US20080008717A1 - Polynucleotide Fragments of an Infectious Human Endogenous Retrovirus - Google Patents
Polynucleotide Fragments of an Infectious Human Endogenous Retrovirus Download PDFInfo
- Publication number
- US20080008717A1 US20080008717A1 US11/828,272 US82827207A US2008008717A1 US 20080008717 A1 US20080008717 A1 US 20080008717A1 US 82827207 A US82827207 A US 82827207A US 2008008717 A1 US2008008717 A1 US 2008008717A1
- Authority
- US
- United States
- Prior art keywords
- sequence
- seq
- fragment
- polynucleotide molecule
- merv
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 208000015181 infectious disease Diseases 0.000 title claims abstract description 114
- 230000002458 infectious effect Effects 0.000 title claims abstract description 100
- 241000713887 Human endogenous retrovirus Species 0.000 title claims abstract description 91
- 239000012634 fragment Substances 0.000 title claims abstract description 80
- 108091033319 polynucleotide Proteins 0.000 title claims description 92
- 102000040430 polynucleotide Human genes 0.000 title claims description 92
- 239000002157 polynucleotide Substances 0.000 title claims description 92
- 239000013598 vector Substances 0.000 claims abstract description 40
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 16
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 9
- 229920001184 polypeptide Polymers 0.000 claims abstract description 5
- 108090000623 proteins and genes Proteins 0.000 claims description 37
- 239000002773 nucleotide Substances 0.000 claims description 30
- 125000003729 nucleotide group Chemical group 0.000 claims description 30
- 102000008394 Immunoglobulin Fragments Human genes 0.000 claims description 28
- 108010021625 Immunoglobulin Fragments Proteins 0.000 claims description 28
- 102000004169 proteins and genes Human genes 0.000 claims description 27
- 230000002068 genetic effect Effects 0.000 claims description 23
- 230000007850 degeneration Effects 0.000 claims description 17
- 239000008194 pharmaceutical composition Substances 0.000 claims description 17
- 108010078428 env Gene Products Proteins 0.000 claims description 16
- 239000007787 solid Substances 0.000 claims description 16
- 102100034353 Integrase Human genes 0.000 claims description 15
- 101710177291 Gag polyprotein Proteins 0.000 claims description 12
- 101710125418 Major capsid protein Proteins 0.000 claims description 11
- 230000000295 complement effect Effects 0.000 claims description 11
- 108010089520 pol Gene Products Proteins 0.000 claims description 6
- 229960005486 vaccine Drugs 0.000 claims description 5
- 239000003443 antiviral agent Substances 0.000 claims description 4
- 239000000516 sunscreening agent Substances 0.000 claims description 4
- 230000002238 attenuated effect Effects 0.000 claims description 3
- 239000003937 drug carrier Substances 0.000 claims description 3
- 238000000034 method Methods 0.000 abstract description 23
- 239000000203 mixture Substances 0.000 abstract description 5
- 108091028043 Nucleic acid sequence Proteins 0.000 abstract description 4
- 210000004027 cell Anatomy 0.000 description 141
- 239000002245 particle Substances 0.000 description 101
- 201000001441 melanoma Diseases 0.000 description 72
- 238000002360 preparation method Methods 0.000 description 50
- 239000006228 supernatant Substances 0.000 description 49
- 102100034349 Integrase Human genes 0.000 description 37
- 241001430294 unidentified retrovirus Species 0.000 description 37
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 36
- 239000000523 sample Substances 0.000 description 32
- 108020004414 DNA Proteins 0.000 description 31
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 28
- 241000192019 Human endogenous retrovirus K Species 0.000 description 27
- 239000013615 primer Substances 0.000 description 27
- 241000700605 Viruses Species 0.000 description 24
- 125000000174 L-prolyl group Chemical group [H]N1C([H])([H])C([H])([H])C([H])([H])[C@@]1([H])C(*)=O 0.000 description 21
- 238000006243 chemical reaction Methods 0.000 description 21
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 20
- 239000002953 phosphate buffered saline Substances 0.000 description 20
- 230000003321 amplification Effects 0.000 description 18
- 238000003199 nucleic acid amplification method Methods 0.000 description 18
- 238000004519 manufacturing process Methods 0.000 description 17
- 239000000427 antigen Substances 0.000 description 16
- 108091007433 antigens Proteins 0.000 description 16
- 102000036639 antigens Human genes 0.000 description 16
- 230000001177 retroviral effect Effects 0.000 description 16
- 230000000694 effects Effects 0.000 description 15
- 238000009396 hybridization Methods 0.000 description 15
- 108090000994 Catalytic RNA Proteins 0.000 description 14
- 102000053642 Catalytic RNA Human genes 0.000 description 14
- 125000003412 L-alanyl group Chemical group [H]N([H])[C@@](C([H])([H])[H])(C(=O)[*])[H] 0.000 description 14
- 239000000047 product Substances 0.000 description 14
- 238000003757 reverse transcription PCR Methods 0.000 description 14
- 108091092562 ribozyme Proteins 0.000 description 14
- 230000000875 corresponding effect Effects 0.000 description 13
- 230000003612 virological effect Effects 0.000 description 13
- 206010028980 Neoplasm Diseases 0.000 description 12
- 108091093037 Peptide nucleic acid Proteins 0.000 description 12
- 238000001514 detection method Methods 0.000 description 12
- 108020004999 messenger RNA Proteins 0.000 description 12
- 239000000126 substance Substances 0.000 description 12
- 239000003550 marker Substances 0.000 description 11
- 210000002752 melanocyte Anatomy 0.000 description 11
- 206010027145 Melanocytic naevus Diseases 0.000 description 10
- 208000007256 Nevus Diseases 0.000 description 10
- 241000283690 Bos taurus Species 0.000 description 9
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 9
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 9
- 125000002059 L-arginyl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])C([H])([H])C([H])([H])N([H])C(=N[H])N([H])[H] 0.000 description 9
- 239000003153 chemical reaction reagent Substances 0.000 description 9
- 239000008188 pellet Substances 0.000 description 9
- 238000005406 washing Methods 0.000 description 9
- 108020004437 Endogenous Retroviruses Proteins 0.000 description 8
- 102100027723 Endogenous retrovirus group K member 6 Rec protein Human genes 0.000 description 8
- 125000003338 L-glutaminyl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])C([H])([H])C(=O)N([H])[H] 0.000 description 8
- 201000011510 cancer Diseases 0.000 description 8
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 8
- 239000012528 membrane Substances 0.000 description 8
- 238000010839 reverse transcription Methods 0.000 description 8
- 241001213909 Human endogenous retroviruses Species 0.000 description 7
- 238000004458 analytical method Methods 0.000 description 7
- 239000002299 complementary DNA Substances 0.000 description 7
- 210000005260 human cell Anatomy 0.000 description 7
- 108700004029 pol Genes Proteins 0.000 description 7
- 239000002243 precursor Substances 0.000 description 7
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 6
- 241001465754 Metazoa Species 0.000 description 6
- 230000027455 binding Effects 0.000 description 6
- 239000000872 buffer Substances 0.000 description 6
- 238000001493 electron microscopy Methods 0.000 description 6
- 235000019441 ethanol Nutrition 0.000 description 6
- NBQNWMBBSKPBAY-UHFFFAOYSA-N iodixanol Chemical compound IC=1C(C(=O)NCC(O)CO)=C(I)C(C(=O)NCC(O)CO)=C(I)C=1N(C(=O)C)CC(O)CN(C(C)=O)C1=C(I)C(C(=O)NCC(O)CO)=C(I)C(C(=O)NCC(O)CO)=C1I NBQNWMBBSKPBAY-UHFFFAOYSA-N 0.000 description 6
- 229960004359 iodixanol Drugs 0.000 description 6
- 101150088264 pol gene Proteins 0.000 description 6
- 210000001519 tissue Anatomy 0.000 description 6
- 125000002061 L-isoleucyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])[C@](C([H])([H])[H])([H])C(C([H])([H])[H])([H])[H] 0.000 description 5
- 125000003440 L-leucyl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])C(C([H])([H])[H])([H])C([H])([H])[H] 0.000 description 5
- 206010027476 Metastases Diseases 0.000 description 5
- 230000000903 blocking effect Effects 0.000 description 5
- 238000011109 contamination Methods 0.000 description 5
- 238000003119 immunoblot Methods 0.000 description 5
- 239000012188 paraffin wax Substances 0.000 description 5
- 239000013612 plasmid Substances 0.000 description 5
- 239000013641 positive control Substances 0.000 description 5
- 239000000725 suspension Substances 0.000 description 5
- 238000012546 transfer Methods 0.000 description 5
- 210000004881 tumor cell Anatomy 0.000 description 5
- 108020005544 Antisense RNA Proteins 0.000 description 4
- 241000699800 Cricetinae Species 0.000 description 4
- 102000004190 Enzymes Human genes 0.000 description 4
- 108090000790 Enzymes Proteins 0.000 description 4
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 4
- 125000002435 L-phenylalanyl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])C1=C([H])C([H])=C([H])C([H])=C1[H] 0.000 description 4
- 125000002842 L-seryl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])O[H] 0.000 description 4
- 125000000769 L-threonyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])[C@](O[H])(C([H])([H])[H])[H] 0.000 description 4
- 125000003798 L-tyrosyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C([H])([H])C1=C([H])C([H])=C(O[H])C([H])=C1[H] 0.000 description 4
- 125000003580 L-valyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(C([H])([H])[H])(C([H])([H])[H])[H] 0.000 description 4
- 238000012300 Sequence Analysis Methods 0.000 description 4
- 238000003556 assay Methods 0.000 description 4
- 230000001413 cellular effect Effects 0.000 description 4
- 238000010790 dilution Methods 0.000 description 4
- 239000012895 dilution Substances 0.000 description 4
- 230000002401 inhibitory effect Effects 0.000 description 4
- 239000013642 negative control Substances 0.000 description 4
- 230000010076 replication Effects 0.000 description 4
- 238000010186 staining Methods 0.000 description 4
- 238000001262 western blot Methods 0.000 description 4
- 102000016911 Deoxyribonucleases Human genes 0.000 description 3
- 108010053770 Deoxyribonucleases Proteins 0.000 description 3
- 229920000209 Hexadimethrine bromide Polymers 0.000 description 3
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 3
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 3
- 125000001176 L-lysyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C([H])([H])C([H])([H])C([H])([H])C(N([H])[H])([H])[H] 0.000 description 3
- 108010052285 Membrane Proteins Proteins 0.000 description 3
- 102000018697 Membrane Proteins Human genes 0.000 description 3
- 241000713869 Moloney murine leukemia virus Species 0.000 description 3
- 230000000798 anti-retroviral effect Effects 0.000 description 3
- 238000005119 centrifugation Methods 0.000 description 3
- 210000000805 cytoplasm Anatomy 0.000 description 3
- 238000002405 diagnostic procedure Methods 0.000 description 3
- 238000010185 immunofluorescence analysis Methods 0.000 description 3
- 238000011534 incubation Methods 0.000 description 3
- 210000001165 lymph node Anatomy 0.000 description 3
- 229910001629 magnesium chloride Inorganic materials 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 230000009401 metastasis Effects 0.000 description 3
- 230000002285 radioactive effect Effects 0.000 description 3
- 108020003175 receptors Proteins 0.000 description 3
- 210000003705 ribosome Anatomy 0.000 description 3
- 210000003491 skin Anatomy 0.000 description 3
- 239000000758 substrate Substances 0.000 description 3
- 208000001608 teratocarcinoma Diseases 0.000 description 3
- 238000002560 therapeutic procedure Methods 0.000 description 3
- 238000001890 transfection Methods 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 2
- FWBHETKCLVMNFS-UHFFFAOYSA-N 4',6-Diamino-2-phenylindol Chemical compound C1=CC(C(=N)N)=CC=C1C1=CC2=CC=C(C(N)=N)C=C2N1 FWBHETKCLVMNFS-UHFFFAOYSA-N 0.000 description 2
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 2
- 108020004705 Codon Proteins 0.000 description 2
- 239000003155 DNA primer Substances 0.000 description 2
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 2
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 2
- 102100023933 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Human genes 0.000 description 2
- 125000000010 L-asparaginyl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])C(=O)N([H])[H] 0.000 description 2
- 208000007433 Lymphatic Metastasis Diseases 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- 108010061100 Nucleoproteins Proteins 0.000 description 2
- 229930040373 Paraformaldehyde Natural products 0.000 description 2
- 108091005804 Peptidases Proteins 0.000 description 2
- 102000007079 Peptide Fragments Human genes 0.000 description 2
- 108010033276 Peptide Fragments Proteins 0.000 description 2
- 102000003992 Peroxidases Human genes 0.000 description 2
- 108010076039 Polyproteins Proteins 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- 210000001744 T-lymphocyte Anatomy 0.000 description 2
- 108020004566 Transfer RNA Proteins 0.000 description 2
- COQLPRJCUIATTQ-UHFFFAOYSA-N Uranyl acetate Chemical compound O.O.O=[U]=O.CC(O)=O.CC(O)=O COQLPRJCUIATTQ-UHFFFAOYSA-N 0.000 description 2
- 108010067390 Viral Proteins Proteins 0.000 description 2
- 108020000999 Viral RNA Proteins 0.000 description 2
- 239000011543 agarose gel Substances 0.000 description 2
- 150000001298 alcohols Chemical class 0.000 description 2
- 125000003275 alpha amino acid group Chemical group 0.000 description 2
- 125000000539 amino acid group Chemical group 0.000 description 2
- 230000003466 anti-cipated effect Effects 0.000 description 2
- 238000011225 antiretroviral therapy Methods 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 230000005540 biological transmission Effects 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 238000011088 calibration curve Methods 0.000 description 2
- 230000034303 cell budding Effects 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 239000003184 complementary RNA Substances 0.000 description 2
- 108091036078 conserved sequence Proteins 0.000 description 2
- 108010011219 dUTP pyrophosphatase Proteins 0.000 description 2
- 238000001962 electrophoresis Methods 0.000 description 2
- ZMMJGEGLRURXTF-UHFFFAOYSA-N ethidium bromide Chemical compound [Br-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CC)=C1C1=CC=CC=C1 ZMMJGEGLRURXTF-UHFFFAOYSA-N 0.000 description 2
- 229960005542 ethidium bromide Drugs 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 239000013604 expression vector Substances 0.000 description 2
- 239000011521 glass Substances 0.000 description 2
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 2
- 238000012203 high throughput assay Methods 0.000 description 2
- 230000003053 immunization Effects 0.000 description 2
- 238000007901 in situ hybridization Methods 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 230000010354 integration Effects 0.000 description 2
- 239000006210 lotion Substances 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- 238000002493 microarray Methods 0.000 description 2
- 238000000386 microscopy Methods 0.000 description 2
- 201000006417 multiple sclerosis Diseases 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 102000039446 nucleic acids Human genes 0.000 description 2
- 108020004707 nucleic acids Proteins 0.000 description 2
- 150000007523 nucleic acids Chemical class 0.000 description 2
- 229920002866 paraformaldehyde Polymers 0.000 description 2
- 108040007629 peroxidase activity proteins Proteins 0.000 description 2
- 239000012071 phase Substances 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 239000003161 ribonuclease inhibitor Substances 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 238000013207 serial dilution Methods 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 238000013518 transcription Methods 0.000 description 2
- 230000035897 transcription Effects 0.000 description 2
- 230000009466 transformation Effects 0.000 description 2
- 238000013519 translation Methods 0.000 description 2
- 241000712461 unidentified influenza virus Species 0.000 description 2
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- 208000030507 AIDS Diseases 0.000 description 1
- ITZMJCSORYKOSI-AJNGGQMLSA-N APGPR Enterostatin Chemical compound C[C@H](N)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N1[C@H](C(=O)N[C@@H](CCCN=C(N)N)C(O)=O)CCC1 ITZMJCSORYKOSI-AJNGGQMLSA-N 0.000 description 1
- 239000012103 Alexa Fluor 488 Substances 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 102000004580 Aspartic Acid Proteases Human genes 0.000 description 1
- 108010017640 Aspartic Acid Proteases Proteins 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 102100032532 C-type lectin domain family 10 member A Human genes 0.000 description 1
- 101100180402 Caenorhabditis elegans jun-1 gene Proteins 0.000 description 1
- 108020004635 Complementary DNA Proteins 0.000 description 1
- 108020004394 Complementary RNA Proteins 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- AHCYMLUZIRLXAA-SHYZEUOFSA-N Deoxyuridine 5'-triphosphate Chemical compound O1[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)C[C@@H]1N1C(=O)NC(=O)C=C1 AHCYMLUZIRLXAA-SHYZEUOFSA-N 0.000 description 1
- 108091065810 E family Proteins 0.000 description 1
- 102100038132 Endogenous retrovirus group K member 6 Pro protein Human genes 0.000 description 1
- 102100031780 Endonuclease Human genes 0.000 description 1
- 108010042407 Endonucleases Proteins 0.000 description 1
- 101710091045 Envelope protein Proteins 0.000 description 1
- 101150112014 Gapdh gene Proteins 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 241000282575 Gorilla Species 0.000 description 1
- 208000031886 HIV Infections Diseases 0.000 description 1
- 108090001102 Hammerhead ribozyme Proteins 0.000 description 1
- 101000942296 Homo sapiens C-type lectin domain family 10 member A Proteins 0.000 description 1
- 101000820777 Homo sapiens Syncytin-1 Proteins 0.000 description 1
- 241000578472 Human endogenous retrovirus H Species 0.000 description 1
- 108010061833 Integrases Proteins 0.000 description 1
- 206010064912 Malignant transformation Diseases 0.000 description 1
- 101710159910 Movement protein Proteins 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 206010029488 Nodular melanoma Diseases 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 101710163270 Nuclease Proteins 0.000 description 1
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 1
- 102000011931 Nucleoproteins Human genes 0.000 description 1
- CTQNGGLPUBDAKN-UHFFFAOYSA-N O-Xylene Chemical compound CC1=CC=CC=C1C CTQNGGLPUBDAKN-UHFFFAOYSA-N 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 239000002033 PVDF binder Substances 0.000 description 1
- 241000282577 Pan troglodytes Species 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 239000004743 Polypropylene Substances 0.000 description 1
- 101800000789 Protease-polymerase p70 Proteins 0.000 description 1
- 101800000786 Protease-polymerase p76 Proteins 0.000 description 1
- 102100030232 Protein SON Human genes 0.000 description 1
- 101710148754 Protein SON Proteins 0.000 description 1
- 101710188315 Protein X Proteins 0.000 description 1
- 201000004681 Psoriasis Diseases 0.000 description 1
- 238000010240 RT-PCR analysis Methods 0.000 description 1
- 108020003564 Retroelements Proteins 0.000 description 1
- 208000005074 Retroviridae Infections Diseases 0.000 description 1
- 201000010208 Seminoma Diseases 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 102100036374 Splicing factor 45 Human genes 0.000 description 1
- 101710129494 Splicing factor 45 Proteins 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 102100021696 Syncytin-1 Human genes 0.000 description 1
- 230000005867 T cell response Effects 0.000 description 1
- 108010006785 Taq Polymerase Proteins 0.000 description 1
- 108020005038 Terminator Codon Proteins 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 230000006750 UV protection Effects 0.000 description 1
- 108010015780 Viral Core Proteins Proteins 0.000 description 1
- 108010003533 Viral Envelope Proteins Proteins 0.000 description 1
- 108010065667 Viral Matrix Proteins Proteins 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 150000001413 amino acids Chemical class 0.000 description 1
- 238000000137 annealing Methods 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- OHDRQQURAXLVGJ-HLVWOLMTSA-N azane;(2e)-3-ethyl-2-[(e)-(3-ethyl-6-sulfo-1,3-benzothiazol-2-ylidene)hydrazinylidene]-1,3-benzothiazole-6-sulfonic acid Chemical compound [NH4+].[NH4+].S/1C2=CC(S([O-])(=O)=O)=CC=C2N(CC)C\1=N/N=C1/SC2=CC(S([O-])(=O)=O)=CC=C2N1CC OHDRQQURAXLVGJ-HLVWOLMTSA-N 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 238000010804 cDNA synthesis Methods 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 208000035250 cutaneous malignant susceptibility to 1 melanoma Diseases 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000004925 denaturation Methods 0.000 description 1
- 230000036425 denaturation Effects 0.000 description 1
- XPPKVPWEQAFLFU-UHFFFAOYSA-J diphosphate(4-) Chemical compound [O-]P([O-])(=O)OP([O-])([O-])=O XPPKVPWEQAFLFU-UHFFFAOYSA-J 0.000 description 1
- 235000011180 diphosphates Nutrition 0.000 description 1
- 238000007598 dipping method Methods 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 241001493065 dsRNA viruses Species 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 108700004025 env Genes Proteins 0.000 description 1
- 101150030339 env gene Proteins 0.000 description 1
- 230000007515 enzymatic degradation Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 210000002919 epithelial cell Anatomy 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 108700004026 gag Genes Proteins 0.000 description 1
- 101150098622 gag gene Proteins 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- 238000007654 immersion Methods 0.000 description 1
- 210000004201 immune sera Anatomy 0.000 description 1
- 229940042743 immune sera Drugs 0.000 description 1
- 208000026278 immune system disease Diseases 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 238000010166 immunofluorescence Methods 0.000 description 1
- 238000003125 immunofluorescent labeling Methods 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 239000002054 inoculum Substances 0.000 description 1
- 239000007791 liquid phase Substances 0.000 description 1
- 239000012139 lysis buffer Substances 0.000 description 1
- 230000036212 malign transformation Effects 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 210000004779 membrane envelope Anatomy 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 230000016379 mucosal immune response Effects 0.000 description 1
- 201000000032 nodular malignant melanoma Diseases 0.000 description 1
- 239000002853 nucleic acid probe Substances 0.000 description 1
- 239000002751 oligonucleotide probe Substances 0.000 description 1
- 231100000590 oncogenic Toxicity 0.000 description 1
- 230000002246 oncogenic effect Effects 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 230000000149 penetrating effect Effects 0.000 description 1
- 239000000825 pharmaceutical preparation Substances 0.000 description 1
- 210000002826 placenta Anatomy 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 238000006116 polymerization reaction Methods 0.000 description 1
- -1 polypropylene Polymers 0.000 description 1
- 229920001155 polypropylene Polymers 0.000 description 1
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 101150059999 pro gene Proteins 0.000 description 1
- 230000001566 pro-viral effect Effects 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000004224 protection Effects 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 239000011535 reaction buffer Substances 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 238000003753 real-time PCR Methods 0.000 description 1
- 241000856131 recombinant Influenza A viruses Species 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 238000002976 reverse transcriptase assay Methods 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- 238000003118 sandwich ELISA Methods 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 210000005005 sentinel lymph node Anatomy 0.000 description 1
- 239000002884 skin cream Substances 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 238000003151 transfection method Methods 0.000 description 1
- 230000005945 translocation Effects 0.000 description 1
- 238000011295 triple combination therapy Methods 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- 239000000439 tumor marker Substances 0.000 description 1
- 210000003501 vero cell Anatomy 0.000 description 1
- 230000029812 viral genome replication Effects 0.000 description 1
- 230000017613 viral reproduction Effects 0.000 description 1
- 210000002845 virion Anatomy 0.000 description 1
- 230000029302 virus maturation Effects 0.000 description 1
- 238000003260 vortexing Methods 0.000 description 1
- 239000011534 wash buffer Substances 0.000 description 1
- 239000008096 xylene Substances 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56983—Viruses
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57407—Specifically defined cancers
- G01N33/5743—Specifically defined cancers of skin, e.g. melanoma
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/525—Virus
- A61K2039/5254—Virus avirulent or attenuated
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/10021—Viruses as such, e.g. new isolates, mutants or their genomic sequences
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/10022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
- G01N2333/08—RNA viruses
- G01N2333/15—Retroviridae, e.g. bovine leukaemia virus, feline leukaemia virus, feline leukaemia virus, human T-cell leukaemia-lymphoma virus
Definitions
- the present invention relates to human endogenous retroviruses, fragments thereof, a biologically functional vector comprising sequences of said retrovirus.
