTGCGGAGCACCAAGCTG CGGATGGTCACCGGCCTGAGAAACATCCCCAGCATCCAGAGCAGGGGCCTGTTCGGAG CCATTGCCGGCTTTATCGAGGGCGGCTGGACCGGCATGATCGACGGGTGGTACGGCTAT CACCACCAGAACGAGCAGGGCAGCGGCTACGCCGCCGATCAGAAGTCTACCCAGAACG CCATCAACGGCATCACCAACAAAGTGAACAGCGTGATCGAGAAGATGAACACCCAGTT CACCGCCGTGGGCAAAGAGTTCAACAAGCTGGAACGGCGGATGGAAAACCTGAACAAG AAGGTGGACGACGGCTTCCTGGACATCTGGACCTACAACGCCGAACTGCTGGTGCTGCT GGAAAACGAGCGGACCCTGGACTTCCACGACAGCAACGTGAAGAACCTGTACGAGAAA GTGAAGTCCCAGCTGAAGAACAACGCCAAAGAGATCGGCAACGGCTGCTTCGAGTTCT ACCACAAGTGCAACAACGAGTGCATGGAAAGCGTGAAGAATGGCACCTACGACTACCC CAAGTACAGCGAGGAAAGCAAGCTGAACCGCGAGAAGATCGACGGCGTGAAGCTGGA ATCCATGGGCGTGTACCAGATCCTGGCCATCTATAGCACCGTGGCCAGCAGCCTGGTGC TGCTGGTGTCTCTGGGCGCCATCAGCTTTTGGATGTGCAGCAACGGCAGCCTGCAGTGC CGGATCTGTATCGGCAGCATCGGATCC - Influenza viruses are segmented negative-strand RNA viruses that belong to the Orthomyxoviridae family. There are three types of Influenza viruses, A, B and C. Influenza A viruses infect a wide variety of birds and mammals, including humans, horses, marine mammals, pigs, ferrets, and chickens. In animals, most influenza A viruses cause mild localized infections of the respiratory and intestinal tract. However, highly pathogenic influenza A strains, such as H5N1, cause systemic infections in poultry in which mortality may reach 100%. Animals infected with influenza A often act as a reservoir for the influenza viruses and certain subtypes have been shown to cross the species barrier to humans.
- Influenza A viruses can be classified into subtypes based on allelic variations in antigenic regions of two genes that encode surface glycoproteins, namely, hemagglutinin (HA) and neuraminidase (NA) which are required for viral attachment and cellular release. Currently, sixteen subtypes of HA (H1-H16) and nine NA (N1-N9) antigenic variants are known for influenza A virus. Previously, only three subtypes were known to circulate in humans (H1N1, H1N2, and H3N2). However, in recent years, the pathogenic H5N1 subtype of avian influenza A has been reported to cross the species barrier and infect humans as documented in Hong Kong in 1997 and 2003, leading to the death of several patients.
- In animals, most influenza A viruses cause mild localized infections of the respiratory and intestinal tract. However, highly pathogenic influenza A strains, such as H5N1, cause systemic infections in poultry in which mortality may reach 100%. In 2009, H1N1 influenza was the most common cause of human influenza. A new strain of swine-origin H1N1 emerged in 2009 and was declared pandemic by the World Health Organization. This strain was referred to as “swine flu.” H1N1 influenza A viruses were also responsible for the Spanish flu pandemic in 1918, the Fort Dix outbreak in 1976, and the Russian flu epidemic in 1977-1978.
- The influenza A virus genome encodes nine structural proteins and one nonstructural (NS 1) protein with regulatory functions. The influenza virus segmented genome contains eight negative-sense RNA (nsRNA) gene segments (PB2, PB1, PA, NP, M, NS, HA and NA) that encode at least ten polypeptides, including RNA-directed RNA polymerase proteins (PB2,
PB 1 and PA), nucleoprotein (NP), neuraminidase (NA), hemagglutinin (subunits HA1 and HA2), the matrix proteins (M1 and M2) and the non-structural proteins (NS 1 and NS2) (Krug et al., In “The Influenza Viruses,” R. M. Krug, ed., Plenum Press, N.Y., 1989, pp. 89 152). - Influenza virus' ability to cause widespread disease is due to its ability to evade the immune system by undergoing antigenic change, which is believed to occur when a host is infected simultaneously with both an animal influenza virus and a human influenza virus. During mutation and reassortment in the host, the virus may incorporate an HA and/or NA surface protein gene from another virus into its genome, thereby producing a new influenza subtype and evading the immune system.
- HA is a viral surface glycoprotein generally comprising approximately 560 amino acids and representing 25% of the total virus protein. It is responsible for adhesion of the viral particle to, and its penetration into, a host cell in the early stages of infection. Cleavage of the virus HA0 precursor into the HA1 and HA2 sub-fragments is a necessary step in order for the virus to infect a cell. Thus, cleavage is required in order to convert new virus particles in a host cell into virions capable of infecting new cells. Cleavage is known to occur during transport of the integral HA0 membrane protein from the endoplasmic reticulum of the infected cell to the plasma membrane. In the course of transport, hemagglutinin undergoes a series of co- and post-translational modifications including proteolytic cleavage of the precursor HA into the amino-terminal fragment HAI and the carboxy terminal HA2. One of the primary difficulties in growing influenza strains in primary tissue culture or established cell lines arises from the requirement for proteolytic cleavage activation of the influenza hemagglutinin in the host cell.
- Although it is known that an uncleaved HA can mediate attachment of the virus to its neuraminic acid-containing receptors on a cell surface, it is not capable of the next step in the infectious cycle, which is fusion. It has been reported that exposure of the hydrophobic amino terminus of HA2 by cleavage is required so that it can be inserted into the target cell, thereby forming a bridge between virus and target cell membrane. This process is followed by fusion of the two membranes and entry of the virus into the target cell.
- Proteolytic activation of HA involves cleavage at an arginine residue by a trypsin-like endoprotease, which is often an intracellular enzyme that is calcium dependent and has a neutral pH optimum. Since the activating proteases are cellular enzymes, the infected cell type determines whether the HA is cleaved. The HA of the mammalian influenza viruses and the nonpathogenic avian influenza viruses are susceptible to proteolytic cleavage only in a restricted number of cell types. On the other hand, HA of pathogenic avian viruses among the H5 and H7 subtypes are cleaved by proteases present in a broad range of different host cells. Thus, there are differences in host range resulting from differences in hemagglutinin cleavability which are correlated with the pathogenic properties of the virus.
