US20160122437A1 - Antibodies to matrix metalloproteinase 9 - Google Patents

Antibodies to matrix metalloproteinase 9 Download PDF

Info

Publication number
US20160122437A1
US20160122437A1 US14/992,678 US201614992678A US2016122437A1 US 20160122437 A1 US20160122437 A1 US 20160122437A1 US 201614992678 A US201614992678 A US 201614992678A US 2016122437 A1 US2016122437 A1 US 2016122437A1
Authority
US
United States
Prior art keywords
mmp9
antibody
antibodies
binding
human
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US14/992,678
Inventor
Scott Alan McCauley
Maria Vaysberg
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Gilead Biologics Inc
Original Assignee
Gilead Biologics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Gilead Biologics Inc filed Critical Gilead Biologics Inc
Priority to US14/992,678 priority Critical patent/US20160122437A1/en
Assigned to GILEAD BIOLOGICS, INC. reassignment GILEAD BIOLOGICS, INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: MCCAULEY, SCOTT, VAYSBERG, MARIA
Publication of US20160122437A1 publication Critical patent/US20160122437A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/40Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/04Antineoplastic agents specific for metastasis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y10TECHNICAL SUBJECTS COVERED BY FORMER USPC
    • Y10STECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y10S435/00Chemistry: molecular biology and microbiology
    • Y10S435/975Kit