- Endogenous retroviruses are integral parts in the genomes of many, if not of all, species. ERVs most probably resulted from infection of germ line cells with exogenous retroviruses and subsequent fixation of their genetic information in the host genome.
- HERVs human endogenous retroviruses
- PBSs primer binding sites
- HERVs endogenous retrovirus sequences
- LTR 5′ long terminal repeat
- human melanoma may also have a viral etiology.
- virus-like particles as well as reverse transcriptase activity in metastases of human melanoma was reported in the early 70s. (Birkmayer et al., Europ. J. Cancer 10 (1974) 419-422).
- virus-like particles are spherical or slightly ovoid and have a diameter of 90-120 nm. They have an electron-dense nucleoid measuring 50-70 nm across and are bounded by a triple-layered, 100 ⁇ thick membrane. Sometimes fine projections extend radially from the nucleoid towards the membrane, and in this case the particles resemble those found in hamster melanoma. Their number is rather small in comparison to that found in hamster melanoma. So far, they have been seen only in the cytoplasm and no infectivity has been observed for these particles (Birkmayer et al., Die Naturwissenschaften 59 (8) (1972), 369-370).
- HERV-K human endogenous retrovirus sequences
- HTDV human teratocarcinoma-derived retrovirus
- HERV-K/HTDV particles were also not infectious: They possess a distinct morphology: (i) they lack the electron lucent space normally seen between viral envelope and core, (ii) they seem to be predominantly arrested in budding stages, and (iii) collapsed cores, a consequence of a final proteolytic step in virus maturation, have never been observed. As long as the gag precursor remains uncleaved, resulting particles are not likely to be infectious.
- HERV-K provirus was shown to be present in gorilla and chimpanzee genomes but not in the human genome (Barbulescu et al., Current Biology 11 (10) (2001), 779-783).
- human endogenous retroviruses have shown to be expressed, however, these virus particles found up to date were all non-infectious virus particles. Some endogenous retrovirus-like particles were found to be expressed in melanoma cells. However, the only infectious endogenous retroviruses found were some animal endogenous retroviruses, e.g. MelARV, a retrovirus capable of infecting cultured murine melanocytes which have also been shown to induce in some instances malignant transformation.
- the WO 01/62937 A1 relates to retrovirus sequences and psoriasis.
- the WO 00/20460 A1 relates to the detection of a HERV-K10 gag-sequence which is brought into relationship with the cancer seminoma, whereby the HERV-K10 gag-sequence is used as tumor marker as well as for therapeutic methods.
- HERV-AVL3-B sequence fragment is brought in connection with methods for the treatment for malign melanomas.
- the WO 99/67395 A1 relates to a 600 bp sequence of an env-gene of a virus family HERV-7q and relates to the use for or in connection with multiple sclerosis, and autoimmune diseases, respectively.
- the JP 9252780 A relates to a method, in which a retrovirus polypeptide of the type HERV-E as a surrogate marker for cancer and other illnesses is detected.
- the WO 01/70941 A2 relates to a retroviral sequence with high homology to the family HERV-H, whereby this sequence is brought into connection with multiple sclerosis.
- the DE 198 11 692 A1 relates to a preparation for the protection against sun rays which is effective against herpes simplex viruses, whereby the preparation comprises organic and anorganic light filters.
- the object of the present invention is therefore to provide at least a fragment of a nucleotide sequence which codes for a further human endogenous retrovirus which is infectious.
- polynucleotide molecule being a fragment of a nucleotide sequence of an infectious human endogenous retrovirus which polynucleotide molecule comprises a sequence selected from the group consisting of
- a polynucleotide molecule as mentioned above codes for (parts of) an infectious human endogenous retrovirus.
- infectious human endogenous retroviruses codes for (parts of) an infectious human endogenous retrovirus.
- the polynucleotide molecule according to the present invention is preferably an isolated and a purified DNA or RNA molecule.
- “Infectious” in the scope of the present application relates especially to retrovirus particles which are able to bind to the receptor of a cell over the env protein and enter into the cell and carry out a reverse transcription in order to produce a cDNA which can integrate into the host cell DNA.
- the differences between the life cycles of different retro elements and between infectious and non-infectious retroviruses is described in the article by Löwer et al. ( Proc. Natl. Acad. Sci 93 (1996), 5177-5184), which is incorporated herein by reference.
- “infectious” human endogenous retroviruses are able to infect bovine MDBK cells and to integrate into these cells' genome.
- sequence according to SEQ ID NO 1 comprises a region which must be present in the polynucleotide molecule in order to code for an infectious human endogenous retrovirus (HERV).
- HERV infectious human endogenous retrovirus
- the polynucleotide molecule according to the present invention can comprise further herein not specifically described sequence regions, in particular LTR regions common to such viruses.
- any here not defined sequence regions can be identified by e.g. amplifying these sequences with the help of optimally designed gene specific primers which will for example bind to the above defined sequence regions.
- the amplification products can then be sequenced. Such methods are well known to the person skilled in the art.
- “Stringent conditions” relate to hybridization reactions under defined hybridization conditions which is a function of factors as concentration of salt or formamide in the hybridization buffer, the temperature of the hybridization and the post-hybridization wash conditions. Such conditions for Northern Blot analysis are for example hybridization at 68° C. with a MERV-specific polynucleotide molecule labeled with dioxigenin or radioactive in a standard SSC hybridization buffer containing 0.1% SDS followed by stringent washing in wash buffer at the same temperature. Stringent washing can be performed for example by two times washing with 2 ⁇ SSC buffer followed by two wash steps with 0.5 ⁇ SSC buffer. In the present case stringent hybridization conditions will preferably involve a temperature of 15° C. to 25° C.
- Tm melting temperature
- Sequences which differ from a given sequence due to the degeneration of the genetic code can be defined by any person skilled in the art. This can be carried out electronically without undue burden.
- deposited vectors MERV-env, MERV-gag, MERV-prt and MERV-pol refer to plasmids deposited at the DSMZ (Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH) according to the Budapest Treaty and comprise the accession numbers DSM1450, DSM14538, DSM14536 and DSM14537.
- sequences inserted into the deposited vectors are concerned not only identical sequences are referred to but also sequences
- the above polynucleotide molecule according to the present invention may further comprise a sequence which is at least 99.7%, 99.8% or 99.9% identical to SEQ ID NO 1.
- the polynucleotide molecule comprises a sequence according to SEQ ID NO 1 and is therefore identical to SEQ ID NO 1.
- This polynucleotide molecule has shown to code for a complete and active infectious particle of a HERV.
- the ORFs of SEQ ID NO 1 are preferably as follows: ORF Nucleotides genetic code gag 1-2013 universal prt 1993-2809 nested reading frame pol 3032-5650 universal env 5352-7451 universal
- polynucleotide molecule which comprises a specific fragment of said above described polynucleotide molecule with a length of at least 15 bp, preferably at least 20 bp, still preferred at least 30 bp.
- the term “specific” defines any fragment which comprises a sequence different to any known HERV sequence. Therefore, any fragment with a length of at least 15 bp which comprises, for example, the in Table 1 mentioned mutations with respect to the known non-infectious HERV K (GeneBank, accession nr. 164614) will be comprised by the polynucleotide molecule according to the present invention. However, these given lengths are minimum lengths and also fragments which are longer, e.g. 100, 1000, 1500 bp, are also comprised by the term “fragment”.
- “Fragments” relate also to specific fragments of the sequences inserted into the vector pCR4-Topo and deposited as MERV-env, MERV-gag, MERV-prt and MERV-pol as mentioned above.
- a polynucleotide molecule encoding for an env protein of an infectious endogenous human retrovirus comprising a sequence selected from the group consisting of
- Env according to the present invention relates also to the sequence inserted into the deposited MERV-env plasmid as mentioned above or a fragment thereof.
- retroviruses are “quasispecies” and sequence variation in a given virus population is given. Such quasispecies variations are, of course, included in the definition of the present viruses and of the sequences of the nucleic acid molecules according to the present invention as long as the infectivity of the virus population as a whole is given.
- Env relates to the envelope protein which is a viral membrane protein mediating the binding of the virus particles to the cellular receptors enabling virus entry which is the first step in a new replication cycle.
- the env protein is particularly important for the ability to spread between cells and individuals (infectivity).
- a further embodiment of the present invention relates to a polynucleotide molecule encoding for a pol protein of a HERV, whereby said polynucleotide molecule comprises a sequence selected from the group consisting of
- polymerase which is an enzyme with RNA dependant reverse transcriptase activity. Also this protein is important for a correct viral replication cycle.
- Poly according to the present invention relates also to the sequence inserted into the deposited MERV-pol plasmid as mentioned above or a fragment thereof.
- a still further aspect of the present invention relates to a polynucleotide molecule encoding for a gag protein of a HERV, whereby said polynucleotide molecule comprises a sequence selected from the group consisting of
- gag gene products have acquired the ability to be transported to the cell surface and abut on the cell membrane incorporating env proteins during this process.
- the gag gene codes for a long polyprotein which in a first step is cut from the long molecule chain and is then cut into a number of parts which are present around the RNA in form of capsomeres. Since these gag proteins are essential for the budding they are important for the infectious viral circle.
- Gag according to the present invention relates also to the sequence inserted into the deposited MERV-gag plasmid as mentioned above or a fragment thereof.
- a further embodiment relates to a polynucleotide molecule encoding for a pro protein of a HERV, whereby said polynucleotide molecule comprises a sequence selected from the group consisting of
- the pro gene comprises 3 regions of particular interest:
- dUTPase hydrolyses dUTP to dUMP and pyrophosphate.
- G_patch ⁇ -glycine rich nucleic binding domain; A predicted glycine rich nucleic binding domain found in the splicing factor 45, SON DNA binding protein and D-type Retrovirus- polyproteins.
- “Pro” relates also to the sequence inserted into the deposited MERV-prt plasmid as mentioned above or a fragment thereof.
- a polynucleotide molecule which comprises a sequence which is complementary to one of the above mentioned sequences according to the present invention. Therefore, not only the sequence according to the RNA strand present in the retrovirus particle is provided but also a sequence according to the cDNA sequence.
- the polynucleotide molecule comprises a detectable label.
- the polynucleotide molecule is a fragment of the above defined sequence, the polynucleotide molecule can be used for the detection of infectious HERV in a sample.
- detecttable label relates to any marker well known in the art, e.g. fluorescent, radioactive, enzymatic or chemical marker.
- a further aspect of the present invention relates to a polynucleotide molecule coding for a ribozyme, which comprises two sections, each of which has a length of at least 10 to 15 base pairs and which are complementary to specific sequence sections of said above identified polynucleotide molecule according to the present invention so that said ribozyme complexes and cuts the mRNA transcribed by a natural infectious human endogenous retrovirus DNA.
- the publication by John M. Burg “Clearing the Way for Ribozymes” (Nat. Biotechnology 15:414-415 (1997)) relates to the general mode of function of ribozymes and is included herein by reference.
- the ribozyme will recognize the mRNA of infectious HERV by complementary base pairing with said mRNA. The ribozyme will then cleave and destroy the RNA in a sequence specific manner before the HERV is translated. After dissociation from the cleaved substrate the ribozyme will repeatedly hybridize with specific RNA molecules and act as specific endonuclease. In general, ribozymes may specifically be produced for inactivation of a certain mRNA even if not the entire DNA sequence which codes for the infectious HERV is known.
- Ribozymes are particularly efficient if the ribosomes move slowly along the mRNA. In that case it is easier for the ribozyme to find a ribosome free site on the mRNA. For this slow ribosomes mutants are also suitable as a system for ribozymes (J. Jayburg (1997), Nature Biotechnology 414-415). A further possible way is also to use a varied form of a ribozyme, i.e. a minizyme. Minizymes are efficient particularly for cleaving larger mRNA molecules. A minizyme is a hammer head ribozyme which has a short oligonucleotide linker instead of the stem/loop II. Primer minizymes are particular efficient (Kuferbara et al. (1998), Nature Biotechnology 16, 961-965).
- the ribozyme comprises sequence sections which are complementary to “specific” sequence sections of the above defined polynucleotide molecule according to the present invention. It is sufficient if at least one of the two sequence sections is specific, meaning that this specific sequence section will only bind to an infectious HERV according to the present invention and not to already known and described non-infectious HERV sequences. Preferably, however, both sequence sections are specific for the above defined polynucleotide molecule according to the present invention, meaning that both sequence sections bind only infectious HERV sequences.
- a further aspect of the present invention refers to a primer pair whereby the primers specifically hybridize to a polynucleotide molecule according to the present invention for an amplification reaction of a fragment of said polynucleotide molecule.
- the term “specifically” refers to primers which will only bind to the above defined polynucleotide molecule according to the present invention and not to any known already described HERV. It is sufficient, if only one of the primers is specific for the inventive polynucleotide molecule, however, preferably both primers bind specifically only to the inventive HERV polynucleotide molecule.
- This primer pair can be used for any detection reaction in order to detect the presence of a HERV in a sample, whereby the term “amplification reaction” relates to any reaction specifically amplifying a sequence corresponding to the above described HERV sequence according to the present invention.
- This may be, for example, a conventional PCR as well as RT-PCR which are both well known to a person skilled in the art.
- the primer pair can also be used to find further herein not defined parts of the infectious HERV provirus according to the present invention.
- the primer pair can furthermore be used to identify other infectious HERVs which comprise, at least partly, similar sequences to the sequence of the infectious HERV according to the present invention.
- primers which are specific for the infectious HERV sequences according to the present invention which e.g. differ from sequences of known (non-infectious) HERVs by only 1, 2 or 3 nucleotides
- primers which are specific for the infectious HERV sequences according to the present invention only hybridize or anneal to the sequences of the infectious HERVs according to the present invention, but not to e.g. the non-infectious HERV sequences known.
- Examples for such specific regions are e.g. the regions covering one or more of the mutations listed in Table 1.
- Further examples may be derived by the skilled man in the art e.g. by comparing the sequences of the present infectious HERV with the known (non-infectious) HERV-K sequences (e.g. HERV-K108).
- a further aspect of the present invention relates to a biologically functional vector comprising a polynucleotide molecule according to the present invention.
- the biologically functional vector will comprise all elements necessary for efficiently expressing the polynucleotide molecule according to the present invention whereby these elements, e.g. the promoter will be selected according to the host into which the functional vector will be transfected and in which the polynucleotide molecule will be expressed, e.g. to produce a protein or polypeptide encoded by the present infectious HERV sequences.
- a person skilled in the art can select the optimal biologically functional vector without undue burden.
- a biologically functional vector comprising a polynucleotide molecule as defined above according to the present invention in inverse orientation with respect to the promoter.
- This vector allows the production of antisense mRNA which is complementary to the mRNA of the infectious HERV according to the present invention.
- the antisense mRNA will bind to the respective region of the infectious HERV mRNA and therefore block any further translation and production of viral proteins and therefore infectious viral particles.
- an essential part of the infectious HERV mRNA is blocked in order to block the production of a complete infectious viral particle, e.g. part of the gag, pol, pro or env mRNA. Therefore, said biologically functional vector can be used in cell cultures to stop the viral production as well as a gene therapy against or prevention of viral replication in a patient.
- a further aspect of the present invention relates to a recombinant host cell stably transfected with said biologically functional vector according to the present invention as defined above.
- the person skilled in the art will select the vector and host cell in order to achieve an effective result, e.g. high expression of the infectious HERV or fragments thereof.
- Transfection methods in order to produce a recombinant host cell are well known to the person skilled in the art and may comprise any electroporation, lipofectamin transfection, salt transfection etc.
- the host cell will either express viral peptides, proteins or particles or produce antisense mRNA.
- the host cell is a mammalian cell. This will allow the production of infectious HERV proteins or peptides with correct post-translational modifications.
- the mammalian cell may be, for example, from any human cell line.
- a further aspect of the present invention relates to a method for producing an infectious human endogenous retrovirus or at least one fragment thereof comprising the steps of
- fragment relates to any peptide encoded by the above defined polynucleotide molecule according to the present invention.
- the fragment will preferably refer to a peptide which can be used as an antigen.
- fragments which can be used as antigens known homologous fragments of corresponding HERVs or ERVs can be used, however, such fragments can also be detected by providing a sample of antibodies of infectious HERV, which sample can be taken of an infected patient, incubating said antibody or antibodies with one or more fragments of the infectious HERV proteins in conditions so that a binding between corresponding antigens and antibodies occur and identifying the respective fragments which have bound to antibodies of infectious HERV.
- a further aspect of the present invention relates to an infectious human endogenous retrovirus comprising as RNA a polynucleotide molecule according to the present invention.
- the infectious HERV according to the present invention will comprise the complete polynucleotide molecule, e.g. comprising the pol, env, gag, pro genes as well as LTR sequences.
- the RNA comprises only one or a few, but not all of the above mentioned genes. It is important that the HERV is able to carry out a complete retroviral replication cycle and infect further cells.
- an infectious human endogenous retrovirus is provided being encoded by a polynucleotide molecule as defined above according to the present invention.
- a further aspect of the present invention relates to a preparation comprising an infectious HERV according to the present invention.
- the preparation may be a pharmaceutical preparation in which case preferably a pharmaceutically acceptable carrier is provided.
- the preparation may also be designed for diagnostic purposes as well as analytical or other purposes, e.g. to produce antibodies, to study the effects in animals etc.
- the preparation according to the present invention will comprise any additional substances depending on the use of the preparation.
- the preparation may comprise further virus particles, as non-infectious HERVs.
- at least one infectious HERV according to the present invention or a significant portion of the preparation leading to the overall infectivity of this preparation must be present.
- a further aspect of the present invention relates to an env protein, a pol protein, a gag, a pro protein encoded by a polynucleotide molecule as defined above according to the present invention.
- proteins can be used for any analytical, diagnostic or production methods and they will be provided in any form, e.g. with additional substances, depending on the use of the protein.