- Neuraminidase (NA) is a second membrane glycoprotein of the influenza viruses. The presence of viral NA has been shown to be important for generating a multi-faceted protective immune response against an infecting virus. For most influenza A viruses, NA is 413 amino acid in length, and is encoded by a gene of 1413 nucleotides. Nine different NA subtypes have been identified in influenza viruses (N1, N2, N3, N4, N5, N6, N7, N8 and N9), all of which have been found among wild birds. NA is involved in the destruction of the cellular receptor for the viral HA by cleaving terminal neuraminic acid (also called sialic acid) residues from carbohydrate moieties on the surfaces of infected cells. NA also cleaves sialic acid residues from viral proteins, preventing aggregation of viruses. Using this mechanism, it is hypothesized that NA facilitates release of viral progeny by preventing newly formed viral particles from accumulating along the cell membrane, as well as by promoting transportation of the virus through the mucus present on the mucosal surface. NA is an important antigenic determinant that is subject to antigenic variation.
- In addition to the surface proteins HA and NA, influenza virus comprises six additional internal genes, which give rise to eight different proteins, including
polymerase genes PB 1, PB2 and PA, matrix proteins M1 and M2, nucleoprotein (NP), and non-structural proteins NS 1 and NS2 (Horimoto et al., Clin Microbiol Rev. 14(1):129-149, 2001). - In order to be packaged into progeny virions, viral RNA is transported from the nucleus as a ribonucleoprotein (RNP) complex composed of the three influenza virus polymerase proteins, the nucleoprotein (NP), and the viral RNA, in association with the influenza virus matrix 1 (M1) protein and nuclear export protein (Marsh et al., J Virol, 82:2295-2304, 2008). The M1 protein that lies within the envelope is thought to function in assembly and budding. A limited number of M2 proteins are integrated into the virions (Zebedee, J. Virol. 62:2762-2772, 1988). They form tetramers having H+ ion channel activity, and when activated by the low pH in endosomes, acidify the inside of the virion, facilitating its uncoating (Pinto et al., Cell 69:517-528, 1992). Amantadine is an anti-influenza drug that prevents viral infection by interfering with M2 ion channel activity, thus inhibiting virus uncoating.
-
NS 1, a nonstructural protein, has multiple functions, including regulation of splicing and nuclear export of cellular mRNAs as well as stimulation of translation. The major function ofNS 1 seems to be to counteract the interferon activity of the host, since anNS 1 knockout virus was viable although it grew less efficiently than the parent virus in interferon-nondefective cells (Garcia-Sastre, Virology 252:324-330, 1998). - NS2 has been detected in virus particles (Richardson et al., Arch. Virol. 116:69-80, 1991; Yasuda et al., Virology 196:249-255, 1993). The average number of NS2 proteins in a virus particle was estimated to be 130-200 molecules. An in vitro binding assay shows direct protein-protein contact between M1 and NS2. NS2-M1 complexes have also been detected by immunoprecipitation in virus-infected cell lysates. The NS2 protein is thought to play a role in the export of RNP from the nucleus through interaction with M1 protein (Ward et al., Arch. Virol. 140:2067-2073, 1995).
- Influenza VLPs comprising an optimized HA (such as the HA having the amino acid sequence set forth as any one of SEQ ID NOs: 1-11) are provided herein. The influenza VLPs are generally made up of the HA, NA and M1 proteins. The production of influenza VLPs has been described in the art and is within the abilities of one of ordinary skill in the art. For example, influenza VLPs can be produced by transfection of host cells with plasmids encoding the HA, NA and M1 proteins. After incubation of the transfected cells for an appropriate time to allow for protein expression (such as for approximately 72 hours), VLPs can be isolated from cell culture supernatants. Example 2 below provides an exemplary protocol for purifying influenza VLPs from cell supernatants. In this example, VLPs are isolated by low speed centrifugation (to remove cell debris), vacuum filtration and ultracentrifugation through 20% glycerol.
- The influenza VLPs disclosed herein can be used as influenza vaccines to elicit a protective immune response against H1N1 influenza viruses.
- Influenza VLPs, or compositions thereof, can be administered to a subject by any of the routes normally used for introducing recombinant virus into a subject. Methods of administration include, but are not limited to, intradermal, intramuscular, intraperitoneal, parenteral, intravenous, subcutaneous, vaginal, rectal, intranasal, inhalation or oral. Parenteral administration, such as subcutaneous, intravenous or intramuscular administration, is generally achieved by injection. Injectables can be prepared in conventional forms, either as liquid solutions or suspensions, solid forms suitable for solution or suspension in liquid prior to injection, or as emulsions. Injection solutions and suspensions can be prepared from sterile powders, granules, and tablets of the kind previously described. Administration can be systemic or local.
- Influenza VLPs, or compositions thereof, are administered in any suitable manner, such as with pharmaceutically acceptable carriers. Pharmaceutically acceptable carriers are determined in part by the particular composition being administered, as well as by the particular method used to administer the composition. Accordingly, there is a wide variety of suitable formulations of pharmaceutical compositions of the present disclosure.
- Preparations for parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, and emulsions. Examples of non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate. Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media. Parenteral vehicles include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils. Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers (such as those based on Ringer's dextrose), and the like. Preservatives and other additives may also be present such as, for example, antimicrobials, anti-oxidants, chelating agents, and inert gases and the like.
- Some of the compositions may potentially be administered as a pharmaceutically acceptable acid- or base-addition salt, formed by reaction with inorganic acids such as hydrochloric acid, hydrobromic acid, perchloric acid, nitric acid, thiocyanic acid, sulfuric acid, and phosphoric acid, and organic acids such as formic acid, acetic acid, propionic acid, glycolic acid, lactic acid, pyruvic acid, oxalic acid, malonic acid, succinic acid, maleic acid, and fumaric acid, or by reaction with an inorganic base such as sodium hydroxide, ammonium hydroxide, potassium hydroxide, and organic bases such as mono-, di-, trialkyl and aryl amines and substituted ethanolamines.
- Administration can be accomplished by single or multiple doses. The dose administered to a subject in the context of the present disclosure should be sufficient to induce a beneficial therapeutic response in a subject over time, or to inhibit or prevent H1N1 influenza virus infection. The dose required will vary from subject to subject depending on the species, age, weight and general condition of the subject, the severity of the infection being treated, the particular composition being used and its mode of administration. An appropriate dose can be determined by one of ordinary skill in the art using only routine experimentation.