Definitions

  • This disclosure is in the field of extracellular enzymes, extracellular matrix enzymes, proteases and immunology.
  • MMPs Matrix metalloproteinases
  • These enzymes contain a conserved catalytic domain in which a zinc atom is coordinated by three histidine residues.
  • Currently, over 20 members of this family are known, organized into a number of groups including collagenases, gelatinases, stromelysins, matrilysins, enamelysins and membrane MMPs.
  • MMP2 and MMP9 belong to the gelatinase group of matrix metalloproteinases. Besides containing signal peptide, propeptide, catalytic, zinc-binding and heamopexin-like domains common to most MMPs, the gelatinases also contain a plurality of fibronectin-like domains and an O-glycosylated domain.
  • MMPs Abnormal activity of certain MMPs has been shown to play a role in tumor growth, metastasis, inflammation and vascular disease. See, for example, Hu et al. (2007) Nature Reviews: Drug Discovery 6:480-498. Because of this, it can be desirable to inhibit the activity of one or more MMPs in certain therapeutic settings. However, the activity of certain other MMPs is often required for normal function. Since most MMP inhibitors are targeted to the conserved catalytic domain and, as a result, inhibit a number of different MMPS, their therapeutic use has caused side effects due to the inhibition of essential, non-pathogenically-related MMPs.
  • the present disclosure provides compositions and methods of use involving binding proteins, e.g., antibodies and antigen-binding fragments thereof, that bind to the matrix metalloproteinase-9 (MMP9) protein (MMP9 is also known as gelatinase-B), wherein the binding proteins comprise an immunoglobulin (Ig) heavy chain (or functional fragment thereof) and an Ig light chain (or functional fragment thereof).
  • MMP9 matrix metalloproteinase-9
  • the disclosure further provides MMP9 binding proteins that bind specifically to MMP9 and not to other, related matrix metalloproteinases.
  • Such MMP9 binding proteins find use in applications in which it is necessary or desirable to obtain specific modulation (e.g., inhibition) of MMP9, e.g., without directly affecting the activity of other matrix metalloproteinases.
  • an anti-MMP9 antibody is a specific inhibitor of the activity of MMP9.
  • the MMP9 binding proteins disclosed herein will be useful for inhibition of MMP9 while allowing normal function of other, related matrix metalloproteinases.
  • the present disclosure provides, inter alia:
  • a MMP9 binding protein comprising an immunoglobulin heavy chain or functional fragment thereof, and an immunoglobulin light chain or functional fragment thereof, wherein the protein does not bind to a matrix metalloproteinase other than MMP9.
  • a vector comprising one or more polynucleotides having a nucleotide sequence selected from the group consisting of SEQ ID NOs: 19-26.
  • a cell comprising the vector of embodiment 9.
  • a pharmaceutical composition comprising the protein of embodiment 1.
  • a pharmaceutical composition comprising the vector of embodiment 9.
  • a pharmaceutical composition comprising the cell of embodiment 10.
  • FIG. 1 shows the amino acid sequence of the heavy chain variable region of a mouse monoclonal anti-MMP9 antibody (AB0041), along with the amino acid sequences of humanized variants of heavy chain (VH1-VH4), aligned to show differences in framework amino acid sequence resulting from humanization. CDRs are shown in italics, and amino acids that are different in the humanized variants, compared to the parent mouse monoclonal, are underlined.
  • FIG. 2 shows the amino acid sequence of the light chain variable region of a mouse monoclonal anti-MMP9 antibody (AB0041), along with the amino acid sequences of humanized variants of this light chain (VH1-VH4), aligned to show differences in framework amino acid sequence resulting from humanization. CDRs are shown in italics, and amino acids that are different in the humanized variants, compared to the parent mouse monoclonal, are underlined.
  • FIG. 3 shows a schematic diagram of the MMP9 protein.
  • the present disclosure provides binding proteins, e.g., antibodies and antigen-binding fragments thereof, that bind to the matrix metalloproteinase-9 (MMP9) protein (MMP9 is also known as gelatinase-B),
  • MMP9 matrix metalloproteinase-9
  • the binding proteins of the present disclosure generally comprise an immunoglobulin (Ig) heavy chain (or functional fragment thereof) and an Ig light chain (or functional fragment thereof).
  • the disclosure further provides MMP9 binding proteins that bind specifically to MMP9 and not to other matrix metalloproteinases such as MMP1, MMP2, MMP3, MMP7, MMP9, MMP10, MMP12, MMP13.
  • MMP9 binding proteins that specifically bind MMP9 find use in applications in which it is necessary or desirable to obtain specific modulation (e.g., inhibition) of MMP9, e.g., without directly affecting the activity of other matrix metalloproteinases.
  • an anti-MMP9 antibody is an inhibitor of the activity of MMP9, and can be a specific inhibitor of MMP9.
  • the MMP9 binding proteins disclosed herein will be useful for inhibition of MMP9 while allowing normal function of other, related matrix metalloproteinases.
  • “An inhibitor of MMP” or “inhibitor of MMP9 activity” can be an antibody or an antigen binding fragment thereof that directly or indirectly inhibits activity of MMP9, including but not limited to enzymatic processing, inhibiting action of MMP9 on it substrate (e.g., by inhibiting substrate binding, substrate cleavage, and the like), and the like.
  • the present disclosure also provides MMP9 binding proteins that specifically bind to non-mouse MMP9, such as human MMP9, Cynomolgus monkey MMP9, and rat MMP9.
  • the present disclosure also provides MMP9 binding proteins (e.g., anti-MMP9 antibodies and functional fragments thereof) that act as non-competitive inhibitors.
  • a “non-competitive inhibitor” refers to an inhibitor binds at site away from substrate binding site of an enzyme, and thus can bind the enzyme and effect inhibitory activity regardless of whether or not the enzyme is bound to its substrate, Such non-competitive inhibitors can, for example, provide for a level of inhibition that can be substantially independent of substrate concentration.
  • MMP9 binding proteins e.g., antibodies and functional fragments thereof
  • MMP9 binding proteins include those that bind MMP9, particularly human MMP9, and having a heavy chain polypeptide (or functional fragment thereof) that has at least about 80%, 85%, 90%, 95% or more amino acid sequence identity to a heavy chain polypeptide disclosed herein.
  • MMP9 binding proteins e.g., antibodies and functional fragments thereof
  • MMP9 binding proteins include those that bind MMP9, particularly human MMP9, and having a light polypeptide (or functional fragment thereof) that has at least about 80%, 85%, 90%, 95% or more amino acid sequence identity to a heavy chain polypeptide disclosed herein.
  • MMP9 binding proteins e.g., antibodies and functional fragments thereof
  • MMP9 binding proteins include those that bind MMP9, particularly human MMP9, and have a heavy chain polypeptide (or functional fragment thereof) having the complementarity determining regions (“CDRs”) of heavy chain polypeptide and the CDRs of a light chain polypeptide (or functional fragment thereof) as disclosed herein.
  • CDRs complementarity determining regions
  • “Homology” or “identity” or “similarity” as used herein in the context of nucleic acids and polypeptides refers to the relationship between two polypeptides or two nucleic acid molecules based on an alignment of the amino acid sequences or nucleic acid sequences, respectively. Homology and identity can each be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When an equivalent position in the compared sequences is occupied by the same base or amino acid, then the molecules are identical at that position; when the equivalent site occupied by the same or a similar amino acid residue (e.g., similar in steric and/or electronic nature), then the molecules can be referred to as homologous (similar) at that position.
  • homologous similar
  • Expression as a percentage of homology/similarity or identity refers to a function of the number of identical or similar amino acids at positions shared by the compared sequences. In comparing two sequences, the absence of residues (amino acids or nucleic acids) or presence of extra residues also decreases the identity and homology/similarity.
  • identity means the percentage of identical nucleotide or amino acid residues at corresponding positions in two or more sequences when the sequences are aligned to maximize sequence matching, i.e., taking into account gaps and insertions. Sequences are generally aligned for maximum correspondence over a designated region, e.g., a region at least about 20, 25, 30, 35, 40, 45, 50, 55, 60, 65 or more amino acids or nucleotides in length, and can be up to the full-length of the reference amino acid or nucleotide. For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared.
  • test and reference sequences are input into a computer program, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated.
  • sequence comparison algorithm calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
  • BLAST and BLAST 2.0 algorithms are described in Altschul et al. (1990) J. Mol. Biol. 215: 403-410 and Altschul et al. (1977) Nucleic Acids Res. 25: 3389-3402, respectively.
  • Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (www.ncbi.nlm.nih.gov).
  • Further exemplary algorithms include ClustalW (Higgins D., et al. (1994) Nucleic Acids Res 22: 4673-4680), available at www.ebi.ac.uk/Tools/clustalw/index.html.
  • Residue positions which are not identical can differ by conservative amino acid substitutions.
  • Conservative amino acid substitutions refer to the interchangeability of residues having similar side chains.
  • a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine
  • a group of amino acids having aliphatic-hydroxyl side chains is serine and threonine
  • a group of amino acids having amide-containing side chains is asparagine and glutamine
  • a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan
  • a group of amino acids having basic side chains is lysine, arginine, and histidine
  • a group of amino acids having sulfur-containing side chains is cysteine and methionine.
  • Sequence identity between two nucleic acids can also be described in terms of hybridization of two molecules to each other under stringent conditions.
  • the hybridization conditions are selected following standard methods in the art (see, for example, Sambrook, et al., Molecular Cloning: A Laboratory Manual, Second Edition, (1989) Cold Spring Harbor, N.Y.).
  • An example of stringent hybridization conditions is hybridization at 50° C. or higher and 0.1 ⁇ SSC (15 mM sodium chloride/1.5 mM sodium citrate).
  • Another example of stringent hybridization conditions is overnight incubation at 42° C.
  • Stringent hybridization conditions are hybridization conditions that are at least as stringent as the above representative conditions, where conditions are considered to be at least as stringent if they are at least about 80% as stringent, typically at least 90% as stringent as the above specific stringent conditions.
  • the present disclosure provides, for example, antibodies or antigen binding fragments thereof, comprising a heavy chain variable region polypeptide having at least 80%, 85%, 90%, 95%, or greater amino acid sequence identity to an amino acid sequence of a heavy chain variable region described herein (e.g., SEQ ID NOS:1 or 5-8), and a variable light chain polypeptide having at least 80%, 85%, 90%, 95%, or greater amino acid sequence identity to an amino acid sequence of a light chain polypeptide as set forth herein (e.g., SEQ ID NOS:2 or 9-12).
  • a heavy chain variable region polypeptide having at least 80%, 85%, 90%, 95%, or greater amino acid sequence identity to an amino acid sequence of a heavy chain variable region described herein (e.g., SEQ ID NOS:1 or 5-8)
  • a variable light chain polypeptide having at least 80%, 85%, 90%, 95%, or greater amino acid sequence identity to an amino acid sequence of a light chain polypeptide as set forth here
  • anti-MMP9 antibodies of the present disclosure are described in more detail below.
  • antibody means an isolated or recombinant polypeptide binding agent that comprises peptide sequences (e.g., variable region sequences) that specifically bind an antigenic epitope.
  • the term is used in its broadest sense and specifically covers monoclonal antibodies (including full-length monoclonal antibodies), polyclonal antibodies, human antibodies, humanized antibodies, chimeric antibodies, nanobodies, diabodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments including but not limited to Fv, scFv, Fab, Fab′ F(ab′) 2 and Fab 2 , so long as they exhibit the desired biological activity.
  • human antibody refers to antibodies containing sequences of human origin, except for possible non-human CDR regions, and does not imply that the full structure of an immunoglobulin molecule be present, only that the antibody has minimal immunogenic effect in a human (i.e., does not induce the production of antibodies to itself).
  • antibody fragment comprises a portion of a full-length antibody, for example, the antigen binding or variable region of a full-length antibody. Such antibody fragments may also be referred to herein as “functional fragments: or “antigen-binding fragments”. Examples of antibody fragments include Fab, Fab′, F(ab′) 2 , and Fv fragments; diabodies; linear antibodies (Zapata et al. (1995) Protein Eng. 8(10):1057-1062); single-chain antibody molecules; and multispecific antibodies formed from antibody fragments.
  • Papain digestion of antibodies produces two identical antigen-binding fragments, called “Fab” fragments, each with a single antigen-binding site, and a residual “Fc” fragment, a designation reflecting the ability to crystallize readily.
  • Pepsin treatment yields an F(ab′) 2 fragment that has two antigen combining sites and is still capable of cross-linking antigen.
  • Fv is the minimum antibody fragment which contains a complete antigen-recognition and-binding site. This region consists of a dimer of one heavy- and one light-chain variable domain in tight, non-covalent association. It is in this configuration that the three complementarity-determining regions (CDRs) of each variable domain interact to define an antigen-binding site on the surface of the V H -V L dimer. Collectively, the six CDRs confer antigen-binding specificity to the antibody. However, even a single variable domain (or an isolated V H or V L region comprising only three of the six CDRs specific for an antigen) has the ability to recognize and bind antigen, although generally at a lower affinity than does the entire F v fragment.
  • CDRs complementarity-determining regions
  • the “F ab ” fragment also contains, in addition to heavy and light chain variable regions, the constant domain of the light chain and the first constant domain (CH 1 ) of the heavy chain.
  • Fab fragments were originally observed following papain digestion of an antibody.
  • Fab′ fragments differ from Fab fragments in that F(ab′) fragments contain several additional residues at the carboxy terminus of the heavy chain CH 1 domain, including one or more cysteines from the antibody hinge region.
  • F(ab′) 2 fragments contain two Fab fragments joined, near the hinge region, by disulfide bonds, and were originally observed following pepsin digestion of an antibody.
  • Fab′-SH is the designation herein for Fab′ fragments in which the cysteine residue(s) of the constant domains bear a free thiol group. Other chemical couplings of antibody fragments are also known.
  • immunoglobulins The “light chains” of antibodies (immunoglobulins) from any vertebrate species can be assigned to one of two clearly distinct types, called kappa and lambda, based on the amino acid sequences of their constant domains. Depending on the amino acid sequence of the constant domain of their heavy chains, immunoglobulins can be assigned to five major classes: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2.
  • Single-chain Fv or “sFv” or “scFv” antibody fragments comprise the V H and V L domains of antibody, wherein these domains are present in a single polypeptide chain.
  • the Fv polypeptide further comprises a polypeptide linker between the V H and V L domains, which enables the sFv to form the desired structure for antigen binding.
  • diabodies refers to small antibody fragments with two antigen-binding sites, which fragments comprise a heavy-chain variable domain (V H ) connected to a light-chain variable domain (V L ) in the same polypeptide chain (V H -V L ).
  • V H heavy-chain variable domain
  • V L light-chain variable domain
  • Diabodies are additionally described, for example, in EP404,097; WO93/11161 and Hollinger et al. (1993) Proc. Natl. Acad. Sci. USA 90:6444-6448.
  • an “isolated” antibody is one that has been identified and separated and/or recovered from a component of its natural environment. Components of its natural environment may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes.
  • an isolated antibody is purified (1) to greater than 95% by weight of antibody as determined by the Lowry method, for example, more than 99% by weight, (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence, e.g., by use of a spinning cup sequenator, or (3) to homogeneity by gel electrophoresis (e.g., SDS-PAGE) under reducing or nonreducing conditions, with detection by Coomassie blue or silver stain.
  • isolated antibody includes an antibody in situ within recombinant cells, since at least one component of the antibody's natural environment will not be present.
  • isolated antibody is prepared by at least one purification step.
  • immunosorbent refers to antibodies or fragments thereof that are specific to a sequence of amino acid residues (“binding site” or “epitope”), yet if are cross-reactive to other peptides/proteins, are not toxic at the levels at which they are formulated for administration to human use.
  • Epitope refers to that portion of an antigen capable of forming a binding interaction with an antibody or antigen binding fragment thereof.
  • An epitope can be a linear peptide sequence (i.e., “continuous”) or can be composed of noncontiguous amino acid sequences (i.e., “conformational” or “discontinuous”).
  • preferentially binds means that the binding agent binds to the binding site with greater affinity than it binds unrelated amino acid sequences.
  • Anti-MMP9 antibodies can be described in terms of the CDRs of the heavy and light chains.
  • CDR or “complementarity determining region” is intended to mean the non-contiguous antigen combining sites found within the variable region of both heavy and light chain polypeptides. These particular regions have been described by Kabat et al., J. Biol. Chem. 252:6609-6616 (1977); Kabat et al., U.S. Dept. of Health and Human Services, “Sequences of proteins of immunological interest” (1991); by Chothia et al., J. Mol. Biol. 196:901-917 (1987); and MacCallum et al., J. Mol. Biol.
  • variable region when used in reference to an antibody variable region is intended to mean all amino acid residues outside the CDR regions within the variable region of an antibody.
  • a variable region framework is generally a discontinuous amino acid sequence between about 100-120 amino acids in length but is intended to reference only those amino acids outside of the CDRs.
  • framework region is intended to mean each domain of the framework that is separated by the CDRs.
  • an antibody is a humanized antibody or a human antibody.
  • Humanized antibodies include human immununoglobulins (recipient antibody) in which residues from a complementary-determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity and capacity.
  • CDR complementary-determining region
  • donor antibody non-human species
  • humanized forms of non-human (e.g., murine) antibodies are chimeric immunoglobulins which contain minimal sequence derived from non-human immunoglobulin. The non-human sequences are located primarily in the variable regions, particularly in the complementarity-determining regions (CDRs).
  • Fv framework residues of the human immunoglobulin are replaced by corresponding non-human residues.
  • Humanized antibodies can also comprise residues that are found neither in the recipient antibody nor in the imported CDR or framework sequences.
  • a humanized antibody comprises substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDRs correspond to those of a non-human immunoglobulin and all or substantially all of the framework regions are those of a human immunoglobulin consensus sequence.
  • humanized antibodies can also include immunoglobulin fragments, such as Fv, Fab, Fab′, F(ab′) 2 or other antigen-binding subsequences of antibodies.
  • the humanized antibody can also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • a humanized antibody has one or more amino acid residues introduced into it from a source that is non-human. These non-human amino acid residues are often referred to as “import” or “donor” residues, which are typically obtained from an “import” or “donor” variable domain.
  • humanization can be performed essentially according to the method of Winter and co-workers, by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody. See, for example, Jones et al., supra; Riechmann et al., supra and Verhoeyen et al. (1988) Science 239:1534-1536.
  • humanized antibodies include chimeric antibodies (U.S. Pat. No. 4,816,567), wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species.
  • humanized antibodies are human antibodies in which some CDR residues and optionally some framework region residues are substituted by residues from analogous sites in rodent antibodies (e.g., murine monoclonal antibodies).
  • Human antibodies can also be produced, for example, by using phage display libraries. Hoogenboom et al. (1991) J. Mol. Biol, 227:381; Marks et al. (1991) J. Mol. Biol. 222:581. Other methods for preparing human monoclonal antibodies are described by Cole et al. (1985) “Monoclonal Antibodies and Cancer Therapy,” Alan R. Liss, p. 77 and Boerner et al. (1991) J. Immunol. 147:86-95.
  • Antibodies can be affinity matured using known selection and/or mutagenesis methods as described above.
  • affinity matured antibodies have an affinity which is five times or more, ten times or more, twenty times or more, or thirty times or more than that of the starting antibody (generally murine, rabbit, chicken, humanized or human) from which the matured antibody is prepared.
  • An antibody can also be a bispecific antibody.
  • Bispecific antibodies are monoclonal, and may be human or humanized antibodies that have binding specificities for at least two different antigens.
  • the two different binding specificities can be directed to two different MMPs, or to two different epitopes on a single MMP (e.g., MMP9).
  • An antibody as disclosed herein can also be an immunoconjugate.
  • immunoconjugates comprise an antibody (e.g., to MMP9) conjugated to a second molecule, such as a reporter.
  • An immunoconjugate can also comprise an antibody conjugated to a cytotoxic agent such as a chemotherapeutic agent, a toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).
  • a cytotoxic agent such as a chemotherapeutic agent, a toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).
  • An antibody that “specifically binds to” or is “specific for” a particular polypeptide or an epitope on a particular polypeptide is one that binds to that particular polypeptide or epitope without substantially binding to any other polypeptide or polypeptide epitope.
  • an antibody of the present disclosure specifically binds to human MMP9 with a dissociation constant (K d ) equal to or lower than 100 nM, optionally lower than 10 nM, optionally lower than 1 nM, optionally lower than 0.5 nM, optionally lower than 0.1 nM, optionally lower than 0.01 nM, or optionally lower than 0.005 nM; in the form of monoclonal antibody, scFv, Fab, or other form of antibody measured at a temperature of about 4° C., 25° C., 37° C. or 42° C.
  • K d dissociation constant