- a peptide which is a specific fragment of said retrovirus as defined above according to the present invention.
- “specific” refers to any fragment which is not identical to a non-infectious HERV fragment already known.
- the fragment may be any fragment of said retrovirus particle, however, preferably said fragment can be used as an antigen (e.g. a T or B cell epitope) and therefore be used in diagnostic methods as well as for the induction of the production of respective antibodies in a patient or animal and/or for the induction of specific T cell responses, both TH1 and TH2.
- the detection of such fragments can be carried out as described above.
- Fragments of the gag protein may be: LMQNEAIEQVRAICL, (SEQ ID NO:9) IPYDWEILAKSSLSP, (SEQ ID NO:10) ADQLLGIGQNWSTIS, (SEQ ID NO:11) TISQQALMQNEAIEQ, (SEQ ID NO:12) EKARKVIVELMAYEN, (SEQ ID NO:13) MAYENANPECQSAIK, (SEQ ID NO:14) PVLNKQNITIQATTT, (SEQ ID NO:15) RSKFDKNGQPLSGNE, (SEQ ID NO:16) LSGNEQRGQPQAPQQ, (SEQ ID NO:17) QPPLSQVFQGISQLP, (SEQ ID NO:18) EIIDKSRKEGDTEAW, (SEQ ID NO:19) VSTKNLIKL, (SEQ ID NO:20) GIGQNWSTI, (SEQ ID NO:21) QYGPNSPYM, (SEQ ID NO:
- Fragments of the env protein may be: PAVDSDLTESLDKHK, (SEQ ID NO:30) WNSQSSIDQKLANQI, (SEQ ID NO:31) VSMDRPWEASPSVHI, (SEQ ID NO:32) PAVQNWLVEVPTVSP, (SEQ ID NO:33) LRPRVNYLQDFSYQR, (SEQ ID NO:34) NTEVLVWEECVANSA, (SEQ ID NO:35) SAVILQNNEFGTIID, (SEQ ID NO:36) QFYHNCSGQTQSCPS, (SEQ ID NO:37) NRSKRFIFTLIAVIM, (SEQ ID NO:38) PYMLVVGNI, (SEQ ID NO:39) IFKASKAHL, (SEQ ID NO:40) KTIGSTTII, (SEQ ID NO:41) GYHYPPICL, (SEQ ID NO:42) SYQRSLKFR, (SEQ ID NO:43) KG
- such peptide fragments contain at least 6 amino acid residues with at least one residue being specific for the present infectious HERV sequences, especially at least one of the amino acid residues not being present in the (non-infectious) HERV-K (HERV-K108). More preferred these peptides have a length from 7 to 15 amino acids, especially from 8 to 11. Such peptide fragments of these lengths are preferably fragments of the above mentioned gag and env fragments.
- a further aspect of the present invention relates to an antibody which is directed against an antigen derived from said retrovirus as defined above according to the present invention.
- the production of antibodies towards any specific antigen may be carried out according to any method well known in the state of the art, e.g. by immunization of an animal and producing the antibodies in cell culture.
- the term “antibody” refers to any form of antibody, e.g. monoclonal, polyclonal, humanized antibody etc.
- the antibodies directed against antigens from the infectious HERV according to the present invention can be used in immunizing methods, diagnostic methods or therapeutic methods.
- an antibody fragment is provided which is directed against an antigen derived from said retrovirus as defined above according to the present invention.
- antibody fragments may be for example Fa, F(ab) 2 or Fv which are capable of binding an epitopic determinant.
- single chain antibodies are comprised by the term “antibody fragment”. These antibody fragments can be used as described above for the antibodies, however, due to their smaller size they may show advantages with respect to stability, production etc.
- the antibody fragment is specific, meaning that the antibody fragment comprises a sequence specific to infectious HERV according to the present invention.
- a further aspect of the present invention relates to a solid support which has attached to its surface said antibodies defined above according to the present invention or said antibody fragments as defined above according to the present invention.
- the solid support according to the present invention may be of any size or shape, e.g. in the form of a flat slide, microtiter plate, chip, filter, column, membrane etc. and may be made of any material generally used for solid supports, e.g. modified or unmodified glass, polymeric material etc.
- the antibody or antibody fragment can be attached to the complete surface of the solid support. However, it may also be attached in localized regions, as for example spots. Also the quantity in which the antibody is bound to said solid support may vary according to the size of the antibody or antibody fragment.
- micro array chips on which the antibodies or antibody fragments are bound in high density.
- the selection of the solid support and the mode of attachment of the antibody to its surface will depend on the use of said solid support, e.g. for preparation, purification methods, detection methods, etc. and a person skilled in the art will be able to select the most appropriate solid support and the optimum mode of attachment of said antibody or antibody fragment to said solid support.
- a further aspect of the present invention relates to a method for diagnosing cancerous cells comprising the steps of
- cancerous cells refers to malignant tumor cells. It has been surprisingly found that the infectious HERV according to the present invention is related to the transformation of cells into cancerous cells, especially melanomas. Therefore, by detecting the presence of said infectious HERV it is possible to diagnose cancerous cells already at a very early stage. Therefore, the term “diagnosing cancerous cells” includes also diagnosing cells which will be transformed into cancerous cells, however, with conventional methods these cells would not yet be diagnosed as transformed.
- the detection method may be carried out according to any protocol known in the art whereby it is possible to detect said infectious HERV or fragment thereof on DNA, RNA or protein level. It is further possible to determine the stage of cancer by determining the amount of infectious HERV.
- said analyzing step comprises an antigen-antibody reaction using an antibody or antibody fragment as defined above according to the present invention in order to detect proteins or protein fragments of said retrovirus.
- any known antigen-antibody reaction may be carried out, e.g. on solid support, in liquid phase, by sandwich-ELISA, etc. It is, of course, possible to detect antibodies in said sample, however, since the production of antibodies may vary, it is preferred to detect an antigen in said sample by providing one or more specific antibodies whereby these antibodies may be bound to a solid support and/or comprise a label which may be detected and quantified.
- said analyzing step comprises detecting the polynucleotide sequence of said retrovirus and a fragment of the polynucleotide sequence specific for said retrovirus, respectively, whereby a hybridization reaction or amplification reaction is carried out using a polynucleotide as defined above according to the present invention.
- polynucleotide sequence comprises RNA sequences, e.g. the polynucleotide molecule derived from the transcription of the respective DNA or the polynucleotide molecule present in the virus particle, as well as DNA, e.g.
- said amplification reaction will comprise PCR as well as RT-PCR. Therefore, the above mentioned primer pair will preferably be used.
- said polynucleotide sequence is transformed into cDNA in a reverse transcription step prior to said hybridization step and amplification reaction, respectively.
- Said hybridization step will be preferably carried out with one of the above defined fragments of said polynucleotide molecule according to the present invention as mentioned above.
- labeled fragments or labeled nucleotides e.g. retroactive nucleotides in order to easily detect and quantify, respectively, said polynucleotide sequence.
- said analyzing step comprises
- the HERV according to the present invention is infectious, the supernatant of said sample—if it comprises an infectious HERV—will infect the cells devoid of said endogenous retrovirus. After infection the infectious HERVs will integrate into said cells and further HERV particles will be produced. After cultivating said cells, therefore, the integrated polynucleotide molecule of the infectious HERV as defined above will be detectable in the DNA of said cells. This is a very reliable and quick method for detecting infectious HERVs. Again, the detection of said polynucleotide molecule may be carried out by a hybridization step and amplification reaction, respectively.
- said cells are non-human cells. Since non-human cells do not comprise HERVs, the detection of a HERV polynucleotide molecule in said human cells will be a clear method of detecting infectious HERV particles.
- said non-human cells are bovine cells. Infectivity of the virus particles with respect to these non-human cells is also a way of defining infectivity according to the present invention.
- said sample is a skin tissue sample from a patient. Since said infectious HERVs preferably infect skin tissue cells, a sample of a skin tissue is preferably used in order to detect said infectious HERVs.
- said sample comprises melanocytes. Since said infectious HERVs are related to cancerous cells a sample comprising melanocytes is a preferred sample for detecting infectious HERVs according to the present invention.
- said sample is a blood sample of said patient.
- a blood sample is very easily and quickly taken from a patient without necessity of costly apparatuses.
- microarrays Furthermore, it is possible to diagnose an unlimited amount of samples in a very short time. As mentioned above for high throughput assays it is preferable to use microarrays.
- said analyzing step comprises an antigen-antibody reaction using an antigen derived from said retrovirus as defined above according to the present invention.
- a first reagent comprising a polynucleotide molecule as defined above according to the present invention, an antibody as defined above according to the present invention or an antibody fragment as defined above according to the present invention or a solid support as defined above according to the present invention and
- a second reagent comprising a polynucleotide comprising a sequence which is complementary to the sequence of said polynucleotide in said first reagent or a retrovirus as defined above according to the present invention, an env protein as defined above according to the present invention, a pol protein as defined above, a gag protein as defined above or a peptide as defined above according to the present invention.
- a further solid support without attached antibodies or antibody fragments. In this case the antibody or antibody fragment as well as the mode of attachment can be varied.
- said antigen is labeled with a detectable marker.
- This marker may be for example radioactive, fluorescent, an enzymatically or chemically detectable marker.
- said antigen is immobilized to a solid support. This allows an easy handling of said kit and the method can be carried out immediately without prior preparations.
- a PNA molecule which comprises a base sequence complementary to the sequence of said polynucleotide molecule as defined above according to the present invention.
- PNA peptide nucleic acid
- PNA is a DNA like sequence, the nucleic basis being bound to a pseudo peptide backbone.
- PNA generally hybridizes with complementary DNA, RNA or DNA polymers by Watson-Creek base pair and helix formation.
- the peptide backbone ensures a greater resistance to enzymatic degradation.
- the PNA molecule thus is an improved antisense agent.
- the advantage lies in that neither nucleases nor proteases are capable of attacking a PNA molecule. Therefore, the PNA molecule is highly stable, if it is bound to a complementary sequence, since it comprises a sufficient steric blocking of DNA and RNA polymerases, reverse transcriptase, telemorase and ribosomes (Buga et al, “Cell Penetrating DNA Constructs Regulate Alanin Receptor Levels and Modify Transmission in vivo”, Nature Biotechnology 16:857-861 (1998)).
- the PNA molecule As in the case of the antisense RNA, if the PNA molecule comprises the above defined sequence it will bind to the DNA/RNA or to a site of the DNA/RNA respectively, which codes for infectious HERV peptides. In this way, the PNA molecule will inhibit the transcription of the virus.
- the PNA molecule is prepared synthetically, e.g. by aid of the T-boc technique, since it is neither transcribed nor translated.
- the present invention also relates to the use of anti-retroviral substances for preparing a medicament to treat melanoma.
- the present invention therefore provides a method for treating patients having or being at risk of developing melanoma comprising administering an effective amount of substances acting against retroviruses, e.g. substances which inhibit replication and polymerization of retroviral (infectious HERV) genomes. Examples of such treatment are e.g. known for the treatment of HIV infections.
- a pharmaceutical composition comprising a polynucleotide as defined above according to the present invention, a vector as defined above according to the present invention, an antibody as defined above, an antibody fragment as defined above and a PNA molecule as defined above, respectively, and a pharmaceutically acceptable carrier.
- the pharmaceutical composition may comprise any further molecules or substances useful for a therapeutic method.
- the pharmaceutical composition may for example be provided as a skin cream or lotion, which may for example be used as an after sun lotion in a preventive manner.
- the pharmaceutical composition further comprises at least one antiviral substance, especially anti-retroviral substances.
- antiviral substances especially anti-retroviral substances.
- these may be any substances well known in the art, for example the agents used in known triple anti-retroviral therapy, see for example Bartlett J A, DeMasi R, Quinn J, Moxham C, Rousseau F. Overview of the effectiveness of triple combination therapy in antiretroviral-naive HIV-1 infected adults. AIDS. 2001 Jul 27;15(11):1369-77; Marimoutou C, Chene G, Mercie P, Neau D, Farbos S, Morlat P, Ceccaldi J, Dabis F.
- a sun cream which comprises a polynucleotide as defined above according to the present invention, an antibody, an antibody fragment as defined above and a PNA molecule as defined above, respectively, and at least one UV-protection substance. Therefore, applying a sun cream with these substances will prevent or inhibit the production of or infection by infectious HERV according to the present invention.
- said sun cream further comprises at least one antiviral substance.
- the same antiviral substance as mentioned above for the pharmaceutical composition will be preferred.
- a vaccine which comprises as an antigen an attenuated retrovirus as mentioned above, an env protein, a pol protein, a gag protein or a peptide as defined above according to the present invention, respectively, and optionally an adjuvant.
- an adjuvant for treating infectious HERV infections.
- FIG. 1 shows the characterization of particle preparations from melanoma cell supernatants.
- FIG. 2 shows an electron microscopy of melanoma cell-derived supernatants.
- FIG. 3 shows the expression of the retroviralpol gene in melanomas.
- FIGS. 4A and 4B show an immunofluorescence analysis with HERV-K-specific antibodies against gag, cORF, and env.
- FIG. 5 shows cells infected with melanoma-associated particles.
- FIG. 6 shows the detection of particle associated RNA and supernatants from infected MDBK cells.
- FIGS. 7A and 7B show the transfer of supernatants from melanoma particle exposed MDBK cells to uninfected MDBK cells.
- FIGS. 8A and 8B show the vector pCR4Topo (SEQ ID NOs:48 and 49) as well as the gag (SEQ ID NO:50), prot (SEQ ID NO:51), pol (SEQ ID NO:52) and env (SEQ ID NO:53) primers.
- RT activity was determined by fluorescent probe-based product enhanced RT (F-PERT) assay as described, with modifications.
- F-PERT fluorescent probe-based product enhanced RT
- pellets were suspended in lysis buffer (Roche). Then RT was performed, using the suspended pellet as source of enzyme, the primer 3′A10 (5′-CACAGGTCAAACCGCCTAGGAATG-3′ (SEQ ID NO:54)), and 0.3 ⁇ g MS2-RNA as a template (Roche # 165948).
- 0.5 ⁇ g calf-thymus DNA was added. After incubation at 42° C.
- the resulting mixture was then amplified by incubating 10 mins at 95° C., followed by 40 cycles at 94° C. for 20 sec and 64° C. for 1 min, in a SD 7700 (Perkin Elmer).
- the calibration curve was generated by plotting the RT activity of a serial dilution of Moloney Murine Leukemia Virus (M-MLV) RT (Superscript II Gibco # 18064-014).
- M-MLV Moloney Murine Leukemia Virus
- detection of reverse transcriptase was performed with a commercially available reverse transcription assay (Boehringer Mannheim). In this procedure, dioxigenin (DIG) and biotin-labeled nucleotides synthesized by the reverse transcriptase are incorporated into the DNA molecule.
- DIG dioxigenin
- biotin-labeled nucleotides synthesized by the reverse transcriptase are incorporated into the DNA molecule.
- Biotion-labeled DNA is then captured to the streptavidin coated surface of the microtiter plates.
- an antibody to DIG conjugated to peroxidase is bound to the dioxigenin-labeled DNA.
- the peroxidase substrate ABTS and a substrate enhancer were added. The absorbance of the samples was determined using a microtiter plate reader. The calibration curve was generated by plotting a serial dilution of an HIV-1 derived RT with defined activity.
- Supernatants were found to contain a fluctuating yet continuously present RT activity, corresponding to the activity of up to 10000 ⁇ units of M-MLV RT (Superscript II, Gibco) per ml supernatant.
- supernatants from cultured melanocytes did not contain detectable RT activity (detection limit 10 ⁇ 1 ⁇ units).
- the fact that supernatants derived from melanoma cells but not from melanocytes contain pelletable RT activity shows that melanoma cells contain proviral sequences with sufficient genetic information to form particles containing a functional RT. Since no RT activity was detected in the supernatants of melanocytes, production of particles containing RT appears to be activated during transformation of melanocytes to malignant cells.
- Retroviral pol genes are generally the most conserved sequences among retroviruses.
- a sequence was amplified by using degenerate primers corresponding to conserved sequences of the pol gene.
- Particle preparations of the melanoma cell line 518A2 and SK-Mel28 were used for RT-PCR analysis. Particles were treated with DNase, to remove contaminating traces of genomic DNA.
- the reaction mixture contained 10 mM Tris-HCl buffer pH 8.3, 50 mM KCl, 1.5 mM MgCl 2 , 0.005% (w/v) gelatin, 0.2 mM dNTPs, 25 pmol of 3′ABDPOLS and 5′ABDPOLAS, 10 ⁇ l of the reverse transcription reaction and 1.25 U Taq polymerase (Boehringer Mannheim) in a final volume of 50 ⁇ l.
- the reaction mixes were overlaid with mineral oil and subjected to 3 thermal cycles of denaturation at 92° C. for 45 s, primer annealing at 45° C. for 45 s and elongation at 72° C. for 60 s, followed by 45 cycles at 92° C.
- each amplification product was analyzed by electrophoresis in a 1.5% agarose gel and visualized by ethidium bromide staining. An aliquot of the amplification product was cloned and sequenced.
- RT-PCR of these preparations revealed the anticipated amplification products of 298 nucleotides. Since no amplification products were obtained when RT was omitted, possible DNA contaminations can be excluded ( FIG. 1 a ).
- A RT-PCR. Particle preparations of the melanoma cell line Mel-Juso were treated with DNase and used for analysis. PCR (lane 1) or RT-PCR (lane 2) with degenerate primers corresponding to sequences that are conserved in retroviral polymerase (pol) genes was performed; M, molecular weight marker (Boehringer Mannheim VIII). No amplification products were obtained in the control reactions without RT, demonstrating the absence of contamination with DNA (lane 1).
- RT-PCR revealed the anticipated amplification products of 298 nucleotides (lane 2).
- B Immunoblotting. Particle preparations from SK-Mel28 supernatants were separated by SDS-PAGE, blotted and HERV-K-specific proteins were detected with antiserum recognizing env (lane 1), gag (lane 3) and the corresponding pre-immunesera, pre-env (lane 2) and pre-gag (lane 4). Molecular weight is indicated to the left.
- RT-PCR of the GAPDH gene was negative, reflecting the lack of contamination with cellular mRNA (data not shown). The amplification product was cloned into an expression vector and sequenced.
- Sequence analysis revealed that the amplified fragment shows high homology to the corresponding pol region of endogenous retrovirus HERV-K.
- Translation of the obtained nucleotide sequence revealed the amino acid sequence IKKKSGKWRMLTDLRAINSVIQPMGALQPGLPSPAIIPKNWPLVVIDLKDSFFTIPL ADQDCEWFAFIIPAVNNLQPAKHF (SEQ ID NO:59).
- This sequence is highly homologous with the corresponding sequences of the HERV-K HML2 and HML3 families. Within these groups the highest identity (90%) was observed for clone NMWV5 (GenBank accession AF0115998). Homology to sequences of type A, B and C retroviruses was less than 70%.
- the sequence analysis excludes contamination with any known non-human retrovirus and suggests an endogenous origin of the packaged RNA.
- Particles derived from SK-Mel28 melanoma cells were purified on iodixanol-cushions and analyzed for the presence of HERV-K-specific env and gag proteins in Western blots.
- Iodixanol-cushion purified particles from SK-Mel28 supernatants were pelleted, resuspended in PBS and analyzed. The amount of soluble proteins was quantified by means of a modified Bradford analysis (Bio-rad, Richmond Calif.). 5 ⁇ g of total protein was applied per lane and separated by SDS-PAGE (10%). Proteins were transferred to PVDF membranes (Millipore, Bedford, Mass.) by Western blotting, and generated blots were incubated with the gag- and env-specific antisera. The membranes were washed twice with blocking solution and HERV-K-specific proteins were detected with an alkaline-phosphatase-conjugated second-step antibody.
- the envelope (env) gene of retroviruses displays an ORF for the surface protein (SU) and a membrane spanning protein (TM).
- the env precursor is usually cleaved into the SU and TM subunits before translocation to the cell surface and incorporation into virus particles.
- immunoblotting with an antiserum recognizing the TM domain was performed. As shown in FIG. 1 b two bands are visible in the Western blot. The upper band corresponds to the precursor migrating at approximately 80 to 90 kDa. In addition, a lower band migrating at approximately 37 kDa is visible, suggesting cleavage of the precursor into subunits.
- Immunoblotting with an HERV-K anti-gag antiserum revealed a double band at approximately 76 kDa, corresponding to gag precursors, as well as processed intermediate gag proteins at approximately 61 kDa, 30 kDa and one band migrating with the front (less than 19 kDa).
- the 30 kDa protein corresponds to the putative major core protein of HERV-K.
- the presence of processed gag proteins in the Western blots indicates a functional protease.
- the grid was exposed to 5 nM colloidal gold conjugated rabbit anti-goat antibody (British Biocell, Cambridge, UK) diluted 1:50 in PBS/1% BSA for 1 h. After fixation in 2.5% glutaraldehyde, washing and negative staining with 1% uranyl acetate, the grid was left to air dry. All grids were examined with a JEOL 1010 electron microscope.