- Provided herein are pharmaceutical compositions which include a therapeutically effective amount of the influenza VLPs alone or in combination with a pharmaceutically acceptable carrier. Pharmaceutically acceptable carriers include, but are not limited to, saline, buffered saline, dextrose, water, glycerol, ethanol, and combinations thereof. The carrier and composition can be sterile, and the formulation suits the mode of administration. The composition can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. The composition can be a liquid solution, suspension, emulsion, tablet, pill, capsule, sustained release formulation, or powder. The composition can be formulated as a suppository, with traditional binders and carriers such as triglycerides. Oral formulations can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, and magnesium carbonate. Any of the common pharmaceutical carriers, such as sterile saline solution or sesame oil, can be used. The medium can also contain conventional pharmaceutical adjunct materials such as, for example, pharmaceutically acceptable salts to adjust the osmotic pressure, buffers, preservatives and the like. Other media that can be used with the compositions and methods provided herein are normal saline and sesame oil.
- The influenza VLPs described herein can be administered alone or in combination with other therapeutic agents to enhance antigenicity. For example, the influenza VLPs can be administered with an adjuvant, such as Freund incomplete adjuvant or Freund's complete adjuvant.
- Optionally, one or more cytokines, such as IL-2, IL-6, IL-12, RANTES, GM-CSF, TNF-α, or IFN-γ, one or more growth factors, such as GM-CSF or G-CSF; one or more molecules such as OX-40L or 41 BBL, or combinations of these molecules, can be used as biological adjuvants (see, for example, Salgaller et al., 1998, J. Surg. Oncol. 68(2):122-38; Lotze et al., 2000, Cancer J. Sci. Am. 6(Suppl 1):S61-6; Cao et al., 1998, Stem Cells 16(Suppl 1):251-60; Kuiper et al., 2000, Adv. Exp. Med. Biol. 465:381-90). These molecules can be administered systemically (or locally) to the host.
- A number of means for inducing cellular responses, both in vitro and in vivo, are known. Lipids have been identified as agents capable of assisting in priming CTL in vivo against various antigens. For example, as described in U.S. Pat. No. 5,662,907, palmitic acid residues can be attached to the alpha and epsilon amino groups of a lysine residue and then linked (for example, via one or more linking residues, such as glycine, glycine-glycine, serine, serine-serine, or the like) to an immunogenic peptide. The lipidated peptide can then be injected directly in a micellar form, incorporated in a liposome, or emulsified in an adjuvant. As another example, E. coli lipoproteins, such as tripalmitoyl-S-glycerylcysteinlyseryl-serine can be used to prime tumor specific CTL when covalently attached to an appropriate peptide (see, Deres et al., Nature 342:561, 1989). Further, as the induction of neutralizing antibodies can also be primed with the same molecule conjugated to a peptide which displays an appropriate epitope, two compositions can be combined to elicit both humoral and cell-mediated responses where that is deemed desirable.
- Although administration of VLPs containing an optimized HA protein is exemplified herein, one of skill in the art would understand that it is also possible to administer the optimized influenza HA protein itself (in the absence of a viral particle) or as a fusion protein to elicit an immune response in a subject.
- The following examples are provided to illustrate certain particular features and/or embodiments. These examples should not be construed to limit the disclosure to the particular features or embodiments described.
- Influenza A H1N1 HA amino acid sequences were downloaded from the NCBI Influenza Virus Resource database. H1N1 HA proteins from 1134 isolates from 1918-2011 were used for generating consensus sequences. Eleven different consensus sequences (SEQ ID NOs: 1-11) were generated using the following methods:
- Sequences (456) were organized by date of isolation and eight primary consensus sequences were generated using isolates from 1918-1934 (8), 1935-1947 (13), 1948-1957 (12), 1977-1983 (68), 1984-1986 (9), 1987-1991 (12), 1992-1999 (59) and 2000-2005 (263). Four secondary consensus sequences were generated by grouping the primary consensus sequences by date, as shown in
FIG. 1 . The final consensus sequence (the third layer consensus; SEQ ID NO: 1) was generated by alignment of the four secondary consensus sequences. - As with
method 1, sequences (456) were organized by date of isolation to generate eight primary consensus sequences. The final consensus sequence (SEQ ID NO: 2) was generated by aligning the eight primary consensus sequences, as illustrated inFIG. 2 . - The consensus sequence (SEQ ID NO: 3) was generated by alignment of 456 H1N1 virus isolates from 1918-2005.
- Sequences (456) were organized by date of isolation and ten primary consensus sequences were generated using isolates from 1918-1933 (6), 1934-1946 (15), 1947-1956 (12), 1957-1977 (8), 1978-1980 (17), 1981-1985 (49), 1986-1990 (14), 1991-1995 (27), 1996-1998 (27) and 1999-2005 (281), as shown in
FIG. 3 . The final consensus sequence (SEQ ID NO: 4) was generated by alignment of the ten primary consensus sequences. - Sequences (1134) were organized by date of isolation and 12 primary consensus sequences were generated using isolates from 1918 (1), 1976 (4), 2009-2011 (123), 1933-1934 (8), 1935-1947 (13), 1948-1957 (12), 1977-1983 (68), 1984-1986 (9), 1987-1991 (12), 1992-1999 (27), 2000-2005 (59) and 2006-2008 (798). Four secondary consensus sequences were generated by grouping the primary consensus sequences according to “swine” sequences or by date, as shown in
FIG. 4 . The final consensus sequence (the third layer consensus; SEQ ID NO: 5) was generated by alignment of the four secondary consensus sequences. - Sequences (1134) were organized by date of isolation and 13 primary consensus sequences were generated using isolates from 1918 (1), 1933-1934 (8), 1935-1947 (13), 1948-1957 (12), 1976 (4), 1977-1983 (68), 1984-1986 (9), 1987-1991 (12), 1992-1999 (27), 2000-2005 (59), 2006 (76), 2007-2008 (722) and 2009-2011 (123), as shown in
FIG. 5 . The final consensus sequence (SEQ ID NO: 6) was generated by alignment of the 13 primary consensus sequences. - 7.
COBRA Method 5 deglycosylated - This sequence (SEQ ID NO: 7) was generated by altering the
Method 5 consensus sequence (SEQ ID NO: 5) to remove predicted glycosylation sites. - This sequence (SEQ ID NO: 8) was generated by alignment of H1N1 isolates from 1918-1957.
- This sequence (SEQ ID NO: 9) was generated by alignment of H1N1 isolates from 1977-2005.
- This sequence (SEQ ID NO: 10) was generated by alignment of H1N1 human swine influenza isolates. This sequence was aligned using consensus sequences from 1918, 1976 and 2009-2011.