  • an antibody of the present disclosure binds to one or more processing sites (e.g., sites of proteolytic cleavage) in MMP9, thereby effectively blocking processing of the proenzyme or preproenzyme to the catalytically active enzyme, and thus reducing the proteolytic activity of the MMP9.
  • processing sites e.g., sites of proteolytic cleavage
  • an antibody according to the present disclosure binds to MMP9 with an affinity at least 2 times, at least 5 times, at least 10 times, at least 25 times, at least 50 times, at least 100 times, at least 500 times, or at least 1000 times greater than its binding affinity for another MMP.
  • Binding affinity can be measured by any method known in the art and can be expressed as, for example, on-rate, off-rate, dissociation constant (K d ), equilibrium constant (K eq ) or any term in the art.
  • an antibody according to the present disclosure is a non-competitive inhibitor of the catalytic activity of MMP9. In certain embodiments, an antibody according to the present disclosure binds within the catalytic domain of MMP9. In additional embodiments, an antibody according to the present disclosure binds outside the catalytic domain of MMP9.
  • the present disclosure also contemplates antibodies or antigen binding fragments thereof, that compete with anti-MMP9 antibodies or antigen binding fragments thereof described herein for binding to MMP9.
  • the present disclosure contemplates anti-MMP9 antibodies, and functional fragments thereof, that compete for binding with, for example, an antibody having a heavy chain polypeptide of any of SEQ ID NOS;1 or 5-8, a light chain polypeptide of SEQ ID NOS:2 or 9-12, or combinations thereof.
  • the anti-MMP9 antibody, for functional fragment thereof competes for binding to human MMP9 with the antibody described herein as AB0041.
  • amino acid sequence of human MMP9 protein is as follows:
  • Protein domains are shown schematically in FIG. 3 and are indicated below:
  • MMP9 binding proteins that bind any portion of MMP9, e.g., human MMP9, with MMP9 binding proteins that preferentially bind MMP9 relative to other MMPs being of particular interest.
  • Anti-MMP9 antibodies and functional fragments thereof, can be generated accordingly to methods well known in the art. Examples of anti-MMP9 antibodies are provided below.
  • a mouse monoclonal antibody to human MMP9 was obtained as described in Example 1. This antibody contains a mouse IgG2b heavy chain and a mouse kappa light chain, and is denoted AB0041.
  • the signal sequence is underlined, and the sequence of the IgG2b constant region is presented italics.
  • amino acid sequence of theAB0041 light chain is as follows:
  • the signal sequence is underlined, and the sequence of the kappa constant region is presented in italics.
  • the following amino acid sequence comprises the framework regions and complementarity-determining regions (CDRs) of the variable region of the IgG2b heavy chain of AB0041 (with CDRs underlined):
  • the following amino acid sequence comprises the framework regions and complementarity-determining regions (CDRs) of the variable region of the kappa light chain of AB0041 (with CDRs underlined):
  • variable regions of the AB0041 heavy and light chains were separately modified, by altering framework region sequences in the heavy and light chain variable regions.
  • the effect of these sequence alterations was to deplete the antibody of human T-cell epitopes, thereby reducing or abolishing its immunogenicity in humans (Antitope, Babraham, UK).
  • VH1 (SEQ ID NO: 5) QVQLQESGPGLVKPSETLSLTCTVSGFSLLSYGVHWVRQPPGKG LEWLGVIWTGGTTNYNSALMSRLTISKDDSKSTVYLKMNSLKTE DTAIYYCARYYYGMDYWGQGTSVTVSS VH2 (SEQ ID NO: 6) QVQLQESGPGLVKPSETLSLTCTVSGFSLLSYGVHWVRQPPGKG LEWLGVIWTGGTTNYNSALMSRLTISKDDSKNTVYLKMNSLKTE DTAIYYCARYYYGMDYWGQGTLVTVSS VH3 (SEQ ID NO: 7) QVQLQESGPGLVKPSETLSLTCTVSGFSLLSYGVHWVRQPPGKG LEWLGVIWTGGTTNYNSALMSRFTISKDDSKNTVYLKMNSLKTE DTAIYYCARYYYGMDYWGQGTLVTVSS VH4 (SEQ ID NO: 8)
  • FIG. 1 shows an alignment of the amino acid sequences of the variable regions of the humanized heavy chains and indicates the differences in amino acid sequences in the framework regions among the four variants.
  • the amino acid sequences of their framework regions and CDRs are as follows:
  • FIG. 2 shows an alignment of the amino acid sequences of the variable regions of the humanized light chains and indicates the differences in amino acid sequences in the framework regions among the four variants.
  • the humanized heavy and light chains are combined in all possible pair-wise combinations to generate a number of functional humanized anti-MMP9 antibodies.
  • Additional heavy chain variable region amino acid sequences having 75% or more, 80% or more, 90% or more, 95% or more, or 99% or more homology to the heavy chain variable region sequences disclosed herein are also provided.
  • additional light chain variable region amino acid sequences having 75% or more, 80% or more, 90% or more, 95% or more, or 99% or more homology to the light chain variable region sequences disclosed herein are also provided.
  • Additional heavy chain variable region amino acid sequences having 75% or more, 80% or more, 90% or more, 95% or more, or 99% or more sequence identity to the heavy chain variable region sequences disclosed herein are also provided.
  • additional light chain variable region amino acid sequences having 75% or more, 80% or more, 90% or more, 95% or more, or 99% or more sequence identity to the light chain variable region sequences disclosed herein are also provided.
  • CDRs Complementarity-Determining Regions
  • the CDRs of the heavy chain of an anti-MMP9 antibody as disclosed herein have the following amino acid sequences:
  • CDR1 (SEQ ID NO: 13) GFSLLSYGVH
  • CDR2 (SEQ ID NO: 14) VIWTGGTTNYNSALMS
  • CDR3 (SEQ ID NO: 15) YYYGMDY
  • the CDRs of the light chain of an anti-MMP9 antibody as disclosed herein have the following amino acid sequences:
  • the present disclosure provides nucleic acids encoding anti-MMP9 antibodies and functional fragments thereof. Accordingly, the present disclosure provides an isolated polynucleotide (nucleic acid) encoding an antibody or antigen-binding fragment as described herein, vectors containing such polynucleotides, and host cells and expression systems for transcribing and translating such polynucleotides into polypeptides.
  • the present disclosure also contemplates constructs in the form of plasmids, vectors, transcription or expression cassettes which comprise at least one polynucleotide as above.
  • the present disclosure also provides a recombinant host cell which comprises one or more constructs as above, as well as methods of production of the antibody or antigen-binding fragments thereof described herein which method comprises expression of nucleic acid encoding a heavy chain polypeptide and a light chain polypeptide (in the same or different host cells, and from the same or different constructs) in a recombination host cell. Expression can be achieved by culturing under appropriate conditions recombinant host cells containing the nucleic acid. Following production by expression, an antibody or antigen-binding fragment can be isolated and/or purified using any suitable technique, then used as appropriate.
  • Suitable host cells include bacteria, mammalian cells, yeast and baculovirus systems.
  • Mammalian cell lines available in the art for expression of a heterologous polypeptide include Chinese hamster ovary cells, HeLa cells, baby hamster kidney cells, NSO mouse melanoma cells and many others.
  • a common bacterial host is E. coli.
  • Suitable vectors can be chosen or constructed, containing appropriate regulatory sequences, including operably linked promoter sequences, terminator sequences, polyadenylation sequences, enhancer sequences, marker genes and/or other sequences as appropriate.
  • Vectors can be plasmids, viral e.g. ‘phage, or phagemid, as appropriate.
  • phage a virus
  • phagemid a virus
  • the nucleic acid encoding a polypeptide of interest is integrated into the genome of the host cell or can be maintained as a stable or transient episomal element.
  • sequences that control the expression of a DNA sequence operatively linked to it can be used in these vectors to express the DNA sequences.
  • a nucleic acid encoding a polypeptide of interest can be operably linked to a promoter, and provided in an expression construct for use in methods of production of recombinant MMP9 proteins or portions thereof.
  • nucleic acids encoding the antibody chains disclosed herein can be synthesized using standard knowledge and procedures in molecular biology.
  • nucleotide sequences encoding the heavy and light chain amino acid sequences disclosed herein are as follows:
  • VH1 (SEQ ID NO: 19) CAGGTGCAGC TGCAGGAATC CGGCCCTGGC CTGGTCAAGC CCTCCGAGAC ACTGTCCCTG ACCTGCACCG TGTCCGGCTT CTCCCTGCTG TCCTACGGCG TGCACTGGGT CCGACAGCCT CCAGGGAAGG GCCTGGAATG GCTGGGCGTG ATCTGGACCG GCGGCACCAC CAACTACAAC TCCGCCCTGA TGTCCCGGCT GACCATCTCC AAGGACGACT CCAAGTCCAC CGTACCTG AAGATGAACT CCCTGAAAAC CGAGGACACC GCCATCTACT ACTGCGCCCG GTACTACTAC GGCATGGACT ACTGGGGCCA GGGCACCTCC GTGACCGTGT CCTCA VH2: (SEQ ID NO: 20) CAGGTGCAGC TGCAGGAATC CGGCCCTGGC CTGGTCAAGC CCTCCGAGAC ACTGTCCCTG ACCTGCACCG TGTCCGGC
  • nucleic acid sequences having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98% and at least 99% homology to any of the nucleotide sequences disclosed herein are also provided.
  • polynucleotides comprising nucleic acid sequences having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98% and at least 99% identity to any of the nucleotide sequences disclosed herein are also provided.
  • MMP9 binding proteins as well as nucleic acid (e.g., DNA or RNA) encoding MMP9 binding proteins, can be provided as a pharmaceutical composition, e.g., combined with a pharmaceutically acceptable carrier or excipient.
  • Such pharmaceutical compositions are useful for, for example, administration to a subject in vivo or ex vivo, and for diagnosing and/or treating a subject with the MMP9 binding proteins.
  • Pharmaceutically acceptable carriers are physiologically acceptable to the administered patient and retain the therapeutic properties of the antibodies or peptides with which it is administered.
  • Pharmaceutically-acceptable carriers and their formulations are and generally described in, for example, Remington’ pharmaceutical Sciences (18th Edition, ed. A. Gennaro, Mack Publishing Co., Easton, Pa. 1990).
  • One exemplary pharmaceutical carrier is physiological saline.
  • Each carrier is “pharmaceutically acceptable” in the sense of being compatible with the other ingredients of the formulation and not substantially injurious to the patient.
  • compositions can be formulated to be compatible with a particular route of administration, systemic or local.
  • pharmaceutical compositions include carriers, diluents, or excipients suitable for administration by various routes.
  • compositions can include pharmaceutically acceptable additives.
  • additives include, but are not limited to, a sugar such as mannitol, sorbitol, glucose, xylitol, trehalose, sorbose, sucrose, galactose, dextran, dextrose, fructose, lactose and mixtures thereof.
  • Pharmaceutically acceptable additives can be combined with pharmaceutically acceptable carriers and/or excipients such as dextrose.
  • Additives also include surfactants such as polysorbate 20 or polysorbate 80.
  • formulation and delivery methods will generally be adapted according to the site and the disease to be treated.
  • exemplary formulations include, but are not limited to, those suitable for parenteral administration, e.g., intravenous, intra-arterial, intramuscular, or subcutaneous administration.
  • compositions for parenteral delivery include, for example, water, saline, phosphate buffered saline, Hank's solution, Ringer's solution, dextrose/saline, and glucose solutions.
  • the formulations can contain auxiliary substances to approximate physiological conditions, such as buffering agents, tonicity adjusting agents, wetting agents, detergents and the like.
  • Additives can also include additional active ingredients such as bactericidal agents, or stabilizers.
  • the solution can contain sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate or triethanolamine oleate. Additional parenteral formulations and methods are described in Bai (1997) J. Neuroimmunol.
  • the parenteral preparation can be enclosed in ampules, disposable syringes or multiple dose vials made of glass or plastic.
  • compositions for intradermal or subcutaneous administration can include a sterile diluent, such as water, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid, glutathione or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose.
  • a sterile diluent such as water, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents
  • antibacterial agents such as benzyl alcohol or methyl parabens
  • antioxidants such as ascorbic acid, glutathione or sodium bisulfite
  • chelating agents such as ethylenediaminete
  • compositions for injection include aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
  • suitable carriers include physiological saline, bacteriostatic water, Cremophor ELTM (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS).
  • the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyetheylene glycol, and the like), and suitable mixtures thereof.
  • Fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
  • Antibacterial and antifungal agents include, for example, parabens, chlorobutanol, phenol, ascorbic acid and thimerosal.
  • Isotonic agents for example, sugars, polyalcohols such as manitol, sorbitol, and sodium chloride may be included in the composition.
  • the resulting solutions can be packaged for use as is, or lyophilized; the lyophilized preparation can later be combined with a sterile solution prior to administration.
  • Pharmaceutically acceptable carriers can contain a compound that stabilizes, increases or delays absorption or clearance.
  • Such compounds include, for example, carbohydrates, such as glucose, sucrose, or dextrans; low molecular weight proteins; compositions that reduce the clearance or hydrolysis of peptides; or excipients or other stabilizers and/or buffers.
  • Agents that delay absorption include, for example, aluminum monostearate and gelatin.
  • Detergents can also be used to stabilize or to increase or decrease the absorption of the pharmaceutical composition, including liposomal carriers.
  • the compound can be complexed with a composition to render it resistant to acidic and enzymatic hydrolysis, or the compound can be complexed in an appropriately resistant carrier such as a liposome.
  • compositions of the present invention can be combined with other therapeutic moieties or imaging/diagnostic moieties as provided herein.
  • Therapeutic moieties and/or imaging moieties can be provided as a separate composition, or as a conjugated moiety present on an MMP9 binding protein.
  • Formulations for in vivo administration are generally sterile.
  • the pharmaceutical compositions are formulated to be free of pyrogens such that they are acceptable for administration to human patients.
  • compositions can be formulated based on the physical characteristics of the patient/subject needing treatment, the route of administration, and the like. Such can be packaged in a suitable pharmaceutical package with appropriate labels for the distribution to hospitals and clinics wherein the label is for the indication of treating a disorder as described herein in a subject. Medicaments can be packaged as a single or multiple units. Instructions for the dosage and administration of the pharmaceutical compositions of the present invention can be included with the pharmaceutical packages and kits described below.
  • the MMP9 binding proteins of the present disclosure can be used in, for example, methods of detection of MMP9 in a sample, methods of treatment (e.g., as in methods of inhibition of angiogenesis), and methods of diagnosis. Examples of methods of use are described below.
  • Diseases and disorder include, but are not limited to tumors (e.g., primary or metastatic) that express or are disposed in a tissue which expresses MMP9.
  • treat or “treatment” means stasis or a postponement of development of the symptoms associated a disease or disorder described herein.
  • the terms further include ameliorating existing uncontrolled or unwanted symptoms, preventing additional symptoms, and ameliorating or preventing the underlying metabolic causes of symptoms.
  • the terms denote that a beneficial result has been conferred on a mammalian subject with a disease or symptom, or with the potential to develop such disease or symptom.
  • a response is achieved when the patient experiences partial or total alleviation, or reduction of signs or symptoms of illness, and specifically includes, without limitation, prolongation of survival.
  • the expected progression-free survival times can be measured in months to years, depending on prognostic factors including the number of relapses, stage of disease, and other factors.
  • compositions for use in connection with such methods.
  • Compositions can be suitable for administration locally or systemically by any suitable route.
  • MMP9 binding proteins are administered in a therapeutically effective amount, e.g., in an amount to effect inhibition of tumor growth in a subject and/or to inhibit metastasis.
  • the term “therapeutically effective amount” or “effective amount” refers to an amount of a therapeutic agent that when administered alone or in combination with another therapeutic agent to a subject is effective to prevent or ameliorate the disease condition or the progression of the disease.
  • a therapeutically effective dose further refers to that amount of the compound sufficient to result in amelioration of symptoms, e.g., treatment, healing, prevention or amelioration of the relevant medical condition, or an increase in rate of treatment, healing, prevention or amelioration of such conditions.
  • a therapeutically effective dose refers to that ingredient alone.
  • a therapeutically effective dose refers to combined amounts of the active ingredients that result in the therapeutic effect, whether administered in combination, serially or simultaneously.
  • normal dosage amounts can vary from about 10 ng/kg to up to 100 mg/kg of mammal body weight or more per day, preferably about 1 ⁇ g/kg/day to 50 mg/kg/day, optionally about 100 ⁇ g/kg/day to 20 mg/kg/day, 500 ⁇ g/kg/day to 10 mg/kg/day, or 1 mg/kg/day to 10 mg/kg/day, depending upon the route of administration.
  • the selected dosage regimen will depend upon a variety of factors including the activity of the MMP9 binding protein, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular composition employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
  • ED50 effective amount of the pharmaceutical composition required.
  • the physician or veterinarian can start doses of the compounds of the invention employed in the pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved.
  • the term “subject” means mammalian subjects. Exemplary subjects include, but are not limited to humans, monkeys, dogs, cats, mice, rats, cows, horses, goats and sheep. In some embodiments, the subject has cancer and can be treated with the agent of the present invention as described below.
  • methods can further include surgical removal of the cancer and/or administration of an anti-cancer agent or treatment in addition to an MMP9 binding protein. Administration of such an anti-cancer agent or treatment can be concurrent with administration of the compositions disclosed herein.
  • the present disclosure also contemplates methods of detecting MMP9 in a subject, e.g., to detect tumor or tumor-associated tissue expressing MMP9.
  • methods of diagnosing, monitoring, staging or detecting a tumor having MMP9 activity are provided.
  • Samples from an individual suspected of having a tumor associated with MMP9 expression can be collected and analyzed by detecting the presence or absence of binding of an MMP9 binding protein. This analysis can be performed prior to the initiation of treatment using an MMP9 binding protein as described herein, or can be done as part of monitoring of progress of cancer treatment. Such diagnostic analysis can be performed using any sample, including but not limited to tissue, cells isolated from such tissues, and the like. Tissue samples include, for example, formalin-fixed or frozen tissue sections.
  • MMP9 Any suitable method for detection and analysis of MMP9 be employed.
  • Various diagnostic assay techniques known in the art can be adapted for such prupose, such as competitive binding assays, direct or indirect sandwich assays and immunoprecipitation assays conducted in either heterogeneous or homogeneous phases.
  • MMP9 binding proteins for use in detection methods can be labeled with a detectable moiety.
  • the detectable moiety directly or indirectly produces a detectable signal.
  • the detectable moiety can be any of those described herein such as, for example, a radioisotope, such as 3H, 14C, 32P, 35S, or 1251, a fluorescent or chemiluminescent compound, such as fluorescein isothiocyanate (FITC), Texas red, cyanin, photocyan, rhodamine, or luciferin, or an enzyme, such as alkaline phosphatase, ⁇ -galactosidase or horseradish peroxidase.
  • Detection can be accomplished by contacting a sample under conditions suitable for MMP9 binding protein binding to MMP9, and assessing the presence (e.g., level) or absence of MMP9 binding protein-MMP9 complexes.
  • a level of MMP9 in the sample in comparison with a level of a reference sample can indicate the presence of a tumor or tumor-associated tissues having MMP9 activity.
  • the reference sample can be a sample taken from the subject at an earlier time point or a sample from another individual.
  • the full-length human MMP9 protein without a signal peptide, which is SEQ ID NO. 28 was used to immunize mice. Spleen cells from immunized mice were fused with myeloma cells to generate a hybridoma library. Monoclonal cultures were prepared and screened to identify cultures expressing an anti-MMP9 monoclonal antibody.
  • Antibody (AB0041) was purified from one of the cultures and characterized.
  • the antibody contained an IgG2b heavy chain and a kappa light chain. Characterization included testing for the binding of AB0041 to other human MMPs and to MMP9 proteins from other species, including cynomolgus monkey, rat and mouse. It was found that the AB0041 antibody bound strongly to human and cynomolgus MMP9, that it bound less strongly to rat MMP9, and that it did not bind to murine MMP9 or to many of the human non-MMP matrix metalloproteinases.
  • Additional characterization included assaying the binding of the antibody to mouse MMP9 in which certain amino acids were altered to more closely correspond to the human MMP9 sequence.
  • the human MMP9 protein was mutagenized, and the various mutants tested for their ability to be bound by the antibody, to determine amino acids important for antibody binding and thereby define the therapeutic epitope.
  • This analysis identified an arginine residue at position 162 of the MMP9 amino acid sequence (R162) as important for antibody binding.
  • Other amino acid residues in MMP9 that are important for binding of the AB0041 antibody include E111, D113, and 1198. Recent crystal structure of MMP9 showed that E111, D113, R162, and 1198 were grouped near each other around a Ca2 + ion binding pocket of MMP9. Without binding to any specific scientific theory, AB0041 may bind to the region on MMP9 wherein these residues are located. Alternatively, these MMP9 residues may have direct contact with AB0041.
  • the AB0041 antibody was found to act as a non-competitive inhibitor.
  • the amino acid sequences of the heavy chain and light chain of the mouse AB0041 antibody were altered at certain locations in the framework (i.e., non-CDR) portion of their variable regions to generate proteins that are less immunogenic in humans. These amino acid sequence changes were shown in FIGS. 1 and 2 .
  • the cross-reactivity of the humanized antibody (referred to as AB0045) is shown in Table 2 above.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Microbiology (AREA)
  • Epidemiology (AREA)
  • Mycology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Cardiology (AREA)
  • Oncology (AREA)
  • Pain & Pain Management (AREA)
  • Rheumatology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)