- Iodixanol is an iodinated, nonionic density gradient medium (Nycomed Pharma, Oslo, Norway). It has a low viscosity and provides iso-osmotic conditions up to densities of 1.32 g/ml.
- the supernatants were overlaid on a cushion of 5 ml 50% iodixanol.
- the tubes were centrifuged in an SW28 rotor at 45000 ⁇ g for 2 h at 4° C.
- This fraction was harvested, pelleted in a SW41 rotor at 150000 ⁇ g for 90 min at 4° C., resuspended in PBS and analyzed.
- the cushion-derived fraction was loaded on iodixanol density gradients, and the fraction corresponding to a density of approximately 1.16 g/ml was harvested.
- the harvested fractions were diluted in PBS and pelleted in a SW41 rotor at 150000 ⁇ g for 90 min at 4° C. and resuspended in PBS.
- Pellets were partially purified on iodixanol-cushions ( FIG. 2 , upper part). Alternatively, these fractions were further purified on iodixanol density-gradients ( FIG. 2 , lower part). These preparations were analyzed by immunelectron microscopy using an env-specific antiserum and a colloidal gold conjugated reporter antibody. EM analysis of these preparations revealed the presence of retrovirus-like particles characterized by membrane bound spherical structures with diameters ranging between 80 and 120 nm. The presence of immunogold on the particles indicates that the env protein is present in the envelope.
- the pol Gene is Expressed in Tumor Cells Derived from Melanomas
- the integration sites of human endogenous retroviral elements have been found to be distributed over the whole human genome.
- the HERV-K family was reported to be present in approximately 30 copies per human haploid genome.
- melanoma cells but not melanocytes
- the formation of virus-like particles might be due to the activation of retroviral genes that are usually repressed. Therefore the cloned pol sequence derived from the particle preparations was used as a probe and looked for expression of this sequence in the cytoplasm of melanoma cells by in situ hybridization.
- Touch preparations of a nevus, primary melanoma, and melanoma metastasis were made by dipping freshly excised tissue on coated slides (DAKO, Biotek Solutions). Slides were fixed in 4% paraformaldehyde for 20 mins, washed in PBS, dehydrated through graded alcohols to absolute ethanol, and were air dried.
- hybridization mixtures consisted of Hybrisol VI (Oncor, Gaithersburg) and DIG-labeled cDNA probes, giving a final concentration of 2 ng/ ⁇ l.
- Slides were covered with glass coverslips and sealed with Gelbond (ICN). Probe and cellular material were denatured by heating to 80° C. for 5 mins. Hybridization was carried out at 37° C. overnight in a humid chamber. After removal of the coverslips the slides were washed at 46° C. three times with 50% formamide/2 ⁇ SSC, once with 2 ⁇ SSC for 10 mins, followed by a single wash step in 2 ⁇ SSC containing 0,1% NP40 for 10 mins.
- touch preparations of a nodular melanoma were analyzed, a lymph node metastasis, and a cutaneous metastasis that had been surgically removed from melanoma patients.
- FIG. 3 Touch preparations from primary melanoma (a), lymph node metastasis (b), cutaneous metastasis (c), nevus (d), and a tumor free sentinel lymph node (e) surgically removed from patients were analyzed by in situ hybridization with probes specific for nucleotide sequences of the pol gene (POL), melanoma inhibiting activity gene (MIA), and the influenza virus nucleoprotein (FLU).
- Nucleotide sequences of the pol and the melanoma inhibiting activity genes are found in primary melanoma and lymph node and cutaneous metastases but not in the nevus and tumor free lymph node), high copy numbers of the pol sequence were found in tumor cells of all melanoma preparations tested. In comparison, cells derived from the lymph node and the benign nevus of healthy individuals were negative. A probe specific for the nucleoprotein gene of influenza virus was always negative. As a positive control, a probe recognizing the melanoma-inhibiting activity gene was used. The rate of tumor cells expressing the pol gene was in the range of 60-90%, a percentage similar to the one obtained with the melanoma-inhibiting activity specific probe. The observation that the sequences are not found in all tumor cells might be due to the sensitivity of the assay and variations in the expression levels.
- Immunofluorescence staining was performed by incubating chamber slides, touch preparations, and paraffin sections with HERV-K-specific antibodies at a dilution of 1:100 for 1 h at 37° C. in a humidified box, followed by washing three times with PBS and subsequent incubation with Alexafluor-488-conjugated antibodies at a dilution of 1:200 for 1 h at 37° C.
- Counterstaining was performed by mounting in Vectashield containing DAPI (Vector). Preparations were analyzed by using a Zeiss fluorescence microscope with appropriate filters.
- FIG. 4 a shows that the melanoma cell lines Mel-Juso and SK-Mel28 express the gag, cORF and env proteins.
- the percentage of gag-expressing cells was in the range of 1-10%, cORF was found to be present in about 20%, while expression of the env protein was detected in about 10% of the analyzed cells.
- Expression of gag and env was found in the cytoplasm, while cORF was mainly found in the nucleus.
- cultured human melanocytes (Nhem) and Vero cells did not react with any HERV-K-specific antisera. None of the corresponding preimmune-sera was reactive with any of the cells tested.
- FIG. 4 b shows that gag, cORF, and env were detected in touch preparations and paraffin sections of a primary melanoma but not in the corresponding preparations of a nevus.
- the human epithelial cell line 293 is a well established target for retrovirus infection. Immunofluorescence with HERV-K specific gag antibodies was performed three weeks post infection (p.i.). Control cells were mock-treated. 293 cells were treated with the melanoma-derived viral particles, and demonstrate that upon treatment they express the HERV-K specific gag-protein ( FIG. 5 a ). Moreover, expression of the retroviral proteins correlated with the level of pelletable RT-activity in the supernatants ( FIG. 5 b ), suggesting that the 293 cells were infected with the melanoma-derived particles.
- the cells were continuously passaged at a ratio of 1:10 and the supernatants were analyzed for the presence of viral particles by detecting particle-associated RNA.
- 1.5 ml of the supernatants from infected MDBK cells were put onto new (uninfected) MDBK cells, in the presence of polybrene. 24 hours later the cells were washed twice with PBS and incubated for 7 days, and passaged at a ratio of 1:10.
- the release of particles from the cells was determined by detecting particle-associated RNA in the supernatants by RT-PCR as described below:
- RT reverse transcription
- FIG. 6 shows the result after the first passage.
- Lanes 1-6 After infection cells were passaged 1:10 and supernatants were analyzed by RT-PCR with pol-specific primers (+). Absence of contaminating DNA was analyzed by omitting the RT step ( ⁇ ); Lane 1, no template control; lane 2, heat inactivated particles; lane 3, particle preparation diluted 1:100, lane 4, 1:10 dilution, lane 5, undiluted particle preparations; lane 6, 518A2 supernatant; M, molecular weight marker; Analysis of genomic DNA with pol-specific primers by PCR. Lane 1, no template control; lane 2, no template control; lane 3, MDBK DNA; lane 4, 518A2 DNA, lane 5, no enzyme control.
- Sequence analysis of the amplification product of lane 5 revealed the nucleotide sequence 5 ′ CCACTGTAGAGCCTCCTAAACCCATACCATTAACTTGGAAAACAGAAAAAC CGGTGTGGGTAAATCAGTGGCCGCTACCAAAACAAAAACTGGAGGCTTTACA TTTATTAGCAAATGAACAGTTAGAAAAGGGTCATATTGAGCCTTCGTTCAC CTTGGAATTCTCCTGTGTTTGTAATTCAGAAGAAATCAGGCAAATGGCATAT GTTAACTGACTTAAAGGCCGTAAACGCCGTAATTCAACCCAT 3′ (SEQ ID No 8). This sequence is highly homologues (98%) to the sequence from HERV-K 108.
- FIG. 7 shows the transfer of supernatants from melanoma-particle exposed MDBK cells to uninfected MDBK cells. 24 hours later cells were washed twice with PBS, incubated for one week, and subsequently passaged at a ratio of 1:10.
- FIG. 7 a shows pelleted supernatants from these cells which were analyzed for release of particle-associated RNA by RT-PCR with pol-specific primers (lanes 1, 3, 5, 7). As negative controls supernatants from MDBK cells exposed to heat inactivated particles were transferred to MDBK cells which were treated and analyzed in the same manner (lanes 2, 4, 6, 8).
- Lanes 1 and 2 5 days after transfer; lanes 3 and 4: passage 1; lanes 5 and 6: passage 2; lanes 7 and 8: passage 3; lane M: molecular weight marker (Boehringer Mannheim VIII); lane 9: negative control: pelleted supernatant from uninfected MDBK cells; lane 10: positive control: pelleted supernatants from 518A2 cells; FIG. 7 b shows the expression of HERV-specific RNAs which was analyzed by RT-PCR from whole genomic RNA of MDBK cells from passage 1 with pol-specific primers.
- Lane 1 MDBK cells treated with supernatants from infected MDBK cells; lane 2: MDBK cells treated with supernatants from MDBK cells exposed to heat inactivated melanoma-derived particle preparations; lane M, molecular weight marker (Boehringer Mannheim VIII); lane 3, negative control: PCR of genomic DNA derived from uninfected MDBK cells; lane 4, positive control: PCR of genomic DNA derived from 518A2 cells; lane 5: non-template control. Lanes 1, 3, 5, and 7 correspond to passages 0, 1, 2, and 3 respectively. Lanes 2, 4, 6, and 8 are the negative controls and correspond to passages 0, 1, 2, and 3 of cells treated with supernatants from cells exposed to heat inactivated particle preparations.
- Pol-specific signals were detectable after passages 0, 1, and 3, suggesting the presence of viral particles (lanes 1, 3, and 7). Analysis of passage number 2 did not reveal a pol-signal which might be due to fluctuating production levels of viral particles (lane 5). Transfer of supernatants from MDBK cells that were treated with heat inactivated particle preparations did not result in the release of particles (lanes 2, 4, 6, and 8). PCR alone did not reveal pol-specific signals, indicating that the signals obtained by RT-PCR are derived from RNA. The result that transfer of the supernatant from infected MDBK cells to uninfected MDBK cells resulted in the release of particle associated viral RNA, indicates that infection with melanoma derived particles of MDBK cells is productive.
- FIG. 8 a shows the pCR4-Topo vector into which the MERV gag, pro, pol and env sequences isolated from the above described infected bovine cells were inserted.
- the primers used in the above examples are shown in the boxes of each sequence of vectors shown in FIG. 8 b. These vectors were deposited on 26 Sep. 2001 at the DSMZ under the names MERV-env, MERV-gag, MERV-prt and MERV-pol according to the Budapest Treaty.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- Virology (AREA)
- Biomedical Technology (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Genetics & Genomics (AREA)
- Biotechnology (AREA)
- Oncology (AREA)
- General Physics & Mathematics (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Pathology (AREA)
- Cell Biology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Hospice & Palliative Care (AREA)
- General Engineering & Computer Science (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Tropical Medicine & Parasitology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Communicable Diseases (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
Abstract
Nucleotide sequences and fragments which code for a human endogenous retrovirus which is infectious. “Fragments” according to the present invention relate also to specific fragments of the sequences inserted into the vector pCR4-Topo and deposited as MERV-env, MERV-gag, MERV-prt and MERV-pol as mentioned above. Additionally, methods of using such sequences, polypeptides encoded by such sequences, antibodies directs against such sequences, and methods and compositions relating to the same are all contemplated.
Description
- This application is a divisional of co-pending U.S. application Ser. No. 10/490,920 filed 26 Mar. 2004, which is a national phase application under 35 U.S.C. § 371 of International Application No. PCT/EP02/10899 filed 27 Sep. 2002, which claims priority to Austrian Application No. A 1539/2001 filed 27 Sep. 2001, the contents of which are incorporated herein by reference in their entirety.
- 1. Field of the Invention
- The present invention relates to human endogenous retroviruses, fragments thereof, a biologically functional vector comprising sequences of said retrovirus.
- 2. Description of Related Art
- Endogenous retroviruses (ERVs) are integral parts in the genomes of many, if not of all, species. ERVs most probably resulted from infection of germ line cells with exogenous retroviruses and subsequent fixation of their genetic information in the host genome.
- Many types of human endogenous retroviruses (HERVs) have been characterized previously, and they have been classified into different groups, or families, partly on the basis of their sequence identity and partly according to the similarity of their primer binding sites (PBSs) to host tRNAs. Thus, members of the HERV.H family contain a PBS with a sequence similar to a region of tRNAHis, whereas the HERV.E family is primed by tRNAGlu. Despite the large amount of data available, the classification of the many different HERV families within an overall phylogenetic framework has been hampered for several reasons: (i) some highly divergent retroviruses are primed by the same type of tRNA; (ii) many HERV families have not been fully characterized, and the sequence information that has been reported is often derived from different genomic regions, making interfamily comparisons problematic; and (iii) the relative lack of sequence information on other host taxa has made it difficult to distinguish between genuinely monophyletic HERV families and polyphyletic families that appear monophyletic only because similar viruses in other hosts have not yet been described. A pathogenic potential of nondefective endogenous retroviruses has so far only been demonstrated in mice, in which they may induce tumors and immunological disorders. In human DNA, endogenous retrovirus sequences (HERVs) are well known genetic elements. They all seem to be defective due to multiple termination codons, deletions, or the lack of a 5′ long terminal repeat (LTR). Replication competent human endogenous retrovirus genomes have not yet been isolated.
- Extensive studies on animal melanomas (especially that of the hamster), which serve as model for human malignant melanoma have shown the occurrence of virus particles in the tumors. A high molecular weight (70S) RNA species as well as an RNA-directed DNA polymerase, two diagnostic features for oncoma (oncogenic RNA) viruses have been associated with these particles. Cell-free transmission experiments end to the conclusion that hamster melanomas are caused by an RNA virus.
- Based on these findings the working hypothesis was proposed that human melanoma may also have a viral etiology. In experiments the occurrence of virus-like particles as well as reverse transcriptase activity in metastases of human melanoma was reported in the early 70s. (Birkmayer et al., Europ. J. Cancer 10 (1974) 419-422).
- These virus-like particles are spherical or slightly ovoid and have a diameter of 90-120 nm. They have an electron-dense nucleoid measuring 50-70 nm across and are bounded by a triple-layered, 100 Å thick membrane. Sometimes fine projections extend radially from the nucleoid towards the membrane, and in this case the particles resemble those found in hamster melanoma. Their number is rather small in comparison to that found in hamster melanoma. So far, they have been seen only in the cytoplasm and no infectivity has been observed for these particles (Birkmayer et al., Die Naturwissenschaften 59 (8) (1972), 369-370).
- Also Balda et al. (Proc. Nat. Acad. Sci, USA 72 (9) (1975, 3697-3700) described a high molecular weight RNA encapsulated with an RNA extracted DNA polymerase in particles possessing the identity characteristic of the RNA tumor viruses which was detected in human malignant melanomas. However, also here no infectious particles were observed.
- Only many years later the expression of a family of human endogenous retrovirus sequences (HERV-K) in GH cells, a teratocarcinoma cell line producing the human teratocarcinoma-derived retrovirus (HTDV) particles was described (Lower et al., Proc. Natl. Acad. Sci. USA 90 (1993): 4480-4484). Detailed electron microscopic surveys have revealed the existence of retrovirus-like particles in human placentas and teratocarcinoma cell lines. However, these found HERV-K/HTDV particles were also not infectious: They possess a distinct morphology: (i) they lack the electron lucent space normally seen between viral envelope and core, (ii) they seem to be predominantly arrested in budding stages, and (iii) collapsed cores, a consequence of a final proteolytic step in virus maturation, have never been observed. As long as the gag precursor remains uncleaved, resulting particles are not likely to be infectious.
- A further HERV-K provirus was shown to be present in gorilla and chimpanzee genomes but not in the human genome (Barbulescu et al., Current Biology 11 (10) (2001), 779-783).
- Therefore, human endogenous retroviruses have shown to be expressed, however, these virus particles found up to date were all non-infectious virus particles. Some endogenous retrovirus-like particles were found to be expressed in melanoma cells. However, the only infectious endogenous retroviruses found were some animal endogenous retroviruses, e.g. MelARV, a retrovirus capable of infecting cultured murine melanocytes which have also been shown to induce in some instances malignant transformation.
- In the article by Reus et al. (Journal of Virology, October 2001, 8917-8926) it is stated that the average age of HERV-K proviruses is ca. 28 million years. It is described that at that time the HERV-Ks probably used to be infectious.
- The WO 01/62937 A1 relates to retrovirus sequences and psoriasis.
- In the WO 00/53789 A1 various retroviral expression vectors are listed.
- The WO 00/20460 A1 relates to the detection of a HERV-K10 gag-sequence which is brought into relationship with the cancer seminoma, whereby the HERV-K10 gag-sequence is used as tumor marker as well as for therapeutic methods.
- In the WO 00/06598 A1 a HERV-AVL3-B sequence fragment is brought in connection with methods for the treatment for malign melanomas.
- The WO 99/67395 A1 relates to a 600 bp sequence of an env-gene of a virus family HERV-7q and relates to the use for or in connection with multiple sclerosis, and autoimmune diseases, respectively.
- In the WO 98/24454 A1 the use of a retroviral ribozyme sequence HERV-PTN for the inhibition of tumor growth is described.
- The JP 9252780 A relates to a method, in which a retrovirus polypeptide of the type HERV-E as a surrogate marker for cancer and other illnesses is detected.
- The WO 01/70941 A2 relates to a retroviral sequence with high homology to the family HERV-H, whereby this sequence is brought into connection with multiple sclerosis.
- The DE 198 11 692 A1 relates to a preparation for the protection against sun rays which is effective against herpes simplex viruses, whereby the preparation comprises organic and anorganic light filters.
- The object of the present invention is therefore to provide at least a fragment of a nucleotide sequence which codes for a further human endogenous retrovirus which is infectious.
- The object of the present invention is solved by a polynucleotide molecule being a fragment of a nucleotide sequence of an infectious human endogenous retrovirus which polynucleotide molecule comprises a sequence selected from the group consisting of
-
- (a) a sequence with at least 98%, preferably 99%, still preferred 99.5%, identity to a sequence according to
SEQ ID No 1, - (b) a sequence which hybridizes under stringent conditions with a nucleotide sequence according to said
SEQ ID No 1, - (c) a sequence which differs from said sequences (a) or (b) due to degeneration of the genetic code and
- (d) a sequence comprising sequences inserted into vectors pCR4-Topo and deposited as “MERV-env”, “MERV-gag”, “MERV-prt” and “MERV-pol” at the DSMZ on 26 Sep. 2001 or fragments thereof.
- (a) a sequence with at least 98%, preferably 99%, still preferred 99.5%, identity to a sequence according to
- It has been surprisingly found that a polynucleotide molecule as mentioned above codes for (parts of) an infectious human endogenous retrovirus. With the present invention it can be shown for the first time that not only infectious animal endogenous retroviruses exist but also infectious human endogenous retroviruses. This is particularly surprising due to the fact that human endogenous retroviruses have been known and described for more than 30 years, however, even though many groups have been carrying out research in this field over decades, infectious human endogenous retroviruses could not be isolated or detected so far.
- The polynucleotide molecule according to the present invention is preferably an isolated and a purified DNA or RNA molecule.
- “Infectious” in the scope of the present application relates especially to retrovirus particles which are able to bind to the receptor of a cell over the env protein and enter into the cell and carry out a reverse transcription in order to produce a cDNA which can integrate into the host cell DNA. The differences between the life cycles of different retro elements and between infectious and non-infectious retroviruses is described in the article by Löwer et al. (Proc. Natl. Acad. Sci 93 (1996), 5177-5184), which is incorporated herein by reference.
- Preferably, “infectious” human endogenous retroviruses according to the present invention are able to infect bovine MDBK cells and to integrate into these cells' genome.
- The sequence according to
SEQ ID NO 1 comprises a region which must be present in the polynucleotide molecule in order to code for an infectious human endogenous retrovirus (HERV). However, at both ends the polynucleotide molecule according to the present invention can comprise further herein not specifically described sequence regions, in particular LTR regions common to such viruses. With the present polynucleotide molecule any here not defined sequence regions can be identified by e.g. amplifying these sequences with the help of optimally designed gene specific primers which will for example bind to the above defined sequence regions. The amplification products can then be sequenced. Such methods are well known to the person skilled in the art. - “Stringent conditions” relate to hybridization reactions under defined hybridization conditions which is a function of factors as concentration of salt or formamide in the hybridization buffer, the temperature of the hybridization and the post-hybridization wash conditions. Such conditions for Northern Blot analysis are for example hybridization at 68° C. with a MERV-specific polynucleotide molecule labeled with dioxigenin or radioactive in a standard SSC hybridization buffer containing 0.1% SDS followed by stringent washing in wash buffer at the same temperature. Stringent washing can be performed for example by two times washing with 2×SSC buffer followed by two wash steps with 0.5×SSC buffer. In the present case stringent hybridization conditions will preferably involve a temperature of 15° C. to 25° C. below the melting temperature (Tm), whereby the Tm of a hybridization product of a nucleic acid probe can be calculated using a formula based on the g+c contained in the nucleic acids and that takes chain lengths into account, such as the formula Tm=81.5 to 16.6 (log [na+])+0.41 (% G+C)−600/N), wherein N=chain length (Sambrook et al. (1989), which is incorporated herein by reference). In practice an estimated Tm for an oligonucleotide probe is often confirmed and thus a person skilled in the art can calculate the Tm for any chosen probe whose nucleotide sequence is known.