- This sequence (SEQ ID NO: 11) was generated by alignment of H1N1 swine influenza isolates. This sequence was aligned using swine sequences from 1930-2010.
- The COBRA amino acid sequence generated according to
Method 1 was reverse translated and optimized for expression in mammalian cells, including codon usage and RNA optimization (GeneArt; Regensburg, Germany). The optimized nucleic acid sequence is set forth herein as SEQ ID NO: 13. The remaining COBRA sequences will also be reverse translated and optimized for expression in mammalian cells. The optimized nucleic acid sequences will be inserted into the pTR600 expression vector (U.S. Patent Application Publication No. 2002/0106798; Ross et al., Nat Immunol. 1(2):102-103, 2000; Green et al., Vaccine 20:242-248, 2001). - The following methods can be used to produce and characterize influenza VLPs comprising an optimized HA. Exemplary methods for immunization of mice, ferrets and macaques are also described below (see also, Giles and Ross, Vaccine 29(16):3043-3054, 2011).
- 293T cells are transiently transfected with plasmids expressing M1, NA and an optimized HA, and incubated for 72 hours at 37° C. The M1, NA and HA coding sequences can be codon-optimized for expression in mammalian cells. Supernatants are collected and cell debris is removed by low speed centrifugation followed by vacuum filtration through a 0.22 μm sterile filter. VLPs are purified via ultracentrifugation (100,000×g through 20% glycerol, weight per volume) for 4 hours at 4° C. The pellets are subsequently resuspended in PBS pH 7.2 and stored in single use aliquots at −80° C. until use. Total protein concentration is determined by Micro BCA™ Protein Assay Reagent Kit (Pierce Biotechnology, Rockford, Ill., USA).
- Dose determination
- HA specific content can be determined by western blot and densitometry. Purified recombinant COBRA HA and purified VLPs are prepared in standard total protein amounts and are electrophoresed on a 10% SDS-PAGE gel and transferred to a PVDF membrane. The blot is probed with mouse polyclonal antisera from influenza infected mice and the HA-antibody complexes are detected using a goat anti-mouse IgG conjugated to horseradish peroxidase (HRP) (Southern Biotech; Birmingham, Ala., USA). HRP is detected by chemiluminescent substrate (Pierce Biotechnology; Rockford Ill., USA) and exposed to X-ray film (ThermoFisher; Pittsburgh, Pa., USA). Density of bands is determined using ImageJ software (NIH). Density of recombinant HA bands is used to calculate a standard curve and the density of the purified VLPs is interpolated using the results from the recombinant HA.
- Mouse studies
- BALB/c mice (Mus musculis, females, 6-8 weeks old) can be purchased from Harlan Sprague Dawley (Indianapolis, Ind., USA). Mice are housed in microisolator units and allowed free access to food and water and are cared for under USDA guidelines for laboratory animals. Mice are vaccinated with one of three doses of purified COBRA HA VLPs (1.5 μg, 0.3 μg or 0.06 μg), based upon HA content from a densitometry assay, via intramuscular injection at week 0 and then boosted with the same dose at
week 3. Vaccines at each dose are formulated with alum adjuvant (Imject Alum, Pierce Biotechnology; Rockford, Ill., USA), CpG oligonucleotides, or vehicle alone. Fourteen to twenty-one days after each vaccination, blood is collected from anesthetized mice via the retro-orbital plexus and transferred to a microfuge tube. Tubes are centrifuged and sera is removed and frozen at −80 ±5° C. Hemagglutination inhibition (HAI) serum antibody titer for each vaccine group is determined atweek 5 using representative reassortant viruses or COBRA HA VLPs. - Three weeks after final vaccination, mice are challenged intranasally with a highly pathogenic H1N1 virus in a volume of 50 μl. After infection, mice are monitored daily for weight loss, disease signs and death for 14 days after infection. Individual body weights, sickness scores (Toapanta and Ross, Respiratory Research 10(1):112, 2009) and death are recorded for each group on each day after inoculation.
- Fitch ferrets (Mustela putorius faro, female, 6-12-months of age), influenza naïve and de-scented, can be purchased from Marshall Farms (Sayre, Pa., USA). Ferrets are pair housed in stainless steel cages (Shor-line, Kansas City, Kans., USA) containing Sani-chips Laboratory Animal Bedding (P.J. Murphy Forest Products, Montville, N.J., USA). Ferrets are provided with Teklad Global Ferret Diet (Harlan Teklad, Madison, Wis., USA) and fresh water ad libitum. The COBRA HA VLPs are diluted in PBS, pH 7.2 to achieve final concentration. Ferrets are vaccinated with one of two doses of purified COBRA VLPs (15 μg, 3 μg), based upon HA content as determined by densitometry assay, via intramuscular injection in the quadriceps muscle in a volume of 0.25 ml at week 0 and then boosted with the same dose at
week 3. Vaccines are stored at −80° C. prior to use and formulated with alum adjuvant (Imject Alum; Pierce Biotechnology, Rockford, Ill., USA) immediately prior to use. Animals are monitored for adverse events including weight loss, temperature, decrease in activity, nasal discharge, sneezing and diarrhea weekly during the vaccination regimen. Prior to vaccination, animals are confirmed by HAI assay to be seronegative for circulating influenza A and influenza B viruses. Fourteen to twenty-one days after each vaccination, blood is collected from anesthetized ferrets via the anterior vena cava and transferred to a microfuge tube. Tubes are centrifuged and sera is removed and frozen at −80 ±5° C. HAI serum antibody titer for each vaccine group is determined atweek 5 using representative reassortant viruses or COBRA HA VLPs. - Three weeks after final vaccination, ferrets are challenged intranasally with a highly pathogenic H1N1 virus in a volume of 1 ml. After infection, ferrets are monitored daily for weight loss, disease signs and death for 14 days after infection. Individual body weights, sickness scores, and death are recorded for each group on each day after inoculation. Nasal washes are performed by instilling 3 ml of PBS into the nares of anesthetized ferrets each day for 7 days after inoculation. Washes are collected and stored at −80° C. until use.
- Cynomolgus macaques (Macaca fascicularis, male, 3-5 years old) can be purchased from Harlan Sprague Dawley (Indianapolis, IN, USA). Macaques are vaccinated with purified COBRA HA VLPs (15 μg), based upon HA content from a densitometry assay, via intramuscular injection at week 0 and then boosted with the same dose at
weeks week 5 using representative reassortant viruses or COBRA HA VLPs. - Three weeks after final vaccination, macaques are challenged by intranasal, intratracheal, and orbital inoculation with a highly pathogenic H1N1 virus in a volume of 1 ml. After infection, macaques are monitored daily for weight loss, disease signs and death for 5 days after infection. Individual body weights, sickness scores and death are recorded for each group on each day after inoculation.