Abstract

The present disclosure provides compositions and methods of use involving binding proteins, e.g., antibodies and antigen-binding fragments thereof, that bind to the matrix metalloproteinase-9 (MMP9) protein (MMP9 is also known as gelatinase-B), wherein the binding proteins comprise an immunoglobulin (Ig) heavy chain (or functional fragment thereof) and an Ig light chain (or functional fragment thereof).

Description

    CROSS REFERENCE TO RELATED APPLICATIONS
  • This application is a continuation of U.S. patent application Ser. No. 13/619,318, filed Sep. 14, 2012, now allowed, which is a divisional of U.S. patent application Ser. No. 13/219,523, filed Aug. 26, 2011, now U.S. Pat. No. 8,377,443, which claims priority benefit of U.S. Provisional Patent Application No. 61/377,886, filed Aug. 27, 2010. The contents of each of these applications are incorporated herein by reference in their entirety for all purposes.
  • SUBMISSION OF SEQUENCE LISTING ON ASCII TEXT FILE
  • The content of the following submission on ASCII text file is incorporated herein by reference in its entirety: a computer readable form (CRF) of the Sequence Listing (file name: 246102008001Seqlist.txt, date recorded: Jul. 1, 2013, size: 39,055 bytes).
  • FIELD
  • This disclosure is in the field of extracellular enzymes, extracellular matrix enzymes, proteases and immunology.
  • INTRODUCTION
  • Matrix metalloproteinases (MMPs) are a family of extracellular enzymes involved in forming and remodeling the extracellular matrix. These enzymes contain a conserved catalytic domain in which a zinc atom is coordinated by three histidine residues. Currently, over 20 members of this family are known, organized into a number of groups including collagenases, gelatinases, stromelysins, matrilysins, enamelysins and membrane MMPs.
  • MMP2 and MMP9 belong to the gelatinase group of matrix metalloproteinases. Besides containing signal peptide, propeptide, catalytic, zinc-binding and heamopexin-like domains common to most MMPs, the gelatinases also contain a plurality of fibronectin-like domains and an O-glycosylated domain.
  • Abnormal activity of certain MMPs has been shown to play a role in tumor growth, metastasis, inflammation and vascular disease. See, for example, Hu et al. (2007) Nature Reviews: Drug Discovery 6:480-498. Because of this, it can be desirable to inhibit the activity of one or more MMPs in certain therapeutic settings. However, the activity of certain other MMPs is often required for normal function. Since most MMP inhibitors are targeted to the conserved catalytic domain and, as a result, inhibit a number of different MMPS, their therapeutic use has caused side effects due to the inhibition of essential, non-pathogenically-related MMPs.
  • Despite this problem, it has proven difficult to develop inhibitors that are specific to a particular MMP, because inhibition of enzymatic activity generally requires that the inhibitor be targeted to the catalytic domain. Consequently, most inhibitors of matrix metalloproteinase enzymatic activity are likely to react with more than one MMP, due to homologies in their catalytic domains. Thus, there remains a need for therapeutic reagents that specifically inhibit the catalytic activity of a single MMP, and that do not react with other MMPs.
  • SUMMARY
  • The present disclosure provides compositions and methods of use involving binding proteins, e.g., antibodies and antigen-binding fragments thereof, that bind to the matrix metalloproteinase-9 (MMP9) protein (MMP9 is also known as gelatinase-B), wherein the binding proteins comprise an immunoglobulin (Ig) heavy chain (or functional fragment thereof) and an Ig light chain (or functional fragment thereof). The disclosure further provides MMP9 binding proteins that bind specifically to MMP9 and not to other, related matrix metalloproteinases. Such MMP9 binding proteins find use in applications in which it is necessary or desirable to obtain specific modulation (e.g., inhibition) of MMP9, e.g., without directly affecting the activity of other matrix metalloproteinases. Thus, in certain embodiments of the present disclosure an anti-MMP9 antibody is a specific inhibitor of the activity of MMP9. In particular, the MMP9 binding proteins disclosed herein will be useful for inhibition of MMP9 while allowing normal function of other, related matrix metalloproteinases.
  • Accordingly, the present disclosure provides, inter alia:
  • 1. A MMP9 binding protein comprising an immunoglobulin heavy chain or functional fragment thereof, and an immunoglobulin light chain or functional fragment thereof, wherein the protein does not bind to a matrix metalloproteinase other than MMP9.
  • 2. The protein of embodiment 1, wherein the heavy chain comprises a complementarity-determining region (CDR) selected from one or more of SEQ ID NOs: 13-15, and the light chain comprises a CDR selected from one or more of SEQ ID NOs: 16-18.
  • 3. The protein of embodiment 2, wherein the heavy chain comprises a variable region selected from the group consisting of SEQ ID NOs: 3 or 5-8, and the light chain comprises a variable region selected from the group consisting of SEQ ID NOs: 4 or 9-12.
  • 4. The protein of embodiment 1, wherein the heavy chain is an IgG.
  • 5. The protein of embodiment 1, wherein the light chain is a kappa chain.
  • 6. The protein of embodiment 1, wherein the binding of the protein to MMP9 inhibits the enzymatic activity of MMP9.
  • 7. The protein of embodiment 6, wherein the inhibition is non-competitive.
  • 8. The protein of embodiment 1, wherein the heavy chain is encoded by a polynucleotide having a nucleotide sequence selected from the group consisting of SEQ ID NOs: 19-22 and the light chain is encoded by a polynucleotide having a nucleotide sequence selected from the group consisting of SEQ ID NOs: 23-26.
  • 9. A vector comprising one or more polynucleotides having a nucleotide sequence selected from the group consisting of SEQ ID NOs: 19-26.
  • 10. A cell comprising the vector of embodiment 9.
  • 11. A pharmaceutical composition comprising the protein of embodiment 1.
  • 12. A pharmaceutical composition comprising the vector of embodiment 9.
  • 13. A pharmaceutical composition comprising the cell of embodiment 10.
  • BRIEF DESCRIPTION OF THE DRAWINGS
  • FIG. 1 shows the amino acid sequence of the heavy chain variable region of a mouse monoclonal anti-MMP9 antibody (AB0041), along with the amino acid sequences of humanized variants of heavy chain (VH1-VH4), aligned to show differences in framework amino acid sequence resulting from humanization. CDRs are shown in italics, and amino acids that are different in the humanized variants, compared to the parent mouse monoclonal, are underlined.
  • FIG. 2 shows the amino acid sequence of the light chain variable region of a mouse monoclonal anti-MMP9 antibody (AB0041), along with the amino acid sequences of humanized variants of this light chain (VH1-VH4), aligned to show differences in framework amino acid sequence resulting from humanization. CDRs are shown in italics, and amino acids that are different in the humanized variants, compared to the parent mouse monoclonal, are underlined.
  • FIG. 3 shows a schematic diagram of the MMP9 protein.
  • DETAILED DESCRIPTION
  • Practice of the present disclosure employs, unless otherwise indicated, standard methods and conventional techniques in the fields of cell biology, toxicology, molecular biology, biochemistry, cell culture, immunology, oncology, recombinant DNA and related fields as are within the skill of the art. Such techniques are described in the literature and thereby available to those of skill in the art. See, for example, Alberts, B. et al., “Molecular Biology of the Cell,” 5th edition, Garland Science, New York, N.Y., 2008; Voet, D. et al. “Fundamentals of Biochemistry: Life at the Molecular Level,” 3rd edition, John Wiley & Sons, Hoboken, N.J., 2008; Sambrook, J. et al., “Molecular Cloning: A Laboratory Manual,” 3rd edition, Cold Spring Harbor Laboratory Press, 2001; Ausubel, F. et al., “Current Protocols in Molecular Biology,” John Wiley & Sons, New York, 1987 and periodic updates; Freshney, R.I., “Culture of Animal Cells: A Manual of Basic Technique,” 4th edition, John Wiley & Sons, Somerset, N.J., 2000; and the series “Methods in Enzymology,” Academic Press, San Diego, Calif.
  • See also, for example, “Current Protocols in Immunology,” (R. Coico, series editor), Wiley, last updated August 2010.
  • MMP9 Binding Proteins
  • The present disclosure provides binding proteins, e.g., antibodies and antigen-binding fragments thereof, that bind to the matrix metalloproteinase-9 (MMP9) protein (MMP9 is also known as gelatinase-B), The binding proteins of the present disclosure generally comprise an immunoglobulin (Ig) heavy chain (or functional fragment thereof) and an Ig light chain (or functional fragment thereof).
  • The disclosure further provides MMP9 binding proteins that bind specifically to MMP9 and not to other matrix metalloproteinases such as MMP1, MMP2, MMP3, MMP7, MMP9, MMP10, MMP12, MMP13. Such specific MMP9 binding proteins are thus generally not significantly or detectably crossreactive with non-MMP9 matrix metalloproteinases. MMP9 binding proteins that specifically bind MMP9 find use in applications in which it is necessary or desirable to obtain specific modulation (e.g., inhibition) of MMP9, e.g., without directly affecting the activity of other matrix metalloproteinases.
  • In certain embodiments of the present disclosure an anti-MMP9 antibody is an inhibitor of the activity of MMP9, and can be a specific inhibitor of MMP9. In particular, the MMP9 binding proteins disclosed herein will be useful for inhibition of MMP9 while allowing normal function of other, related matrix metalloproteinases. “An inhibitor of MMP” or “inhibitor of MMP9 activity” can be an antibody or an antigen binding fragment thereof that directly or indirectly inhibits activity of MMP9, including but not limited to enzymatic processing, inhibiting action of MMP9 on it substrate (e.g., by inhibiting substrate binding, substrate cleavage, and the like), and the like.
  • The present disclosure also provides MMP9 binding proteins that specifically bind to non-mouse MMP9, such as human MMP9, Cynomolgus monkey MMP9, and rat MMP9.
  • The present disclosure also provides MMP9 binding proteins (e.g., anti-MMP9 antibodies and functional fragments thereof) that act as non-competitive inhibitors. A “non-competitive inhibitor” refers to an inhibitor binds at site away from substrate binding site of an enzyme, and thus can bind the enzyme and effect inhibitory activity regardless of whether or not the enzyme is bound to its substrate, Such non-competitive inhibitors can, for example, provide for a level of inhibition that can be substantially independent of substrate concentration.
  • MMP9 binding proteins (e.g., antibodies and functional fragments thereof) of the present disclosure include those that bind MMP9, particularly human MMP9, and having a heavy chain polypeptide (or functional fragment thereof) that has at least about 80%, 85%, 90%, 95% or more amino acid sequence identity to a heavy chain polypeptide disclosed herein.
  • MMP9 binding proteins (e.g., antibodies and functional fragments thereof) of the present disclosure include those that bind MMP9, particularly human MMP9, and having a light polypeptide (or functional fragment thereof) that has at least about 80%, 85%, 90%, 95% or more amino acid sequence identity to a heavy chain polypeptide disclosed herein.
  • MMP9 binding proteins (e.g., antibodies and functional fragments thereof) of the present disclosure include those that bind MMP9, particularly human MMP9, and have a heavy chain polypeptide (or functional fragment thereof) having the complementarity determining regions (“CDRs”) of heavy chain polypeptide and the CDRs of a light chain polypeptide (or functional fragment thereof) as disclosed herein.
  • “Homology” or “identity” or “similarity” as used herein in the context of nucleic acids and polypeptides refers to the relationship between two polypeptides or two nucleic acid molecules based on an alignment of the amino acid sequences or nucleic acid sequences, respectively. Homology and identity can each be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When an equivalent position in the compared sequences is occupied by the same base or amino acid, then the molecules are identical at that position; when the equivalent site occupied by the same or a similar amino acid residue (e.g., similar in steric and/or electronic nature), then the molecules can be referred to as homologous (similar) at that position. Expression as a percentage of homology/similarity or identity refers to a function of the number of identical or similar amino acids at positions shared by the compared sequences. In comparing two sequences, the absence of residues (amino acids or nucleic acids) or presence of extra residues also decreases the identity and homology/similarity.
  • As used herein, “identity” means the percentage of identical nucleotide or amino acid residues at corresponding positions in two or more sequences when the sequences are aligned to maximize sequence matching, i.e., taking into account gaps and insertions. Sequences are generally aligned for maximum correspondence over a designated region, e.g., a region at least about 20, 25, 30, 35, 40, 45, 50, 55, 60, 65 or more amino acids or nucleotides in length, and can be up to the full-length of the reference amino acid or nucleotide. For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are input into a computer program, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. The sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
  • Examples of algorithms that are suitable for determining percent sequence identity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. (1990) J. Mol. Biol. 215: 403-410 and Altschul et al. (1977) Nucleic Acids Res. 25: 3389-3402, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (www.ncbi.nlm.nih.gov). Further exemplary algorithms include ClustalW (Higgins D., et al. (1994) Nucleic Acids Res 22: 4673-4680), available at www.ebi.ac.uk/Tools/clustalw/index.html.
  • Residue positions which are not identical can differ by conservative amino acid substitutions. Conservative amino acid substitutions refer to the interchangeability of residues having similar side chains. For example, a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains is serine and threonine; a group of amino acids having amide-containing side chains is asparagine and glutamine; a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains is lysine, arginine, and histidine; and a group of amino acids having sulfur-containing side chains is cysteine and methionine.
  • Sequence identity between two nucleic acids can also be described in terms of hybridization of two molecules to each other under stringent conditions. The hybridization conditions are selected following standard methods in the art (see, for example, Sambrook, et al., Molecular Cloning: A Laboratory Manual, Second Edition, (1989) Cold Spring Harbor, N.Y.). An example of stringent hybridization conditions is hybridization at 50° C. or higher and 0.1×SSC (15 mM sodium chloride/1.5 mM sodium citrate). Another example of stringent hybridization conditions is overnight incubation at 42° C. in a solution: 50% formamide, 5×SSC (150 mM NaCl, 15 mM trisodium citrate), 50 mM sodium phosphate (pH7.6), 5×Denhardt's solution, 10% dextran sulfate, and 20 mg/ml denatured, sheared salmon sperm DNA, followed by washing the filters in 0.1×SSC at about 65° C. Stringent hybridization conditions are hybridization conditions that are at least as stringent as the above representative conditions, where conditions are considered to be at least as stringent if they are at least about 80% as stringent, typically at least 90% as stringent as the above specific stringent conditions.
  • Accordingly, the present disclosure provides, for example, antibodies or antigen binding fragments thereof, comprising a heavy chain variable region polypeptide having at least 80%, 85%, 90%, 95%, or greater amino acid sequence identity to an amino acid sequence of a heavy chain variable region described herein (e.g., SEQ ID NOS:1 or 5-8), and a variable light chain polypeptide having at least 80%, 85%, 90%, 95%, or greater amino acid sequence identity to an amino acid sequence of a light chain polypeptide as set forth herein (e.g., SEQ ID NOS:2 or 9-12).
  • Examples of anti-MMP9 antibodies of the present disclosure are described in more detail below.
  • Antibodies
  • MMP9 binding proteins including antibodies and functional fragments thereof. As used herein, the term “antibody” means an isolated or recombinant polypeptide binding agent that comprises peptide sequences (e.g., variable region sequences) that specifically bind an antigenic epitope. The term is used in its broadest sense and specifically covers monoclonal antibodies (including full-length monoclonal antibodies), polyclonal antibodies, human antibodies, humanized antibodies, chimeric antibodies, nanobodies, diabodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments including but not limited to Fv, scFv, Fab, Fab′ F(ab′)2 and Fab2, so long as they exhibit the desired biological activity. The term “human antibody” refers to antibodies containing sequences of human origin, except for possible non-human CDR regions, and does not imply that the full structure of an immunoglobulin molecule be present, only that the antibody has minimal immunogenic effect in a human (i.e., does not induce the production of antibodies to itself).