- Sequences which differ from a given sequence due to the degeneration of the genetic code can be defined by any person skilled in the art. This can be carried out electronically without undue burden.
- In the scope of the present application the deposited vectors MERV-env, MERV-gag, MERV-prt and MERV-pol refer to plasmids deposited at the DSMZ (Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH) according to the Budapest Treaty and comprise the accession numbers DSM1450, DSM14538, DSM14536 and DSM14537.
- In the scope of the present invention, when sequences inserted into the deposited vectors are concerned not only identical sequences are referred to but also sequences
-
- (a) with at least 98%, preferably 99%, still preferred 99.5%, identity to the sequences inserted into the deposited vectors,
- (b) which hybridize under stringent conditions with sequences inserted into the deposited vectors and
- (c) which differ from said sequences inserted into the deposited vectors due to degeneration of the genetic code.
- The above polynucleotide molecule according to the present invention may further comprise a sequence which is at least 99.7%, 99.8% or 99.9% identical to
SEQ ID NO 1. - Preferably, the polynucleotide molecule comprises a sequence according to
SEQ ID NO 1 and is therefore identical toSEQ ID NO 1. This polynucleotide molecule has shown to code for a complete and active infectious particle of a HERV. The ORFs of SEQ ID NO 1 are preferably as follows:ORF Nucleotides genetic code gag 1-2013 universal prt 1993-2809 nested reading frame pol 3032-5650 universal env 5352-7451 universal - Still preferred a polynucleotide molecule is provided which comprises a specific fragment of said above described polynucleotide molecule with a length of at least 15 bp, preferably at least 20 bp, still preferred at least 30 bp. The term “specific” defines any fragment which comprises a sequence different to any known HERV sequence. Therefore, any fragment with a length of at least 15 bp which comprises, for example, the in Table 1 mentioned mutations with respect to the known non-infectious HERV K (GeneBank, accession nr. 164614) will be comprised by the polynucleotide molecule according to the present invention. However, these given lengths are minimum lengths and also fragments which are longer, e.g. 100, 1000, 1500 bp, are also comprised by the term “fragment”.
- “Fragments” according to the present invention relate also to specific fragments of the sequences inserted into the vector pCR4-Topo and deposited as MERV-env, MERV-gag, MERV-prt and MERV-pol as mentioned above.
TABLE 1 position in amino acid position HERV K108 change in (Accession nucleotide change (MERV/ clone name MERV 164614) (MERV/HERV) HERV) MERV gag 416 1515 C/T Ala/Val 602 1701 C/A Arg/Lys 630 1729 A/G Pro/Pro 639 1738 T/C Ala/Ala 654 1753 G/T Pro/Pro 738 1837 G/A Pro/Pro 799 1898 G/A Glu/Lys 802 1901 C/T Leu/leu 866 1965 T/C Met/Thr 945 2044 A/G Ser/Ser 953 2052 T/A Met/Lys 972 2071 A/G Glu/Glu 1149 2248 A/G Gln/Arg 1348 2447 A/G Lys/Gly 1413 2512 C/T Ala/Ala 1642 2741 G/A Gly/Arg 1653 2752 C/T Tyr/Tyr 1668 2767 C/T Ile/Ile 1701 2800 C/T Asn/Asn 1989 3088 A/G Pro/Pro MERV prot 2068 3167 T/C Ile/Thr 2087 3186 C/A Gly/Gly 2090 3189 A/C Pro/Pro 2097 3196 G/A Glu/Lys 2100 3199 A/G Arg/Gly 2124 3223 A/C Arg/Arg 2163 3262 G/A Gly/Ser 2198 3297 G/A Gln/Gln 2238 3337 G/A Gly/Arg 2253 3352 G/C Glu/Gln 2273 3372 T/C Tyr/Tyr 2305 3404 C/T Thr/Ile 2313 3412 T/C Phe/Leu 2330 3429 G/A Pro/Pro 2461 3560 G/A Arg/Gln 2501 3600 T/A Gly/Gly 2502 3601 T/C Phe/Leu 2543 3642 T/G Thr/Thr 2554 3653 G/A Arg/His 2590 3689 G/A Arg/Gln 2654 3753 A/G Ala/Ala 2659-2661 3758-3760 —/ATC —/Ile 2677 3776 T/C Leu/Ser 2741 3840 A/G Gly/Gly 2763 3862 G/A Val/Ile 2808 3907 T/A Tyr/Asn 2815 3914 T/G Phe/Cys 2816 3915 T/C Phe/Cys MERV prot 2878 3977 G/A Arg/Gln 2938 4037 G/A Arg/Gln 2974 4073 A/G His/Arg 3052 4151 C/T Ala/Ala 3091 4190 T/C Pro/Pro 3105 4204 T/C Leu/Pro 3124 4223 C/T Leu/Asp 3178 4277 G/A Ala/Ala MERV pol 3363 4462 A/G Tyr/Cys 3664 4763 A/C Ile/Ile 3700 4799 A/G Ile/Met 4040 5139 C/A Gln/Lys 4115 5214 A/T Met/Leu 4219 5318 G/A Gly/Gly 4225 5324 G/A Lys/Lys 4255 5354 T/G Ser/Ser 4336 5435 C/A Ala/Ala 4465 5564 T/A Thr/Thr 4517 5616 G/C Glu/Gln 4771 5870 G/A Ser/Ser 4780 5879 T/C His/His MERV env 5402 6501 C/T His/His 5719 6818 T/C Ile/Thr 6456 7555 G/A Val/Ile 6458 7557 C/T Val/Ile 6464 7563 A/G Leu/Leu 6802 7901 G/C Gly/Ala 7146 8245 A/G Lys/Glu 7262 8361 A/G Thr/Thr 7340 8439 G/A Arg/Arg 7347 8446 A/G Asn/Asp 7388 8487 A/G Ser/Ser 7436 8535 C/T Val/Val - According to a preferred embodiment of the present invention a polynucleotide molecule encoding for an env protein of an infectious endogenous human retrovirus is provided, said polynucleotide molecule comprising a sequence selected from the group consisting of
- (a) a sequence with at least 98%, preferably 99%, still preferred 99.5%, identity to a sequence according to
SEQ ID No 2, - (b) a sequence which hybridizes under stringent conditions with a nucleotide sequence according to said
SEQ ID No 2 and - (c) a sequence which differs from said sequence (a) or (b) due to degeneration of the genetic code.
- “Env” according to the present invention relates also to the sequence inserted into the deposited MERV-env plasmid as mentioned above or a fragment thereof.
- It is known that retroviruses are “quasispecies” and sequence variation in a given virus population is given. Such quasispecies variations are, of course, included in the definition of the present viruses and of the sequences of the nucleic acid molecules according to the present invention as long as the infectivity of the virus population as a whole is given.
- “Env” relates to the envelope protein which is a viral membrane protein mediating the binding of the virus particles to the cellular receptors enabling virus entry which is the first step in a new replication cycle. The env protein is particularly important for the ability to spread between cells and individuals (infectivity).
- A further embodiment of the present invention relates to a polynucleotide molecule encoding for a pol protein of a HERV, whereby said polynucleotide molecule comprises a sequence selected from the group consisting of
- (a) a sequence with at least 99%, preferably 99.5%, still preferred 99.8%, identity to a sequence according to
SEQ ID No 3, - (b) a sequence which hybridizes under stringent conditions with a nucleotide sequence according to said
SEQ ID No 3 and - (c) a sequence which differs from said sequence (a) or (b) due to degeneration of the genetic code. “pol” relates to the polymerase which is an enzyme with RNA dependant reverse transcriptase activity. Also this protein is important for a correct viral replication cycle.
- “Pol” according to the present invention relates also to the sequence inserted into the deposited MERV-pol plasmid as mentioned above or a fragment thereof.
- A still further aspect of the present invention relates to a polynucleotide molecule encoding for a gag protein of a HERV, whereby said polynucleotide molecule comprises a sequence selected from the group consisting of
- (a) a sequence with at least 98%, preferably 99%, still preferred 99.5%, identity to a sequence according to
SEQ ID No 4, - (b) a sequence which hybridizes under stringent conditions with a nucleotide sequence according to said
SEQ ID No 4 and - (c) a sequence which differs from said sequence (a) or (b) due to degeneration of the genetic code.
- The gag gene products have acquired the ability to be transported to the cell surface and abut on the cell membrane incorporating env proteins during this process. The gag gene codes for a long polyprotein which in a first step is cut from the long molecule chain and is then cut into a number of parts which are present around the RNA in form of capsomeres. Since these gag proteins are essential for the budding they are important for the infectious viral circle.
- “Gag” according to the present invention relates also to the sequence inserted into the deposited MERV-gag plasmid as mentioned above or a fragment thereof.
- A further embodiment relates to a polynucleotide molecule encoding for a pro protein of a HERV, whereby said polynucleotide molecule comprises a sequence selected from the group consisting of
- (a) a sequence with at least 98%, preferably 99%, still preferred 99.5%, identity to a sequence according to
SEQ ID No 5, - (b) a sequence which hybridizes under stringent conditions with a nucleotide sequence according to said
SEQ ID No 5 and - (c) a sequence which differs from said sequence (a) or (b) due to degeneration of the genetic code.
- The pro gene comprises 3 regions of particular interest:
- 1. dUTPase, dUTPase hydrolyses dUTP to dUMP and pyrophosphate.
- 2. prt retroviral Aspartyl-Proteinase
- 3. G_patch, α-glycine rich nucleic binding domain; A predicted glycine rich nucleic binding domain found in the splicing factor 45, SON DNA binding protein and D-type Retrovirus- polyproteins.
- “Pro” according to the present invention relates also to the sequence inserted into the deposited MERV-prt plasmid as mentioned above or a fragment thereof.
- Advantageously, a polynucleotide molecule is provided which comprises a sequence which is complementary to one of the above mentioned sequences according to the present invention. Therefore, not only the sequence according to the RNA strand present in the retrovirus particle is provided but also a sequence according to the cDNA sequence.
- Still preferred, the polynucleotide molecule comprises a detectable label. In particular if the polynucleotide molecule is a fragment of the above defined sequence, the polynucleotide molecule can be used for the detection of infectious HERV in a sample.
- The term “detectable label” relates to any marker well known in the art, e.g. fluorescent, radioactive, enzymatic or chemical marker.
- A further aspect of the present invention relates to a polynucleotide molecule coding for a ribozyme, which comprises two sections, each of which has a length of at least 10 to 15 base pairs and which are complementary to specific sequence sections of said above identified polynucleotide molecule according to the present invention so that said ribozyme complexes and cuts the mRNA transcribed by a natural infectious human endogenous retrovirus DNA. The publication by John M. Burg “Clearing the Way for Ribozymes” (Nat. Biotechnology 15:414-415 (1997)) relates to the general mode of function of ribozymes and is included herein by reference. The ribozyme will recognize the mRNA of infectious HERV by complementary base pairing with said mRNA. The ribozyme will then cleave and destroy the RNA in a sequence specific manner before the HERV is translated. After dissociation from the cleaved substrate the ribozyme will repeatedly hybridize with specific RNA molecules and act as specific endonuclease. In general, ribozymes may specifically be produced for inactivation of a certain mRNA even if not the entire DNA sequence which codes for the infectious HERV is known.
- Ribozymes are particularly efficient if the ribosomes move slowly along the mRNA. In that case it is easier for the ribozyme to find a ribosome free site on the mRNA. For this slow ribosomes mutants are also suitable as a system for ribozymes (J. Jayburg (1997), Nature Biotechnology 414-415). A further possible way is also to use a varied form of a ribozyme, i.e. a minizyme. Minizymes are efficient particularly for cleaving larger mRNA molecules. A minizyme is a hammer head ribozyme which has a short oligonucleotide linker instead of the stem/loop II. Primer minizymes are particular efficient (Kuferbara et al. (1998), Nature Biotechnology 16, 961-965).
- Here again the ribozyme comprises sequence sections which are complementary to “specific” sequence sections of the above defined polynucleotide molecule according to the present invention. It is sufficient if at least one of the two sequence sections is specific, meaning that this specific sequence section will only bind to an infectious HERV according to the present invention and not to already known and described non-infectious HERV sequences. Preferably, however, both sequence sections are specific for the above defined polynucleotide molecule according to the present invention, meaning that both sequence sections bind only infectious HERV sequences.
- A further aspect of the present invention refers to a primer pair whereby the primers specifically hybridize to a polynucleotide molecule according to the present invention for an amplification reaction of a fragment of said polynucleotide molecule. Here again the term “specifically” refers to primers which will only bind to the above defined polynucleotide molecule according to the present invention and not to any known already described HERV. It is sufficient, if only one of the primers is specific for the inventive polynucleotide molecule, however, preferably both primers bind specifically only to the inventive HERV polynucleotide molecule. This primer pair can be used for any detection reaction in order to detect the presence of a HERV in a sample, whereby the term “amplification reaction” relates to any reaction specifically amplifying a sequence corresponding to the above described HERV sequence according to the present invention. This may be, for example, a conventional PCR as well as RT-PCR which are both well known to a person skilled in the art. However, the primer pair can also be used to find further herein not defined parts of the infectious HERV provirus according to the present invention. The primer pair can furthermore be used to identify other infectious HERVs which comprise, at least partly, similar sequences to the sequence of the infectious HERV according to the present invention.
- The skilled man in the art easily finds conditions wherein primers which are specific for the infectious HERV sequences according to the present invention (which e.g. differ from sequences of known (non-infectious) HERVs by only 1, 2 or 3 nucleotides) only hybridize or anneal to the sequences of the infectious HERVs according to the present invention, but not to e.g. the non-infectious HERV sequences known. Examples for such specific regions are e.g. the regions covering one or more of the mutations listed in Table 1. Further examples may be derived by the skilled man in the art e.g. by comparing the sequences of the present infectious HERV with the known (non-infectious) HERV-K sequences (e.g. HERV-K108).
- A further aspect of the present invention relates to a biologically functional vector comprising a polynucleotide molecule according to the present invention. The biologically functional vector will comprise all elements necessary for efficiently expressing the polynucleotide molecule according to the present invention whereby these elements, e.g. the promoter will be selected according to the host into which the functional vector will be transfected and in which the polynucleotide molecule will be expressed, e.g. to produce a protein or polypeptide encoded by the present infectious HERV sequences. A person skilled in the art can select the optimal biologically functional vector without undue burden.
- Still preferred, a biologically functional vector comprising a polynucleotide molecule as defined above according to the present invention in inverse orientation with respect to the promoter is provided. This vector allows the production of antisense mRNA which is complementary to the mRNA of the infectious HERV according to the present invention. The antisense mRNA will bind to the respective region of the infectious HERV mRNA and therefore block any further translation and production of viral proteins and therefore infectious viral particles. Hereby it is sufficient, if an essential part of the infectious HERV mRNA is blocked in order to block the production of a complete infectious viral particle, e.g. part of the gag, pol, pro or env mRNA. Therefore, said biologically functional vector can be used in cell cultures to stop the viral production as well as a gene therapy against or prevention of viral replication in a patient.
- A further aspect of the present invention relates to a recombinant host cell stably transfected with said biologically functional vector according to the present invention as defined above. Here, the person skilled in the art will select the vector and host cell in order to achieve an effective result, e.g. high expression of the infectious HERV or fragments thereof. Transfection methods in order to produce a recombinant host cell are well known to the person skilled in the art and may comprise any electroporation, lipofectamin transfection, salt transfection etc. Depending on the vector which is transfected into the host cell, the host cell will either express viral peptides, proteins or particles or produce antisense mRNA.
- Still preferred the host cell is a mammalian cell. This will allow the production of infectious HERV proteins or peptides with correct post-translational modifications. The mammalian cell may be, for example, from any human cell line.
- A further aspect of the present invention relates to a method for producing an infectious human endogenous retrovirus or at least one fragment thereof comprising the steps of
- (a) transfecting a host cell with a vector as defined above according to the present invention,
- (b) selecting and cultivating cells which are stably transfected with said vector and
- (c) isolating and purifying said retrovirus or said fragment.
- Here again the above mentioned definitions and preferred embodiments apply, in particular with respect to the transfection step and the selection of the host cell and vector. The selection of stably transfected cells may be carried out according to any method well known in the art, e.g. selection with antibiotic resistance or optical selection. The term “fragment” relates to any peptide encoded by the above defined polynucleotide molecule according to the present invention. However, the fragment will preferably refer to a peptide which can be used as an antigen. To detect fragments which can be used as antigens known homologous fragments of corresponding HERVs or ERVs can be used, however, such fragments can also be detected by providing a sample of antibodies of infectious HERV, which sample can be taken of an infected patient, incubating said antibody or antibodies with one or more fragments of the infectious HERV proteins in conditions so that a binding between corresponding antigens and antibodies occur and identifying the respective fragments which have bound to antibodies of infectious HERV.
- A further aspect of the present invention relates to an infectious human endogenous retrovirus comprising as RNA a polynucleotide molecule according to the present invention. Preferably the infectious HERV according to the present invention will comprise the complete polynucleotide molecule, e.g. comprising the pol, env, gag, pro genes as well as LTR sequences. However, it is also possible that the RNA comprises only one or a few, but not all of the above mentioned genes. It is important that the HERV is able to carry out a complete retroviral replication cycle and infect further cells.
- Furthermore, an infectious human endogenous retrovirus is provided being encoded by a polynucleotide molecule as defined above according to the present invention.
- A further aspect of the present invention relates to a preparation comprising an infectious HERV according to the present invention. The preparation may be a pharmaceutical preparation in which case preferably a pharmaceutically acceptable carrier is provided. However, the preparation may also be designed for diagnostic purposes as well as analytical or other purposes, e.g. to produce antibodies, to study the effects in animals etc. Of course, the preparation according to the present invention will comprise any additional substances depending on the use of the preparation. The preparation may comprise further virus particles, as non-infectious HERVs. However, at least one infectious HERV according to the present invention or a significant portion of the preparation leading to the overall infectivity of this preparation must be present.
- A further aspect of the present invention relates to an env protein, a pol protein, a gag, a pro protein encoded by a polynucleotide molecule as defined above according to the present invention. These proteins can be used for any analytical, diagnostic or production methods and they will be provided in any form, e.g. with additional substances, depending on the use of the protein.
- Furthermore a peptide is provided which is a specific fragment of said retrovirus as defined above according to the present invention. Here again, “specific” refers to any fragment which is not identical to a non-infectious HERV fragment already known. As mentioned above already the fragment may be any fragment of said retrovirus particle, however, preferably said fragment can be used as an antigen (e.g. a T or B cell epitope) and therefore be used in diagnostic methods as well as for the induction of the production of respective antibodies in a patient or animal and/or for the induction of specific T cell responses, both TH1 and TH2. The detection of such fragments can be carried out as described above.
- The following fragments are examples of such antigens:
- Fragments of the gag protein may be:
LMQNEAIEQVRAICL, (SEQ ID NO:9) IPYDWEILAKSSLSP, (SEQ ID NO:10) ADQLLGIGQNWSTIS, (SEQ ID NO:11) TISQQALMQNEAIEQ, (SEQ ID NO:12) EKARKVIVELMAYEN, (SEQ ID NO:13) MAYENANPECQSAIK, (SEQ ID NO:14) PVLNKQNITIQATTT, (SEQ ID NO:15) RSKFDKNGQPLSGNE, (SEQ ID NO:16) LSGNEQRGQPQAPQQ, (SEQ ID NO:17) QPPLSQVFQGISQLP, (SEQ ID NO:18) EIIDKSRKEGDTEAW, (SEQ ID NO:19) VSTKNLIKL, (SEQ ID NO:20) GIGQNWSTI, (SEQ ID NO:21) QYGPNSPYM, (SEQ ID NO:22) CPVLNKQNI, (SEQ ID NO:23) LTVWNDWAI, (SEQ ID NO:24) KFDKNGQPL, (SEQ ID NO:25) GKCYNCGQI, (SEQ ID NO:26) HLKKNCPVL, (SEQ ID NO:27) GRKGNIIPL, (SEQ ID NO:28) FSIKMLKDM (SEQ ID NO:29) - Fragments of the env protein may be:
PAVDSDLTESLDKHK, (SEQ ID NO:30) WNSQSSIDQKLANQI, (SEQ ID NO:31) VSMDRPWEASPSVHI, (SEQ ID NO:32) PAVQNWLVEVPTVSP, (SEQ ID NO:33) LRPRVNYLQDFSYQR, (SEQ ID NO:34) NTEVLVWEECVANSA, (SEQ ID NO:35) SAVILQNNEFGTIID, (SEQ ID NO:36) QFYHNCSGQTQSCPS, (SEQ ID NO:37) NRSKRFIFTLIAVIM, (SEQ ID NO:38) PYMLVVGNI, (SEQ ID NO:39) IFKASKAHL, (SEQ ID NO:40) KTIGSTTII, (SEQ ID NO:41) GYHYPPICL, (SEQ ID NO:42) SYQRSLKFR, (SEQ ID NO:43) KGKPCPKEI, (SEQ ID NO:44) VEVPTVSPI, (SEQ ID NO:45) SLRPRVNYL, (SEQ ID NO:46) TFNWQHRIL (SEQ ID NO:47) - Preferably, such peptide fragments contain at least 6 amino acid residues with at least one residue being specific for the present infectious HERV sequences, especially at least one of the amino acid residues not being present in the (non-infectious) HERV-K (HERV-K108). More preferred these peptides have a length from 7 to 15 amino acids, especially from 8 to 11. Such peptide fragments of these lengths are preferably fragments of the above mentioned gag and env fragments.