- This example describes the finding that inoculation of mice with COBRA H1N1 influenza VLPs induces significant HAI serum antibody titers, and further shows that translation of COBRA H1N1 HA in vitro results in expression of the protein at the expected molecular weight.
- To evaluate whether influenza virus containing
COBRA Method 1 H1N1 HA is capable of eliciting an antibody response in infected animals, VLPs comprising theCOBRA Method 1 HA (SEQ ID NO: 1) were generated as described in Example 2. Mice were inoculated with the VLPs and serum was collected atweeks FIG. 6 , HAI titers were detected starting at 5 weeks post-infection and increased atweeks - As described in Example 2, the
COBRA HA Method 1 amino acid sequence was reverse translated and optimized for expression in mammalian cells. The optimized nucleic acid sequence (SEQ ID NO: 13) encoding COBRA HA was inserted into the pTR600 expression vector. To assess whether COBRA H1N1 HA is properly expressed in vitro, cells were transfected with the pTR600 expression vector encoding COBRA H1N1 HA. Cell culture lysates were analyzed by SDS-PAGE, followed by Western blot for detection of influenza HA. As shown inFIG. 7 , COBRA HA migrated to its expected molecular weight, confirming expression of the synthetic protein in vitro. - In view of the many possible embodiments to which the principles of the disclosed invention may be applied, it should be recognized that the illustrated embodiments are only preferred examples of the invention and should not be taken as limiting the scope of the invention. Rather, the scope of the invention is defined by the following claims. We therefore claim as our invention all that comes within the scope and spirit of these claims.
Claims (15)
1. An isolated nucleic acid molecule encoding a recombinant influenza hemagglutinin (HA) polypeptide, wherein the polypeptide comprises:
(i) an amino acid sequence at least 99% identical to residues 2-566 of SEQ ID NO: 1;
(ii) the amino acid sequence of residues 2-566 of SEQ ID NO: 2;
(iii) an amino acid sequence at least 99% identical to residues 2-566 of SEQ ID NO: 3;
(iv) an amino acid sequence at least 99% identical to residues 2-566 of SEQ ID NO: 4
(v) an amino acid sequence at least 98% identical to residues 2-566 of SEQ ID NO: 5
(vi) an amino acid sequence at least 99% identical to residues 2-566 of SEQ ID NO: 6
(vii) an amino acid sequence at least 97% identical to residues 2-566 of SEQ ID NO: 7;
(viii) an amino acid sequence at least 99% identical to residues 2-566 of SEQ ID NO: 8;
(ix) the amino acid sequence of residues 2-566 of SEQ ID NO: 9;
(x) an amino acid sequence at least 99% identical to residues 2-566 of SEQ ID NO: 10; or
(xi) an amino acid sequence at least 99% identical to residues 2-566 of SEQ ID NO: 11.
2. The isolated nucleic acid molecule of claim 1 , wherein the polypeptide comprises:
(i) an amino acid sequence at least 99% identical to SEQ ID NO: 1;
(ii) the amino acid sequence of SEQ ID NO: 2;
(iii) an amino acid sequence at least 99% identical to SEQ ID NO: 3;
(iv) an amino acid sequence at least 99% identical to SEQ ID NO: 4;
(v) an amino acid sequence at least 98% identical to SEQ ID NO: 5;
(vi) an amino acid sequence at least 99% identical to SEQ ID NO: 6;
(vi) an amino acid sequence at least 97% identical to SEQ ID NO: 7;
(vii) an amino acid sequence at least 99% identical to SEQ ID NO: 8;
(viii) the amino acid sequence of SEQ ID NO: 9;
(ix) an amino acid sequence at least 99% identical to SEQ ID NO: 10; or
(x) an amino acid sequence at least 99% identical to SEQ ID NO: 11.
3. The isolated nucleic acid molecule of claim 1 , wherein the polypeptide comprises the amino acid sequence of residues 2-566 of SEQ ID NO: 1, residues 2-566 of SEQ ID NO: 3, residues 2-566 of SEQ ID NO: 4, residues 2-566 of SEQ ID NO: 5, residues 2-566 of SEQ ID NO: 6, residues 2-566 of SEQ ID NO: 7, residues 2-566 of SEQ ID NO: 8, residues 2-566 of SEQ ID NO: 10 or residues 2-566 of SEQ ID NO: 11.
4. The isolated nucleic acid molecule of claim 1 , wherein the amino acid sequence of the polypeptide consists of residues 2-566 of SEQ ID NO: 1, residues 2-566 of SEQ ID NO: 2, residues 2-566 of SEQ ID NO: 3, residues 2-566 of SEQ ID NO: 4, residues 2-566 of SEQ ID NO: 5, residues 2-566 of SEQ ID NO: 6, residues 2-566 of SEQ ID NO: 7, residues 2-566 of SEQ ID NO: 8, residues 2-566 of SEQ ID NO: 9, residues 2-566 of SEQ ID NO: 10 or residues 2-566 of SEQ ID NO: 11.
5. The isolated nucleic acid molecule of claim 2 , wherein the polypeptide comprises the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 10 or SEQ ID NO: 11.
6. The isolated nucleic acid molecule of claim 2 , wherein the amino acid sequence of the polypeptide consists of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10 or SEQ ID NO: 11.
7. The isolated nucleic acid molecule of claim 1 , wherein the nucleic acid molecule is codon-optimized for expression in mammalian cells.
8. A vector comprising the nucleic acid molecule of claim 1 .
9. The vector of claim 8 , further comprising a promoter operably linked to the nucleic acid sequence encoding the influenza HA polypeptide.
10. An isolated cell comprising the vector of claim 8 .
11. An isolated nucleic acid molecule encoding a recombinant influenza hemagglutinin (HA) polypeptide, wherein the amino acid sequence of the polypeptide comprises:
(i) no more than 5 amino acid substitutions relative to SEQ ID NO: 1;
(ii) SEQ ID NO: 2;
(iii) no more than 6 amino acid substitutions relative to SEQ ID NO: 3;
(iv) no more than 8 amino acid substitutions relative to SEQ ID NO: 4;
(v) no more than 10 amino acid substitutions relative to SEQ ID NO: 5;
(vi) no more than 8 amino acid substitutions relative to SEQ ID NO: 6;
(vii) no more than 10 amino acid substitutions relative to SEQ ID NO: 7;
(viii) no more than 10 amino acid substitutions relative to SEQ ID NO: 8;
(ix) SEQ ID NO: 9;
(ix) no more than 8 amino acid substitutions relative to SEQ ID NO: 10; or
(x) no more than 5 amino acid substitutions relative to SEQ ID NO: 11.