  • An “antibody fragment” comprises a portion of a full-length antibody, for example, the antigen binding or variable region of a full-length antibody. Such antibody fragments may also be referred to herein as “functional fragments: or “antigen-binding fragments”. Examples of antibody fragments include Fab, Fab′, F(ab′)2, and Fv fragments; diabodies; linear antibodies (Zapata et al. (1995) Protein Eng. 8(10):1057-1062); single-chain antibody molecules; and multispecific antibodies formed from antibody fragments. Papain digestion of antibodies produces two identical antigen-binding fragments, called “Fab” fragments, each with a single antigen-binding site, and a residual “Fc” fragment, a designation reflecting the ability to crystallize readily. Pepsin treatment yields an F(ab′)2 fragment that has two antigen combining sites and is still capable of cross-linking antigen.
  • “Fv” is the minimum antibody fragment which contains a complete antigen-recognition and-binding site. This region consists of a dimer of one heavy- and one light-chain variable domain in tight, non-covalent association. It is in this configuration that the three complementarity-determining regions (CDRs) of each variable domain interact to define an antigen-binding site on the surface of the VH-VL dimer. Collectively, the six CDRs confer antigen-binding specificity to the antibody. However, even a single variable domain (or an isolated VH or VL region comprising only three of the six CDRs specific for an antigen) has the ability to recognize and bind antigen, although generally at a lower affinity than does the entire Fv fragment.
  • The “Fab” fragment also contains, in addition to heavy and light chain variable regions, the constant domain of the light chain and the first constant domain (CH1) of the heavy chain. Fab fragments were originally observed following papain digestion of an antibody. Fab′ fragments differ from Fab fragments in that F(ab′) fragments contain several additional residues at the carboxy terminus of the heavy chain CH1 domain, including one or more cysteines from the antibody hinge region. F(ab′)2 fragments contain two Fab fragments joined, near the hinge region, by disulfide bonds, and were originally observed following pepsin digestion of an antibody. Fab′-SH is the designation herein for Fab′ fragments in which the cysteine residue(s) of the constant domains bear a free thiol group. Other chemical couplings of antibody fragments are also known.
  • The “light chains” of antibodies (immunoglobulins) from any vertebrate species can be assigned to one of two clearly distinct types, called kappa and lambda, based on the amino acid sequences of their constant domains. Depending on the amino acid sequence of the constant domain of their heavy chains, immunoglobulins can be assigned to five major classes: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2.
  • “Single-chain Fv” or “sFv” or “scFv” antibody fragments comprise the VH and VL domains of antibody, wherein these domains are present in a single polypeptide chain. In some embodiments, the Fv polypeptide further comprises a polypeptide linker between the VH and VL domains, which enables the sFv to form the desired structure for antigen binding. For a review of sFv, see Pluckthun, in The Pharmacology of Monoclonal Antibodies, vol. 113 (Rosenburg and Moore eds.) Springer-Verlag, New York, pp. 269-315 (1994).
  • The term “diabodies” refers to small antibody fragments with two antigen-binding sites, which fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) in the same polypeptide chain (VH-VL). By using a linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain, thereby creating two antigen-binding sites. Diabodies are additionally described, for example, in EP404,097; WO93/11161 and Hollinger et al. (1993) Proc. Natl. Acad. Sci. USA 90:6444-6448.
  • An “isolated” antibody is one that has been identified and separated and/or recovered from a component of its natural environment. Components of its natural environment may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes. In some embodiments, an isolated antibody is purified (1) to greater than 95% by weight of antibody as determined by the Lowry method, for example, more than 99% by weight, (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence, e.g., by use of a spinning cup sequenator, or (3) to homogeneity by gel electrophoresis (e.g., SDS-PAGE) under reducing or nonreducing conditions, with detection by Coomassie blue or silver stain. The term “isolated antibody” includes an antibody in situ within recombinant cells, since at least one component of the antibody's natural environment will not be present. In certain embodiments, isolated antibody is prepared by at least one purification step.
  • As used herein, “immunoreactive” refers to antibodies or fragments thereof that are specific to a sequence of amino acid residues (“binding site” or “epitope”), yet if are cross-reactive to other peptides/proteins, are not toxic at the levels at which they are formulated for administration to human use. “Epitope” refers to that portion of an antigen capable of forming a binding interaction with an antibody or antigen binding fragment thereof. An epitope can be a linear peptide sequence (i.e., “continuous”) or can be composed of noncontiguous amino acid sequences (i.e., “conformational” or “discontinuous”). The term “preferentially binds” means that the binding agent binds to the binding site with greater affinity than it binds unrelated amino acid sequences.
  • Anti-MMP9 antibodies can be described in terms of the CDRs of the heavy and light chains. As used herein, the term “CDR” or “complementarity determining region” is intended to mean the non-contiguous antigen combining sites found within the variable region of both heavy and light chain polypeptides. These particular regions have been described by Kabat et al., J. Biol. Chem. 252:6609-6616 (1977); Kabat et al., U.S. Dept. of Health and Human Services, “Sequences of proteins of immunological interest” (1991); by Chothia et al., J. Mol. Biol. 196:901-917 (1987); and MacCallum et al., J. Mol. Biol. 262:732-745 (1996), where the definitions include overlapping or subsets of amino acid residues when compared against each other. Nevertheless, application of either definition to refer to a CDR of an antibody or grafted antibodies or variants thereof is intended to be within the scope of the term as defined and used herein. The amino acid residues which encompass the CDRs as defined by each of the above cited references are set forth below in Table 1 as a comparison.
  • TABLE 1
    CDR Definitions
    Kabat1 Chothia2 MacCallum3
    VH CDR1 31-35 26-32 30-35
    VH CDR2 50-65 53-55 47-58
    VH CDR3  95-102  96-101  93-101
    VL CDR1 24-34 26-32 30-36
    VL CDR2 50-56 50-52 46-55
    VL CDR3 89-97 91-96 89-96
    1Residue numbering follows the nomenclature of Kabat et al., supra
    2Residue numbering follows the nomenclature of Chothia et al., supra
    3Residue numbering follows the nomenclature of MacCallum et al., supra
  • As used herein, the term “framework” when used in reference to an antibody variable region is intended to mean all amino acid residues outside the CDR regions within the variable region of an antibody. A variable region framework is generally a discontinuous amino acid sequence between about 100-120 amino acids in length but is intended to reference only those amino acids outside of the CDRs. As used herein, the term “framework region” is intended to mean each domain of the framework that is separated by the CDRs.
  • In some embodiments, an antibody is a humanized antibody or a human antibody. Humanized antibodies include human immununoglobulins (recipient antibody) in which residues from a complementary-determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity and capacity. Thus, humanized forms of non-human (e.g., murine) antibodies are chimeric immunoglobulins which contain minimal sequence derived from non-human immunoglobulin. The non-human sequences are located primarily in the variable regions, particularly in the complementarity-determining regions (CDRs). In some embodiments, Fv framework residues of the human immunoglobulin are replaced by corresponding non-human residues. Humanized antibodies can also comprise residues that are found neither in the recipient antibody nor in the imported CDR or framework sequences. In certain embodiments, a humanized antibody comprises substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDRs correspond to those of a non-human immunoglobulin and all or substantially all of the framework regions are those of a human immunoglobulin consensus sequence. For the purposes of the present disclosure, humanized antibodies can also include immunoglobulin fragments, such as Fv, Fab, Fab′, F(ab′)2 or other antigen-binding subsequences of antibodies.
  • The humanized antibody can also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. See, for example, Jones et al. (1986)Nature 321:522-525; Riechmann et al. (1988) Nature 332:323-329; and Presta (1992) Curr. Op. Struct. Biol. 2:593-596.
  • Methods for humanizing non-human antibodies are known in the art. Generally, a humanized antibody has one or more amino acid residues introduced into it from a source that is non-human. These non-human amino acid residues are often referred to as “import” or “donor” residues, which are typically obtained from an “import” or “donor” variable domain. For example, humanization can be performed essentially according to the method of Winter and co-workers, by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody. See, for example, Jones et al., supra; Riechmann et al., supra and Verhoeyen et al. (1988) Science 239:1534-1536. Accordingly, such “humanized” antibodies include chimeric antibodies (U.S. Pat. No. 4,816,567), wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species. In certain embodiments, humanized antibodies are human antibodies in which some CDR residues and optionally some framework region residues are substituted by residues from analogous sites in rodent antibodies (e.g., murine monoclonal antibodies).
  • Human antibodies can also be produced, for example, by using phage display libraries. Hoogenboom et al. (1991) J. Mol. Biol, 227:381; Marks et al. (1991) J. Mol. Biol. 222:581. Other methods for preparing human monoclonal antibodies are described by Cole et al. (1985) “Monoclonal Antibodies and Cancer Therapy,” Alan R. Liss, p. 77 and Boerner et al. (1991) J. Immunol. 147:86-95.
  • Human antibodies can be made by introducing human immunoglobulin loci into transgenic animals (e.g., mice) in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon immunological challenge, human antibody production is observed, which closely resembles that seen in humans in all respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, for example, in U.S. Pat. Nos. 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; 5,661,016, and in the following scientific publications: Marks et al. (1992) Bio/Technology 10:779-783 (1992); Lonberg et al. (1994) Nature 368: 856-859; Morrison (1994) Nature 368:812-813; Fishwald et al. (1996) Nature Biotechnology 14:845-851; Neuberger (1996) Nature Biotechnology 14:826; and Lonberg et al. (1995) Intern. Rev. Immunol. 13:65-93.
  • Antibodies can be affinity matured using known selection and/or mutagenesis methods as described above. In some embodiments, affinity matured antibodies have an affinity which is five times or more, ten times or more, twenty times or more, or thirty times or more than that of the starting antibody (generally murine, rabbit, chicken, humanized or human) from which the matured antibody is prepared.
  • An antibody can also be a bispecific antibody. Bispecific antibodies are monoclonal, and may be human or humanized antibodies that have binding specificities for at least two different antigens. In the present case, the two different binding specificities can be directed to two different MMPs, or to two different epitopes on a single MMP (e.g., MMP9).
  • An antibody as disclosed herein can also be an immunoconjugate. Such immunoconjugates comprise an antibody (e.g., to MMP9) conjugated to a second molecule, such as a reporter. An immunoconjugate can also comprise an antibody conjugated to a cytotoxic agent such as a chemotherapeutic agent, a toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).
  • An antibody that “specifically binds to” or is “specific for” a particular polypeptide or an epitope on a particular polypeptide is one that binds to that particular polypeptide or epitope without substantially binding to any other polypeptide or polypeptide epitope. In some embodiments, an antibody of the present disclosure specifically binds to human MMP9 with a dissociation constant (Kd) equal to or lower than 100 nM, optionally lower than 10 nM, optionally lower than 1 nM, optionally lower than 0.5 nM, optionally lower than 0.1 nM, optionally lower than 0.01 nM, or optionally lower than 0.005 nM; in the form of monoclonal antibody, scFv, Fab, or other form of antibody measured at a temperature of about 4° C., 25° C., 37° C. or 42° C.
  • In certain embodiments, an antibody of the present disclosure binds to one or more processing sites (e.g., sites of proteolytic cleavage) in MMP9, thereby effectively blocking processing of the proenzyme or preproenzyme to the catalytically active enzyme, and thus reducing the proteolytic activity of the MMP9.
  • In certain embodiments, an antibody according to the present disclosure binds to MMP9 with an affinity at least 2 times, at least 5 times, at least 10 times, at least 25 times, at least 50 times, at least 100 times, at least 500 times, or at least 1000 times greater than its binding affinity for another MMP. Binding affinity can be measured by any method known in the art and can be expressed as, for example, on-rate, off-rate, dissociation constant (Kd), equilibrium constant (Keq) or any term in the art.
  • In certain embodiments, an antibody according to the present disclosure is a non-competitive inhibitor of the catalytic activity of MMP9. In certain embodiments, an antibody according to the present disclosure binds within the catalytic domain of MMP9. In additional embodiments, an antibody according to the present disclosure binds outside the catalytic domain of MMP9.
  • The present disclosure also contemplates antibodies or antigen binding fragments thereof, that compete with anti-MMP9 antibodies or antigen binding fragments thereof described herein for binding to MMP9. Thus, the present disclosure contemplates anti-MMP9 antibodies, and functional fragments thereof, that compete for binding with, for example, an antibody having a heavy chain polypeptide of any of SEQ ID NOS;1 or 5-8, a light chain polypeptide of SEQ ID NOS:2 or 9-12, or combinations thereof. In one embodiment, the anti-MMP9 antibody, for functional fragment thereof, competes for binding to human MMP9 with the antibody described herein as AB0041.
  • MMP9 Sequence
  • The amino acid sequence of human MMP9 protein is as follows:
  • (SEQ ID NO: 27)
    MSLWQPLVLV LLVLGCCFAA PRQRQSTLVL FPGDLRTNLT DRQLAEEYLY  50
    RYGYTRVAEM RGESKSLGPA LLLLQKQLSL PETGELDSAT LKAMRTPRCG 100
    VPDLGRFQTF EGDLKWHHHN ITYWIQNYSE DLPRAVIDDA FARAFALWSA 150
    VTPLTFTRVY SRDADIVIQF GVAEHGDGYP FDGKDGLLAH AFPPGPGIQG 200
    DAHFDDDELW SLGKGVVVPT RFGNADGAAC HFPFIFEGRS YSACTTDGRS 250
    DGLPWCSTTA NYDTDDRFGF CPSERLYTRD GNADGKPCQF PFIFQGQSYS 300
    ACTTDGRSDG YRWCATTANY DRDKLFGFCP TRADSTVMGG NSAGELCVFP 350
    FTFLGKEYST CTSEGRGDGR LWCATTSNFD SDKKWGFCPD QGYSLFLVAA 400
    HEFGHALGLD HSSVPEALMY PMYRFTEGPP LHKDDVNGIR HLYGPRPEPE 450
    PRPPTTTTPQ PTAPPTVCPT GPPTVHPSER PTAGPTGPPS AGPTGPPTAG 500
    PSTATTVPLS PVDDACNVNI FDAIAEIGNQ LYLFKDGKYW RFSEGRGSRP 550
    QGPFLIADKW PALPRKLDSV FEEPLSKKLF FFSGRQVWVY TGASVLGPRR 600
    LDKLGLGADV AQVTGALRSG RGKMLLFSGR RLWRFDVKAQ MVDPRSASEV 650
    DRMFPGVPLD THDVFQYREK AYFCQDRFYW RVSSRSELNQ VDQVGYVTYD 700
    ILQCPED
  • Protein domains are shown schematically in FIG. 3 and are indicated below:
  • Amino Acid # Feature
     1-19 Signal Peptide
    38-98 Peptidoglycan Binding Domain
    R98/C99 Propetide cleavage site (dependent on cleavage enzyme)
    112-445 Zn dependent metalloproteinase domain
    223-271 Fibronectin type II domain (gelatin binding domain)
    281-329 Fibronectin type II domain (gelatin binding domain)
    340-388 Fibronectin type II domain (gelatin binding domain)
    400-411 Zn binding region
    521-565 Hemopexin-like domain
    567-608 Hemopexin-like domain
    613-659 Hemopexin-like domain
    661-704 Hemopexin-like domain
  • The amino acid sequence of mature full-length human MMP9 (which is the amino acid sequence of the propolypeptide of SEQ ID NO:27 without the signal peptide) is:
  • (SEQ ID NO: 28)
    PRQRQSTLVL FPGDLRTNLT DRQLAEEYLY RYGYTRVAEM
    RGESKSLGPA LLLLQKQLSL PETGELDSAT LKAMRTPRCG
    VPDLGRFQTF EGDLKWHHHN ITYWIQNYSE DLPRAVIDDA
    FARAFALWSA VTPLTFTRVY SRDADIVIQF GVAEHGDGYP
    FDGKDGLLAH AFPPGPGIQG DAHFDDDELW SLGKGVVVPT
    RFGNADGAAC HFPFIFEGRS YSACTTDGRS DGLPWCSTTA
    NYDTDDRFGF CPSERLYTRD GNADGKPCQF PFIFQGQSYS
    ACTTDGRSDG YRWCATTANY DRDKLFGFCP TRADSTVMGG
    NSAGELCVFP FTFLGKEYST CTSEGRGDGR LWCATTSNFD
    SDKKWGFCPD QGYSLFLVAA HEFGHALGLD HSSVPEALMY
    PMYRFTEGPP LHKDDVNGIR HLYGPRPEPE PRPPTTTTPQ
    PTAPPTVCPT GPPTVHPSER PTAGPTGPPS AGPTGPPTAG
    PSTATTVPLS PVDDACNVNI FDAIAEIGNQ LYLFKDGKYW
    RFSEGRGSRP QGPFLIADKW PALPRKLDSV FEEPLSKKLF
    FFSGRQVWVY TGASVLGPRR LDKLGLGADV AQVTGALRSG
    RGKMLLFSGR RLWRFDVKAQ MVDPRSASEV DRMFPGVPLD
    THDVFQYREK AYFCQDRFYW RVSSRSELNQ VDQVGYVTYD
    ILQCPED