- A further aspect of the present invention relates to an antibody which is directed against an antigen derived from said retrovirus as defined above according to the present invention. The production of antibodies towards any specific antigen may be carried out according to any method well known in the state of the art, e.g. by immunization of an animal and producing the antibodies in cell culture. The term “antibody” refers to any form of antibody, e.g. monoclonal, polyclonal, humanized antibody etc. The antibodies directed against antigens from the infectious HERV according to the present invention can be used in immunizing methods, diagnostic methods or therapeutic methods.
- Preferably, an antibody fragment is provided which is directed against an antigen derived from said retrovirus as defined above according to the present invention. Such antibody fragments may be for example Fa, F(ab)2 or Fv which are capable of binding an epitopic determinant. Furthermore, single chain antibodies are comprised by the term “antibody fragment”. These antibody fragments can be used as described above for the antibodies, however, due to their smaller size they may show advantages with respect to stability, production etc. Also here, the antibody fragment is specific, meaning that the antibody fragment comprises a sequence specific to infectious HERV according to the present invention.
- A further aspect of the present invention relates to a solid support which has attached to its surface said antibodies defined above according to the present invention or said antibody fragments as defined above according to the present invention. The solid support according to the present invention may be of any size or shape, e.g. in the form of a flat slide, microtiter plate, chip, filter, column, membrane etc. and may be made of any material generally used for solid supports, e.g. modified or unmodified glass, polymeric material etc. Hereby the antibody or antibody fragment can be attached to the complete surface of the solid support. However, it may also be attached in localized regions, as for example spots. Also the quantity in which the antibody is bound to said solid support may vary according to the size of the antibody or antibody fragment. Of course, for high throughput assays it will be advantageous to use micro array chips on which the antibodies or antibody fragments are bound in high density. The selection of the solid support and the mode of attachment of the antibody to its surface will depend on the use of said solid support, e.g. for preparation, purification methods, detection methods, etc. and a person skilled in the art will be able to select the most appropriate solid support and the optimum mode of attachment of said antibody or antibody fragment to said solid support.
- A further aspect of the present invention relates to a method for diagnosing cancerous cells comprising the steps of
- (a) providing a sample of said cells to be tested or supernatant thereof,
- (b) analyzing whether or not said infectious endogenous retrovirus according to the present invention as described above or fragment thereof is present in said sample whereby
- (c) the presence of said retrovirus or fragment thereof in said sample diagnoses cancerous cells.
- The term “cancerous cells” refers to malignant tumor cells. It has been surprisingly found that the infectious HERV according to the present invention is related to the transformation of cells into cancerous cells, especially melanomas. Therefore, by detecting the presence of said infectious HERV it is possible to diagnose cancerous cells already at a very early stage. Therefore, the term “diagnosing cancerous cells” includes also diagnosing cells which will be transformed into cancerous cells, however, with conventional methods these cells would not yet be diagnosed as transformed.
- However, it is not necessary to detect the complete infectious endogenous retrovirus. It is sufficient to detect at least one specific fragment thereof. Here again, the term “specific” refers to a fragment containing a sequence which differs from the sequences of the known non-infectious HERVs. The detection method may be carried out according to any protocol known in the art whereby it is possible to detect said infectious HERV or fragment thereof on DNA, RNA or protein level. It is further possible to determine the stage of cancer by determining the amount of infectious HERV.
- Preferably, said analyzing step comprises an antigen-antibody reaction using an antibody or antibody fragment as defined above according to the present invention in order to detect proteins or protein fragments of said retrovirus. Here, any known antigen-antibody reaction may be carried out, e.g. on solid support, in liquid phase, by sandwich-ELISA, etc. It is, of course, possible to detect antibodies in said sample, however, since the production of antibodies may vary, it is preferred to detect an antigen in said sample by providing one or more specific antibodies whereby these antibodies may be bound to a solid support and/or comprise a label which may be detected and quantified.
- According to a preferred method said analyzing step comprises detecting the polynucleotide sequence of said retrovirus and a fragment of the polynucleotide sequence specific for said retrovirus, respectively, whereby a hybridization reaction or amplification reaction is carried out using a polynucleotide as defined above according to the present invention. Hereby, the term “polynucleotide sequence” comprises RNA sequences, e.g. the polynucleotide molecule derived from the transcription of the respective DNA or the polynucleotide molecule present in the virus particle, as well as DNA, e.g. cDNA resulting from the reverse transcriptase reaction thereafter, whereby the cDNA may be still present in the virus particle or also the DNA already integrated into the host DNA. Therefore, said amplification reaction will comprise PCR as well as RT-PCR. Therefore, the above mentioned primer pair will preferably be used.
- Advantageously, said polynucleotide sequence is transformed into cDNA in a reverse transcription step prior to said hybridization step and amplification reaction, respectively. Said hybridization step will be preferably carried out with one of the above defined fragments of said polynucleotide molecule according to the present invention as mentioned above. Hereby it is, of course, possible to use labeled fragments or labeled nucleotides, e.g. retroactive nucleotides in order to easily detect and quantify, respectively, said polynucleotide sequence.
- According to a further preferred method said analyzing step comprises
- a) providing cells devoid of said endogenous retrovirus,
- (b) adding said supernatant of said sample to said cells,
- (c) cultivating said cells and
- (d) detecting a polynucleotide molecule as defined above according to the present invention in the DNA of said cells.
- Since the HERV according to the present invention is infectious, the supernatant of said sample—if it comprises an infectious HERV—will infect the cells devoid of said endogenous retrovirus. After infection the infectious HERVs will integrate into said cells and further HERV particles will be produced. After cultivating said cells, therefore, the integrated polynucleotide molecule of the infectious HERV as defined above will be detectable in the DNA of said cells. This is a very reliable and quick method for detecting infectious HERVs. Again, the detection of said polynucleotide molecule may be carried out by a hybridization step and amplification reaction, respectively.
- Preferably said cells are non-human cells. Since non-human cells do not comprise HERVs, the detection of a HERV polynucleotide molecule in said human cells will be a clear method of detecting infectious HERV particles. Preferably, said non-human cells are bovine cells. Infectivity of the virus particles with respect to these non-human cells is also a way of defining infectivity according to the present invention.
- Still preferred said sample is a skin tissue sample from a patient. Since said infectious HERVs preferably infect skin tissue cells, a sample of a skin tissue is preferably used in order to detect said infectious HERVs.
- Still preferred, said sample comprises melanocytes. Since said infectious HERVs are related to cancerous cells a sample comprising melanocytes is a preferred sample for detecting infectious HERVs according to the present invention.
- According to a preferred embodiment of the present invention a method is provided for diagnosing cancer in a patient comprising the steps of
- (a) providing a sample of said patient to be tested,
- (b) analyzing whether or not at least one antibody as defined above or antibody fragment as defined above according to the present invention is present in said sample whereby
- (c) the presence of said antibody or fragment thereof in said sample diagnoses cancer.
- Here again, the same definitions and preferred embodiments as mentioned above apply.
- Preferably said sample is a blood sample of said patient. A blood sample is very easily and quickly taken from a patient without necessity of costly apparatuses.
- Furthermore, it is possible to diagnose an unlimited amount of samples in a very short time. As mentioned above for high throughput assays it is preferable to use microarrays.
- According to an advantageous method said analyzing step comprises an antigen-antibody reaction using an antigen derived from said retrovirus as defined above according to the present invention. Here again, the above mentioned definitions and preferred embodiments apply.
- According to a further advantageous embodiment a kit is provided for diagnosing cancerous cells according to the method as mentioned above according to the present invention comprising
- (a) a first reagent comprising a polynucleotide molecule as defined above according to the present invention, an antibody as defined above according to the present invention or an antibody fragment as defined above according to the present invention or a solid support as defined above according to the present invention and
- (b) as a positive control a second reagent comprising a polynucleotide comprising a sequence which is complementary to the sequence of said polynucleotide in said first reagent or a retrovirus as defined above according to the present invention, an env protein as defined above according to the present invention, a pol protein as defined above, a gag protein as defined above or a peptide as defined above according to the present invention. Here again, the same definitions and preferred embodiments as described above apply. Of course, it is also possible to provide additionally to the first reagent a further solid support without attached antibodies or antibody fragments. In this case the antibody or antibody fragment as well as the mode of attachment can be varied.
- According to a further embodiment of the present invention a kit for carrying out a method for diagnosing cancer in a patient as described above is provided comprising
- (a) a first reagent comprising an antigen derived from said retrovirus as defined above and
- (b) as a positive control a second reagent comprising an antibody according to the present invention or an antibody fragment as defined above specific for said antigen in said first reagent.
- Here again the same definitions and preferred embodiments as described above apply.
- Preferably, said antigen is labeled with a detectable marker. This marker may be for example radioactive, fluorescent, an enzymatically or chemically detectable marker.
- Such markers are well known in the state of the art and the person skilled in the art will be able to select the optimal marker.
- Still preferred, said antigen is immobilized to a solid support. This allows an easy handling of said kit and the method can be carried out immediately without prior preparations.
- According to a further embodiment of the present invention a PNA molecule is provided which comprises a base sequence complementary to the sequence of said polynucleotide molecule as defined above according to the present invention. PNA (peptide nucleic acid) is a DNA like sequence, the nucleic basis being bound to a pseudo peptide backbone. PNA generally hybridizes with complementary DNA, RNA or DNA polymers by Watson-Creek base pair and helix formation. The peptide backbone ensures a greater resistance to enzymatic degradation. The PNA molecule thus is an improved antisense agent.
- Here, the advantage lies in that neither nucleases nor proteases are capable of attacking a PNA molecule. Therefore, the PNA molecule is highly stable, if it is bound to a complementary sequence, since it comprises a sufficient steric blocking of DNA and RNA polymerases, reverse transcriptase, telemorase and ribosomes (Buga et al, “Cell Penetrating DNA Constructs Regulate Alanin Receptor Levels and Modify Transmission in vivo”, Nature Biotechnology 16:857-861 (1998)).
- As in the case of the antisense RNA, if the PNA molecule comprises the above defined sequence it will bind to the DNA/RNA or to a site of the DNA/RNA respectively, which codes for infectious HERV peptides. In this way, the PNA molecule will inhibit the transcription of the virus. The PNA molecule is prepared synthetically, e.g. by aid of the T-boc technique, since it is neither transcribed nor translated.
- The present invention also relates to the use of anti-retroviral substances for preparing a medicament to treat melanoma. The present invention therefore provides a method for treating patients having or being at risk of developing melanoma comprising administering an effective amount of substances acting against retroviruses, e.g. substances which inhibit replication and polymerization of retroviral (infectious HERV) genomes. Examples of such treatment are e.g. known for the treatment of HIV infections.
- Preferably, a pharmaceutical composition is provided comprising a polynucleotide as defined above according to the present invention, a vector as defined above according to the present invention, an antibody as defined above, an antibody fragment as defined above and a PNA molecule as defined above, respectively, and a pharmaceutically acceptable carrier. Of course, the pharmaceutical composition may comprise any further molecules or substances useful for a therapeutic method. The pharmaceutical composition may for example be provided as a skin cream or lotion, which may for example be used as an after sun lotion in a preventive manner.
- Preferably, the pharmaceutical composition further comprises at least one antiviral substance, especially anti-retroviral substances. These may be any substances well known in the art, for example the agents used in known triple anti-retroviral therapy, see for example Bartlett J A, DeMasi R, Quinn J, Moxham C, Rousseau F. Overview of the effectiveness of triple combination therapy in antiretroviral-naive HIV-1 infected adults. AIDS. 2001 Jul 27;15(11):1369-77; Marimoutou C, Chene G, Mercie P, Neau D, Farbos S, Morlat P, Ceccaldi J, Dabis F. Prognostic factors of combined viral load and CD4+ cell count responses under triple antiretroviral therapy, Aquitaine cohort, 1996-1998. J Acquir Immune Defic Syndr. 2001
Jun 1;27(2):161-7, which are incorporated herein by reference. - According to a further embodiment of the present invention a sun cream is provided which comprises a polynucleotide as defined above according to the present invention, an antibody, an antibody fragment as defined above and a PNA molecule as defined above, respectively, and at least one UV-protection substance. Therefore, applying a sun cream with these substances will prevent or inhibit the production of or infection by infectious HERV according to the present invention.
- Preferably, said sun cream further comprises at least one antiviral substance. Here, the same antiviral substance as mentioned above for the pharmaceutical composition will be preferred.
- According to a further embodiment of the present invention a vaccine is provided which comprises as an antigen an attenuated retrovirus as mentioned above, an env protein, a pol protein, a gag protein or a peptide as defined above according to the present invention, respectively, and optionally an adjuvant. Such a vaccine when applied to a patient will induce the production of antibodies and/or T cells, which can inhibit infectious HERVs according to the present invention. Therefore, such a vaccine is a highly effective substance for treating infectious HERV infections. The production of vaccines against retroviruses is described in “Hyperattenuated Recombinant Influenza A Virus Nonstructural-Protein-Encoding Vectors Induce Human
Immunodeficiency Virus Type 1 Nef-Specific Systemic and Mucosal Immune Responses in Mice”, Boris Ferko, Jana Stasakova, Sabine Sereinig, Julia Romanova, Dietmar Katinger, Brigitte Niebler, Hermann Katinger, and Andrej Egorov. Journal of Virology, October 2001, p. 8899-8908, Vol. 75, No. 19, which is incorporated herein by reference. - The present invention is described in more detail with the help of the following examples and figures to which it should not, however, be limited.
- In the drawings:
-
FIG. 1 shows the characterization of particle preparations from melanoma cell supernatants. -
FIG. 2 shows an electron microscopy of melanoma cell-derived supernatants. -
FIG. 3 shows the expression of the retroviralpol gene in melanomas. -
FIGS. 4A and 4B show an immunofluorescence analysis with HERV-K-specific antibodies against gag, cORF, and env. -
FIG. 5 shows cells infected with melanoma-associated particles. -
FIG. 6 shows the detection of particle associated RNA and supernatants from infected MDBK cells. -
FIGS. 7A and 7B show the transfer of supernatants from melanoma particle exposed MDBK cells to uninfected MDBK cells. -
FIGS. 8A and 8B show the vector pCR4Topo (SEQ ID NOs:48 and 49) as well as the gag (SEQ ID NO:50), prot (SEQ ID NO:51), pol (SEQ ID NO:52) and env (SEQ ID NO:53) primers. - To detect extracellular virions, supernatants from the melanoma cell lines SKMel-28, SKMel-1, 518A2 were analyzed, as well as primary melanoma cells for pelletable RT. Supernatants from cultured human neonatal melanocytes (NHEM) served as controls. Cell-free supernatants from approximately 106 cells were concentrated by centrifugation. The RT activity of the resulting pellets was analyzed by F-PERT assay.
- Supernatants from melanoma cell lines, and normal human melanocytes were centrifuged at 3000×g at 4° C. and sterile-filtered through a 0.22 μm low-protein membrane (Nunc) to remove cells and cellular debris. The clarified supernatants were centrifuged for 20 min at 250000×g at 4° C. in a Beckman SW50.1 rotor. Pellets were rinsed with phosphate-buffered saline (PBS) and centrifuged for 15 min at 250000×g and resuspended. The resulting particle suspensions were used as an enzyme source for RT assays.
- Pelleted particles derived from 4 ml cell-free supernatants of approximately 106 cells were analyzed. RT activity was determined by fluorescent probe-based product enhanced RT (F-PERT) assay as described, with modifications. First, pellets were suspended in lysis buffer (Roche). Then RT was performed, using the suspended pellet as source of enzyme, the
primer 3′A10 (5′-CACAGGTCAAACCGCCTAGGAATG-3′ (SEQ ID NO:54)), and 0.3 μg MS2-RNA as a template (Roche # 165948). To limit unspecific reverse transcription, 0.5 μg calf-thymus DNA (Sigma # D4522) was added. After incubation at 42° C. for 1 h, a 5 μl aliquot of this reaction was amplified by real-time PCR, by adding 25 μl TaqMan Universal PCR Master Mix (Applied Biosystems # 4304437), 1 μl of theprimers 3′A10 and 5′A 11 (5′-TCCTGCTCAACTTCCTGTCGAG-3′ (SEQ ID NO:55)) at a concentration of 10 μM each, 1 μl F-PERT probe (genxpress, 10 μM, 5′(FAM)-TCTTTAGCGAGACGCTACCATGGCTA-(TAMRA)3′ (SEQ ID NO:56)), and 17 μl AD. The resulting mixture was then amplified by incubating 10 mins at 95° C., followed by 40 cycles at 94° C. for 20 sec and 64° C. for 1 min, in a SD 7700 (Perkin Elmer). The calibration curve was generated by plotting the RT activity of a serial dilution of Moloney Murine Leukemia Virus (M-MLV) RT (Superscript II Gibco # 18064-014). Alternatively, detection of reverse transcriptase was performed with a commercially available reverse transcription assay (Boehringer Mannheim). In this procedure, dioxigenin (DIG) and biotin-labeled nucleotides synthesized by the reverse transcriptase are incorporated into the DNA molecule. Biotion-labeled DNA is then captured to the streptavidin coated surface of the microtiter plates. In a subsequent step, an antibody to DIG conjugated to peroxidase is bound to the dioxigenin-labeled DNA. In the final step, the peroxidase substrate ABTS and a substrate enhancer were added. The absorbance of the samples was determined using a microtiter plate reader. The calibration curve was generated by plotting a serial dilution of an HIV-1 derived RT with defined activity. - Supernatants were found to contain a fluctuating yet continuously present RT activity, corresponding to the activity of up to 10000 μunits of M-MLV RT (Superscript II, Gibco) per ml supernatant. On the other hand, supernatants from cultured melanocytes did not contain detectable RT activity (
detection limit 10−1 μunits). The fact that supernatants derived from melanoma cells but not from melanocytes contain pelletable RT activity shows that melanoma cells contain proviral sequences with sufficient genetic information to form particles containing a functional RT. Since no RT activity was detected in the supernatants of melanocytes, production of particles containing RT appears to be activated during transformation of melanocytes to malignant cells. - Retroviral pol genes are generally the most conserved sequences among retroviruses. In an attempt to analyze the particle preparations on a molecular level, a sequence was amplified by using degenerate primers corresponding to conserved sequences of the pol gene. Particle preparations of the melanoma cell line 518A2 and SK-Mel28 were used for RT-PCR analysis. Particles were treated with DNase, to remove contaminating traces of genomic DNA.
-
Oligonucleotide primers 3′ABDPOLS 5′dCATTCCTTGTGGTAAAACTTTCCA[T/C]TG 3′ (SEQ ID NO:57) and 5′ABDPOLAS 5′dCCCCTTGGAATACTCCTGTTTT[T/C]TG 3′ (SEQ ID NO:58) (Codon Genetic Systems, Austria), derived from conserved regions within the retroviral reverse transcriptase (RT), were adopted from Medstrand and Blomberg. In order to release viral RNA, the particle suspension was transferred to a 0.5 ml polypropylene microcentrifuge tube (Sorensen Inc., USA). Then 10 μl of sterile water containing 0.1% Triton X-100 and 10 U RNase inhibitor (Gibco) was added and incubated at 65° C. for 10 min. The reverse transcription was performed in the same tubes. A mixture containing 50 mM Tris-HCl buffer pH 8.3, 50 mM KCl, 7.5 mM MgCl2, 5 mM DTT, 1 mM dNTPs, 20pmol primer 3′ABDPOLA, 10 U RNase inhibitor and 100 U of Superscript II RT (Gibco) in a final volume of 20 μl was added while the tubes were kept on ice. The reaction was performed at 42° C. for 45 min. - For PCR, the reaction mixture contained 10 mM Tris-HCl buffer pH 8.3, 50 mM KCl, 1.5 mM MgCl2, 0.005% (w/v) gelatin, 0.2 mM dNTPs, 25 pmol of 3′ABDPOLS and 5′ABDPOLAS, 10 μl of the reverse transcription reaction and 1.25 U Taq polymerase (Boehringer Mannheim) in a final volume of 50 μl. The reaction mixes were overlaid with mineral oil and subjected to 3 thermal cycles of denaturation at 92° C. for 45 s, primer annealing at 45° C. for 45 s and elongation at 72° C. for 60 s, followed by 45 cycles at 92° C. for 45 s, 55° C. for 45 s and 72° C. for 60 s. 10 μl of each amplification product were analyzed by electrophoresis in a 1.5% agarose gel and visualized by ethidium bromide staining. An aliquot of the amplification product was cloned and sequenced.