12. The isolated nucleic acid molecule of claim 11 , wherein the nucleic acid molecule is codon-optimized for expression in mammalian cells.
13. A vector comprising the nucleic acid molecule of claim 11 .
14. The vector of claim 13 , further comprising a promoter operably linked to the nucleic acid sequence encoding the influenza HA polypeptide.
15. An isolated cell comprising the vector of claim 13 .
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US15/407,502 US10093703B2 (en) | 2011-06-20 | 2017-01-17 | Computationally optimized broadly reactive antigens for H1N1 influenza |
US16/119,501 US10562940B2 (en) | 2011-06-20 | 2018-08-31 | Computationally optimized broadly reactive antigens for H1N1 influenza |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201161498800P | 2011-06-20 | 2011-06-20 | |
PCT/US2012/043347 WO2012177760A1 (en) | 2011-06-20 | 2012-06-20 | Computationally optimized broadly reactive antigens for h1n1 influenza |
US201314126550A | 2013-12-16 | 2013-12-16 | |
US15/407,502 US10093703B2 (en) | 2011-06-20 | 2017-01-17 | Computationally optimized broadly reactive antigens for H1N1 influenza |
Related Parent Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2012/043347 Division WO2012177760A1 (en) | 2011-06-20 | 2012-06-20 | Computationally optimized broadly reactive antigens for h1n1 influenza |
US14/126,550 Division US9580475B2 (en) | 2011-06-20 | 2012-06-20 | Computationally optimized broadly reactive antigens for H1N1 influenza |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/119,501 Division US10562940B2 (en) | 2011-06-20 | 2018-08-31 | Computationally optimized broadly reactive antigens for H1N1 influenza |
Publications (2)
Publication Number | Publication Date |
---|---|
US20170121374A1 true US20170121374A1 (en) | 2017-05-04 |
US10093703B2 US10093703B2 (en) | 2018-10-09 |
Family
ID=47422918
Family Applications (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/126,550 Active 2032-11-28 US9580475B2 (en) | 2011-06-20 | 2012-06-20 | Computationally optimized broadly reactive antigens for H1N1 influenza |
US15/407,502 Active US10093703B2 (en) | 2011-06-20 | 2017-01-17 | Computationally optimized broadly reactive antigens for H1N1 influenza |
US16/119,501 Active US10562940B2 (en) | 2011-06-20 | 2018-08-31 | Computationally optimized broadly reactive antigens for H1N1 influenza |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/126,550 Active 2032-11-28 US9580475B2 (en) | 2011-06-20 | 2012-06-20 | Computationally optimized broadly reactive antigens for H1N1 influenza |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/119,501 Active US10562940B2 (en) | 2011-06-20 | 2018-08-31 | Computationally optimized broadly reactive antigens for H1N1 influenza |
Country Status (10)
Country | Link |
---|---|
US (3) | US9580475B2 (en) |
EP (2) | EP2721158B1 (en) |
JP (2) | JP6113155B2 (en) |
KR (1) | KR20140047069A (en) |
CN (2) | CN103732749B (en) |
AU (2) | AU2012273039B2 (en) |
BR (1) | BR112013032723A2 (en) |
CA (1) | CA2839995A1 (en) |
RU (1) | RU2612900C2 (en) |
WO (1) | WO2012177760A1 (en) |
Families Citing this family (32)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP3578205A1 (en) | 2010-08-06 | 2019-12-11 | ModernaTX, Inc. | A pharmaceutical formulation comprising engineered nucleic acids and medical use thereof |
WO2012036993A1 (en) * | 2010-09-14 | 2012-03-22 | University Of Pittsburgh-Of The Commonwealth System Of Higher Education | Computationally optimized broadly reactive antigens for influenza |
CA2813466A1 (en) | 2010-10-01 | 2012-04-05 | Moderna Therapeutics, Inc. | Modified nucleosides, nucleotides, and nucleic acids that disrupt major groove binding partner interactions |
CA2831613A1 (en) | 2011-03-31 | 2012-10-04 | Moderna Therapeutics, Inc. | Delivery and formulation of engineered nucleic acids |
CN103732749B (en) * | 2011-06-20 | 2017-03-29 | 高等教育联邦系统-匹兹堡大学 | The H1N1 influenza antigens of the width reactivity of calculation optimization |
US9464124B2 (en) | 2011-09-12 | 2016-10-11 | Moderna Therapeutics, Inc. | Engineered nucleic acids and methods of use thereof |
CN110511939A (en) | 2011-10-03 | 2019-11-29 | 现代泰克斯公司 | Nucleosides, nucleotide and nucleic acid of modification and application thereof |
EP2791160B1 (en) | 2011-12-16 | 2022-03-02 | ModernaTX, Inc. | Modified mrna compositions |
WO2013119683A1 (en) | 2012-02-07 | 2013-08-15 | University Of Pittsburgh - Of The Commonwealth System Of Higher Education | Computationally optimized broadly reactive antigens for h3n2, h2n2, and b influenza viruses |
AU2013221877B2 (en) | 2012-02-13 | 2017-11-09 | University Of Pittsburgh - Of The Commonwealth System Of Higher Education | Computationally optimized broadly reactive antigens for human and avian H5N1 influenza |
CA2868330A1 (en) | 2012-03-30 | 2013-10-03 | University Of Pittsburgh - Of The Commonwealth System Of Higher Education | Computationally optimized broadly reactive antigens for h5n1 and h1n1 influenza viruses |
US9283287B2 (en) | 2012-04-02 | 2016-03-15 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of nuclear proteins |
EP2833923A4 (en) | 2012-04-02 | 2016-02-24 | Moderna Therapeutics Inc | Modified polynucleotides for the production of proteins |
US9878056B2 (en) | 2012-04-02 | 2018-01-30 | Modernatx, Inc. | Modified polynucleotides for the production of cosmetic proteins and peptides |
US9572897B2 (en) | 2012-04-02 | 2017-02-21 | Modernatx, Inc. | Modified polynucleotides for the production of cytoplasmic and cytoskeletal proteins |
PT2922554T (en) | 2012-11-26 | 2022-06-28 | Modernatx Inc | Terminally modified rna |
MX2015005056A (en) | 2012-11-27 | 2015-07-23 | Univ Pittsburgh | Computationally optimized broadly reactive antigens for h1n1 influenza. |
US8980864B2 (en) | 2013-03-15 | 2015-03-17 | Moderna Therapeutics, Inc. | Compositions and methods of altering cholesterol levels |
CN105007938A (en) * | 2013-03-15 | 2015-10-28 | 宾夕法尼亚大学理事会 | Influenza nucleic acid molecules and vaccines made therefrom |
WO2015048744A2 (en) | 2013-09-30 | 2015-04-02 | Moderna Therapeutics, Inc. | Polynucleotides encoding immune modulating polypeptides |
SG11201602503TA (en) | 2013-10-03 | 2016-04-28 | Moderna Therapeutics Inc | Polynucleotides encoding low density lipoprotein receptor |
EP3981437A1 (en) | 2014-04-23 | 2022-04-13 | ModernaTX, Inc. | Nucleic acid vaccines |
CA2986096A1 (en) | 2014-05-30 | 2015-12-03 | Sanofi Pasteur Inc. | Expression and conformational analysis of engineered influenza hemagglutinin |
US10548965B2 (en) * | 2014-12-19 | 2020-02-04 | Oregon Health & Science University | Synergistic co-administration of computationally optimized broadly reactive antigens for human and avian H5N1 influenza |
US10927151B2 (en) * | 2015-06-09 | 2021-02-23 | Sanofi Pasteur Inc. | Methods of optimizing nucleotide sequences encoding engineered influenza proteins |
BR112018008078A2 (en) * | 2015-10-22 | 2018-11-13 | Modernatx Inc | broad spectrum influenza virus vaccine |
BR112018075078A2 (en) | 2016-06-03 | 2019-03-06 | Sanofi Pasteur Inc. | modification of manipulated influenza hemagglutinin polypeptides |
KR101906457B1 (en) * | 2016-10-28 | 2018-10-12 | 성신여자대학교 산학협력단 | Virus like particle vaccine for h5 influenza virus and the method for the same |
US11576961B2 (en) | 2017-03-15 | 2023-02-14 | Modernatx, Inc. | Broad spectrum influenza virus vaccine |
EP3774884B1 (en) * | 2018-03-28 | 2023-12-06 | Sanofi Pasteur Inc. | Methods of generating broadly protective vaccine compositions comprising hemagglutinin |
JP2021519600A (en) | 2018-04-03 | 2021-08-12 | サノフイSanofi | Antigenic influenza-ferritin polypeptide |
EP3773698A1 (en) | 2018-04-03 | 2021-02-17 | Sanofi | Ferritin proteins |
Family Cites Families (38)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5662907A (en) | 1992-08-07 | 1997-09-02 | Cytel Corporation | Induction of anti-tumor cytotoxic T lymphocytes in humans using synthetic peptide epitopes |
US6207646B1 (en) | 1994-07-15 | 2001-03-27 | University Of Iowa Research Foundation | Immunostimulatory nucleic acid molecules |
US6239116B1 (en) | 1994-07-15 | 2001-05-29 | University Of Iowa Research Foundation | Immunostimulatory nucleic acid molecules |
US6429199B1 (en) | 1994-07-15 | 2002-08-06 | University Of Iowa Research Foundation | Immunostimulatory nucleic acid molecules for activating dendritic cells |
EP0772619B2 (en) | 1994-07-15 | 2010-12-08 | The University of Iowa Research Foundation | Immunomodulatory oligonucleotides |
CN101353375A (en) * | 1995-05-26 | 2009-01-28 | Mg-Pmc有限公司 | Method for producing influenza hemagglutinin multivalent vaccine |
CA2281838A1 (en) | 1997-02-28 | 1998-09-03 | University Of Iowa Research Foundation | Use of nucleic acids containing unmethylated cpg dinucleotide in the treatment of lps-associated disorders |
US6406705B1 (en) | 1997-03-10 | 2002-06-18 | University Of Iowa Research Foundation | Use of nucleic acids containing unmethylated CpG dinucleotide as an adjuvant |
CA2301575C (en) | 1997-05-20 | 2003-12-23 | Ottawa Civic Hospital Loeb Research Institute | Vectors and methods for immunization or therapeutic protocols |
CA2323929C (en) | 1998-04-03 | 2004-03-09 | University Of Iowa Research Foundation | Methods and products for stimulating the immune system using immunotherapeutic oligonucleotides and cytokines |
EP2388015A1 (en) | 2000-03-02 | 2011-11-23 | Emory University | DNA expression vectors and methods of use |
MXPA02012254A (en) * | 2000-06-23 | 2003-04-25 | American Cyanamid Co | Assembly of wild-type and chimeric influenza virus-like particles (vlps). |
US20050181459A1 (en) | 2002-06-11 | 2005-08-18 | Matthew Baker | Method for mapping and eliminating T cell epitopes |
US8592197B2 (en) * | 2003-07-11 | 2013-11-26 | Novavax, Inc. | Functional influenza virus-like particles (VLPs) |
EP1851238A4 (en) | 2005-02-24 | 2008-12-31 | Univ Massachusetts | Influenza nucleic acids, polypeptides, and uses thereof |
CN101227920A (en) | 2005-07-19 | 2008-07-23 | 陶氏环球技术公司 | Recombinant flu vaccines |
EP1969510A2 (en) | 2005-12-19 | 2008-09-17 | Novartis Vaccines and Diagnostics S.r.l. | Methods of clustering gene and protein sequences |
EP2468296A3 (en) * | 2006-02-02 | 2013-12-04 | Globeimmune, Inc. | Yeast-based vaccine for inducing an immune response |
US20080045472A1 (en) | 2006-03-31 | 2008-02-21 | Council Of Scientific And Industrial Research Bharat Biotech | Targets for human micro rnas in avian influenza virus (h5n1) genome |
US8778353B2 (en) | 2006-05-01 | 2014-07-15 | Technovax, Inc. | Influenza virus-like particle (VLP) compositions |
US8980281B2 (en) | 2006-09-05 | 2015-03-17 | Academia Sinica | High-yield transgenic mammalian expression system for generating virus-like particles |
CA2663388C (en) | 2006-09-07 | 2017-01-17 | Crucell Holland B.V. | Human binding molecules capable of neutralizing influenza virus h5n1 and uses thereof |
CA2615372A1 (en) | 2007-07-13 | 2009-01-13 | Marc-Andre D'aoust | Influenza virus-like particles (vlps) comprising hemagglutinin |
WO2009016639A2 (en) * | 2007-08-02 | 2009-02-05 | Biondvax Pharmaceuticals Ltd. | Multimeric multiepitope influenza vaccines |
EP2185195A2 (en) | 2007-08-16 | 2010-05-19 | Tripep Ab | Immunogen platform |
WO2009073330A2 (en) * | 2007-11-12 | 2009-06-11 | The Trustees Of The University Of Pennsylvania | Novel vaccines against multiple subtypes of influenza virus |
EA034733B1 (en) * | 2008-01-21 | 2020-03-13 | Медикаго Инк. | Nucleic acid for increased expression of hemagglutinin of influenza virus in a plant and use thereof |
US7981428B2 (en) | 2008-01-23 | 2011-07-19 | Academia Sinica | Flu vaccines and methods of use thereof |
US20120034253A1 (en) | 2008-09-25 | 2012-02-09 | Fraunhofer Usa, Inc. | Influenza Vaccines, Antigens, Compositions, and Methods |
US20110177122A1 (en) * | 2008-09-26 | 2011-07-21 | The United States Of America, As Represented By The Secretary, Dept. Of Health & Human Services | Dna prime/activated vaccine boost immunization to influenza virus |
CA2757030C (en) | 2009-04-03 | 2019-01-15 | Merial Limited | Vectors comprising newcastle disease viruses and compositions thereof |
US8298820B2 (en) | 2010-01-26 | 2012-10-30 | The Trustees Of The University Of Pennsylvania | Influenza nucleic acid molecules and vaccines made therefrom |
WO2012036993A1 (en) | 2010-09-14 | 2012-03-22 | University Of Pittsburgh-Of The Commonwealth System Of Higher Education | Computationally optimized broadly reactive antigens for influenza |
CN103732749B (en) * | 2011-06-20 | 2017-03-29 | 高等教育联邦系统-匹兹堡大学 | The H1N1 influenza antigens of the width reactivity of calculation optimization |
WO2013119683A1 (en) | 2012-02-07 | 2013-08-15 | University Of Pittsburgh - Of The Commonwealth System Of Higher Education | Computationally optimized broadly reactive antigens for h3n2, h2n2, and b influenza viruses |
AU2013221877B2 (en) | 2012-02-13 | 2017-11-09 | University Of Pittsburgh - Of The Commonwealth System Of Higher Education | Computationally optimized broadly reactive antigens for human and avian H5N1 influenza |
CA2868330A1 (en) | 2012-03-30 | 2013-10-03 | University Of Pittsburgh - Of The Commonwealth System Of Higher Education | Computationally optimized broadly reactive antigens for h5n1 and h1n1 influenza viruses |
MX2015005056A (en) * | 2012-11-27 | 2015-07-23 | Univ Pittsburgh | Computationally optimized broadly reactive antigens for h1n1 influenza. |
-
2012
- 2012-06-20 CN CN201280039877.0A patent/CN103732749B/en not_active Expired - Fee Related
- 2012-06-20 US US14/126,550 patent/US9580475B2/en active Active
- 2012-06-20 KR KR1020147000840A patent/KR20140047069A/en not_active Application Discontinuation
- 2012-06-20 CA CA2839995A patent/CA2839995A1/en not_active Abandoned
- 2012-06-20 EP EP12802232.4A patent/EP2721158B1/en active Active
- 2012-06-20 WO PCT/US2012/043347 patent/WO2012177760A1/en active Application Filing
- 2012-06-20 EP EP17161197.3A patent/EP3199545B1/en active Active
- 2012-06-20 CN CN201710128479.0A patent/CN106995488A/en active Pending
- 2012-06-20 JP JP2014517123A patent/JP6113155B2/en not_active Expired - Fee Related
- 2012-06-20 AU AU2012273039A patent/AU2012273039B2/en not_active Ceased
- 2012-06-20 BR BR112013032723A patent/BR112013032723A2/en active Search and Examination
- 2012-06-20 RU RU2014101401A patent/RU2612900C2/en not_active IP Right Cessation
-
2016
- 2016-05-02 JP JP2016092342A patent/JP2016183168A/en active Pending
-
2017
- 2017-01-17 US US15/407,502 patent/US10093703B2/en active Active
- 2017-02-28 AU AU2017201381A patent/AU2017201381A1/en not_active Abandoned
-
2018
- 2018-08-31 US US16/119,501 patent/US10562940B2/en active Active
Also Published As
Publication number | Publication date |
---|---|
AU2012273039B2 (en) | 2016-12-01 |
US9580475B2 (en) | 2017-02-28 |
RU2014101401A (en) | 2015-07-27 |
JP2016183168A (en) | 2016-10-20 |
CN103732749A (en) | 2014-04-16 |
US20180371025A1 (en) | 2018-12-27 |
EP3199545A3 (en) | 2017-09-20 |
JP2014519849A (en) | 2014-08-21 |
EP3199545B1 (en) | 2019-10-30 |
AU2012273039A1 (en) | 2014-01-16 |
AU2017201381A1 (en) | 2017-03-23 |
EP3199545A2 (en) | 2017-08-02 |
US20140127248A1 (en) | 2014-05-08 |
CN106995488A (en) | 2017-08-01 |
JP6113155B2 (en) | 2017-04-12 |
EP2721158B1 (en) | 2017-05-03 |
WO2012177760A1 (en) | 2012-12-27 |
RU2612900C2 (en) | 2017-03-13 |
US10093703B2 (en) | 2018-10-09 |
US10562940B2 (en) | 2020-02-18 |
BR112013032723A2 (en) | 2017-01-31 |
EP2721158A4 (en) | 2015-06-10 |
CN103732749B (en) | 2017-03-29 |
EP2721158A1 (en) | 2014-04-23 |
CA2839995A1 (en) | 2012-12-27 |
KR20140047069A (en) | 2014-04-21 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US10562940B2 (en) | Computationally optimized broadly reactive antigens for H1N1 influenza | |
US10865228B2 (en) | Computationally optimized broadly reactive antigens for human and avian H5N1 influenza | |
US9234008B2 (en) | Computationally optimized broadly reactive antigens for H3N2, H2N2, and B influenza viruses | |
US10017544B2 (en) | Computationally optimized broadly reactive antigens for H1N1 influenza |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: UNIVERSITY OF PITTSBURGH - OF THE COMMONWEALTH SYS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:ROSS, TED M.;CREVAR, COREY J.;REEL/FRAME:041219/0336 Effective date: 20120717 |
|
STCF | Information on status: patent grant |
Free format text: PATENTED CASE |
|
MAFP | Maintenance fee payment |
Free format text: PAYMENT OF MAINTENANCE FEE, 4TH YEAR, LARGE ENTITY (ORIGINAL EVENT CODE: M1551); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY Year of fee payment: 4 |