    where the amino acid sequence of the signal peptide is MSLWQPLVLV LLVLGCCFAA (SEQ ID NO:29).
  • The present disclosure contemplate MMP9 binding proteins that bind any portion of MMP9, e.g., human MMP9, with MMP9 binding proteins that preferentially bind MMP9 relative to other MMPs being of particular interest.
  • Anti-MMP9 antibodies, and functional fragments thereof, can be generated accordingly to methods well known in the art. Examples of anti-MMP9 antibodies are provided below.
  • Mouse Monoclonal Anti-MMP9
  • A mouse monoclonal antibody to human MMP9 was obtained as described in Example 1. This antibody contains a mouse IgG2b heavy chain and a mouse kappa light chain, and is denoted AB0041.
  • The amino acid sequence of the AB0041 heavy chain is as follows:
  • (SEQ ID NO: 1)
    MAVLVLFLCLVAFPSCVLSQVQLKESGPGLVAPSQSLSITCTV
    SGFSLLSYGVHWVRQPPGKGLEWLGVIWTGGTTNYNSALMSRL
    SISKDDSKSQVFLKMNSLQTDDTAIYYCARYYYGMDYWGQGTS
    VTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVT
    VTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVT
    CSVAHPASSTTVDKKLEPSGPISTINPCPPCKECHKCPAPNLE
    GGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVRISWF
    VNNVEVHTAQTQTHREDYNSTIRVVSALPIQHQDWMSGKEFKC
    KVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVS
    LTCLVVGFNPGDISVEVVTSNGHTEENYKDTAPVLDSDGSYFI
    YSKLDIKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK
  • The signal sequence is underlined, and the sequence of the IgG2b constant region is presented italics.
  • The amino acid sequence of theAB0041 light chain is as follows:
  • (SEQ ID NO: 2)
    MESQIQVFVFVFLWLSGVDGDIVMTQSHKFMSTSVGDRVSITC
    KASQDVRNTVAWYQQKTGQSPKLLIYSSSYRNTGVPDRFTGSG
    SGTDFTFTISSVQAEDLAVYFCQQHYITPYTFGGGTKLEIKRA
    DAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDG
    SERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCE
    ATHKTSTSPIVKSFNRNEC
  • The signal sequence is underlined, and the sequence of the kappa constant region is presented in italics.
  • The following amino acid sequence comprises the framework regions and complementarity-determining regions (CDRs) of the variable region of the IgG2b heavy chain of AB0041 (with CDRs underlined):
  • (SEQ ID NO: 3)
    QVQLKESGPGLVAPSQSLSITCTVSGFSLLSYGVHWVRQPPGKG
    LEWLGVIWTGGTTNYNSALMSRLSISKDDSKSQVFLKMNSLQTD
    DTAIYYCARYYYGMDYWGQGTSVTVSS
  • The following amino acid sequence comprises the framework regions and complementarity-determining regions (CDRs) of the variable region of the kappa light chain of AB0041 (with CDRs underlined):
  • (SEQ ID NO: 4)
    DIVMTQSHKFMSTSVGDRVSITCKASQDVRNTVAWYQQKTGQSP
    KLLIYSSSYRNTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYFC
    QQHYITPYTFGGGTKLEIK
  • Heavy-Chain Variants
  • The amino acid sequences of the variable regions of the AB0041 heavy and light chains were separately modified, by altering framework region sequences in the heavy and light chain variable regions. The effect of these sequence alterations was to deplete the antibody of human T-cell epitopes, thereby reducing or abolishing its immunogenicity in humans (Antitope, Babraham, UK).
  • Four heavy-chain variants were constructed, in a human IgG4 heavy chain background containing a S241P amino acid change that stabilizes the hinge domain (Angal et al. (1993) Molec. Immunol. 30:105-108), and are denoted VH1, VH2, VH3 and VH4. The amino acid sequences of their framework regions and CDRs are as follows:
  • VH1
    (SEQ ID NO: 5)
    QVQLQESGPGLVKPSETLSLTCTVSGFSLLSYGVHWVRQPPGKG
    LEWLGVIWTGGTTNYNSALMSRLTISKDDSKSTVYLKMNSLKTE
    DTAIYYCARYYYGMDYWGQGTSVTVSS
    VH2
    (SEQ ID NO: 6)
    QVQLQESGPGLVKPSETLSLTCTVSGFSLLSYGVHWVRQPPGKG
    LEWLGVIWTGGTTNYNSALMSRLTISKDDSKNTVYLKMNSLKTE
    DTAIYYCARYYYGMDYWGQGTLVTVSS
    VH3
    (SEQ ID NO: 7)
    QVQLQESGPGLVKPSETLSLTCTVSGFSLLSYGVHWVRQPPGKG
    LEWLGVIWTGGTTNYNSALMSRFTISKDDSKNTVYLKMNSLKTE
    DTAIYYCARYYYGMDYWGQGTLVTVSS
    VH4
    (SEQ ID NO: 8)
    QVQLQESGPGLVKPSETLSLTCTVSGFSLLSYGVHWVRQPPGKG
    LEWLGVIWTGGTTNYNSALMSRFTISKDDSKNTLYLKMNSLKTE
    DTAIYYCARYYYGMDYWGQGTLVTVSS
  • FIG. 1 shows an alignment of the amino acid sequences of the variable regions of the humanized heavy chains and indicates the differences in amino acid sequences in the framework regions among the four variants.
  • Light-Chain Variants
  • Four light-chain variants were constructed, in a human kappa chain background, and are denoted Vk1, Vk2, Vk3 and Vk4. The amino acid sequences of their framework regions and CDRs are as follows:
  • Vk1
    (SEQ ID NO: 9)
    DIVMTQSPSFLSASVGDRVTITCKASQDVRNTVAWYQQKTGKAP
    KLLIYSSSYRNTGVPDRFTGSGSGTDFTLTISSLQAEDVAVYFC
    QQHYITPYTFGGGTKVEIK
    Vk2
    (SEQ ID NO: 10)
    DIVMTQSPSSLSASVGDRVTITCKASQDVRNTVAWYQQKPGKAP
    KLLIYSSSYRNTGVPDRFTGSGSGTDFTLTISSLQAEDVAVYFC
    QQHYITPYTFGGGTKVEIK
    Vk3
    (SEQ ID NO: 11)
    DIQMTQSPSSLSASVGDRVTITCKASQDVRNTVAWYQQKPGKAP
    KLLIYSSSYRNTGVPDRFSGSGSGTDFTLTISSLQAEDVAVYFC
    QQHYITPYTFGGGTKVEIK
    Vk4
    (SEQ ID NO: 12)
    DIQMTQSPSSLSASVGDRVTITCKASQDVRNTVAWYQQKPGKAP
    KLLIYSSSYRNTGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYC
    QQHYITPYTFGGGTKVEIK
  • FIG. 2 shows an alignment of the amino acid sequences of the variable regions of the humanized light chains and indicates the differences in amino acid sequences in the framework regions among the four variants.
  • The humanized heavy and light chains are combined in all possible pair-wise combinations to generate a number of functional humanized anti-MMP9 antibodies.
  • Additional heavy chain variable region amino acid sequences having 75% or more, 80% or more, 90% or more, 95% or more, or 99% or more homology to the heavy chain variable region sequences disclosed herein are also provided. Furthermore, additional light chain variable region amino acid sequences having 75% or more, 80% or more, 90% or more, 95% or more, or 99% or more homology to the light chain variable region sequences disclosed herein are also provided.
  • Additional heavy chain variable region amino acid sequences having 75% or more, 80% or more, 90% or more, 95% or more, or 99% or more sequence identity to the heavy chain variable region sequences disclosed herein are also provided. Furthermore, additional light chain variable region amino acid sequences having 75% or more, 80% or more, 90% or more, 95% or more, or 99% or more sequence identity to the light chain variable region sequences disclosed herein are also provided.
  • Complementarity-Determining Regions (CDRs)
  • The CDRs of the heavy chain of an anti-MMP9 antibody as disclosed herein have the following amino acid sequences:
  • CDR1:
    (SEQ ID NO: 13)
    GFSLLSYGVH
    CDR2:
    (SEQ ID NO: 14)
    VIWTGGTTNYNSALMS
    CDR3:
    (SEQ ID NO: 15)
    YYYGMDY
  • The CDRs of the light chain of an anti-MMP9 antibody as disclosed herein have the following amino acid sequences:
  • CDR1:
    (SEQ ID NO: 16)
    KASQDVRNTVA
    CDR2:
    (SEQ ID NO: 17)
    SSSYRNT
    CDR3:
    (SEQ ID NO: 18)
    QQHYITPYT
  • Nucleic Acids Encoding Anti-MMP9 Antibodies
  • The present disclosure provides nucleic acids encoding anti-MMP9 antibodies and functional fragments thereof. Accordingly, the present disclosure provides an isolated polynucleotide (nucleic acid) encoding an antibody or antigen-binding fragment as described herein, vectors containing such polynucleotides, and host cells and expression systems for transcribing and translating such polynucleotides into polypeptides.
  • The present disclosure also contemplates constructs in the form of plasmids, vectors, transcription or expression cassettes which comprise at least one polynucleotide as above.
  • The present disclosure also provides a recombinant host cell which comprises one or more constructs as above, as well as methods of production of the antibody or antigen-binding fragments thereof described herein which method comprises expression of nucleic acid encoding a heavy chain polypeptide and a light chain polypeptide (in the same or different host cells, and from the same or different constructs) in a recombination host cell. Expression can be achieved by culturing under appropriate conditions recombinant host cells containing the nucleic acid. Following production by expression, an antibody or antigen-binding fragment can be isolated and/or purified using any suitable technique, then used as appropriate.
  • Systems for cloning and expression of a polypeptide in a variety of different host cells are well known. Suitable host cells include bacteria, mammalian cells, yeast and baculovirus systems. Mammalian cell lines available in the art for expression of a heterologous polypeptide include Chinese hamster ovary cells, HeLa cells, baby hamster kidney cells, NSO mouse melanoma cells and many others. A common bacterial host is E. coli.
  • Suitable vectors can be chosen or constructed, containing appropriate regulatory sequences, including operably linked promoter sequences, terminator sequences, polyadenylation sequences, enhancer sequences, marker genes and/or other sequences as appropriate. Vectors can be plasmids, viral e.g. ‘phage, or phagemid, as appropriate. For further details see, for example, Molecular Cloning: a Laboratory Manual: 2nd edition, Sambrook et al., 1989, Cold Spring Harbor Laboratory Press. Many known techniques and protocols for manipulation of nucleic acid, for example in preparation of nucleic acid constructs, mutagenesis, sequencing, introduction of DNA into cells and gene expression, and analysis of proteins, are described in detail in Short Protocols in Molecular Biology, Second Edition, Ausubel et al. eds., John Wiley & Sons, 1992. The disclosures of Sambrook et al. and Ausubel et al. are incorporated herein by reference in their entirety.
  • The nucleic acid encoding a polypeptide of interest is integrated into the genome of the host cell or can be maintained as a stable or transient episomal element.
  • Any of a wide variety of expression control sequences—sequences that control the expression of a DNA sequence operatively linked to it—can be used in these vectors to express the DNA sequences. For example, a nucleic acid encoding a polypeptide of interest can be operably linked to a promoter, and provided in an expression construct for use in methods of production of recombinant MMP9 proteins or portions thereof.
  • Those of skill in the art are aware that nucleic acids encoding the antibody chains disclosed herein can be synthesized using standard knowledge and procedures in molecular biology.
  • Examples of nucleotide sequences encoding the heavy and light chain amino acid sequences disclosed herein, are as follows:
  • VH1:
    (SEQ ID NO: 19)
    CAGGTGCAGC TGCAGGAATC CGGCCCTGGC CTGGTCAAGC
    CCTCCGAGAC ACTGTCCCTG ACCTGCACCG TGTCCGGCTT
    CTCCCTGCTG TCCTACGGCG TGCACTGGGT CCGACAGCCT
    CCAGGGAAGG GCCTGGAATG GCTGGGCGTG ATCTGGACCG
    GCGGCACCAC CAACTACAAC TCCGCCCTGA TGTCCCGGCT
    GACCATCTCC AAGGACGACT CCAAGTCCAC CGTGTACCTG
    AAGATGAACT CCCTGAAAAC CGAGGACACC GCCATCTACT
    ACTGCGCCCG GTACTACTAC GGCATGGACT ACTGGGGCCA
    GGGCACCTCC GTGACCGTGT CCTCA
    VH2:
    (SEQ ID NO: 20)
    CAGGTGCAGC TGCAGGAATC CGGCCCTGGC CTGGTCAAGC
    CCTCCGAGAC ACTGTCCCTG ACCTGCACCG TGTCCGGCTT
    CTCCCTGCTG TCCTACGGCG TGCACTGGGT CCGACAGCCT
    CCAGGCAAAG GCCTGGAATG GCTGGGCGTG ATCTGGACCG
    GCGGCACCAC CAACTACAAC TCCGCCCTGA TGTCCCGGCT
    GACCATCTCC AAGGACGACT CCAAGAACAC CGTGTACCTG
    AAGATGAACT CCCTGAAAAC CGAGGACACC GCCATCTACT
    ACTGCGCCCG GTACTACTAC GGCATGGACT ACTGGGGCCA
    GGGCACCCTG GTCACCGTGT CCTCA
    VH3:
    (SEQ ID NO: 21)
    CAGGTGCAGC TGCAGGAATC CGGCCCTGGC CTGGTCAAGC
    CCTCCGAGAC ACTGTCCCTG ACCTGCACCG TGTCCGGCTT
    CTCCCTGCTG TCCTACGGCG TGCACTGGGT CCGACAGCCT
    CCAGGCAAAG GCCTGGAATG GCTGGGCGTG ATCTGGACCG
    GCGGCACCAC CAACTACAAC TCCGCCCTGA TGTCCCGGTT
    CACCATCTCC AAGGACGACT CCAAGAACAC CGTGTACCTG
    AAGATGAACT CCCTGAAAAC CGAGGACACC GCCATCTACT
    ACTGCGCCCG GTACTACTAC GGCATGGACT ACTGGGGCCA
    GGGCACCCTG GTCACCGTGT CCTCA
    VH4:
    (SEQ ID NO: 22)
    CAGGTGCAGC TGCAGGAATC CGGCCCTGGC CTGGTCAAGC
    CCTCCGAGAC ACTGTCCCTG ACCTGCACCG TGTCCGGCTT
    CTCCCTGCTG TCCTACGGCG TGCACTGGGT CCGACAGCCT
    CCAGGCAAAG GCCTGGAATG GCTGGGCGTG ATCTGGACCG
    GCGGCACCAC CAACTACAAC TCCGCCCTGA TGTCCCGGTT
    CACCATCTCC AAGGACGACT CCAAGAACAC CCTGTACCTG
    AAGATGAACT CCCTGAAAAC CGAGGACACC GCCATCTACT
    ACTGCGCCCG GTACTACTAC GGCATGGACT ACTGGGGCCA
    GGGCACCCTG GTCACCGTGT CCTCA
    Vk1:
    (SEQ ID NO: 23)
    GACATCGTGA TGACCCAGTC CCCCAGCTTC CTGTCCGCCT
    CCGTGGGCGA CAGAGTGACC ATCACATGCA AGGCCTCTCA
    GGACGTGCGG AACACCGTGG CCTGGTATCA GCAGAAAACC
    GGCAAGGCCC CCAAGCTGCT GATCTACTCC TCCTCCTACC
    GGAACACCGG CGTGCCCGAC CGGTTTACCG GCTCTGGCTC
    CGGCACCGAC TTTACCCTGA CCATCAGCTC CCTGCAGGCC
    GAGGACGTGG CCGTGTACTT CTGCCAGCAG CACTACATCA
    CCCCCTACAC CTTCGGCGGA GGCACCAAGG TGGAAATAAA
    A
    Vk2:
    (SEQ ID NO: 24)
    GACATCGTGA TGACCCAGTC CCCCTCCAGC CTGTCCGCCT
    CTGTGGGCGA CAGAGTGACC ATCACATGCA AGGCCTCTCA
    GGACGTGCGG AACACCGTGG CCTGGTATCA GCAGAAGCCC
    GGCAAGGCCC CCAAGCTGCT GATCTACTCC TCCTCCTACC
    GGAACACCGG CGTGCCCGAC CGGTTTACCG GCTCTGGCTC
    CGGCACCGAC TTTACCCTGA CCATCAGCTC CCTGCAGGCC
    GAGGACGTGG CCGTGTACTT CTGCCAGCAG CACTACATCA
    CCCCCTACAC CTTCGGCGGA GGCACCAAGG TGGAAATAAA
    A
    Vk3:
    (SEQ ID NO: 25)
    GACATCCAGA TGACCCAGTC CCCCTCCAGC CTGTCCGCCT
    CTGTGGGCGA CAGAGTGACC ATCACATGCA AGGCCTCCCA
    GGACGTGCGG AACACCGTGG CCTGGTATCA GCAGAAGCCC
    GGCAAGGCCC CCAAGCTGCT GATCTACTCC TCCTCCTACC
    GGAACACCGG CGTGCCCGAC CGGTTCTCTG GCTCTGGAAG
    CGGCACCGAC TTTACCCTGA CCATCAGCTC CCTGCAGGCC
    GAGGACGTGG CCGTGTACTT CTGCCAGCAG CACTACATCA
    CCCCCTACAC CTTCGGCGGA GGCACCAAGG TGGAAATAAA
    A
    Vk4:
    (SEQ ID NO: 26)
    GACATCCAGA TGACCCAGTC CCCCTCCAGC CTGTCCGCCT
    CTGTGGGCGA CAGAGTGACC ATCACATGCA AGGCCTCTCA
    GGACGTGCGG AACACCGTGG CCTGGTATCA GCAGAAGCCC
    GGCAAGGCCC CCAAGCTGCT GATCTACTCC TCCTCCTACC
    GGAACACCGG CGTGCCCGAC CGGTTCTCTG GCTCTGGAAG
    CGGCACCGAC TTTACCCTGA CCATCAGCTC CCTGCAGGCC
    GAGGACGTGG CCGTGTACTA CTGCCAGCAG CACTACATCA
    CCCCCTACAC CTTCGGCGGA GGCACCAAGG TGGAAATAAA
    A
  • Because the structure of antibodies, including the juxtaposition of CDRs and framework regions in the variable region, the structure of framework regions and the structure of heavy- and light-chain constant regions, is well-known in the art; it is well within the skill of the art to obtain related nucleic acids that encode anti-MMP-9 antibodies. Accordingly, polynucleotides comprising nucleic acid sequences having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98% and at least 99% homology to any of the nucleotide sequences disclosed herein are also provided. Accordingly, polynucleotides comprising nucleic acid sequences having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98% and at least 99% identity to any of the nucleotide sequences disclosed herein are also provided.
  • Pharmaceutical Compositions
  • MMP9 binding proteins, as well as nucleic acid (e.g., DNA or RNA) encoding MMP9 binding proteins, can be provided as a pharmaceutical composition, e.g., combined with a pharmaceutically acceptable carrier or excipient. Such pharmaceutical compositions are useful for, for example, administration to a subject in vivo or ex vivo, and for diagnosing and/or treating a subject with the MMP9 binding proteins.
  • Pharmaceutically acceptable carriers are physiologically acceptable to the administered patient and retain the therapeutic properties of the antibodies or peptides with which it is administered. Pharmaceutically-acceptable carriers and their formulations are and generally described in, for example, Remington’ pharmaceutical Sciences (18th Edition, ed. A. Gennaro, Mack Publishing Co., Easton, Pa. 1990). One exemplary pharmaceutical carrier is physiological saline. Each carrier is “pharmaceutically acceptable” in the sense of being compatible with the other ingredients of the formulation and not substantially injurious to the patient.
  • Pharmaceutical compositions can be formulated to be compatible with a particular route of administration, systemic or local. Thus, pharmaceutical compositions include carriers, diluents, or excipients suitable for administration by various routes.
  • Pharmaceutical compositions can include pharmaceutically acceptable additives. Examples of additives include, but are not limited to, a sugar such as mannitol, sorbitol, glucose, xylitol, trehalose, sorbose, sucrose, galactose, dextran, dextrose, fructose, lactose and mixtures thereof. Pharmaceutically acceptable additives can be combined with pharmaceutically acceptable carriers and/or excipients such as dextrose. Additives also include surfactants such as polysorbate 20 or polysorbate 80.
  • The formulation and delivery methods will generally be adapted according to the site and the disease to be treated. Exemplary formulations include, but are not limited to, those suitable for parenteral administration, e.g., intravenous, intra-arterial, intramuscular, or subcutaneous administration.
  • Pharmaceutical compositions for parenteral delivery include, for example, water, saline, phosphate buffered saline, Hank's solution, Ringer's solution, dextrose/saline, and glucose solutions. The formulations can contain auxiliary substances to approximate physiological conditions, such as buffering agents, tonicity adjusting agents, wetting agents, detergents and the like. Additives can also include additional active ingredients such as bactericidal agents, or stabilizers. For example, the solution can contain sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate or triethanolamine oleate. Additional parenteral formulations and methods are described in Bai (1997) J. Neuroimmunol. 80:65 75; Warren (1997) J. Neurol. Sci. 152:31 38; and Tonegawa (1997) J. Exp. Med. 186:507 515. The parenteral preparation can be enclosed in ampules, disposable syringes or multiple dose vials made of glass or plastic.
  • Pharmaceutical compositions for intradermal or subcutaneous administration can include a sterile diluent, such as water, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid, glutathione or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose.
  • Pharmaceutical compositions for injection include aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. For intravenous administration, suitable carriers include physiological saline, bacteriostatic water, Cremophor EL™ (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS). The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyetheylene glycol, and the like), and suitable mixtures thereof. Fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Antibacterial and antifungal agents include, for example, parabens, chlorobutanol, phenol, ascorbic acid and thimerosal. Isotonic agents, for example, sugars, polyalcohols such as manitol, sorbitol, and sodium chloride may be included in the composition. The resulting solutions can be packaged for use as is, or lyophilized; the lyophilized preparation can later be combined with a sterile solution prior to administration.
  • Pharmaceutically acceptable carriers can contain a compound that stabilizes, increases or delays absorption or clearance. Such compounds include, for example, carbohydrates, such as glucose, sucrose, or dextrans; low molecular weight proteins; compositions that reduce the clearance or hydrolysis of peptides; or excipients or other stabilizers and/or buffers. Agents that delay absorption include, for example, aluminum monostearate and gelatin. Detergents can also be used to stabilize or to increase or decrease the absorption of the pharmaceutical composition, including liposomal carriers. To protect from digestion the compound can be complexed with a composition to render it resistant to acidic and enzymatic hydrolysis, or the compound can be complexed in an appropriately resistant carrier such as a liposome. Means of protecting compounds from digestion are known in the art (see, e.g., Fix (1996) Pharm Res. 13:1760 1764; Samanen (1996) J. Pharm. Pharmacol. 48:119 135; and U.S. Pat. No. 5,391,377, describing lipid compositions for oral delivery of therapeutic agents).
  • Compositions of the present invention can be combined with other therapeutic moieties or imaging/diagnostic moieties as provided herein. Therapeutic moieties and/or imaging moieties can be provided as a separate composition, or as a conjugated moiety present on an MMP9 binding protein.
  • Formulations for in vivo administration are generally sterile. In one embodiment, the pharmaceutical compositions are formulated to be free of pyrogens such that they are acceptable for administration to human patients.
  • Various other pharmaceutical compositions and techniques for their preparation and use will be known to those of skill in the art in light of the present disclosure. For a detailed listing of suitable pharmacological compositions and associated administrative techniques one can refer to the detailed teachings herein, which can be further supplemented by texts such as Remington: The Science and Practice of Pharmacy 20th Ed. (Lippincott, Williams & Wilkins 2003).
  • Pharmaceutical compositions can be formulated based on the physical characteristics of the patient/subject needing treatment, the route of administration, and the like. Such can be packaged in a suitable pharmaceutical package with appropriate labels for the distribution to hospitals and clinics wherein the label is for the indication of treating a disorder as described herein in a subject. Medicaments can be packaged as a single or multiple units. Instructions for the dosage and administration of the pharmaceutical compositions of the present invention can be included with the pharmaceutical packages and kits described below.
  • Methods of Use
  • The MMP9 binding proteins of the present disclosure can be used in, for example, methods of detection of MMP9 in a sample, methods of treatment (e.g., as in methods of inhibition of angiogenesis), and methods of diagnosis. Examples of methods of use are described below.
  • Methods of Treatment
  • Provided herein are methods of treating diseases and disorders associated with MMP9 activity. Diseases and disorder include, but are not limited to tumors (e.g., primary or metastatic) that express or are disposed in a tissue which expresses MMP9.
  • As used herein, “treat” or “treatment” means stasis or a postponement of development of the symptoms associated a disease or disorder described herein. The terms further include ameliorating existing uncontrolled or unwanted symptoms, preventing additional symptoms, and ameliorating or preventing the underlying metabolic causes of symptoms. Thus, the terms denote that a beneficial result has been conferred on a mammalian subject with a disease or symptom, or with the potential to develop such disease or symptom. A response is achieved when the patient experiences partial or total alleviation, or reduction of signs or symptoms of illness, and specifically includes, without limitation, prolongation of survival. The expected progression-free survival times can be measured in months to years, depending on prognostic factors including the number of relapses, stage of disease, and other factors.
  • The present disclosure contemplates pharmaceutical compositions for use in connection with such methods. Compositions can be suitable for administration locally or systemically by any suitable route.
  • In general, MMP9 binding proteins are administered in a therapeutically effective amount, e.g., in an amount to effect inhibition of tumor growth in a subject and/or to inhibit metastasis.
  • As used herein, the term “therapeutically effective amount” or “effective amount” refers to an amount of a therapeutic agent that when administered alone or in combination with another therapeutic agent to a subject is effective to prevent or ameliorate the disease condition or the progression of the disease. A therapeutically effective dose further refers to that amount of the compound sufficient to result in amelioration of symptoms, e.g., treatment, healing, prevention or amelioration of the relevant medical condition, or an increase in rate of treatment, healing, prevention or amelioration of such conditions. When applied to an individual active ingredient administered alone, a therapeutically effective dose refers to that ingredient alone. When applied to a combination, a therapeutically effective dose refers to combined amounts of the active ingredients that result in the therapeutic effect, whether administered in combination, serially or simultaneously. For example, when in vivo administration of an anti-MMP9 antibody is employed, normal dosage amounts can vary from about 10 ng/kg to up to 100 mg/kg of mammal body weight or more per day, preferably about 1 μg/kg/day to 50 mg/kg/day, optionally about 100 μg/kg/day to 20 mg/kg/day, 500 μg/kg/day to 10 mg/kg/day, or 1 mg/kg/day to 10 mg/kg/day, depending upon the route of administration.
  • The selected dosage regimen will depend upon a variety of factors including the activity of the MMP9 binding protein, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular composition employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
  • A clinician having ordinary skill in the art can readily determine and prescribe the effective amount (ED50) of the pharmaceutical composition required. For example, the physician or veterinarian can start doses of the compounds of the invention employed in the pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved.
  • As used herein, the term “subject” means mammalian subjects. Exemplary subjects include, but are not limited to humans, monkeys, dogs, cats, mice, rats, cows, horses, goats and sheep. In some embodiments, the subject has cancer and can be treated with the agent of the present invention as described below.
  • If needed, for cancer treatments, methods can further include surgical removal of the cancer and/or administration of an anti-cancer agent or treatment in addition to an MMP9 binding protein. Administration of such an anti-cancer agent or treatment can be concurrent with administration of the compositions disclosed herein.
  • Methods of Detection of MMP9
  • The present disclosure also contemplates methods of detecting MMP9 in a subject, e.g., to detect tumor or tumor-associated tissue expressing MMP9. Thus, methods of diagnosing, monitoring, staging or detecting a tumor having MMP9 activity are provided.
  • Samples from an individual suspected of having a tumor associated with MMP9 expression can be collected and analyzed by detecting the presence or absence of binding of an MMP9 binding protein. This analysis can be performed prior to the initiation of treatment using an MMP9 binding protein as described herein, or can be done as part of monitoring of progress of cancer treatment. Such diagnostic analysis can be performed using any sample, including but not limited to tissue, cells isolated from such tissues, and the like. Tissue samples include, for example, formalin-fixed or frozen tissue sections.
  • Any suitable method for detection and analysis of MMP9 be employed. Various diagnostic assay techniques known in the art can be adapted for such prupose, such as competitive binding assays, direct or indirect sandwich assays and immunoprecipitation assays conducted in either heterogeneous or homogeneous phases.
  • MMP9 binding proteins for use in detection methods can be labeled with a detectable moiety. The detectable moiety directly or indirectly produces a detectable signal. For example, the detectable moiety can be any of those described herein such as, for example, a radioisotope, such as 3H, 14C, 32P, 35S, or 1251, a fluorescent or chemiluminescent compound, such as fluorescein isothiocyanate (FITC), Texas red, cyanin, photocyan, rhodamine, or luciferin, or an enzyme, such as alkaline phosphatase, β-galactosidase or horseradish peroxidase.
  • Detection can be accomplished by contacting a sample under conditions suitable for MMP9 binding protein binding to MMP9, and assessing the presence (e.g., level) or absence of MMP9 binding protein-MMP9 complexes. A level of MMP9 in the sample in comparison with a level of a reference sample can indicate the presence of a tumor or tumor-associated tissues having MMP9 activity. The reference sample can be a sample taken from the subject at an earlier time point or a sample from another individual.
  • EXAMPLES Example 1 Preparation of Antibodies to Human MMP-9
  • The full-length human MMP9 protein without a signal peptide, which is SEQ ID NO. 28 was used to immunize mice. Spleen cells from immunized mice were fused with myeloma cells to generate a hybridoma library. Monoclonal cultures were prepared and screened to identify cultures expressing an anti-MMP9 monoclonal antibody.
  • Antibody (AB0041) was purified from one of the cultures and characterized. The antibody contained an IgG2b heavy chain and a kappa light chain. Characterization included testing for the binding of AB0041 to other human MMPs and to MMP9 proteins from other species, including cynomolgus monkey, rat and mouse. It was found that the AB0041 antibody bound strongly to human and cynomolgus MMP9, that it bound less strongly to rat MMP9, and that it did not bind to murine MMP9 or to many of the human non-MMP matrix metalloproteinases.
  • TABLE 2
    Cross reactivity of AB0041 and AB0045.
    Dissociation constant (Kd)
    MMP Tested AB0045 AB0041
    Human MMP1 >100 nM >100 nM
    Human MMP2 >100 nM >100 nM
    Mouse MMP2 >100 nM >100 nM
    Human MMP3 >100 nM >100 nM
    Human MMP7 >100 nM >100 nM
    Human MMP8 >100 nM >100 nM
    Human MMP9 0.168 ± 0.117 nM 0.133 ± 0.030 nM
    Cynomolgus monkey 0.082 ± 0.022 nM 0.145 ± 0.16 nM 
    MMP9
    Mouse MMP9 >100 nM >100 nM
    Rat MMP9 0.311 ± 0.017 nM 0.332 ± 0.022 nM
    Human MMP10 >100 nM >100 nM
    Human MMP12 >100 nM >100 nM
    Human MMP13 >100 nM >100 nM
  • Additional characterization included assaying the binding of the antibody to mouse MMP9 in which certain amino acids were altered to more closely correspond to the human MMP9 sequence. In addition, the human MMP9 protein was mutagenized, and the various mutants tested for their ability to be bound by the antibody, to determine amino acids important for antibody binding and thereby define the therapeutic epitope. This analysis identified an arginine residue at position 162 of the MMP9 amino acid sequence (R162) as important for antibody binding. Other amino acid residues in MMP9 that are important for binding of the AB0041 antibody include E111, D113, and 1198. Recent crystal structure of MMP9 showed that E111, D113, R162, and 1198 were grouped near each other around a Ca2 + ion binding pocket of MMP9. Without binding to any specific scientific theory, AB0041 may bind to the region on MMP9 wherein these residues are located. Alternatively, these MMP9 residues may have direct contact with AB0041.
  • In an enzymatic assay for MMP9, the AB0041 antibody was found to act as a non-competitive inhibitor.
  • Example 2 Humanization of Antibodies to Human MMP9
  • The amino acid sequences of the heavy chain and light chain of the mouse AB0041 antibody were altered at certain locations in the framework (i.e., non-CDR) portion of their variable regions to generate proteins that are less immunogenic in humans. These amino acid sequence changes were shown in FIGS. 1 and 2. The cross-reactivity of the humanized antibody (referred to as AB0045) is shown in Table 2 above.