- RT-PCR of these preparations revealed the anticipated amplification products of 298 nucleotides. Since no amplification products were obtained when RT was omitted, possible DNA contaminations can be excluded (
FIG. 1 a). (A) RT-PCR. Particle preparations of the melanoma cell line Mel-Juso were treated with DNase and used for analysis. PCR (lane 1) or RT-PCR (lane 2) with degenerate primers corresponding to sequences that are conserved in retroviral polymerase (pol) genes was performed; M, molecular weight marker (Boehringer Mannheim VIII). No amplification products were obtained in the control reactions without RT, demonstrating the absence of contamination with DNA (lane 1). In contrast, RT-PCR revealed the anticipated amplification products of 298 nucleotides (lane 2). (B) Immunoblotting. Particle preparations from SK-Mel28 supernatants were separated by SDS-PAGE, blotted and HERV-K-specific proteins were detected with antiserum recognizing env (lane 1), gag (lane 3) and the corresponding pre-immunesera, pre-env (lane 2) and pre-gag (lane 4). Molecular weight is indicated to the left. In addition, RT-PCR of the GAPDH gene was negative, reflecting the lack of contamination with cellular mRNA (data not shown). The amplification product was cloned into an expression vector and sequenced. Sequence analysis revealed that the amplified fragment shows high homology to the corresponding pol region of endogenous retrovirus HERV-K. Translation of the obtained nucleotide sequence revealed the amino acid sequence IKKKSGKWRMLTDLRAINSVIQPMGALQPGLPSPAIIPKNWPLVVIDLKDSFFTIPL ADQDCEWFAFIIPAVNNLQPAKHF (SEQ ID NO:59). This sequence is highly homologous with the corresponding sequences of the HERV-K HML2 and HML3 families. Within these groups the highest identity (90%) was observed for clone NMWV5 (GenBank accession AF0115998). Homology to sequences of type A, B and C retroviruses was less than 70%. The sequence analysis excludes contamination with any known non-human retrovirus and suggests an endogenous origin of the packaged RNA. - Particles derived from SK-Mel28 melanoma cells were purified on iodixanol-cushions and analyzed for the presence of HERV-K-specific env and gag proteins in Western blots.
- Iodixanol-cushion purified particles from SK-Mel28 supernatants were pelleted, resuspended in PBS and analyzed. The amount of soluble proteins was quantified by means of a modified Bradford analysis (Bio-rad, Richmond Calif.). 5 μg of total protein was applied per lane and separated by SDS-PAGE (10%). Proteins were transferred to PVDF membranes (Millipore, Bedford, Mass.) by Western blotting, and generated blots were incubated with the gag- and env-specific antisera. The membranes were washed twice with blocking solution and HERV-K-specific proteins were detected with an alkaline-phosphatase-conjugated second-step antibody.
- The envelope (env) gene of retroviruses displays an ORF for the surface protein (SU) and a membrane spanning protein (TM). The env precursor is usually cleaved into the SU and TM subunits before translocation to the cell surface and incorporation into virus particles. To determine whether the env protein is present on the particles, immunoblotting with an antiserum recognizing the TM domain was performed. As shown in
FIG. 1 b two bands are visible in the Western blot. The upper band corresponds to the precursor migrating at approximately 80 to 90 kDa. In addition, a lower band migrating at approximately 37 kDa is visible, suggesting cleavage of the precursor into subunits. - Immunoblotting with an HERV-K anti-gag antiserum revealed a double band at approximately 76 kDa, corresponding to gag precursors, as well as processed intermediate gag proteins at approximately 61 kDa, 30 kDa and one band migrating with the front (less than 19 kDa). The 30 kDa protein corresponds to the putative major core protein of HERV-K. The presence of processed gag proteins in the Western blots indicates a functional protease.
- To confirm the presence of particles electron microscopy (EM) was performed.
- 15 μl aliquots of iodixanol-density gradient purified particle suspensions from SK-Mel28 supernatants were applied on Formvar coated grids and left there for 15 min. Excess suspension was removed from the edges of the grids by filter paper. The grid with the remaining sample was air dried for 1 h. The sample was either directly exposed to 1% uranyl acetate for negative staining or, for immunoelectron microscopy, fixed in paraformaldehyde-lysine-periodate for 15 min, rinsed in distilled water, quenched in PBS/1% BSA and incubated in anti-env antiserum diluted 1:25 in PBS/1% BSA for 1 h at RT. After washing, the grid was exposed to 5 nM colloidal gold conjugated rabbit anti-goat antibody (British Biocell, Cardiff, UK) diluted 1:50 in PBS/1% BSA for 1 h. After fixation in 2.5% glutaraldehyde, washing and negative staining with 1% uranyl acetate, the grid was left to air dry. All grids were examined with a JEOL 1010 electron microscope.
- For electron microscopy, immunoblotting and infection studies, cell-free supernatants were purified on iodixanol density gradients or cushions. Iodixanol is an iodinated, nonionic density gradient medium (Nycomed Pharma, Oslo, Norway). It has a low viscosity and provides iso-osmotic conditions up to densities of 1.32 g/ml. The supernatants were overlaid on a cushion of 5 ml 50% iodixanol. The tubes were centrifuged in an SW28 rotor at 45000×g for 2 h at 4° C. and the supernatant was removed from the tubes by suction, leaving a volume of 4 ml of the medium in proximity of the cushion. This fraction was harvested, pelleted in a SW41 rotor at 150000×g for 90 min at 4° C., resuspended in PBS and analyzed. Alternatively, for further purification the cushion-derived fraction was loaded on iodixanol density gradients, and the fraction corresponding to a density of approximately 1.16 g/ml was harvested. The harvested fractions were diluted in PBS and pelleted in a SW41 rotor at 150000×g for 90 min at 4° C. and resuspended in PBS.
- Pellets were partially purified on iodixanol-cushions (
FIG. 2 , upper part). Alternatively, these fractions were further purified on iodixanol density-gradients (FIG. 2 , lower part). These preparations were analyzed by immunelectron microscopy using an env-specific antiserum and a colloidal gold conjugated reporter antibody. EM analysis of these preparations revealed the presence of retrovirus-like particles characterized by membrane bound spherical structures with diameters ranging between 80 and 120 nm. The presence of immunogold on the particles indicates that the env protein is present in the envelope. - The integration sites of human endogenous retroviral elements have been found to be distributed over the whole human genome. For example, the HERV-K family was reported to be present in approximately 30 copies per human haploid genome. Based on the observation that melanoma cells (but not melanocytes) produce retrovirus-like particles, it can be hypothesized that the formation of virus-like particles might be due to the activation of retroviral genes that are usually repressed. Therefore the cloned pol sequence derived from the particle preparations was used as a probe and looked for expression of this sequence in the cytoplasm of melanoma cells by in situ hybridization.
- Touch preparations of a nevus, primary melanoma, and melanoma metastasis were made by dipping freshly excised tissue on coated slides (DAKO, Biotek Solutions). Slides were fixed in 4% paraformaldehyde for 20 mins, washed in PBS, dehydrated through graded alcohols to absolute ethanol, and were air dried.
- The hybridization mixtures consisted of Hybrisol VI (Oncor, Gaithersburg) and DIG-labeled cDNA probes, giving a final concentration of 2 ng/μl. Slides were covered with glass coverslips and sealed with Gelbond (ICN). Probe and cellular material were denatured by heating to 80° C. for 5 mins. Hybridization was carried out at 37° C. overnight in a humid chamber. After removal of the coverslips the slides were washed at 46° C. three times with 50% formamide/2×SSC, once with 2×SSC for 10 mins, followed by a single wash step in 2×SSC containing 0,1% NP40 for 10 mins. Signal detection was performed after a blocking step in 1% blocking reagent (Boehringer Mannheim) of 30 mins at 37° C. by incubation with anti-DIG antibody, conjugated to rhodamine at a dilution of 1:10 in 1% blocking reagent for 30 mins at 37° C. in a humidified box. After extensive washings in PBS, slides were counterstained with 10 μg/ml DAPI for 20 mins and visualized with a Zeiss fluorescence microscope using a triple bandpass filter and software from PSI.
- To determine the specificity of the pol sequence for melanoma, touch preparations of a nodular melanoma were analyzed, a lymph node metastasis, and a cutaneous metastasis that had been surgically removed from melanoma patients. As shown in
FIG. 3 (Touch preparations from primary melanoma (a), lymph node metastasis (b), cutaneous metastasis (c), nevus (d), and a tumor free sentinel lymph node (e) surgically removed from patients were analyzed by in situ hybridization with probes specific for nucleotide sequences of the pol gene (POL), melanoma inhibiting activity gene (MIA), and the influenza virus nucleoprotein (FLU). Nucleotide sequences of the pol and the melanoma inhibiting activity genes are found in primary melanoma and lymph node and cutaneous metastases but not in the nevus and tumor free lymph node), high copy numbers of the pol sequence were found in tumor cells of all melanoma preparations tested. In comparison, cells derived from the lymph node and the benign nevus of healthy individuals were negative. A probe specific for the nucleoprotein gene of influenza virus was always negative. As a positive control, a probe recognizing the melanoma-inhibiting activity gene was used. The rate of tumor cells expressing the pol gene was in the range of 60-90%, a percentage similar to the one obtained with the melanoma-inhibiting activity specific probe. The observation that the sequences are not found in all tumor cells might be due to the sensitivity of the assay and variations in the expression levels. - To determine whether HERV-specific proteins were detectable in melanoma cells, immunofluorescence analysis with antisera recognizing the gag, cORF and env proteins of HERV-K was performed.
- Cells grown on chamber slides, as well as touch preparations from a nevus and primary melanoma on coated slides (DAKO) were fixed in 4% paraformaldehyde for 20 mins, washed in PBS and dehydrated through graded alcohols to absolute ethanol and air dried. In addition, five micrometer sections prepared from routinely processed paraffin wax blocks of a nevus and melanoma were placed on coated slides (DAKO). The tissues were dewaxed in xylene, rehydrated by sequential immersion in graded ethanols and PBS and subsequently permeabilised by microwave treatment.
- Immunofluorescence staining was performed by incubating chamber slides, touch preparations, and paraffin sections with HERV-K-specific antibodies at a dilution of 1:100 for 1 h at 37° C. in a humidified box, followed by washing three times with PBS and subsequent incubation with Alexafluor-488-conjugated antibodies at a dilution of 1:200 for 1 h at 37° C. Counterstaining was performed by mounting in Vectashield containing DAPI (Vector). Preparations were analyzed by using a Zeiss fluorescence microscope with appropriate filters.
-
FIG. 4 a shows that the melanoma cell lines Mel-Juso and SK-Mel28 express the gag, cORF and env proteins. The percentage of gag-expressing cells was in the range of 1-10%, cORF was found to be present in about 20%, while expression of the env protein was detected in about 10% of the analyzed cells. Expression of gag and env was found in the cytoplasm, while cORF was mainly found in the nucleus. In contrast, cultured human melanocytes (Nhem) and Vero cells did not react with any HERV-K-specific antisera. None of the corresponding preimmune-sera was reactive with any of the cells tested. immunofluorescence analysis was performed with touch preparation of a primary melanoma (first column); touch preparation of a nevus (second column); paraffin preparation primary melanoma (third column); paraffin preparation nevus (fourth column). Retroviral proteins are present in the melanoma preparations but absent from nevus tissue. - It was then analyzed whether these proteins are also expressed in primary melanoma.
FIG. 4 b shows that gag, cORF, and env were detected in touch preparations and paraffin sections of a primary melanoma but not in the corresponding preparations of a nevus. - Supernatants of approximately 108 melanoma cells were loaded on 30% sucrose cushions and centrifuged at 28K. The resulting pellets were washed and resuspended in 500 μl PBS. For infection studies human 293 cells were grown to approximately 30% confluency and exposed overnight to the particle preparations in the presence of 8 μg/ml polybrene. As controls, cells were treated with particle preparations that were heat inactivated 30 min at 60° C. or mock-treated. 293 cells were exposed to particle preparations from the melanoma cell line SKMe128.
- The human epithelial cell line 293 is a well established target for retrovirus infection. Immunofluorescence with HERV-K specific gag antibodies was performed three weeks post infection (p.i.). Control cells were mock-treated. 293 cells were treated with the melanoma-derived viral particles, and demonstrate that upon treatment they express the HERV-K specific gag-protein (
FIG. 5 a). Moreover, expression of the retroviral proteins correlated with the level of pelletable RT-activity in the supernatants (FIG. 5 b), suggesting that the 293 cells were infected with the melanoma-derived particles. However, due to the high copy numbers of various HERV sequences present in the human genome it was not possible to demonstrate that expression of proteins and production of RT-containing particles was derived from de novo integrated retroviral DNA into the hosts genome. Therefore this question was addressed in bovine MDBK cells. - It was tested whether the melanoma-derived particles are infectious. Due to the high copy numbers of various HERV sequences present in the human genome it is difficult to demonstrate in human cells whether virus particles produced are derived from endogenous or exogenous virus. This question was therefore addressed in bovine MDBK cells which are free of viruses that are homologous to HERV-K. MDBK cells were exposed to melanoma derived particle preparations and passaged at a ratio of 1:10. Supernatants of these cells were analyzed by RT-PCR with pol-specific HERV primers as described below:
- Cell free supernatants of approximately 108 518A2 melanoma cells were loaded on 20% sucrose cushions and pelleted at 28K in a Beckmann SW28 rotor. The resulting pellets were washed and resuspended in 500 μl PBS. For infection studies bovine MDBK cells were grown to approximately 30% confluency and exposed overnight to 100 μl aliquots of the particle preparations in the presence of 0.8% polybrene. As controls, cells were treated with particle preparations that were heat inactivated. 24 hour post infection (p.i.) the inoculum was removed, the cells were washed twice with PBS and incubated with normal media. Starting at 7 days p.i. the cells were continuously passaged at a ratio of 1:10 and the supernatants were analyzed for the presence of viral particles by detecting particle-associated RNA. In addition 1.5 ml of the supernatants from infected MDBK cells were put onto new (uninfected) MDBK cells, in the presence of polybrene. 24 hours later the cells were washed twice with PBS and incubated for 7 days, and passaged at a ratio of 1:10. The release of particles from the cells was determined by detecting particle-associated RNA in the supernatants by RT-PCR as described below:
- For detecting particles released by the cells, supernatants from approximately 107 518A2 or infected MDBK cells were filtered, pelleted 2 hours at 28K and resuspended in 500 μl Trizol. To this suspension 100 μl chloroform were added. After vortexing and centrifugation the upper phase was precipitated with isopropanol. The precipitate was pelleted by centrifugation and washed with 70% ethanol. The pellet was resuspended, treated with DNase in the presence of 25 mM MgCl2 for 45 min at 37° C., and the DNAse was inactivated for 10 min at 65° C. After precipitation with 96% ethanol, the pellet was washed with 70% ethanol, resuspended in reverse transcription (RT) reaction buffer and RT was performed with the random primer p(dN)6.1/10 of the reverse transcription reaction was used as template for PCR with the
oligonucleotide primers 5′108 propol 3925 5′CCACTGTAGAGCCTCCTAAACCC 3′ (SEQ ID No 6) and 3′108 pol 4315 5′GCTGGTATAGTAAAGGCAAATTTTTC 3′ (SEQ ID No 7) (Codon Genetic Systems, Austria) which correspond to conserved regions within the pol gene. - 10 μl of each amplification product were analyzed by electrophoresis in a 1.5% agarose gel and visualized by ethidium bromide staining. An aliquot of the amplification product was cloned and sequenced. Expression of HERV-specific RNA expressed in MDBK cells was detected by RT-PCR of total genomic RNA derived from approximately 107 cells in the same manner.
-
FIG. 6 shows the result after the first passage. Lanes 1-6: After infection cells were passaged 1:10 and supernatants were analyzed by RT-PCR with pol-specific primers (+). Absence of contaminating DNA was analyzed by omitting the RT step (−);Lane 1, no template control;lane 2, heat inactivated particles;lane 3, particle preparation diluted 1:100,lane 4, 1:10 dilution,lane 5, undiluted particle preparations;lane 6, 518A2 supernatant; M, molecular weight marker; Analysis of genomic DNA with pol-specific primers by PCR.Lane 1, no template control;lane 2, no template control;lane 3, MDBK DNA;lane 4, 518A2 DNA,lane 5, no enzyme control. Infection with undiluted particle preparations revealed a pol-specific amplification product (lane 5, +), while infection with particle preparations that were diluted 1:10 (lane 4+), diluted 1:100 (lane 3+)or were heat inactivated (lane 2+) did not. None of the reactions revealed a signal when the RT step was omitted, excluding that the signals were derived from genomic DNAs contaminations (lanes 2-6,−). The presence of particle associated viral sequences in the supernatant of the melanoma-derived particle exposed MDBK cells indicates that melanoma-derived particles are capable to infect bovine cells. - Sequence analysis of the amplification product of
lane 5 revealed thenucleotide sequence 5 ′ CCACTGTAGAGCCTCCTAAACCCATACCATTAACTTGGAAAACAGAAAAAC CGGTGTGGGTAAATCAGTGGCCGCTACCAAAACAAAAACTGGAGGCTTTACATTTATTAGCAAATGAACAGTTAGAAAAGGGTCATATTGAGCCTTCGTTCTCAC CTTGGAATTCTCCTGTGTTTGTAATTCAGAAGAAATCAGGCAAATGGCATAT GTTAACTGACTTAAAGGCCGTAAACGCCGTAATTCAACCCAT 3′ (SEQ ID No 8). This sequence is highly homologues (98%) to the sequence from HERV-K 108. - Cell free supernatants from cells exposed to undiluted melanoma particle preparations were put onto new (uninfected) MDBK cells which were subsequently passaged 3 times at a ratio of 1:10
-
FIG. 7 shows the transfer of supernatants from melanoma-particle exposed MDBK cells to uninfected MDBK cells. 24 hours later cells were washed twice with PBS, incubated for one week, and subsequently passaged at a ratio of 1:10.FIG. 7 a shows pelleted supernatants from these cells which were analyzed for release of particle-associated RNA by RT-PCR with pol-specific primers (lanes lanes Lanes 1 and 2: 5 days after transfer;lanes 3 and 4:passage 1;lanes 5 and 6:passage 2;lanes 7 and 8:passage 3; lane M: molecular weight marker (Boehringer Mannheim VIII); lane 9: negative control: pelleted supernatant from uninfected MDBK cells; lane 10: positive control: pelleted supernatants from 518A2 cells;FIG. 7 b shows the expression of HERV-specific RNAs which was analyzed by RT-PCR from whole genomic RNA of MDBK cells frompassage 1 with pol-specific primers. Lane 1: MDBK cells treated with supernatants from infected MDBK cells; lane 2: MDBK cells treated with supernatants from MDBK cells exposed to heat inactivated melanoma-derived particle preparations; lane M, molecular weight marker (Boehringer Mannheim VIII);lane 3, negative control: PCR of genomic DNA derived from uninfected MDBK cells;lane 4, positive control: PCR of genomic DNA derived from 518A2 cells; lane 5: non-template control.Lanes passages Lanes passages - Shown is the presence of particle associated RNA as indicated by the presence of a pol-specific sequences. Pol-specific signals were detectable after
passages lanes passage number 2 did not reveal a pol-signal which might be due to fluctuating production levels of viral particles (lane 5). Transfer of supernatants from MDBK cells that were treated with heat inactivated particle preparations did not result in the release of particles (lanes - These data show that retroviral sequences and infectious particles are expressed in melanoma cells.
- Partial sequence analysis, immunoblotting and immuno-electron microscopy studies show the particles belong to the HERV-K family. In contrast to other known HERV-K like viruses, which lack infectivity, the env precursor appears to be cleaved in the melanoma derived particles, resulting in approximately equimolar amounts of the precursor and the putative transmembrane domain. Cell-free particle preparations from the melanoma cells were able to infect both human and bovine cells, as indicated by the appearance of the viral proteins gag, cORF, and env, and pelletable RT-activity in the supernatants of infected cells. Moreover, the fact that human pol and gag sequences in the genome of the infected bovine MDBK cells were detected, indicates that the melanoma-associated viruses are capable of de novo integration of their genome. This observation also suggests the presence of a functional integrase in the viral particles.
-
FIG. 8 a shows the pCR4-Topo vector into which the MERV gag, pro, pol and env sequences isolated from the above described infected bovine cells were inserted. The primers used in the above examples are shown in the boxes of each sequence of vectors shown inFIG. 8 b. These vectors were deposited on 26 Sep. 2001 at the DSMZ under the names MERV-env, MERV-gag, MERV-prt and MERV-pol according to the Budapest Treaty.
Claims (22)
1-90. (canceled)
91. An antibody or fragment thereof directed against a polypeptide encoded by a polynucleotide molecule comprising all or a fragment of a nucleotide sequence of an infectious human endogenous retrovirus, which sequence is or is complementary to a sequence which:
(a) has at least 98% identity to a sequence of SEQ ID NO: 1 or a fragment thereof;
(b) hybridizes under stringent conditions with a nucleotide sequence of said SEQ ID NO: 1 or a fragment thereof;
(c) differs from the sequences of (a) and/or (b) due to degeneration of the genetic code; and/or
(d) comprises a sequence inserted into a vector pCR4-Topo and deposited as any of “MERV-env”, “MERV-gag”, “MERV-prt” and “MERV-pol” at the DSMZ on 26 Sep. 2001 or a fragment of such a sequence.
92. The antibody or antibody fragment of claim 91 , further defined as attached to the surface of a solid support.
93. The antibody or antibody fragment of claim 91 , wherein the polynucleotide molecule is further defined as comprising the sequence of SEQ ID NO: 1 or a fragment thereof.
94. The antibody or antibody fragment of claim 91 , wherein the polynucleotide molecule is further defined as comprising a specific fragment with a length of at least 15 bp of SEQ ID NO: 1.
95. The antibody or antibody fragment of claim 91 , wherein the polynucleotide molecule is further defined as comprising a specific fragment of SEQ ID NO:1, wherein the fragment is defined as having a sequence identical to SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, or SEQ ID NO:5.
96. The antibody or antibody fragment of claim 91 , wherein the polynucleotide molecule is further defined as encoding an env protein of an infectious human endogenous retrovirus, said polynucleotide molecule comprising a sequence:
(a) with at least 99.5% identity to a sequence of SEQ ID NO:2;
(b) which hybridizes under stringent conditions with a nucleotide sequence of said SEQ ID NO:2;
(c) which differs from the sequences of (a) and/or (b) due to degeneration of the genetic code; and/or
(d) comprises the sequence inserted into a vector pCR4-Topo and deposited as “MERV-env” or a fragment of that sequence.
97. The antibody or antibody fragment of claim 91 , wherein the polynucleotide molecule is further defined as encoding a gag protein of an infectious human endogenous retrovirus, said polynucleotide molecule comprising a sequence:
(a) with at least 99.5% identity to a sequence of SEQ ID NO:4;
(b) which hybridizes under stringent conditions with a nucleotide sequence of said SEQ ID NO:4;
(c) which differs from the sequences of (a) and/or (b) due to degeneration of the genetic code; and/or
(d) comprises the sequence inserted into a vector pCR4-Topo and deposited as “MERV-gag” or a fragment of that sequence.
98. The antibody or antibody fragment of claim 91 , wherein the polynucleotide molecule is further defined as encoding a pro protein of an infectious human endogenous retrovirus, said polynucleotide molecule comprising a sequence:
(a) with at least 98% identity to a sequence of SEQ ID NO:5;
(b) which hybridizes under stringent conditions with a nucleotide sequence of said SEQ ID NO:5;
(c) which differs from the sequences of (a) and/or (b) due to degeneration of the genetic code; and/or
(d) comprises the sequence inserted into a vector pCR4-Topo and deposited as “MERV-prt” or a fragment of that sequence.
99. The antibody or antibody fragment of claim 91 , wherein the polynucleotide molecule is further defined as encoding a pol protein of an infectious human endogenous retrovirus, said polynucleotide molecule comprising a sequence:
(a) with at least 99% identity to a sequence of SEQ ID NO:3;
(b) which hybridizes under stringent conditions with a nucleotide sequence of said SEQ ID NO:3;
(c) which differs from the sequences of (a) and/or (b) due to degeneration of the genetic code; and/or
(d) comprises the sequence inserted into a vector pCR4-Topo and deposited as “MERV-pol” or a fragment of that sequence.
100. A pharmaceutical composition comprising a polynucleotide molecule comprising a base sequence complementary to the sequence of a polynucleotide molecule comprising all or a fragment of a nucleotide sequence of an infectious human endogenous retrovirus, which sequence is or is complementary to a sequence which:
(a) has at least 98% identity to a sequence of SEQ ID NO:1 or a fragment thereof;
(b) hybridizes under stringent conditions with a nucleotide sequence of said SEQ ID NO:1 or a fragment thereof;
(c) differs from the sequences of (a) and/or (b) due to degeneration of the genetic code; and/or
(d) comprises a sequence inserted into a vector pCR4-Topo and deposited as any of “MERV-env”, “MERV-gag”, “MERV-prt” and “MERV-pol” at the DSMZ on 26 Sep. 2001 or a fragment of such a sequence;
a vector comprising such a polynucleotide molecule, an infectious or attenuated human endogenous retrovirus encoded by such a polynucleotide molecule, an antibody or antibody fragment directed against a polypeptide encoded by such a polynucleotide molecule or against an infectious or attenuated human endogenous retrovirus, or a PNA molecule comprising a base sequence of such a molecule in a pharmaceutically acceptable carrier.
101. The pharmaceutical composition of claim 100 , further defined as attached to the surface of a solid support.
102. The pharmaceutical composition of claim 100 , wherein the polynucleotide molecule is further defined as comprising the sequence of SEQ ID NO:1 or a fragment thereof.
103. The pharmaceutical composition of claim 100 , wherein the polynucleotide molecule is further defined as comprising a specific fragment with a length of at least 15 bp of SEQ ID NO:1.
104. The pharmaceutical composition of claim 100 , wherein the polynucleotide molecule is further defined as comprising a specific fragment of SEQ ID NO:1, wherein the fragment is defined as having a sequence identical to SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, or SEQ ID NO:5.
105. The pharmaceutical composition of claim 100 , wherein the polynucleotide molecule is further defined as encoding an env protein of an infectious human endogenous retrovirus, said polynucleotide molecule comprising a sequence:
(a) with at least 99.5% identity to a sequence of SEQ ID NO:2;
(b) which hybridizes under stringent conditions with a nucleotide sequence of said SEQ ID NO:2;
(c) which differs from the sequences of (a) and/or (b) due to degeneration of the genetic code; and/or
(d) comprises the sequence inserted into a vector pCR4-Topo and deposited as “MERV-env” or a fragment of that sequence.
106. The pharmaceutical composition of claim 100 , wherein the polynucleotide molecule is further defined as encoding a gag protein of an infectious human endogenous retrovirus, said polynucleotide molecule comprising a sequence:
(a) with at least 99.5% identity to a sequence of SEQ ID NO:4;
(b) which hybridizes under stringent conditions with a nucleotide sequence of said SEQ ID NO:4;
(c) which differs from the sequences of (a) and/or (b) due to degeneration of the genetic code; and/or
(d) comprises the sequence inserted into a vector pCR4-Topo and deposited as “MERV-gag” or a fragment of that sequence.
107. The pharmaceutical composition of claim 100 , wherein the polynucleotide molecule is further defined as encoding a pro protein of an infectious human endogenous retrovirus, said polynucleotide molecule comprising a sequence:
(a) with at least 98% identity to a sequence of SEQ ID NO:5;
(b) which hybridizes under stringent conditions with a nucleotide sequence of said SEQ ID NO:5;
(c) which differs from the sequences of (a) and/or (b) due to degeneration of the genetic code; and/or
(d) comprises the sequence inserted into a vector pCR4-Topo and deposited as “MERV-prt” or a fragment of that sequence.
108. The pharmaceutical composition of claim 100 , wherein the polynucleotide molecule is further defined as encoding a pol protein of an infectious human endogenous retrovirus, said polynucleotide molecule comprising a sequence:
(a) with at least 99% identity to a sequence of SEQ ID NO:3;
(b) which hybridizes under stringent conditions with a nucleotide sequence of said SEQ ID NO:3;
(c) which differs from the sequences of (a) and/or (b) due to degeneration of the genetic code; and/or
(d) comprises the sequence inserted into a vector pCR4-Topo and deposited as “MERV-pol” or a fragment of that sequence.
109. The pharmaceutical composition of claim 100 , further comprising at least one antiviral substance.
110. The pharmaceutical composition of claim 100 , further defined as a sun cream.
111. The pharmaceutical composition of claim 100 , further defined as a vaccine.
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US11/828,272 US20080008717A1 (en) | 2001-09-27 | 2007-07-25 | Polynucleotide Fragments of an Infectious Human Endogenous Retrovirus |
US13/451,256 US20120237527A1 (en) | 2001-09-27 | 2012-04-19 | Polynucleotide Fragments of an Infectious Human Endogenous Retrovirus |
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AT0153901A AT411262B (en) | 2001-09-27 | 2001-09-27 | HUMAN ENDOGENIC RETROVIRUS |
AT1539/2001 | 2001-09-27 | ||
PCT/EP2002/010899 WO2003029460A1 (en) | 2001-09-27 | 2002-09-27 | Polynucleotide fragments of an infectious human endogenous retrovirus |
US10/490,920 US7510862B2 (en) | 2001-09-27 | 2002-09-27 | Polynucleotide fragments of an infectious human endogenous retrovirus |
US11/828,272 US20080008717A1 (en) | 2001-09-27 | 2007-07-25 | Polynucleotide Fragments of an Infectious Human Endogenous Retrovirus |
Related Parent Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US10/490,920 Division US7510862B2 (en) | 2001-09-27 | 2002-09-27 | Polynucleotide fragments of an infectious human endogenous retrovirus |
PCT/EP2002/010899 Division WO2003029460A1 (en) | 2001-09-27 | 2002-09-27 | Polynucleotide fragments of an infectious human endogenous retrovirus |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US13/451,256 Continuation US20120237527A1 (en) | 2001-09-27 | 2012-04-19 | Polynucleotide Fragments of an Infectious Human Endogenous Retrovirus |
Publications (1)
Publication Number | Publication Date |
---|---|
US20080008717A1 true US20080008717A1 (en) | 2008-01-10 |
Family
ID=3688328
Family Applications (4)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US10/490,920 Expired - Fee Related US7510862B2 (en) | 2001-09-27 | 2002-09-27 | Polynucleotide fragments of an infectious human endogenous retrovirus |
US11/828,272 Abandoned US20080008717A1 (en) | 2001-09-27 | 2007-07-25 | Polynucleotide Fragments of an Infectious Human Endogenous Retrovirus |
US12/261,374 Expired - Fee Related US8008460B2 (en) | 2001-09-27 | 2008-10-30 | Polynucleotide fragments of an infectious human endogenous retrovirus |
US13/451,256 Abandoned US20120237527A1 (en) | 2001-09-27 | 2012-04-19 | Polynucleotide Fragments of an Infectious Human Endogenous Retrovirus |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US10/490,920 Expired - Fee Related US7510862B2 (en) | 2001-09-27 | 2002-09-27 | Polynucleotide fragments of an infectious human endogenous retrovirus |
Family Applications After (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US12/261,374 Expired - Fee Related US8008460B2 (en) | 2001-09-27 | 2008-10-30 | Polynucleotide fragments of an infectious human endogenous retrovirus |
US13/451,256 Abandoned US20120237527A1 (en) | 2001-09-27 | 2012-04-19 | Polynucleotide Fragments of an Infectious Human Endogenous Retrovirus |
Country Status (4)
Country | Link |
---|---|
US (4) | US7510862B2 (en) |
EP (1) | EP1430127A1 (en) |
AT (1) | AT411262B (en) |
WO (1) | WO2003029460A1 (en) |
Families Citing this family (9)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
AT411262B (en) * | 2001-09-27 | 2003-11-25 | Wolff Klaus Dr | HUMAN ENDOGENIC RETROVIRUS |
ATE458003T1 (en) * | 2001-12-07 | 2010-03-15 | Novartis Vaccines & Diagnostic | ENDOGENE RETROVIRUS HIGHLY REGULATED IN PROSTATE CANCER |
US7858743B2 (en) * | 2004-09-09 | 2010-12-28 | Ludwig Institute For Cancer Research | SSX-4 peptides presented by HLA class II molecules |
WO2006103562A2 (en) * | 2005-03-30 | 2006-10-05 | Centre National De La Recherche Scientifique (Cnrs) | Endogenous retrovirus and proteins encoded by env gene as a target for cancer treatment |
AT502292B1 (en) * | 2005-05-11 | 2010-04-15 | Avir Green Hills Biotechnology | MELANOMA DIAGNOSIS |
US20090297530A1 (en) * | 2006-05-22 | 2009-12-03 | Feng Wang-Johanning | Herv-k antigens, antibodies, and methods |
AU2007275693A1 (en) * | 2006-07-21 | 2008-01-24 | Albert Einstein College Of Medicine | Human endogenous retrovirus polypeptide compositions and methods of use thereof |
EA200901590A1 (en) | 2007-05-24 | 2010-04-30 | Авир Грин Хилз Байотекнолоджи Рисерч Дивелопмент Трейд Аг | ANTIBODIES USED IN TREATMENT AND CANCER DIAGNOSTICS |
AT505028B1 (en) * | 2008-02-01 | 2008-10-15 | Avir Green Hills Biotechnology | NEW ANTIBODY AGAINST A RETROVIRAL EPITOP |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4769234A (en) * | 1987-10-06 | 1988-09-06 | Peter M. Stephan Center Ltd. | Skin care compositions containing polyvalent equine immune serum |
US6395549B1 (en) * | 1998-10-22 | 2002-05-28 | Medical College Of Georgia Research Institute, Inc. | Long terminal repeat, enhancer, and insulator sequences for use in recombinant vectors |
US6500869B1 (en) * | 1998-03-18 | 2002-12-31 | Merck Patent Gesellschaft | Sun-protection formulations active against herpes simplex viruses |
US7776523B2 (en) * | 2000-12-07 | 2010-08-17 | Novartis Vaccines And Diagnostics, Inc. | Endogenous retroviruses up-regulated in prostate cancer |
Family Cites Families (11)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JP2885689B2 (en) * | 1996-03-26 | 1999-04-26 | 有限会社エムティーアンドエル医学研究所 | A cancer detecting agent comprising a polypeptide derived from a human endogenous retrovirus gene or an antibody against the polypeptide |
WO1998024454A1 (en) * | 1996-12-02 | 1998-06-11 | Georgetown University | Human trophoblast and choriocarcinoma inhibition |
US6396549B1 (en) | 1997-11-19 | 2002-05-28 | Harold J. Weber | Remote controller for a multi-device television receiving system providing channel number auto-completion, presettable audio hush level and base channel auto-reaffirm |
FR2780069B1 (en) * | 1998-06-23 | 2002-06-28 | Inst Nat Sante Rech Med | FAMILY OF NUCLEIC SEQUENCES AND DEDUCTED PROTEIN SEQUENCES WITH HUMAN ENDOGENOUS RETROVIRAL PATTERNS AND THEIR APPLICATIONS |
US6770456B1 (en) * | 1998-07-29 | 2004-08-03 | Ludwig Institute For Cancer Research | Endogenous retrovirus tumor associated nucleic acids and antigens |
EP1117691A1 (en) * | 1998-10-05 | 2001-07-25 | Ludwig Institute For Cancer Research | Methods for producing human tumor antigen specific antibodies |
DE19910650A1 (en) * | 1999-03-10 | 2000-09-21 | Gsf Forschungszentrum Umwelt | Retroviral expression vectors based on HERV-LTR sequences |
WO2001042461A2 (en) * | 1999-12-10 | 2001-06-14 | Leadd B.V. | Apoptin-associating protein |
FR2805279B1 (en) * | 2000-02-23 | 2004-09-24 | Jean Jacques Guilhou | RETROVIRAL SEQUENCES ASSOCIATED WITH SKIN CONDITIONS |
EP1265989A2 (en) * | 2000-03-21 | 2002-12-18 | MS Research A/S | An infective endogenous retrovirus in association with demyelinating diseases e.g. multiple sclerosis |
AT411262B (en) * | 2001-09-27 | 2003-11-25 | Wolff Klaus Dr | HUMAN ENDOGENIC RETROVIRUS |
-
2001
- 2001-09-27 AT AT0153901A patent/AT411262B/en not_active IP Right Cessation
-
2002
- 2002-09-27 US US10/490,920 patent/US7510862B2/en not_active Expired - Fee Related
- 2002-09-27 EP EP02779436A patent/EP1430127A1/en not_active Withdrawn
- 2002-09-27 WO PCT/EP2002/010899 patent/WO2003029460A1/en not_active Application Discontinuation
-
2007
- 2007-07-25 US US11/828,272 patent/US20080008717A1/en not_active Abandoned
-
2008
- 2008-10-30 US US12/261,374 patent/US8008460B2/en not_active Expired - Fee Related
-
2012
- 2012-04-19 US US13/451,256 patent/US20120237527A1/en not_active Abandoned
Patent Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4769234A (en) * | 1987-10-06 | 1988-09-06 | Peter M. Stephan Center Ltd. | Skin care compositions containing polyvalent equine immune serum |
US6500869B1 (en) * | 1998-03-18 | 2002-12-31 | Merck Patent Gesellschaft | Sun-protection formulations active against herpes simplex viruses |
US6395549B1 (en) * | 1998-10-22 | 2002-05-28 | Medical College Of Georgia Research Institute, Inc. | Long terminal repeat, enhancer, and insulator sequences for use in recombinant vectors |
US7776523B2 (en) * | 2000-12-07 | 2010-08-17 | Novartis Vaccines And Diagnostics, Inc. | Endogenous retroviruses up-regulated in prostate cancer |
Also Published As
Publication number | Publication date |
---|---|
AT411262B (en) | 2003-11-25 |
US20120237527A1 (en) | 2012-09-20 |
ATA15392001A (en) | 2003-04-15 |
US20090180975A1 (en) | 2009-07-16 |
US20040241642A1 (en) | 2004-12-02 |
US7510862B2 (en) | 2009-03-31 |
US8008460B2 (en) | 2011-08-30 |
WO2003029460A1 (en) | 2003-04-10 |
EP1430127A1 (en) | 2004-06-23 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US8008460B2 (en) | Polynucleotide fragments of an infectious human endogenous retrovirus | |
Guyader et al. | Genome organization and transactivation of the human immunodeficiency virus type 2 | |
US5866320A (en) | Nucleic acids encoding for non-infectious, replication-defective, self-assembling HIV-1 viral particles containing antigenic markers in the gag coding region | |
DK175959B1 (en) | Human HIV-2 retrovirus that can cause AIDS, and method and means for detecting this retrovirus in vitro | |
US5030714A (en) | Variant of LAV viruses | |
US6544752B1 (en) | Anigenically-marked non-infectious retrovirus-like particles | |
US6518030B1 (en) | Antigentically-marked non-infectious retrovirus-like particles | |
US7029679B2 (en) | Variant of LAV viruses | |
JP2003522948A (en) | Assays for detection of viral fusion inhibitors | |
KR100216417B1 (en) | Retrovirus from the hiv group and its use | |
Bachelez et al. | Oligoclonal expansion of HIV-specific cytotoxic CD8 T lymphocytes in the skin of HIV-1-infected patients with cutaneous pseudolymphoma. | |
US20020168628A1 (en) | Variant of LAV viruses | |
FR2780069A1 (en) | New nucleic acid sequences of human endogenous retrovirus, HERV-7q, used for diagnosis, treatment and prevention of autoimmune and neurological diseases | |
US6974866B2 (en) | Retrovirus from the HIV type O and its use (MVP-2901/94) | |
EP2633321B1 (en) | Antisera assays for mlv related viruses in humans and other mammals | |
US20100080818A1 (en) | Expression and Characterization of HIV-1 Envelope Protein Associated with Broadly Cross Reactive Neutralizing Antibody Response | |
EP1633308A2 (en) | Hiv-1 envelope glycoproteins having unusual disulfide structure | |
WO1995029240A1 (en) | Isolation and characterization of a novel primate t-cell lymphotropic virus and the use of this virus or components thereof in diagnostics assays and vaccines | |
JP2004502407A (en) | Infectious endogenous retrovirus and its relationship to demyelinating and other diseases | |
CA1338323C (en) | Retrovirus capable of causing aids, means and methods for detecting it in vitro | |
US20090304708A1 (en) | Preparation for the Prevention and/or Treatment of a Tissue Change of Mesenchymal Origin | |
CA1340875C (en) | Variants of lav viruses their dna- and protein- components and their uses, particularly for diagnostic purposes and for the preparation of immunogenic compositions | |
WO2011041350A9 (en) | Xenotropic mulv-related virus (xmrv) compositions and methods of use |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |
|
AS | Assignment |
Owner name: BAXTER HEALTHCARE SA, SWITZERLAND Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:AVIR GREEN HILLS BIOTECHNOLOGY RESEARCH DEVELOPMENT TRADE AG;REEL/FRAME:029996/0569 Effective date: 20130118 |