Claims (1)

What is claimed is:
1. An isolated matrix metalloproteinase 9 (MMP9) binding protein, comprising:
an immunoglobulin heavy chain polypeptide, or functional fragment thereof, and
an immunoglobulin light chain polypeptide, or functional fragment thereof,
wherein the MMP9 binding protein specifically binds to an to epitope of human MMP9 comprising amino acid residues R162, E111, D113, and 1198.
US14/992,678 2010-08-27 2016-01-11 Antibodies to matrix metalloproteinase 9 Abandoned US20160122437A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US14/992,678 US20160122437A1 (en) 2010-08-27 2016-01-11 Antibodies to matrix metalloproteinase 9

Applications Claiming Priority (5)

Application Number Priority Date Filing Date Title
US37788610P 2010-08-27 2010-08-27
US13/219,523 US8377443B2 (en) 2010-08-27 2011-08-26 Antibodies to matrix metalloproteinase 9
US13/619,318 US8501916B2 (en) 2010-08-27 2012-09-14 Antibodies to matrix metalloproteinase 9
US13/935,352 US9260532B2 (en) 2010-08-27 2013-07-03 Antibodies to matrix metalloproteinase 9
US14/992,678 US20160122437A1 (en) 2010-08-27 2016-01-11 Antibodies to matrix metalloproteinase 9

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
US13/935,352 Division US9260532B2 (en) 2010-08-27 2013-07-03 Antibodies to matrix metalloproteinase 9

Publications (1)

Publication Number Publication Date
US20160122437A1 true US20160122437A1 (en) 2016-05-05

Family

ID=45724100

Family Applications (7)

Application Number Title Priority Date Filing Date
US13/219,523 Active US8377443B2 (en) 2010-08-27 2011-08-26 Antibodies to matrix metalloproteinase 9
US13/619,318 Active US8501916B2 (en) 2010-08-27 2012-09-14 Antibodies to matrix metalloproteinase 9
US13/935,352 Active 2031-08-28 US9260532B2 (en) 2010-08-27 2013-07-03 Antibodies to matrix metalloproteinase 9
US13/935,370 Active 2031-09-20 US9120863B2 (en) 2010-08-27 2013-07-03 Nucleic acids encoding antibodies to matrix metalloproteinase 9
US14/839,503 Abandoned US20160159923A1 (en) 2010-08-27 2015-08-28 Antibodies to matrix metalloproteinase 9
US14/992,678 Abandoned US20160122437A1 (en) 2010-08-27 2016-01-11 Antibodies to matrix metalloproteinase 9
US15/695,765 Abandoned US20180086845A1 (en) 2010-08-27 2017-09-05 Nucleic acids encoding antibodies to matrix metalloproteinase 9

Family Applications Before (5)

Application Number Title Priority Date Filing Date
US13/219,523 Active US8377443B2 (en) 2010-08-27 2011-08-26 Antibodies to matrix metalloproteinase 9
US13/619,318 Active US8501916B2 (en) 2010-08-27 2012-09-14 Antibodies to matrix metalloproteinase 9
US13/935,352 Active 2031-08-28 US9260532B2 (en) 2010-08-27 2013-07-03 Antibodies to matrix metalloproteinase 9
US13/935,370 Active 2031-09-20 US9120863B2 (en) 2010-08-27 2013-07-03 Nucleic acids encoding antibodies to matrix metalloproteinase 9
US14/839,503 Abandoned US20160159923A1 (en) 2010-08-27 2015-08-28 Antibodies to matrix metalloproteinase 9

Family Applications After (1)

Application Number Title Priority Date Filing Date
US15/695,765 Abandoned US20180086845A1 (en) 2010-08-27 2017-09-05 Nucleic acids encoding antibodies to matrix metalloproteinase 9

Country Status (30)

Country Link
US (7) US8377443B2 (en)
EP (1) EP2608809B1 (en)
JP (3) JP5878538B2 (en)
KR (4) KR101881724B1 (en)
CN (2) CN103140240B (en)
AP (2) AP3948A (en)
AU (1) AU2011293125B2 (en)
BR (1) BR112013004579B1 (en)
CA (1) CA2808418C (en)
CL (1) CL2013000535A1 (en)
CO (1) CO6680656A2 (en)
CR (1) CR20130132A (en)
EA (1) EA031729B1 (en)
EC (1) ECSP13012525A (en)
ES (1) ES2739505T3 (en)
HK (1) HK1208688A1 (en)
IL (2) IL224614A (en)
MA (1) MA34527B1 (en)
MX (1) MX342413B (en)
NZ (2) NZ701444A (en)
PE (1) PE20131376A1 (en)
PH (1) PH12016501691A1 (en)
PL (1) PL2608809T3 (en)
PT (1) PT2608809T (en)
SG (2) SG10201506703VA (en)
SI (1) SI2608809T1 (en)
TR (1) TR201910348T4 (en)
UA (1) UA109908C2 (en)
WO (1) WO2012027721A2 (en)
ZA (2) ZA201301338B (en)

Families Citing this family (80)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101881724B1 (en) 2010-08-27 2018-07-24 길리아드 바이오로직스, 인크. Antibodies to matrix metalloproteinase 9
US9217040B2 (en) 2011-01-14 2015-12-22 The Regents Of The University Of California Therapeutic antibodies against ROR-1 protein and methods for use of same
MD20140107A2 (en) 2012-02-29 2015-03-31 Gilead Biologics, Inc. Antibodies to matrix metalloproteinase 9
MX2014010447A (en) * 2012-02-29 2015-06-23 Gilead Biologics Inc Antibodies to matrix metalloproteinase 9.
KR20160006694A (en) * 2013-04-05 2016-01-19 클라우디아 질버버그 Matrix metalloproteinases and uses thereof
US20150148345A1 (en) 2013-11-26 2015-05-28 Gilead Sciences, Inc. Therapies for treating myeloproliferative disorders
WO2015109286A1 (en) 2014-01-20 2015-07-23 Gilead Sciences, Inc. Therapies for treating cancers
EP2985296A1 (en) * 2014-08-13 2016-02-17 Calypso Biotech SA Antibodies specific for MMP9
EP2985295A1 (en) * 2014-08-13 2016-02-17 Calypso Biotech SA Antibodies specific for MMP9
TW201639573A (en) 2015-02-03 2016-11-16 吉李德科學股份有限公司 Combination therapies for treating cancers
EP3097102B1 (en) 2015-03-04 2017-10-18 Gilead Sciences, Inc. Toll-like receptor modulating 4,6-diamino-pyrido[3,2-d]pyrimidine compounds
CN105037553B (en) * 2015-08-20 2018-04-17 内蒙古蒙元生物基因科技有限公司 A kind of immunoglobulin that can detect cancer
WO2017059224A2 (en) 2015-10-01 2017-04-06 Gilead Sciences, Inc. Combination of a btk inhibitor and a checkpoint inhibitor for treating cancers
AU2016370916A1 (en) 2015-12-17 2018-06-07 Gilead Sciences, Inc. Tank-binding kinase inhibitor compounds
WO2017106566A1 (en) * 2015-12-17 2017-06-22 Gilead Sciences, Inc. Combination of a jak inhibitor and an mmp9 binding protein for treating inflammatory disorders
AU2017228371A1 (en) 2016-03-04 2018-09-13 Gilead Sciences, Inc. Compositions and combinations of autotaxin inhibitors
WO2017177179A1 (en) 2016-04-08 2017-10-12 Gilead Sciences, Inc. Compositions and methods for treating cancer, inflammatory diseases and autoimmune diseases
CN113773387B (en) 2016-06-13 2024-06-21 天境生物科技(上海)有限公司 PD-L1 antibodies and uses thereof
EP3493797A1 (en) 2016-08-04 2019-06-12 Gilead Sciences, Inc. Cobicistat for use in cancer treatments
EP3507276B1 (en) 2016-09-02 2021-11-03 Gilead Sciences, Inc. Toll like receptor modulator compounds
US10640499B2 (en) 2016-09-02 2020-05-05 Gilead Sciences, Inc. Toll like receptor modulator compounds
WO2018085069A1 (en) 2016-11-03 2018-05-11 Gilead Sciences, Inc. Combination of a bcl-2 inhibitor and a bromodomain inhibitor for treating cancer
WO2018097977A1 (en) 2016-11-22 2018-05-31 Gilead Sciences, Inc. Crystalline forms of a phosphate complex of a bet inhibitor
CN110312737A (en) 2016-12-16 2019-10-08 波尔多大学 MMP9 inhibitor and its purposes in prevention or treatment depigmentation illness
PE20191208A1 (en) 2017-01-24 2019-09-10 I Mab ANTI-CD73 ANTIBODIES AND USES OF THEM
US10370381B2 (en) 2017-02-24 2019-08-06 Gilead Sciences, Inc. Inhibitors of bruton'S tyrosine kinase
WO2018156901A1 (en) 2017-02-24 2018-08-30 Gilead Sciences, Inc. Inhibitors of bruton's tyrosine kinase
US10941178B2 (en) 2017-03-17 2021-03-09 Gilead Sciences, Inc. Method of purifying an antibody
JOP20180040A1 (en) 2017-04-20 2019-01-30 Gilead Sciences Inc Pd-1/pd-l1 inhibitors
WO2019017338A1 (en) 2017-07-18 2019-01-24 第一三共株式会社 Active mmp9-binding peptide
JP7037667B2 (en) 2017-12-20 2022-03-16 インスティチュート オブ オーガニック ケミストリー アンド バイオケミストリー エーエスシーアール,ヴイ.ヴイ.アイ. 3'3'cyclic dinucleotide with phosphonate binding that activates the STING adapter protein
US11203610B2 (en) 2017-12-20 2021-12-21 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2′3′ cyclic dinucleotides with phosphonate bond activating the sting adaptor protein
CR20200347A (en) 2018-02-13 2020-09-23 Gilead Sciences Inc Pd-1/pd-l1 inhibitors
TW202005654A (en) 2018-04-06 2020-02-01 捷克科學院有機化學與生物化學研究所 2'2'-cyclic dinucleotides
TWI833744B (en) 2018-04-06 2024-03-01 捷克科學院有機化學與生物化學研究所 3'3'-cyclic dinucleotides
TWI818007B (en) 2018-04-06 2023-10-11 捷克科學院有機化學與生物化學研究所 2'3'-cyclic dinucleotides
CN112041311B (en) 2018-04-19 2023-10-03 吉利德科学公司 PD-1/PD-L1 inhibitors
WO2019211799A1 (en) 2018-05-03 2019-11-07 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2'3'-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide
JP2021523151A (en) 2018-05-11 2021-09-02 ホスホレックス、インコーポレイテッド Microparticles and nanoparticles with negative surface charge
CN112118845B (en) 2018-05-14 2023-06-13 吉利德科学公司 MCL-1 inhibitors
KR20230159715A (en) 2018-07-13 2023-11-21 길리애드 사이언시즈, 인코포레이티드 Pd-1/pd-l1 inhibitors
US11179397B2 (en) 2018-10-03 2021-11-23 Gilead Sciences, Inc. Imidazopyrimidine derivatives
AU2019366355B2 (en) 2018-10-24 2022-10-13 Gilead Sciences, Inc. PD-1/PD-L1 inhibitors
US11071730B2 (en) 2018-10-31 2021-07-27 Gilead Sciences, Inc. Substituted 6-azabenzimidazole compounds
LT3873903T (en) 2018-10-31 2024-05-10 Gilead Sciences, Inc. Substituted 6-azabenzimidazole compounds as hpk1 inhibitors
WO2020178769A1 (en) 2019-03-07 2020-09-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2'3'-cyclic dinucleotides and prodrugs thereof
AU2020231115A1 (en) 2019-03-07 2021-08-26 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 3'3'-cyclic dinucleotides and prodrugs thereof
US11766447B2 (en) 2019-03-07 2023-09-26 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 3′3′-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide as sting modulator
TWI751516B (en) 2019-04-17 2022-01-01 美商基利科學股份有限公司 Solid forms of a toll-like receptor modulator
TWI751517B (en) 2019-04-17 2022-01-01 美商基利科學股份有限公司 Solid forms of a toll-like receptor modulator
EP3972695A1 (en) 2019-05-23 2022-03-30 Gilead Sciences, Inc. Substituted exo-methylene-oxindoles which are hpk1/map4k1 inhibitors
CA3140708A1 (en) 2019-06-18 2020-12-24 Helen Horton Combination of hepatitis b virus (hbv) vaccines and pyridopyrimidine derivatives
CR20210687A (en) 2019-06-25 2022-03-03 Gilead Sciences Inc Flt3l-fc fusion proteins and methods of use
TW202124450A (en) 2019-10-18 2021-07-01 美商四十七股份有限公司 Combination therapies for treating myelodysplastic syndromes and acute myeloid leukemia
JP2022552748A (en) 2019-10-31 2022-12-19 フォーティ セブン, インコーポレイテッド Treatment of hematological cancers with anti-CD47 and anti-CD20
TWI778443B (en) 2019-11-12 2022-09-21 美商基利科學股份有限公司 Mcl1 inhibitors
WO2021130638A1 (en) 2019-12-24 2021-07-01 Carna Biosciences, Inc. Diacylglycerol kinase modulating compounds
WO2021163064A2 (en) 2020-02-14 2021-08-19 Jounce Therapeutics, Inc. Antibodies and fusion proteins that bind to ccr8 and uses thereof
KR20230006891A (en) 2020-05-01 2023-01-11 길리애드 사이언시즈, 인코포레이티드 2,4-dioxopyrimidine compounds that inhibit CD73
TW202302145A (en) 2021-04-14 2023-01-16 美商基利科學股份有限公司 Co-inhibition of cd47/sirpα binding and nedd8-activating enzyme e1 regulatory subunit for the treatment of cancer
US20220389394A1 (en) 2021-05-18 2022-12-08 Gilead Sciences, Inc. METHODS OF USING FLT3L-Fc FUSION PROTEINS
CA3222277A1 (en) 2021-06-23 2022-12-29 Gilead Sciences, Inc. Diacylglyercol kinase modulating compounds
KR20240005901A (en) 2021-06-23 2024-01-12 길리애드 사이언시즈, 인코포레이티드 Diacylglycerol Kinase Modulating Compounds
EP4359389A1 (en) 2021-06-23 2024-05-01 Gilead Sciences, Inc. Diacylglyercol kinase modulating compounds
CA3222439A1 (en) 2021-06-23 2022-12-29 Gilead Sciences, Inc. Diacylglyercol kinase modulating compounds
WO2023278491A1 (en) * 2021-06-28 2023-01-05 Releviate, Llc Mmp-9 antibodies and uses thereof
CA3234909A1 (en) 2021-10-28 2023-05-04 Gilead Sciences, Inc. Pyridizin-3(2h)-one derivatives
WO2023077030A1 (en) 2021-10-29 2023-05-04 Gilead Sciences, Inc. Cd73 compounds
WO2023107954A1 (en) 2021-12-08 2023-06-15 Dragonfly Therapeutics, Inc. Antibodies targeting 5t4 and uses thereof
WO2023107956A1 (en) 2021-12-08 2023-06-15 Dragonfly Therapeutics, Inc. Proteins binding nkg2d, cd16 and 5t4
US20230242508A1 (en) 2021-12-22 2023-08-03 Gilead Sciences, Inc. Ikaros zinc finger family degraders and uses thereof
US20240124412A1 (en) 2021-12-22 2024-04-18 Gilead Sciences, Inc. Ikaros zinc finger family degraders and uses thereof
TW202340168A (en) 2022-01-28 2023-10-16 美商基利科學股份有限公司 Parp7 inhibitors
US20230373950A1 (en) 2022-03-17 2023-11-23 Gilead Sciences, Inc. Ikaros zinc finger family degraders and uses thereof
WO2023183817A1 (en) 2022-03-24 2023-09-28 Gilead Sciences, Inc. Combination therapy for treating trop-2 expressing cancers
TW202345901A (en) 2022-04-05 2023-12-01 美商基利科學股份有限公司 Combination therapy for treating colorectal cancer
US20230374036A1 (en) 2022-04-21 2023-11-23 Gilead Sciences, Inc. Kras g12d modulating compounds
WO2024006929A1 (en) 2022-07-01 2024-01-04 Gilead Sciences, Inc. Cd73 compounds
WO2024064668A1 (en) 2022-09-21 2024-03-28 Gilead Sciences, Inc. FOCAL IONIZING RADIATION AND CD47/SIRPα DISRUPTION ANTICANCER COMBINATION THERAPY
WO2024137852A1 (en) 2022-12-22 2024-06-27 Gilead Sciences, Inc. Prmt5 inhibitors and uses thereof

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8377443B2 (en) * 2010-08-27 2013-02-19 Gilead Biologics, Inc. Antibodies to matrix metalloproteinase 9

Family Cites Families (39)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
GB8823869D0 (en) 1988-10-12 1988-11-16 Medical Res Council Production of antibodies
DE3920358A1 (en) 1989-06-22 1991-01-17 Behringwerke Ag BISPECIFIC AND OLIGO-SPECIFIC, MONO- AND OLIGOVALENT ANTI-BODY CONSTRUCTS, THEIR PRODUCTION AND USE
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
KR100272077B1 (en) 1990-08-29 2000-11-15 젠팜인터내셔날,인코포레이티드 Transgenic non-human animals capable of producing heterologous antibodies
GB9022788D0 (en) 1990-10-19 1990-12-05 Cortecs Ltd Pharmaceutical formulations
DK1136556T3 (en) 1991-11-25 2005-10-03 Enzon Inc Process for the preparation of multivalent antigen-binding proteins
EP0685557B1 (en) 1993-11-30 1998-08-12 Fuji Yakuhin Kogyo Kabushiki Kaisha Novel metalloprotease and dna coding for the same
US5612030A (en) * 1995-01-17 1997-03-18 University Of Kentucky Research Foundation Anti-idiotype monoclonal antibody 1A7 and use for the treatment of melanoma and small cell carcinoma
WO1999062526A2 (en) 1998-06-05 1999-12-09 Mayo Foundation For Medical Education And Research Use of genetically engineered antibodies to cd38 to treat multiple myeloma
US7101975B1 (en) 1999-07-13 2006-09-05 University Of Southern California Method and composition for inhibition of angiogenesis using antagonists based on MMP-9 and β1 integrins
CN1379685A (en) 1999-07-13 2002-11-13 南加利福尼亚大学 Novel method and composition for inhibition of angiogenesis using antagonists based on MMP-9 and beta integrins
AU2002235692A1 (en) 2001-02-23 2002-09-04 Biophage Inc. Methods and compositions for preventing and treating neutrophil-mediated diseases
SE0102298D0 (en) 2001-06-27 2001-06-27 Astrazeneca Ab Crystal structure of enzyme and uses thereof
WO2003006006A1 (en) 2001-07-09 2003-01-23 The Regents Of The University Of California Use of matrix metalloproteinase inhibitors to mitigate nerve damage
WO2003044058A2 (en) 2001-11-23 2003-05-30 Universite Catholique De Louvain Medical use of antibodies directed against human matrix metalloproteinases or related tissue proteinases for the treatment of abnormal uterine bleeding and endometriosis
EP1545611B1 (en) 2002-09-06 2016-11-09 Alexion Pharmaceuticals, Inc. Method of treatment of asthma using antibodies to complement component c5
WO2004076614A2 (en) 2003-02-27 2004-09-10 Bernd Hinzmann Human nucleic acid sequences obtained from prostatic carcinomas
ES2369498T3 (en) * 2003-04-04 2011-12-01 Yeda Research And Development Co., Ltd. ANTIBODIES TO INHIBIT THE ACTIVITY OF MMP-2 AND MMP-9.
WO2006037513A1 (en) 2004-10-09 2006-04-13 Bayer Healthcare Ag Diagnostics and therapeutics for diseases associated with matrix metalloproteinase 9 (mmp9)
JP2008545139A (en) 2005-06-29 2008-12-11 ルールズ−ベースド メディスン,インコーポレーテッド Diagnostic method and diagnostic kit for acute coronary syndrome
KR101434682B1 (en) 2005-12-02 2014-08-27 제넨테크, 인크. Binding polypeptides and uses thereof
WO2007144781A2 (en) 2006-04-21 2007-12-21 Diagnotech Pty. Ltd. Diagnostic methods and kits utilizing antibodies for metalloproteases
WO2008088864A2 (en) 2007-01-18 2008-07-24 The Trustess Of Columbia University In The City Of New York Matrix metalloproteinase-9-related methods
CA2678304A1 (en) * 2007-02-23 2008-08-28 Yeda Research And Development Co. Ltd. Antibodies and pharmaceutical compositions containing same useful for inhibiting activity of metalloproteins
WO2008154439A1 (en) 2007-06-08 2008-12-18 Irm Llc Methods and compositions for inducing apoptosis in cancer cells
CA2695969A1 (en) 2007-08-15 2009-02-19 Yeda Research & Development Co. Ltd. Regulators of mmp-9 and uses therof
JP2011506614A (en) 2007-12-17 2011-03-03 ダイアックス コーポレーション Compositions and methods for treating osteolytic disorders comprising MMP-14 binding proteins
WO2009111508A2 (en) * 2008-03-03 2009-09-11 Dyax Corp. Metalloproteinase 9 and metalloproteinase 2 binding proteins
CA2717576A1 (en) * 2008-03-03 2009-09-11 Dyax Corp. Metalloproteinase 9 binding proteins
WO2010048432A1 (en) 2008-10-22 2010-04-29 Dyax Corp. Combination treatments comprising protease binding proteins for inflammatory disorders
US20110286916A1 (en) 2008-11-20 2011-11-24 Jose Miguel Aste-Amezaga Generation and characterization of anti-notch antibodies for therapeutic and diagnostic use
EP3216805A1 (en) 2010-01-27 2017-09-13 Yeda Research and Development Co. Ltd Antibodies that inhibit metalloproteins
US20110261695A1 (en) * 2010-04-23 2011-10-27 Xiaoming Zhao System and method for network congestion control
MX2014010447A (en) 2012-02-29 2015-06-23 Gilead Biologics Inc Antibodies to matrix metalloproteinase 9.
MD20140107A2 (en) 2012-02-29 2015-03-31 Gilead Biologics, Inc. Antibodies to matrix metalloproteinase 9

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8377443B2 (en) * 2010-08-27 2013-02-19 Gilead Biologics, Inc. Antibodies to matrix metalloproteinase 9
US8501916B2 (en) * 2010-08-27 2013-08-06 Gilead Biologics, Inc. Antibodies to matrix metalloproteinase 9
US9260532B2 (en) * 2010-08-27 2016-02-16 Gilead Biologics, Inc. Antibodies to matrix metalloproteinase 9

Also Published As

Publication number Publication date
US20120135004A1 (en) 2012-05-31
KR20150004936A (en) 2015-01-13
EP2608809A4 (en) 2015-04-01
JP6435381B2 (en) 2018-12-05
KR101930179B1 (en) 2018-12-17
US20130023654A1 (en) 2013-01-24
KR20130063009A (en) 2013-06-13
TR201910348T4 (en) 2019-08-21
US9120863B2 (en) 2015-09-01
CA2808418C (en) 2019-02-05
WO2012027721A2 (en) 2012-03-01
PE20131376A1 (en) 2013-11-25
AP3948A (en) 2016-12-21
JP2016020389A (en) 2016-02-04
CN103140240B (en) 2015-01-21
WO2012027721A3 (en) 2012-08-16
US8377443B2 (en) 2013-02-19
PT2608809T (en) 2019-08-26
CN104530238A (en) 2015-04-22
NZ606880A (en) 2015-01-30
CL2013000535A1 (en) 2014-03-21
KR101827048B1 (en) 2018-02-07
ES2739505T3 (en) 2020-01-31
CN103140240A (en) 2013-06-05
CN104530238B (en) 2019-11-26
MA34527B1 (en) 2013-09-02
SI2608809T1 (en) 2019-08-30
AU2011293125B2 (en) 2015-02-05
AU2011293125A1 (en) 2013-04-18
CA2808418A1 (en) 2012-03-01
US20130281675A1 (en) 2013-10-24
HK1208688A1 (en) 2016-03-11
US20130281676A1 (en) 2013-10-24
MX342413B (en) 2016-09-28
IL224614A (en) 2017-11-30
BR112013004579A2 (en) 2016-02-10
ECSP13012525A (en) 2013-05-31
PL2608809T3 (en) 2019-10-31
JP6198797B2 (en) 2017-09-20
KR101518144B1 (en) 2015-05-28
JP2013539365A (en) 2013-10-24
KR101881724B1 (en) 2018-07-24
EP2608809A2 (en) 2013-07-03
JP2017221216A (en) 2017-12-21
NZ701444A (en) 2016-06-24
AP2013006743A0 (en) 2013-02-28
EA201390146A1 (en) 2013-12-30
MX2013002323A (en) 2013-07-29
ZA201301338B (en) 2016-07-27
CO6680656A2 (en) 2013-05-31
KR20170030659A (en) 2017-03-17
US9260532B2 (en) 2016-02-16
EP2608809B1 (en) 2019-05-22
AP2016009448A0 (en) 2016-09-30
EA031729B1 (en) 2019-02-28
ZA201507081B (en) 2017-02-22
SG10201506703VA (en) 2015-10-29
KR20180014245A (en) 2018-02-07
UA109908C2 (en) 2015-10-26
US8501916B2 (en) 2013-08-06
US20160159923A1 (en) 2016-06-09
IL255300A0 (en) 2017-12-31
JP5878538B2 (en) 2016-03-08
SG188224A1 (en) 2013-04-30
BR112013004579B1 (en) 2019-03-12
US20180086845A1 (en) 2018-03-29
PH12016501691A1 (en) 2017-07-03
CR20130132A (en) 2013-05-29

Similar Documents

Publication Publication Date Title
US9120863B2 (en) Nucleic acids encoding antibodies to matrix metalloproteinase 9
US11634505B2 (en) Antibodies to matrix metalloproteinase 9
AU2015201367B2 (en) Antibodies to matrix metalloproteinase 9
OA18526A (en) Antibodies to Matrix Metalloproteinase 9
NZ629888B2 (en) Antibodies to matrix metalloproteinase 9
OA17085A (en) Antibodies to matrix metalloproteinase 9.

Legal Events

Date Code Title Description
AS Assignment

Owner name: GILEAD BIOLOGICS, INC., CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:MCCAULEY, SCOTT;VAYSBERG, MARIA;SIGNING DATES FROM 20120125 TO 20120130;REEL/FRAME:037642/0274

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION