US20060115470A1 - Camelidae antibodies against imminoglobulin e and use thereof for the treatment of allergic disorders - Google Patents

Camelidae antibodies against imminoglobulin e and use thereof for the treatment of allergic disorders Download PDF

Info

Publication number
US20060115470A1
US20060115470A1 US10/534,292 US53429205A US2006115470A1 US 20060115470 A1 US20060115470 A1 US 20060115470A1 US 53429205 A US53429205 A US 53429205A US 2006115470 A1 US2006115470 A1 US 2006115470A1
Authority
US
United States
Prior art keywords
polypeptide construct
target
single domain
vhh
domain antibody
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US10/534,292
Inventor
Karen Silence
Mark Vaeck
Paul Van Bergen En Henegouwen
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Ablynx NV
Original Assignee
Ablynx NV
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to US10/534,292 priority Critical patent/US20060115470A1/en
Application filed by Ablynx NV filed Critical Ablynx NV
Priority claimed from PCT/BE2003/000190 external-priority patent/WO2004041867A2/en
Publication of US20060115470A1 publication Critical patent/US20060115470A1/en
Priority to US12/431,403 priority patent/US20100003253A1/en
Priority to US12/487,949 priority patent/US20090324512A1/en
Priority to US12/487,895 priority patent/US20100003249A1/en
Priority to US12/487,712 priority patent/US20100003248A1/en
Priority to US12/488,077 priority patent/US20100040613A1/en
Priority to US12/487,684 priority patent/US9243065B2/en
Assigned to ABLYNX N.V. reassignment ABLYNX N.V. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: SILENCE, KAREN, VAECK, MARK, VAN BERGEN EN HENEGOUWEN, PAUL M.P.
Priority to US13/016,709 priority patent/US20110123529A1/en
Priority to US13/078,703 priority patent/US20110184151A1/en
Priority to US13/078,184 priority patent/US20110184145A1/en
Priority to US13/761,554 priority patent/US9320792B2/en
Priority to US15/063,961 priority patent/US9725522B2/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/164Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • A61K38/166Streptokinase
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43Enzymes; Proenzymes; Derivatives thereof
    • A61K38/46Hydrolases (3)
    • A61K38/48Hydrolases (3) acting on peptide bonds (3.4)
    • A61K38/49Urokinase; Tissue plasminogen activator
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L29/00Materials for catheters, medical tubing, cannulae, or endoscopes or for coating catheters
    • A61L29/08Materials for coatings
    • A61L29/085Macromolecular materials
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L29/00Materials for catheters, medical tubing, cannulae, or endoscopes or for coating catheters
    • A61L29/14Materials characterised by their function or physical properties, e.g. lubricating compositions
    • A61L29/16Biologically active materials, e.g. therapeutic substances
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L31/00Materials for other surgical articles, e.g. stents, stent-grafts, shunts, surgical drapes, guide wires, materials for adhesion prevention, occluding devices, surgical gloves, tissue fixation devices
    • A61L31/08Materials for coatings
    • A61L31/10Macromolecular materials
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L31/00Materials for other surgical articles, e.g. stents, stent-grafts, shunts, surgical drapes, guide wires, materials for adhesion prevention, occluding devices, surgical gloves, tissue fixation devices
    • A61L31/14Materials characterised by their function or physical properties, e.g. injectable or lubricating compositions, shape-memory materials, surface modified materials
    • A61L31/16Biologically active materials, e.g. therapeutic substances
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/14Prodigestives, e.g. acids, enzymes, appetite stimulants, antidyspeptics, tonics, antiflatulents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • A61P11/06Antiasthmatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/12Drugs for disorders of the urinary system of the kidneys
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P15/00Drugs for genital or sexual disorders; Contraceptives
    • A61P15/08Drugs for genital or sexual disorders; Contraceptives for gonadal disorders or for enhancing fertility, e.g. inducers of ovulation or of spermatogenesis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/02Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/06Antipsoriatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • A61P21/04Drugs for disorders of the muscular or neuromuscular system for myasthenia gravis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/02Drugs for disorders of the nervous system for peripheral neuropathies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/02Ophthalmic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/16Otologicals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • A61P31/06Antibacterial agents for tuberculosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/16Antivirals for RNA viruses for influenza or rhinoviruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/08Antiallergic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P41/00Drugs used in surgical methods, e.g. surgery adjuvants for preventing adhesion or for vitreum substitution
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/02Antithrombotic agents; Anticoagulants; Platelet aggregation inhibitors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/06Antianaemics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/08Vasodilators for multiple indications
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/14Vasoprotectives; Antihaemorrhoidals; Drugs for varicose therapy; Capillary stabilisers
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • C07K16/241Tumor Necrosis Factors
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • C07K16/249Interferons
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2875Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF/TNF superfamily, e.g. CD70, CD95L, CD153, CD154
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/36Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against blood coagulation factors
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/40Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against enzymes
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/42Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/42Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins
    • C07K16/4283Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins against an allotypic or isotypic determinant on Ig
    • C07K16/4291Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins against an allotypic or isotypic determinant on Ig against IgE
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/46Hybrid immunoglobulins
    • C07K16/468Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6893Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/86Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving blood coagulating time or factors, or their receptors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L2300/00Biologically active materials used in bandages, wound dressings, absorbent pads or medical devices
    • A61L2300/20Biologically active materials used in bandages, wound dressings, absorbent pads or medical devices containing or releasing organic materials
    • A61L2300/252Polypeptides, proteins, e.g. glycoproteins, lipoproteins, cytokines
    • A61L2300/256Antibodies, e.g. immunoglobulins, vaccines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L2300/00Biologically active materials used in bandages, wound dressings, absorbent pads or medical devices
    • A61L2300/40Biologically active materials used in bandages, wound dressings, absorbent pads or medical devices characterised by a specific therapeutic activity or mode of action
    • A61L2300/42Anti-thrombotic agents, anticoagulants, anti-platelet agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L2420/00Materials or methods for coatings medical devices
    • A61L2420/02Methods for coating medical devices
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/22Immunoglobulins specific features characterized by taxonomic origin from camelids, e.g. camel, llama or dromedary
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/569Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/626Diabody or triabody
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/77Internalization into the cell
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/31Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/46Assays involving biological materials from specific organisms or of a specific nature from animals; from humans from vertebrates
    • G01N2333/47Assays involving proteins of known structure or function as defined in the subgroups
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/745Assays involving non-enzymic blood coagulation factors
    • G01N2333/755Factors VIII, e.g. factor VIII C [AHF], factor VIII Ag [VWF]
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2500/00Screening for compounds of potential therapeutic value
    • G01N2500/02Screening involving studying the effect of compounds C on the interaction between interacting molecules A and B (e.g. A = enzyme and B = substrate for A, or A = receptor and B = ligand for the receptor)
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2500/00Screening for compounds of potential therapeutic value
    • G01N2500/04Screening involving studying the effect of compounds C directly on molecule A (e.g. C are potential ligands for a receptor A, or potential substrates for an enzyme A)
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/22Haematology
    • G01N2800/222Platelet disorders

Definitions

  • Polypeptide therapeutics and in particular antibody-based therapeutics have significant potential as drugs because they have extraordinarily specificity to their target and a low inherent toxicity. However, they have one important drawback: these are complex, large molecules and therefore relatively unstable, and they are sensitive to breakdown by proteases. Because the degradation they undergo during passage through, for instance, the gastrointestinal tract, administration of conventional antibodies and their derived fragments or single-chain formats (e.g. scFv's) is not very effective. This means that conventional antibody drugs cannot be administered orally, sublingually, topically, nasally, vaginally, rectally or by inhalation because they are not resistant to the low pH at these sites, the action of proteases at these sites and in the blood and/or because of their large size.
  • scFv's single-chain formats
  • a specialised pathway is present for uptake of specific macromolecules from the extracellular fluid.
  • the macromolecules that bind to specific cell-surface receptors are internalized, a process called receptor-mediated endocytosis.
  • Receptor internalization is based on the principle of regulation of signal transduction by a process called sequestration, whereby bound agonistic (i.e. receptor activation) ligands are recovered from the cell surface in complex with the receptor.
  • sequestration whereby bound agonistic (i.e. receptor activation) ligands are recovered from the cell surface in complex with the receptor.
  • agonistic i.e. receptor activation
  • Antibodies have been described that internalize upon binding to internalizing receptors.
  • these antibodies are complex, large molecules and therefore relatively unstable, and they are sensitive to breakdown by proteases. Moreover, the domains of such antibodies are held together by disulphide bonds that dissociate in the reducing environment of the cytoplasm leading to a substantial loss of binding activity. Therefore, they cannot be used to target intracellular proteins.
  • APCs antigen presenting cells
  • MHC major histocompatibility complex
  • HLA major histocompatibility complex
  • IgE plays a major role in allergic disease by causing the release of histamine and other inflammatory mediatord from mast cells.
  • the most effective treatments of allergic diseases are directed towards a regulation of the inflammatory process with corticosteroids.
  • a more direct approach without the negative effects of corticosteroids consists in regulating the allergic process at the level of the initiatior of the allergic inflammation, IgE, via an anti-IgE.
  • Anti-IgE antibodies which block the binding of IgE to its receptor on basophils and which fail to bind to IgE bound to the receptor, thereby avoiding histamine release are disclosed, for example, by Rup and Kahn (supra), by Baniyash et al. (Molecular Immunology 25:705-711, 1988), and by Hook et al. (Federation of American Societies for Experimental Biology, 71st Annual Meeting, Abstract #6008, 1987).
  • Antagonists of IgE in the form of receptors, anti-IgE antibodies, binding factors, or fragments thereof have been disclosed in the art.
  • U.S. Pat. No. 4,962,035 discloses DNA encoding the alpha-subunit of the mast cell IgE receptor or an IgE binding fragment thereof.
  • Hook et al. disclose monoclonal antibodies, of which one type is anti-idiotypic, a second type binds to common IgE determinants, and a third type is directed towards determinants hidden when IgE is on the basophil surface.
  • U.S. Pat. No. 4,940,782 discloses monoclonal antibodies which react with free IgE and thereby inhibit IgE binding to mast cells, and react with IgE when it is bound to the B-cell FcE receptor, but do not bind with IgE when it is bound to the mast cell FcE receptor, nor block the binding of IgE to the B-cell receptor.
  • U.S. Pat. No. 4,946,788 discloses a purified IgE binding factor and fragments thereof, and monoclonal antibodies which react with IgE binding factor and lymphocyte cellular receptors for IgE, and derivatives thereof.
  • U.S. Pat. No. 5,091,313 discloses antigenic epitopes associated with the extracellular segment of the domain which anchors immunoglobulins to the B cell membrane. The epitopes recognized are present on IgE-bearing B cells but not basophils or in the secreted, soluble form of IgE.
  • U.S. Pat. No. 5,252,467 discloses a method for producing antibodies specific for such antigenic epitopes.
  • U.S. Pat. No. 5,231,026 discloses DNA encoding murine-human antibodies specific for such antigenic epitopes.
  • U.S. Pat. No. 4,714,759 discloses an immunotoxin in the form of an antibody or an antibody fragment coupled to a toxin to treat allergy.
  • U.S. Pat. No. 5,428,133 discloses anti-IgE antibodies as a therapy for allergy, especially antibodies which bind to IgE on B cells, but not IgE on basophils. This publication mentions the possibility of treating asthma with such antibodies.
  • U.S. Pat. No. 5,422,258 discloses a method for making such antibodies.
  • EP0841946 discloses methods for treating allergic asthma using IgE antagonists.
  • the aim of the invention is to provide a method of administering protein therapeutic molecules orally, sublingually, topically, nasally, vaginally, rectally, intraveneously, subcutaneously or by inhalation which overcomes the problems of the prior art. It is a further aim to provide said therapeutic molecules.
  • Another aim of the invention is to provide a method for delivering therapeutic substances to the interior of cells via internalizing receptors without receptor activation.
  • One embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against IgE.
  • Another embodiment of the present invention is a polypeptide construct as described above wherein at least one single domain antibody corresponds to a sequence represented by any of SEQ ID NOs: 1 to 11.
  • Another embodiment of the present invention is a polypeptide construct as described above, wherein the number of anti-IgE single domain antibodies is at least two.
  • Another embodiment of the present invention is a polypeptide construct as described above, wherein at least one single domain antibody is a humanized Camelidae VHH.
  • Another embodiment of the present invention is a polypeptide construct as described above, wherein a single domain antibody is an homologous sequence, a functional portion, or a functional portion of an homologous sequence of the full length single domain antibody.
  • polypeptide construct as described above, wherein the polypeptide construct is an homologous sequence, a functional portion, or a functional portion of an homologous sequence of the full length polypeptide construct.
  • Another embodiment of the present invention is a nucleic acid encoding a polypeptide construct as described above.
  • Another embodiment of the present invention is a polypeptide construct as described above for treating and/or preventing and/or alleviating disorders relating to inflammatory processes.
  • Another embodiment of the present invention is a use of a polypeptide construct as described above for the preparation of a medicament for treating and/or preventing and/or alleviating disorders relating to inflammatory reactions.
  • Another embodiment of the present invention is a method for delivering an anti-target compound to a subject for the treatment of a disorder without being inactivated by administering thereto a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • Another embodiment of the present invention is a method as described above wherein said target is located in the gut system, and said a polypeptide construct is delivered orally.
  • Another embodiment of the present invention is a method as described above wherein said target is located in vaginal and/or rectal tract, and said a polypeptide construct is delivered to the vaginal and/or rectal tract.
  • Another embodiment of the present invention is a method as described above wherein said target is located in nose, upper respiratory tract and/or lung; and said a polypeptide construct is delivered to nose, upper respiratory tract and/or lung.
  • Another embodiment of the present invention is a method as described above wherein said target is located in intestinal mucosa, and said a polypeptide construct is delivered orally.
  • Another embodiment of the present invention is a method as described above wherein said target is located in the tissues beneath the tongue, and said a polypeptide construct is delivered to the tissues beneath the tongue.
  • Another embodiment of the present invention is a method as described above wherein said target is located in the skin, and said a polypeptide construct is delivered topically.
  • Another embodiment of the present invention is a method as described above wherein said target is in, or accessible via the blood, and said a polypeptide construct is delivered orally, to the vaginal and/or rectal tract, nasally, by inhalation though the mouth or nose, to the tissues beneath the tongue, or topically.
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target, for use in treating, preventing and/or alleviating the symptoms of disorders which are susceptible to modulation by an anti-target therapeutic compound that is able pass through the gastric environment without being inactivated.
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target for use in treating, preventing and/or alleviating the symptoms of disorders which are susceptible to modulation by an anti-target therapeutic compound that is able pass through the wall of the intestinal mucosa without being inactivated
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target for use in treating, preventing and/or alleviating the symptoms of disorders which are susceptible to modulation by an anti-target therapeutic compound that is able pass through the wall of the nose, upper respiratory tract and/or lung without being inactivated
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target for use in treating, preventing and/or alleviating the symptoms of disorders which are susceptible to modulation by an anti-target therapeutic compound that is able pass through the wall of virginal and/or rectal tract without being inactivated
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target for use in treating, preventing and/or alleviating the symptoms of disorders which are susceptible to modulation by a therapeutic compound that is able pass through the tissues beneath the tongue without being inactivated
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target for use in treating, preventing and/or alleviating the symptoms of disorders which are susceptible to modulation by a therapeutic compound that is able pass through the skin without being inactivated
  • Another embodiment of the present invention is a method as described above or polypeptide construct as described above, wherein said target is TNF-alpha and the disorder is inflammation.
  • Another embodiment of the present invention is a method or polypeptide as described above, wherein a single domain antibody corresponds to a sequence represented by any of SEQ ID NOs: 12 to 14.
  • Another embodiment of the present invention is a method as described above or polypeptide construct as described above, wherein said target is CEA and the disorder colon cancer.
  • Another embodiment of the present invention is a method as described above or polypeptide construct as described above, wherein said target is EGFR and the disorder is any of head, neck, lung and colon cancer.
  • Another embodiment of the present invention is a method or polypeptide construct as described above, wherein a single domain antibody corresponds to a sequence represented by any of SEQ ID NOs: 23 to 44
  • Another embodiment of the present invention is a method as described above or polypeptide construct as described above, wherein said target is antigen of Helicobacter pylori and the disorder is any of indigestion, gastritis.
  • Another embodiment of the present invention is a method as described above or polypeptide construct as described above, wherein said target is antigen of Mycobacterium tuberculosis and the disorder is tuberculosis.
  • Another embodiment of the present invention is a method as described above or polypeptide construct as described above, wherein said target is antigen of influenza virus and the disorder is flu.
  • Another embodiment of the present invention is a method as described above or polypeptide construct as described above, wherein said target is antigen of IgE and the disorder is allergic response.
  • Another embodiment of the present invention is a method or polypeptide construct as described above, wherein a single domain antibody corresponds to a sequence represented by any of SEQ ID NOs: 1 to 11
  • Another embodiment of the present invention is a method as described above or polypeptide construct as described above, wherein said target is antigen of MMP and the disorder is cancer.
  • Another embodiment of the present invention is a method or polypeptide construct as described above, wherein a single domain antibody corresponds to a sequence represented by any of SEQ ID NOs: 15 to 22
  • Another embodiment of the present invention is a method as described above or polypeptide construct as described above, wherein said target is antigen of IFN-gamma and the disorder is any of cancer, transplant rejection, auto immune disorder.
  • Another embodiment of the present invention is a method or polypeptide construct as described above, wherein a single domain antibody corresponds to a sequence represented by any of SEQ ID NOs: 45 to 70
  • Another embodiment of the present invention is a method as described above or polypeptide construct as described above wherein said target is any of antigen of Helicobacter pylori , antigen of Mycobacterium tuberculosis , antigen of influenza virus.
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against an internalising cellular receptor, and at least one single domain antibody directed against a therapeutic target.
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against an internalising cellular receptor, and at least one therapeutic polypeptide or agent.
  • Another embodiment of the present invention is a polypeptide construct as described above wherein said internalising cellular receptor is Epidermal Growth Factor receptor.
  • Another embodiment of the present invention is a polypeptide as described above wherein a single domain antibody directed against an internalising cellular receptor corresponds to a sequence represented by SEQ ID NO: 23 to 44.
  • Another embodiment of the present invention is a polypeptide construct as described above wherein said internalising cellular receptor is any of LDL receptor, FGF2r, ErbB2r, transferring receptor, PDGr, VEGr, or PsmAr.
  • Another embodiment of the present invention is a polypeptide construct as described above wherein a single domain antibody directed against a therapeutic target, is directed against PDK1.
  • Another embodiment of the present invention is a polypeptide construct as described above wherein a single domain antibody directed against a therapeutic target is directed against any of GSK1, Bad, caspase and Forkhead.
  • Another embodiment of the present invention is a polypeptide construct as described above use in treating cancer.
  • Another embodiment of the present invention is a method for delivering an anti-target therapeutic compound to the interior of a cell comprising administering to a subject a polypeptide construct as described above.
  • Another embodiment of the present invention is a method for delivering an anti-target therapeutic compound to the interior of a cell without being inactivated comprising administering to a subject a polypeptide construct as described above.
  • Another embodiment of the present invention is a method as described above wherein said cell is located in the gut system, and said a polypeptide construct is delivered orally.
  • Another embodiment of the present invention is a method as described above wherein said cell is located in vaginal and/or rectal tract, and said a polypeptide construct is delivered to the vaginal and/or rectal tract.
  • Another embodiment of the present invention is a method as described above wherein said cell is located in nose, upper respiratory tract and/or lung, and said a polypeptide construct is delivered to nose, upper respiratory tract and/or lung.
  • Another embodiment of the present invention is a method as described above wherein said cell is located in intestinal mucosa, and said a polypeptide construct is delivered orally.
  • Another embodiment of the present invention is a method as described above wherein said cell is located in the tissues beneath the tongue, and said a polypeptide construct is delivered to the tissues beneath the tongue.
  • Another embodiment of the present invention is a method as described above wherein said cell is located in the skin, and said a polypeptide construct is delivered topically.
  • Another embodiment of the present invention is a method as described above wherein said cell is in, or accessible via the blood, and said a polypeptide construct is delivered orally, to the vaginal and/or rectal tract, nasally, by inhalation though the mouth or nose, to the tissues beneath the tongue, or topically.
  • Another embodiment of the present invention is a polypeptide construct as described above, or a method as described above, wherein the single domain antibodies are humanized Camelidae VHHs.
  • Another embodiment of the present invention is a polypeptide construct as described above, or a method as described above, wherein said single domain antibody is an homologous sequence, a functional portion, or a functional portion of an homologous sequence of the full length single domain antibody.
  • polypeptide construct as described above or a method as described above, wherein the polypeptide construct is an homologous sequence, a functional portion, or a functional portion of an homologous sequence of the full length polypeptide construct.
  • Another embodiment of the present invention is a polypeptide construct as described above or a method as described above wherein said single domain antibodies are Camelidae VHHs.
  • Another embodiment of the present invention is a nucleic acid capable of encoding a polypeptide construct as described above.
  • compositions comprising a polypeptide construct as defined above, together with a pharmaceutical carrier.
  • the present invention relates to a polypeptide construct comprising one or more single domain antibodies directed to one or more target molecule(s), each in a suitable dosage form either directly or as part of a composition containing an ingredient which facilitates delivery.
  • the invention further relates to polypeptide constructs comprising one or more single domain antibodies, for administration to a subject by non-invasive methods, such as orally, sublingually, topically, nasally, vaginally, rectally or by inhalation.
  • non-invasive routes of delivery unexpectly provide an effective means to conveniently deliver therapeutic compounds
  • the present invention also relates to constructs comprising one or more single domain antibodies, for administration to a subject by normal invasive methods such as intravenously and subcutaneously.
  • the invention further relates to a method for delivering therapeutic peptides comprises the steps of administering a polypeptide construct comprising one or more single domain antibodies orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation to a subject.
  • the invention further relates to polypeptide constructs comprising anti-IgE single domain antibodies.
  • Single domain antibodies are antibodies whose complementary determining regions are part of a single domain polypetide. Examples include, but are not limited to, heavy chain antibodies, antibodies naturally devoid of light chains, single domain antibodies derived from conventional 4-chain antibodies, engineered antibodies and single domain scaffolds other than those derived from antibodies. Single domain antibodies may be any of the art, or any future single domain antibodies. Single domain antibodies may be derived from any species including, but not limited to mouse, human, camel, llama, goat, rabbit, bovine. According to one aspect of the invention, a single domain antibody as used herein is a naturally occurring single domain antibody known as heavy chain antibody devoid of light chains. Such single domain antibodies are disclosed in WO 9404678 for example.
  • variable domain derived from a heavy chain antibody naturally devoid of light chain is known herein as a VHH or nanobody to distinguish it from the conventional VH of four chain immunoglobulins.
  • VHH molecule can be derived from antibodies raised in Camelidae species, for example in camel, llama, dromedary, alpaca and guanaco. Other species besides Camelidae may produce heavy chain antibodies naturally devoid of light chain; such VHHs are within the scope of the invention.
  • VHHs are heavy chain variable domains derived from immunoglobulins naturally devoid of light chains such as those derived from Camelidae as described in WO 94/04678 (and referred to hereinafter as VHH domains or nanobodies).
  • VHH molecules are about 10 ⁇ smaller than IgG molecules. They are single polypeptides and very stable, resisting extreme pH and temperature conditions. Moreover, they are resistant to the action of proteases which is not the case for conventional antibodies. Furthermore, in vitro expression of VHHs produces high yield, properly folded functional VHHs.
  • antibodies generated in Camelids will recognize epitopes other than those recognised by antibodies generated in vitro through the use of antibody libraries or via immunisation of mammals other than Camelids (WO 9749805).
  • anti-albumin VHH's may interact in a more efficient way with serum albumin which is known to be a carrier protein.
  • serum albumin which is known to be a carrier protein.
  • some of the epitopes of serum albumin may be inaccessible by bound proteins, peptides and small chemical compounds. Since VHH's are known to bind into ‘unusual’ or non-conventional epitopes such as cavities (WO 97/49805), the affinity of such VHH's to circulating albumin may be increased.
  • the present invention further relates to a polypeptide construct, wherein a single domain antibody is a VHH directed against a target, wherein the VHH belongs to a class having human-like sequences.
  • the class is characterised in that the VHHs carry an amino acid from the group consisting of glycine, alanine, valine, leucine, isoleucine, proline, phenylalanine, tyrosine, tryptophan, methionine, serine, threonine, asparagine, or glutamine at position 45, such as, for example, L45 according to the Kabat numbering.
  • a VHH sequence represented by SEQ ID NO: 15 which binds to MMP-12 belongs to this human-like class of VHH polypeptides.
  • peptides belonging to this class show a high amino acid sequence homology to human VH framework regions and said peptides might be administered to a human directly without expectation of an unwanted immune response therefrom, and without the burden of further humanisation.
  • Camelidae single domain antibodies represented by sequences 68 which binds to IFN gamma, have been described in WO03035694 and contain the hydrophobic FR2 residues typically found in conventional antibodies of human origin or from other species, but compensating this loss in hydrophilicity by the charged arginine residue on position 103 that substitutes the conserved tryptophan residue present in VH from conventional antibodies.
  • peptides belonging to these two classes show a high amino acid sequence homology to human VH framework regions and said peptides might be administered to a human directly without expectation of an unwanted immune response therefrom, and without the burden of further humanisation.
  • VHHs as used by the invention may be of the traditional class or of the classes of human-like Camelidae antibodies. Said antibodies may be directed against whole target or a fragment thereof, or a fragment of a homologous sequence thereof.
  • These polypeptides include the full length Camelidae antibodies, namely Fc and VHH domains, chimeric versions of heavy chain Camelidae antibodies with a human Fc domain.
  • Targets of the invention are any which are of pharmaceutical interest. Examples are provided here of several targets, and are not intended to limit the invention thereto. Examples of targets include, TNF-alpha, IgE, IFN-gamma, MMP-12, EGFR, CEA, H. pylori , TB, influenza.
  • a single domain antibody directed against a target means a single domain antibody that is capable of binding to said target with an affinity of better than 10 ⁇ 6 M.
  • Targets may also be fragments of said targets.
  • a target is also a fragment of said target, capable of eliciting an immune response.
  • a target is also a fragment of said target, capable of binding to a single domain antibody raised against the full length target.
  • a fragment as used herein refers to less than 100% of the sequence (e.g., 99%, 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 10% etc.), but comprising 5, 6, 7, 8, 9, 10, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more amino acids.
  • a fragment is of sufficient length such that the interaction of interest is maintained with affinity of 1 ⁇ 10 ⁇ 6 M or better.
  • a fragment as used herein also refers to optional insertions, deletions and substitutions of one or more amino acids which do not substantially alter the ability of the target to bind to a single domain antibody raised against the wild-type target.
  • the number of amino acid insertions deletions or substitutions is preferably up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69 or 70 amino acids.
  • One embodiment of the present invention is a polypeptide construct as disclosed herein, wherein the number of single domain antibodies directed to a target is two or more.
  • Such multivalent polypeptide constructs have the advantage of unusually high functional affinity for the target, displaying much higher than expected inhibitory properties compared to their monovalent counterparts.
  • Multivalent polypeptide constructs have functional affinities that are several orders of magnitude higher than polypeptide constructs which are monovalent. The inventors have found that the functional affinities of these multivalent polypeptides are much higher than those reported in the prior art for bivalent and multivalent antibodies. Surprisingly, the multivalent polypeptide constructs of the present invention linked to each other directly or via a short linker sequence show the high functional affinities expected theoretically with multivalent conventional four-chain antibodies.
  • the inventors have found that such large increased functional activities can be detected preferably with antigens composed of multidomain and multimeric proteins, either in straight binding assays or in functional assays, e.g. animal model of chronic colitis.
  • a multivalent anti-target polypeptide as used herein refers to a polypeptide comprising two or more anti-target polypeptides which have been covalently linked.
  • the anti-target polypeptides may be identical in sequence or may be different in sequence, but are directed against the same target or antigen.
  • a multivalent anti-target polypeptide may be bivalent (2 anti-target polypeptides), trivalent (3 anti-target polypeptides), tetravalent (4 anti-target polypeptides) or have a higher valency molecules.
  • Example 7 An example of a multivalent polypeptide construct of the invention, comprising more than one anti-TNF-alpha VHHs is described in Example 7.
  • the single domain antibodies may be joined to form any of the polypeptide constructs disclosed herein comprising more than one single domain antibody using methods known in the art or any future method. They may be joined non-covalently (e.g. using streptavidin/biotin combination, antibody/tag combination) or covalently. They may be fused by chemical cross-linking by reacting amino acid residues with an organic derivatising agent such as described by Blattler et al, Biochemistry 24, 1517-1524; EP294703. Alternatively, the single domain antibody may be fused genetically at the DNA level i.e. a polynucleotide construct formed which encodes the complete polypeptide construct comprising one or more anti-target single domain antibodies.
  • VHH polypeptide constructs A method for producing bivalent or multivalent VHH polypeptide constructs is disclosed in PCT patent application WO 96/34103.
  • One way of joining VHH antibodies is via the genetic route by linking a VHH antibody coding sequences either directly or via a peptide linker.
  • the C-terminal end of the VHH antibody may be linked to the N-terminal end of the next single domain antibody.
  • This linking mode can be extended in order to link additional single domain antibodies for the construction and production of tri-, tetra-, etc. functional constructs.
  • the single domain antibodies are linked to each other via a peptide linker sequence.
  • linker sequence may be a naturally occurring sequence or a non-naturally occurring sequence.
  • the linker sequence is expected to be non-immunogenic in the subject to which the multivalent anti-target polypeptide is administered.
  • the linker sequence may provide sufficient flexibility to the multivalent anti-target polypeptide, at the same time being resistant to proteolytic degradation.
  • a non-limiting example of a linker sequences is one that can be derived from the hinge region of VHHs described in WO 96/34103.
  • VHHs may be obtained using methods known in the art such as by immunising a camel and obtaining hybridomas therefrom, or by cloning a library of single domain antibodies using molecular biology techniques known in the art and subsequent selection by using phage display.
  • a polypeptide construct may be a homologous sequence of a full-length polypeptide construct.
  • a polypeptide construct may be a functional portion of a full-length polypeptide construct.
  • a polypeptide construct may be a homologous sequence of a full length polypeptide construct.
  • a polypeptide construct may be a functional portion of a homologous sequence of a full length polypeptide construct.
  • a polypeptide construct may comprise a sequence of a polypeptide construct.
  • a single domain antibody used to form a polypeptide construct may be a complete single domain antibody (e.g. a VHH) or a homologous sequence thereof.
  • a single domain antibody used to form the polypeptide construct may be a functional portion of a complete single domain antibody.
  • a single domain antibody used to form the polypeptide construct may be a homologous sequence of a complete single domain antibody.
  • a single domain antibody used to form the polypeptide construct may be a functional portion of a homologous sequence of a complete single domain antibody.
  • a homologous sequence of the present invention may comprise additions, deletions or substitutions of one or more amino acids, which do not substantially alter the functional characteristics of the polypeptides of the invention.
  • the number of amino acid deletions or substitutions is preferably up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69 or 70 amino acids.
  • a homologous sequence according to the present invention may be a sequence of an anti-target polypeptide modified by the addition, deletion or substitution of amino acids, said modification not substantially altering the functional characteristics compared with the unmodified polypeptide.
  • a homologous sequence of the present invention may be a polypeptide which has been humanised.
  • the humanisation of antibodies of the new class of VHHs would further reduce the possibility of unwanted immunological reaction in a human individual upon administration.
  • a homologous sequence according to the present invention may be a sequence which exists in other Camelidae species such as, for example, camel, llama, dromedary, alpaca, guanaco etc.
  • homologous sequence indicates sequence identity, it means a sequence which presents a high sequence identity (more than 70%, 75%, 80%, 85%, 90%, 95% or 98% sequence identity) with the parent sequence and is preferably characterised by similar properties of the parent sequence, namely affinity, said identity calculated using known methods.
  • a homologous sequence may also be any amino acid sequence resulting from allowed substitutions at any number of positions of the parent sequence according to the formula below:
  • Arg substituted by one of Arg, His, Gin, Lys, and Glu;
  • Pro substituted by one of Pro, Gly, Ala, and Thr;
  • Thr substituted by one of Thr, Pro, Ser, Ala, Gly, His, and Gin;
  • Ala substituted by one of Ala, Gly, Thr, and Pro;
  • Tyr substituted by one of Tyr, Trp, Met, Phe, lie, Val, and Leu;
  • His substituted by one of His, Glu, Lys, Gln, Thr, and Arg;
  • Gin substituted by one of Gin, Glu, Lys, Asn, His, Thr, and Arg;
  • Lys substituted by one of Lys, Glu, Gin, His, and Arg;
  • Met substituted by one of Met, Phe, lie, Val, Leu, and Tyr.
  • a homologous nucleotide sequence according to the present invention may refer to nucleotide sequences of more than 50, 100, 200, 300, 400, 500, 600, 800 or 1000 nucleotides able to hybridize to the reverse-complement of the nucleotide sequence capable of encoding the patent sequence, under stringent hybridisation conditions (such as the ones described by Sambrook et al., Molecular Cloning, Laboratory Manuel, Cold Spring, Harbor Laboratory press, New York).
  • a functional portion refers to a sequence of a single domain antibody that is of sufficient size such that the interaction of interest is maintained with affinity of 1 ⁇ 10 ⁇ 6 M or better.
  • a functional portion comprises a partial deletion of the complete amino acid sequence and still maintains the binding site(s) and protein domain(s) necessary for the binding of and interaction with its target.
  • a functional portion refers to less than 100% of the complete sequence (e.g., 99%, 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 10%, 5%, 1% etc.), but comprising 5 or more amino acids or 15 or more nucleotides.
  • One aspect of the present invention relates to therapeutic compounds which are suitable for alleviating the symptoms, for the treatment and prevention of allergies. Said therapeutic compounds interact with IgE, and modulate the cascade of immunological responses that is responsible for an allergic response.
  • Another aspect of the present invention relates to the use of anti-IgE single domain antibodies (e.g. VHHs) in the preparation of topical ophthalmic compositions for the treatment of an ocular allergic disorder (Example 2).
  • VHHs anti-IgE single domain antibodies
  • Example 2 Given the ease of production and the low cost using bacterial or yeast expression systems for VHHs, for example, compared to production of conventional antibodies in mammalian cells, the economics of preparing such compositions using VHHs of the invention are much more favourable then for conventional antibodies.
  • polypeptide constructs of the invention are expected to be highly efficient given their high potency, stability combined with a low molecular weigth. Therefore, applications for such indications other than topical can be envisaged with polypeptide constructs of the invention.
  • One embodiment of the present invention is a polypeptide construct comprising one or more single domain antibodies directed against IgE.
  • Another embodiment of the present invention is a polypeptide construct comprising one or more single domain antibodies directed against IgE, wherein a single domain antibody corresponds to a sequence represented by any of SEQ ID NOs: 1 to 11. Said sequences are derived from Camelidae VHHs.
  • the present invention also relates to the finding that a polypeptide construct comprising one or more single domain antibodies directed against IgE and further comprising one or more single domain antibodies directed against one or more serum proteins of a subject, surprisingly has significantly prolonged half-life in the circulation of said subject compared with the half-life of the anti-IgE single domain antibody when not part of said construct. Furthermore, such polypeptide constructs were found to exhibit the same favourable properties of VHHs such as high stability remaining intact in mice, extreme pH resistance, high temperature stability and high target affinity.
  • Another embodiment of the present invention is a polypeptide construct comprising one or more single domain antibodies directed against IgE further comprising one or more single domain antibodies directed against one or more serum proteins.
  • the serum protein may be any suitable protein found in the serum of subject, or fragment thereof.
  • the serum protein is serum albumin, serum immunoglobulins, thyroxine-binding protein, transferrin, or fibrinogen.
  • the VHH-partner can be directed to one of the above serum proteins.
  • One aspect of the invention is a polypeptide construct comprising one or more single domain antibodies directed against IgE, further comprising an anti-serum albumin single domain antibody corresponding to a sequence represented by any of SEQ ID NO: 71 to 84.
  • polypeptide constructs of the invention are not limited to a polypeptide construct comprising anti-IgE single domain antibodies disclosed herein, but, as shown below, is applicable to any target.
  • the polypeptide constructs may comprise single domain antibodies directed against more than one target, optionally with the variations described above.
  • One embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target for use in treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound that is able pass through the gastric environment without being inactivated.
  • formulation technology may be applied to release a maximum amount of VHHs in the right location (in the stomach, in the colon, etc.). This method of delivery is important for treating, prevent and/or alleviate the symptoms of disorder whose targets that are located in the gut system.
  • An aspect of the invention is a method for treating, preventing and/or alleviating the symptoms of a disorder susceptible to modulation by a therapeutic compound that is able pass through the gastric environment without being inactivated, by orally administering to a subject a polypeptide construct comprising one or more single domain antibodies specific for antigen related to the disorder.
  • Another embodiment of the present invention is a use of a polypeptide construct as disclosed herein for the prepararion of a medicament for treating, preventing and/or aleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound that is able pass through the gastric environment without being inactivated.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the gut system without being inactivated, by orally administering to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the bloodstream of a subject without being inactivated, by orally administering to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target herein for use in treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound to the vaginal and/or rectal tract.
  • a formulation according to the invention comprises a polypeptide construct as disclosed herein comprising one or more VHHs directed against one or more targets in the form of a gel, cream, suppository, film, or in the form of a sponge or as a vaginal ring that slowly releases the active ingredient over time (such formulations are described in EP 707473, EP 684814, U.S. Pat. No. 5,629,001).
  • An aspect of the invention is a method for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by a therapeutic compound to the vaginal and/or rectal tract, by vaginally and/or rectally administering to a subject a polypeptide construct comprising one or more single domain antibodies specific for antigen related to the disorder.
  • Another embodiment of the present invention is a use of a polypeptide construct as disclosed herein for the prepararion of a medicament for treating, preventing and/or aleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound to the vaginal and/or rectal tract without being inactivated.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the vaginal and/or rectal tract without being inactivated, by administering to the vaginal and/or rectal tract of a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the bloodstream of a subject without being inactivated, by administering to the vaginal and/or rectal tract of a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target comprising at least one single domain antibody directed against a target, for use in treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound to the nose, upper respiratory tract and/or lung.
  • a formulation according to the invention comprises a polypeptide construct as disclosed herein directed against one or more targets in the form of a nasal spray (e.g. an aerosol) or inhaler. Since the construct is small, it can reach its target much more effectively than therapeutic IgG molecules.
  • An aspect of the invention is a method for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by a therapeutic compound to the upper respiratory tract and lung, by administering to a subject a polypeptide construct as disclosed herein wherein one or more single domain antibodies are specific for an antigen related to the disorder, by inhalation through the mouth or nose.
  • VHH compositions in particular dry powder dispersible VHH compositions, such as those described in U.S. Pat. No. 6,514,496.
  • These dry powder compositions comprise a plurality of discrete dry particles with an average particle size in the range of 0.4-10 ⁇ m.
  • Such powders are capable of being readily dispersed in an inhalation device.
  • VHH's are particularly suited for such composition as lyophilized material can be readily dissolved (in the lung subsequent to being inhaled) due to its high solubilisation capacity (Muyldermans, S., Reviews in Molecular Biotechnology, 74, 277-303, (2001)).
  • such lyophilized VHH formulations can be reconstituted with a diluent to generate a stable reconstituted formulation suitable for subcutaneous administration.
  • anti-IgE antibody formulations (Example 1; U.S. Pat. No. 6,267,958, EP 841946) have been prepared which are usefull for treating allergic asthma.
  • Another embodiment of the present invention is a use of a polypeptide construct as disclosed herein for the prepararion of a medicament for treating, preventing and/or aleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound to to the nose, upper respiratory tract and/or lung without being inactivated.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the nose, upper respiratory tract and lung, by administering to the nose, upper respiratory tract and/or lung of a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the nose, upper respiratory tract and/or lung without being inactivated, by administering to the nose, upper respiratory tract and/or lung of a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the bloodstream of a subject without being inactivated by administering to the nose, upper respiratory tract and/or lung of a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • One embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target for use in treating, preventing and/or alleviating the symptoms of disorders wherein the permeability of the intestinal mucosa is increased. Because of their small size, a polypeptide construct as disclosed herein can pass through the intestinal mucosa and reach the bloodstream more efficiently in subjects suffering from disorders which cause an increase in the permeability of the intestinal mucosa, for example Crohn's disease.
  • An aspect of the invention is a method for treating, preventing and/or alleviating the symptoms of disorders wherein the permeability of the intestinal mucosa is increased, by orally administering to a subject a polypeptide construct as disclosed herein comprising one or more single domain antibodiesspecific for an antigen related to the disorder.
  • VHH is fused to a carrier that enhances the transfer through the intestinal wall into the bloodstream.
  • this “carrier” is a second VHH which is fused to the therapeutic VHH.
  • the “carrier” VHH binds specifically to a receptor on the intestinal wall which induces an active transfer through the wall.
  • Another embodiment of the present invention is a use of a polypeptide construct as disclosed herein for the prepararion of a medicament for treating, preventing and/or aleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound to the intestinal mucosa, wherein said disorder increases the permeability of the intestinal mucosa.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the intestinal mucosa without being inactivated, by administering orally to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the bloodstream of a subject without being inactivated, by administering orally to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • One embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target for use in treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound that is able pass through the tissues beneath the tongue effectively.
  • a formulation of said polypeptide construct as disclosed herein, for example, a tablet, spray, drop is placed under the tongue and adsorbed through the mucus membranes into the capillary network under the tongue.
  • An aspect of the invention is a method for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by a therapeutic compound that is able pass through the tissues beneath the tongue effectively, by sublingually administering to a subject a VHH specific for an antigen related to the disorder.
  • Another embodiment of the present invention is a use of a polypeptide construct as disclosed herein for the preparation of a medicament for treating, preventing and/or aleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound that is able to pass through the tissues beneath the tongue.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the tissues beneath the tongue without being inactivated, by administering orally to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the bloodstream of a subject without being ineactivted, by administering orally to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • One embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody for use in treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound that is able, pass through the skin effectively.
  • a formulation of said polypeptide construct for example, a cream, film, spray, drop, patch, is placed on the skin and passes through.
  • An aspect of the invention is a method for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by a therapeutic compound that is able pass through the skin effectively, by topically administering to a subject a polypeptide construct as disclosed herein comprising one or more single domain antibodies specific for an antigen related to the disorder.
  • Another aspect of the invention is the use of a polypeptide construct as disclosed herein as a topical ophthalmic composition for the treatment of ocular disorder, such as allergic disorders, which method comprises the topical administration of an ophthalmic composition comprising polypeptide construct as disclosed herein, said construct comprising one or more anti-IgE VHH (Example 1, Example 2).
  • Another embodiment of the present invention is a use of a polypeptide construct as disclosed herein for the preparation of a medicament for treating, preventing and/or aleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound that is able pass through the skin effectively.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the skin without being inactivated, by administering topically to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the bloodstream of a subject, by administering topically to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • a non-limiting example of a therapeutic target against which a polypeptide construct of the invention may be used is TNF, which is involved in inflammatory processes.
  • TNF which is involved in inflammatory processes.
  • the blocking of TNF action can have an anti-inflammatory effect, which is highly desirable in certain disease states such as, for example, Crohn's disease.
  • Current therapy consists of intravenous administration of anti-TNF antibodies.
  • VHHs according to the invention demonstrate VHHs according to the invention which bind TNF and moreover, block its binding to the TNF receptor.
  • Oral delivery of these anti-TNF polypeptide constructs results in the delivery of such molecules in an active form in the colon at sites that are affected by the disorder. These sites are highly inflamed and contain TNF-producing cells.
  • anti-TNF polypeptide constructs can neutralise the TNF locally, avoiding distribution throughout the whole body and thus limiting negative side-effects.
  • Genetically modified microorganisms such as Micrococcus lactis are able to secrete antibody fragments (U.S. Pat. No. 6,190,662, WO 0023471). Such modified microorganisms can be used as vehicles for local production and delivery of antibody fragments in the intestine. By using a strain which produces a TNF neutralizing antibody fragment, inflammatory bowel disorder could be treated.
  • polypeptide construct comprising at least one single domain antibody specific for TNF-alpha for use in the treatment, prevention and/or alleviation of disorders relating to inflammatory processes, wherein said polypeptide construct is administered orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation.
  • a method of treating, preventing and/or alleviating disorders relating to inflammatory processes comprising administering to a subject a polypeptide construct comprising at least one single domain antibody directed against for example TNF-alpha orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation.
  • a polypeptide construct of the invention comprises at least one single domain antibody directed against TNF-alpha, said single domain antibody corresponding to a sequence represented by any of SEQ ID NOs: 12 to 14. Said sequences are anti-TNF-alpha Camelidae VHHs.
  • therapeutic targets against which a polypeptide construct of the invention may be used are certain colon cancer specific antigens, such as, for example, CEA or EGF receptors.
  • therapeutic VHHs against colon cancer antigens are linked to or provided with one more tumor destroying reagents such as for example, a chemical compound or a radioactive compound.
  • a colon cancer specific antigen is epidermal growth factor receptor (EGFR) which is an essential mediator of cell division in mammalian cells and is a recognised cellular oncogene. After the binding of EGF to its receptor (EGFR), a signaling cascade is initiated resulting in cell development.
  • EGFR epidermal growth factor receptor
  • the EGFR is also involved in human tumorigenesis as it is overexpressed on cells associated with epithelial malignancies located in sites such as the head, neck, lung, colon.
  • Another aspect of the invention is a polypeptide construct comprising at least one single domain antibody directed against EGFR for use in the treatment, prevention and/or alleviation of disorders relating to EGFR-mediated cancer, wherein said VHH is administered orally, sublingually, topically, nasally, intravenously, subcutaneously, vaginally, rectally or by inhalation (Examples 25 to 31).
  • Another aspect of the invention is a method of treating, preventing and/or alleviating disorders relating to EGFR-mediated cancer, comprising administering to a subject a polypeptide construct comprising at least one single domain antibody directed against EGFR orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation.
  • a polypeptide construct of the invention comprises at least one single domain antibody directed against EGFR, said single domain antibody corresponding to a sequence represented by any of SEQ ID NOs: 23 to 44.
  • Said sequences are anti-EGRF Camelidae VHHs.
  • colon cancer specific antigen is carcinoembryonic antigen (CEA), a recognized tumor marker.
  • CEA carcinoembryonic antigen
  • Another aspect of the invention is a polypeptide construct comprising one or more single domain antibodies specific for CEA for use in the treatment, prevention and/or alleviation of disorders relating to CEA-mediated cancer, wherein said polypeptide is administered orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation.
  • Another aspect of the invention is a method of treating, preventing and/or alleviating disorders relating to CEA-mediated cancer, comprising administering to a subject a polypeptide construct comprising at least one single domain antibody directed against CEA, orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation.
  • a few VHHs specific for this glycoprotein have been isolated by selection on solid-phase coated with CEA out of a dedicated library obtained after immunization of a dromedary. By using FACS analysis it appeared that only two fragments recognized the cell-bound antigen.
  • One of the VHHs, that recognised the native structure has been used to construct a fusion protein with ⁇ -lactamase.
  • the functionality of the purified fusion protein was tested in vitro in a prodrug converting cytotoxicity assay.
  • the immunoconjugate was tested in vivo in a tumor-targeting biodistribution study.
  • a non-limiting example of a therapeutic target against which a polypeptide construct of the invention may be used is Helicobacter pylori , which is a bacterium that lives in the mucus which coats the lining of the human stomach and duodenum.
  • the normal human stomach has a very thin layer of mucus that coats the whole of its inside surface. This mucus has a protective role, acting as a barrier between the acid in the stomach and the sensitive stomach wall.
  • H. pylori acts as an irritant to the lining of the stomach, and this causes inflammation of the stomach (gastritis).
  • a polypeptide construct comprising at least one single domain antibody directed against H.
  • pylori said construct and inhibits the enzymatic function of urease. Since single domain antibodies, in particular VHHs have the specific characteristic to occupy enzymatic sites, selected VHHs would inhibit the enzymatic activity and neutralize the virulence of a H. pylori infection.
  • a polypeptide construct comprising at least one single domain antibody directed against H. pylori , said construct inhibiting the adhesion of the bacteria to the stomach wall so preventing irritation of the stomach wall and gastritis.
  • One aspect of the invention is a polypeptide construct comprising one or more single domain antibodies directed against Helicobacter pylori for use in the treatment, prevention and/or alleviation of disorders relating to irritation of the stomach wall and gastritis, wherein said polypeptide construct is administered orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation, but preferably orally.
  • Another aspect of the invention is a method of treating, preventing and/or alleviating disorders relating to irritation of the stomach wall and gastritis, comprising administering to a subject a polypeptide construct comprising one or more single domain antibodies directed against Helicobacter pylon, orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation, but preferably orally.
  • Hepatitis E is a viral disorder transmitted via the fecal/oral route. Symptoms increase with age and include abdominal pain, anorexia, dark urine, fever, hepatomegaly, jaundice, malaise, nausea, and vomiting. The overall fatality rate is 1-3%, but 15-25% in pregnant women. Once encountered, most patients develop a neutralizing IgG response which gives life-long protection Neutralizing VHH molecules have the advantage over conventional IgG molecules because they may be administered orally. Since most infections with hepatitis E occur in North-Africa, Central-Africa, Asia and Central-America, oral administration is a significant advantage, since medical logistics are less developed in those countries.
  • One aspect of the invention is one or more VHHs specific for HEV capsid protein (56 kDa) for use in the treatment, prevention and/or alleviation of disorders relating hepatitis E, wherein said VHH is administered orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation.
  • Another aspect of the invention is a method of treating, preventing and/or alleviating disorders relating to hepatitis E, comprising administering to a subject said VHH orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation.”
  • TB or tuberculosis is a disorder caused by bacteria called Mycobacterium tuberculosis .
  • the bacteria can attack any part of the body, but they usually attack the lungs.
  • Influenza is a viral disorder that causes ‘flu’. Influenza viruses are also present in the lung.
  • One aspect of the invention is a polypeptide construct comprising at least one single domain antibody directed against Mycobacterium tuberculosis epitope for use in the treatment, prevention and/or alleviation of disorders relating TB, wherein said polypeptide construct is administered orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation.
  • Another aspect of the invention is a method of treating, preventing and/or alleviating disorders relating to TB, comprising administering to a subject said polypeptide construct orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation.
  • polypeptide construct comprising at least one single domain antibody directed against an influenza virus epitope for use in the treatment, prevention and/or alleviation of disorders relating flu, wherein said polypeptide construct is administered orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation.
  • a method of treating, preventing and/or alleviating disorders relating to flu comprising administering to a subject said polypeptide construct orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation.
  • a therapeutic target against which a polypeptide of the invention may be used is IgE in relation to allergies.
  • subjects may develop an allergic response to harmless parasites (e.g. Dermatophagoides pteronyssinus , house dust mite) or substances (clumps, plastics, metals).
  • IgE molecules that initiate a cascade of immunological responses.
  • One aspect of the present invention is a polypeptide construct comprising at least one single domain antibody directed against IgE, said polypeptide preventing the interaction of IgE with their receptor(s) on mast cells and basophils. As such they prevent the initiation of the immunological cascade, an allergic reaction.
  • Another aspect of the invention is a polypeptide construct comprising at least one single domain antibody directed against an IgE epitope for use in the treatment, prevention and/or alleviation of disorders relating to allergies, wherein said polypeptide construct is administered orally, sublingually, topically, nasally, vaginally, rectally or by inhalation.
  • Another aspect of the invention is a method of treating, preventing and/or alleviating disorders relating to allergies, comprising administering to a subject said polypeptide construct orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation.
  • a polypeptide construct of the invention comprises at least one single domain antibody directed against IgE, said single domain antibody corresponding to a sequence represented by any of SEQ ID NOs: 1 to 11. Said sequences are anti-IgE Camelidae VHHs.
  • MMP-12 human macrophage elastase
  • MMPs matrix metalloproteases
  • These enzymes play an important role in normal and inflammatory processes contributing to tissue remodeling and destruction.
  • MMPs play besides proper extracellular matrix remodeling also an important role in diverse disease states such as cancer and inflammation.
  • Macrophage elastase or MMP-12 has a large specificity pocket and broad substrate specificity. It plays a role in several disorders owing to excessive protein degradation of extracellular proteins (e.g. lung damage in smoke induced emphysema, Churg et al, A. 2003) or increased matrix degradation (e.g.
  • MMP-12 is secreted into the extracellular space by lung alveolar macrophages and dysregulation of MMP-12 is a possible reason for degradation of the alveolar membrane leading to lung emphysema.
  • Target substrates of MMP-12 include extracellular matrix proteins such as elastin, fibronectin and laminin, but also ⁇ 1-antitrypsin and tissue factor protease inhibitor.
  • One aspect of the invention is a polypeptide construct comprising at least one single domain antibody directed against MMP-12 for use in the treatment, prevention and/or alleviation of disorders relating to inflammatory processes, wherein said polypeptide construct is administered orally, sublingually, topically, nasally, vaginally, rectally or by inhalation.
  • Another aspect of the invention is a method of treating, preventing and/or alleviating disorders relating to inflammatory processes, comprising administering to a subject said polypeptide construct orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation.
  • Another aspect of this invention consists of (1) VHH's that specifically bind to a metalloproteinase and are not degraded by a metalloproteinase, (2) VHH's which inhibit the proteolytic activity of one or more metalloproteinase and (3) inhibitory VHH's which are highly specific for one MMP (e.g. MMP-12 specific antagonist), unlike none-specific chemical inhibitors (e.g. batimastat, merimastat . . . )
  • a polypeptide construct of the invention comprises at least one single domain antibody directed against human MMP-12, said single domain antibody corresponding to a sequence represented by any of SEQ ID NOs: 15 to 22.
  • Said sequences are anti-MMP-12 Camelidae VHHs.
  • IFN-gamma Another non-limiting example of a therapeutic target against which a polypeptide construct of the invention may be used is IFN-gamma, which is secreted by some T cells.
  • IFN gamma stimulates natural killer (NK) cells and T helper 1 (Th1) cells, and activates macrophages and stimulates the expression of MHC molecules on the surface of cells.
  • NK natural killer
  • Th1 T helper 1
  • IFN gamma generally serves to enhance many aspects of immune function, and is a candidate for treatment of disease states where the immune system is over-active (e.g. Crohn's disease), e.g., autoimmune disorders and organ plant rejection.
  • polypeptide constructs comprising at least one single domain antibody directed against IFN-gamma for use in the treatment, prevention and/or alleviation of disorders relating to the immune response, wherein said polypeptide construct is administered orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation.
  • Another aspect of the invention is a method of treating, preventing and/or alleviating disorders relating to the immune response, comprising administering to a subject said polypeptide construct orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation.
  • polypeptide constructs that neutralize IFN gamma are used to treat patients with psoriasis.
  • a polypeptide construct of the invention comprises at least one single domain antibody directed against IFN-gamma, said single domain antibody corresponding to a sequence represented by any of SEQ ID NOs: 45 to 70.
  • Said sequences are anti-IFN-gamma Camelidae VHHs.
  • the invention also relates to a method of identifying single domain antibodies (e.g. VHHs) harbouring specific sequences which facilitates the delivery or transport of the anti-target single domain antibodies across human or animal tissues (as described in U.S. Pat. No. 6,361,938), including without limitation GIT epithelial layers, alveolar cells, endothelial of the blood-brain barrier, vascular smooth muscle cells, vascular endothelial cells, renal epithelial cells, M cells of the Peyers Patch, and hepatocytes.
  • delivery systems could be used in conjunction with the VHH's of the invention, comprising nanoparticles, microparticles, liposomes, micelles, cyclodextrines.
  • Another aspect of the present invention is a method and molecules for delivering therapeutic polypeptides and/or agents to the inside of cells.
  • a further aspect of the invention is a method and molecules for delivering antigens to the inside of antigen presenting cells, and thereby eliciting a powerful immune response thereto.
  • a still further aspect of the invention is to provide a method and molecules for delivery of therapeutic polypeptides and/or agents across natural barriers such as the blood-brain barrier, lung-blood barrier.
  • One aspect of the invention is a polypeptide construct comprising one or more single domain antibodies directed against a target and comprising one or more single domain antibodies directed against an internalising cellular receptor, wherein said polypeptide construct internalises upon binding to said receptor.
  • the targets inside cells may affect the functioning of said cell, or binding thereto may lead to a change in the phenotype of the cell itself by itself. This can be for example, cell death, effects on cell cycling or cell growth or interference with intracellular signaling pathways (see, for example, Poul M A et al, J Mol Biol, 2000, 301, 1149-1161).
  • One embodiment of the present invention is a polypeptide construct comprising one or more single domain antibodies specific for an internalising cellular receptor, wherein said construct internalises upon binding to said receptor, wherein the polypeptide construct comprises a therapeutic polypeptide or agent which is covalently or non-covalently linked thereto.
  • Said therapeutic polypeptide or agent has one or more targets which acts intracellularly. See, for example, FIG. 12 .
  • Said therapeutic polypeptides may harbour specific sequences which target the polypeptide to specific attachments in the cell, comprising vesicles, organelles and other cytoplasmic structures, membrane-bound structures, the nucleus.
  • An internalising receptor according to the invention is a receptor displayed on the surface of a cell which upon binding to a ligand, mediates the internalisation of said ligand into the cytoplasm of the cell.
  • Internalising receptors according to the invention include, but are not limited to, LDL receptors, EGFr, FGF2r, ErbB2r, transferrin receptor, PDGFr, VEGFr, PsmAr or antigen presenting cell internalising receptors.
  • One embodiment of the present invention is a polypeptide construct comprising one or more single domain antibodies specific for an internalising cellular receptor as disclosed herein, further comprising an antigen.
  • One embodiment of the present invention is a polypeptide construct comprising one or more single domain antibodies specific for an internalising cellular receptor as disclosed herein, wherein said receptor is an internalising receptor on an antigen presenting cell (APC).
  • APC antigen presenting cell
  • the receptor is highly specific for APCs and not present or is present in lower amounts on other cell types.
  • Another embodiment of the invention is a polypeptide construct comprising one or more anti-receptor single domain antibodies and an antigen.
  • antigen uptake by APC is not determined by the passive interaction between APC and antigen, but by the “active” binding between VHH and said receptor. This not only makes the process more efficient, but also more reproducible and not dependent on the antigen structure which causes great variability in the T-cell activation from antigen to antigen.
  • the complex is digested by the APC and pieces of the antigen can be exposed on the surface in association with MHC/HLA and elicit a more powerful immune response.
  • Another embodiment of the present invention is a method for immunising a subject against an antigen comprising administering to a subject in need thereof a polypeptide construct comprising at least one single domain antibody directed against an antigen present on an APC, wherein said single domain antibody further comprises the antigen of interest.
  • One embodiment of the present invention is a polypeptide construct comprising one or more single domain antibodies specific for an internalising cellular receptor as disclosed herein, wherein said receptor is EGFR.
  • sequestration In general internalization of receptors occurs upon binding of the agonistic ligand in a proces called sequestration. In order to ensure that extracellular signals are translated into intracellular signals of appropriate magnitude and specificity, the signalling cascades are tightly regulated via the process of sequestration, whereby receptors are physically removed from the cell surface by internalization to a cytosolic compartment (Carman, C. V. and Benovic, J. L. Current Opinion in Neurobiology 1998, 8: 335-344). This implies that only agonistic ligands or antibodies indeed are expected to internalize via such receptors. In terms of therapeutic use it is not a desired effect that the antibody first triggers proliferation of the tumorcells, before it can deliver a toxic payload to the interiour of the cell.
  • EGF epidermal growth factor receptor
  • ErBb2 receptor ErBb2 receptor
  • EGFR epidermal growth factor receptor
  • ErBb2 receptor ErBb2 receptor
  • EGFR epidermal growth factor receptor
  • a signaling cascade is initiated resulting in cell development.
  • the EGFR is involved in human tumorigenesis as it is overexpressed on cells of many epithelial malignancies such as head, neck, lung, colon.
  • VHH that are internalised upon binding to one of these receptors can be used to deliver molecules inside the cell.
  • polypeptide construct comprising one or more single domain antibodies directed against EGFR, wherein a single domain antibody corresponds to a sequence represented by any of SEQ ID NOs: 23 to 44.
  • a single domain antibody corresponds to a sequence represented by any of SEQ ID NOs: 23 to 44.
  • one of the single domain antibodies did not activate the EGFR, despite the fact that it was internalized efficiently.
  • Such types of antibodies are preferred for therapeutic applications, since these can deliver toxic payloads into cells without stimulating its proliferation.
  • polypeptide construct construct comprising one or more single domain antibodies directed against for EGFR, wherein said anti-EGFR single domain antibody does not activate the EGFR.
  • Said polypeptide construct may be used for the delivery of a therapeutic agents and/or polypeptides into a cell, as mentioned herein, without stimulating the EGFR.
  • polypeptide construct construct comprising one or more single domain antibodies directed against for EGFR, wherein said anti-EGFR single domain antibody does not activate the EGFR and corresponds to a sequence represented by SEQ ID NO: 31.
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against an internalising cellular receptor, wherein said construct internalises upon binding to said receptor, and further comprising one or more single domain antibodies directed against an intracellular target, said single domain antibodies covalently or non-covalently linked.
  • This multispecific polypeptide construct may be used in the treatment, prevention and/or alleviation of disorders, according to the target of the non-receptor specific single domain antibody.
  • This target can be, for example, a kinase such as PDK1.
  • PDK1 is over-expressed in breast tumor cells. It activates Akt by phosphorylating T308 in the activation loop.
  • a number of downstream substrates of Akt play a direct role in promoting cell survival. These include GSK3, Bad, caspase-9 and Forkhead.
  • One embodiment of the present invention is a polypeptide construct comprising a single domain antibody directed against an internalising cellular receptor, wherein said construct internalises upon binding to said receptor, and further comprising one or more single domain antibodies directed against any of PDK1, GSK1, Bad, caspase-9 and Forkhead.
  • Another aspect of the invention the use of said construct for treating cancer.
  • Another aspect of the invention is said construct for the preparation of a medicament for treating cancer.
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against an internalising cellular receptor, wherein said construct internalises upon binding to said receptor, wherein the construct further comprises a drug or a toxic compound covalently or non-covalently linked thereto.
  • a toxic compound is a compound that is only active intracellularly due to reducing environment (e.g. an enzyme recombinantly modified with additional cysteins resulting in inactive enzyme, but active in reducing environment).
  • Another example of a toxic compound is a one that is specifically toxic only to a particular cell-type.
  • An example of a toxic compound or a drug is a compound activated by a ligand present inside the cell and leading to the phenotype of interest.
  • Other examples include prodrugs, small organic molecules.
  • One aspect of the invention the use of said construct in the treatment of disorder requiring administration of the same.
  • Another aspect of the invention is said construct for the preparation of a medicament for the treatment of disorder requiring administration of
  • polypeptide construct comprising at least one single domain antibody directed against an internalising cellular receptor, wherein said construct internalises upon binding to said receptor, and wherein a filamentous phage expresses said construct on its surface.
  • Said construct may be attached to the tip of the phage.
  • construct-phage assembly can be used to package and deliver DNA to the cell for use as a gene therapy vector.
  • the phage may carry DNA in additional to that encoding said construct, for use therapeutically.
  • the phage may carry a gene encoding a therapeutic polypeptide controlled by a promoter for the expression of said gene inside the cell.
  • said promoter includes, but is not limited to, the CMV promoter (Kassner et al, Biochem Biophys Res Commun, 1999, 264: 921-928). Phage have distinct advantages over existing gene therapy vectors because they are simple, economical to produce at high titer, have no intrinsic tropism for mammalian cells, and are relatively simple to genetically modify and evolve (Larocca D et al, Curr. Pharm. Biotechnol, 2002: 3: 45-57).
  • Another embodiment of the present invention is a polypeptide construct as disclosed herein, wherein said single domain antibody is a peptide derived from a VHH specific for an internalising cellular receptor. Said VHH peptide may bind their antigen almost only through the peptide.
  • Internalising VHHs may be prepared from a peptide library which is screened for internalising properties. It is an aspect of the invention that these VHH peptides can be added as a tag to therapeutic polypeptides or agents, for intracellular uptake.
  • the VHH peptide may, for example, be used to transport a therapeutic VHH into a cell.
  • the VHH peptide is the CDR3. In another one embodiment of the invention, the VHH peptide is any other CDR.
  • Another embodiment of the present invention is a method of selecting for VHHs specific for an internalising cellular receptor, wherein said VHH internalise upon binding to said receptor, comprising panning receptor-displaying cells with a phage library (na ⁇ ve or immune) of VHH, and selecting for internalising VHH by recovering the endocytosed phage from within the cell.
  • the invention includes a selection method which uses cell lines that overexpress a receptor or cell lines transfected with a receptor gene to allow the easy selection of phage antibodies binding to the receptor. This avoids the need for protein expression and purification, speeding up significantly the generation of internalizing VHH.
  • Another embodiment of the present invention is a method for delivering a therapeutic polypeptide, agent or antigen for uptake by cellular internalisation by covalently or non-covalently attaching thereto a polypeptide construct comprising at least one single domain antibody specific for an internalising cellular receptor, wherein said construct internalises upon binding to said receptor.
  • VHHs according to the invention may be used to treat, prevent and/or alleviate symptoms of disorders requiring the administration of the same.
  • Another embodiment of the present invention is a method for delivering a therapeutic polypeptide or agent that interacts with intracellular targets molecules comprising administering to a subject in need thereof one or more VHHs specific for an internalising cellular receptor, wherein said VHH internalise upon binding to said receptor, wherein said VHH is fused to said polypeptide or agent.
  • a natural barrier includes, but is not limited to, the blood-brain, lung-blood, gut-blood, vaginal-blood, rectal-blood and nasal-blood barriers.
  • a peptide construct delivered via the upper respiratory tract and lung can be used for transport of therapeutic polypeptides or agents from the lung lumen to the blood.
  • the construct binds specifically to a receptor present on the mucosal surface (bronchial epithelial cells) resulting in transport, via cellular internalisation, of the therapeutic polypeptides or agents specific for bloodstream targets from the lung lumen to the blood.
  • a therapeutic polypeptide or agent is linked to a polypeptide construct comprising at least one single domain antibody directed against an internalising cellular receptor present on the intestinal wall into the bloodstream. Said construct induces a transfer through the wall, via cellular internalization, of said therapeutic polypeptide or agent.
  • VHH specific for an internalising cellular receptor, wherein said VHH internalises upon binding to said receptor, said VHH is covalently or non-covalently attached to a therapeutic polypeptide or agent, and said VHH crosses a natural barrier.
  • Another embodiment of the present invention is a method for delivering a therapeutic polypeptide, agent or antigen for uptake at a local by covalently or non-covalently attaching it to a VHH specific for an internalising cellular receptor, wherein said VHH internalises upon binding to said receptor.
  • a local area includes, but is not limited to, the brain, lung, gut, vaginal, rectal and nasal areas.
  • One embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target for use in treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound that is able pass through the gastric environment without being inactivated.
  • formulation technology may be applied to release a maximum amount of VHHs in the right location (in the stomach, in the colon, etc.). This method of delivery is important for treating, prevent and/or alleviate the symptoms of disorder whose targets that are located in the gut system.
  • An aspect of the invention is a method for treating, preventing and/or alleviating the symptoms of a disorder susceptible to modulation by a therapeutic compound that is able pass through the gastric environment without being inactivated, by orally administering to a subject a polypeptide construct comprising one or more single domain antibodies specific for antigen related to the disorder.
  • Another embodiment of the present invention is a use of a polypeptide construct as disclosed herein for the prepararion of a medicament for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound that is able pass through the gastric environment without being inactivated.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the gut system without being inactivated, by orally administering to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the bloodstream of a subject without being inactivated, by orally administering to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target for use in treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound delivered to the vaginal and/or rectal tract.
  • a formulation according to the invention comprises a polypeptide construct as disclosed herein comprising one or more VHHs directed against one or more targets in the form of a gel, cream, suppository, film, or in the form of a sponge or as a vaginal ring that slowly releases the active ingredient over time (such formulations are described in EP 707473, EP 684814, U.S. Pat. No. 5,629,001).
  • An aspect of the invention is a method for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound delivered to the vaginal and/or rectal tract, by vaginally and/or rectally administering to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • Another embodiment of the present invention is a use of a polypeptide construct as disclosed herein for the preparation of a medicament for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound delivered to the vaginal and/or rectal tract without being inactivated.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the vaginal and/or rectal tract without being inactivated, by administering to the vaginal and/or rectal tract of a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the bloodstream of a subject without being inactivated, by administering to the vaginal and/or rectal tract of a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target comprising at least one single domain antibody directed against a target, for use in treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound delivered to the nose, upper respiratory tract and/or lung.
  • a formulation according to the invention comprises a polypeptide construct as disclosed herein directed against one or more targets in the form of a nasal spray (e.g. an aerosol) or inhaler. Since the construct is small, it can reach its target much more effectively than therapeutic IgG molecules.
  • An aspect of the invention is a method for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic delivered to the nose, upper respiratory tract and lung, by administering to a subject a polypeptide construct as disclosed herein wherein one or more single domain antibodies are specific for an antigen related to the disorder, by inhalation through the mouth or nose.
  • VHH compositions in particular dry powder dispersible VHH compositions, such as those described in U.S. Pat. No. 6,514,496.
  • These dry powder compositions comprise a plurality of discrete dry particles with an average particle size in the range of 0.4-10 mm.
  • Such powders are capable of being readily dispersed in an inhalation device.
  • VHH's are particularly suited for such composition as lyophilized material can be readily dissolved (in the lung subsequent to being inhaled) due to its high solubilisation capacity (Muyldermans, S., Reviews in Molecular Biotechnology, 74, 277-303, (2001)).
  • such lyophilized VHH formulations can be reconstituted with a diluent to generate a stable reconstituted formulation suitable for subcutaneous administration.
  • anti-IgE antibody formulations (Example 1; U.S. Pat. No. 6,267,958, EP 841946) have been prepared which are usefull for treating allergic asthma.
  • Another embodiment of the present invention is a use of a polypeptide construct as disclosed herein for the preparation of a medicament for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound delivered to the nose, upper respiratory tract and/or lung without being inactivated.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the nose, upper respiratory tract and lung, by administering to the nose, upper respiratory tract and/or lung of a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the nose, upper respiratory tract and/or lung without being inactivated, by administering to the nose, upper respiratory tract and/or lung of a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the bloodstream of a subject without being inactivated by administering to the nose, upper respiratory tract and/or lung of a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • One embodiment of the present invention is a polypeptide construct as disclosed herein for use in treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound delivered to the intestinal mucosa, wherein said disorder increases the permeability of the intestinal mucosa. Because of their small size, a polypeptide construct as disclosed herein can pass through the intestinal mucosa and reach the bloodstream more efficiently in subjects suffering from disorders which cause an increase in the permeability of the intestinal mucosa, for example, Crohn's disease.
  • An aspect of the invention is a method for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound delivered to the intestinal mucosa, wherein said disorder increases the permeability of the intestinal mucosa, by orally administering to a subject a polypeptide construct as disclosed herein.
  • Another embodiment of the present invention is a use of a polypeptide construct as disclosed herein for the preparation of a medicament for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound delivered to the intestinal mucosa, wherein said disorder increases the permeability of the intestinal mucosa.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the intestinal mucosa without being inactivated, by administering orally to a subject a polypeptide construct of the invention.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the bloodstream of a subject without being inactivated, by administering orally to a subject a polypeptide construct of the invention.
  • a polypeptide construct as described herein is fused to a carrier that enhances the transfer through the intestinal wall into the bloodstream.
  • this “carrier” is a VHH which is fused to said polypeptide.
  • VHH binds specifically to a receptor on the intestinal wall which induces an active transfer through the wall.
  • One embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target for use in treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound that is able pass through the tissues beneath the tongue effectively.
  • a formulation of said polypeptide construct as disclosed herein, for example, a tablet, spray, drop is placed under the tongue and adsorbed through the mucus membranes into the capillary network under the tongue.
  • An aspect of the invention is a method for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by a therapeutic compound that is able pass through the tissues beneath the tongue effectively, by sublingually administering to a subject a VHH specific for an antigen related to the disorder.
  • Another embodiment of the present invention is a use of a polypeptide construct as disclosed herein for the preparation of a medicament for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound that is able to pass through the tissues beneath the tongue.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the tissues beneath the tongue without being inactivated, by administering orally to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the bloodstream of a subject without being inactivated, by administering orally to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • One embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody for use in treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound that is able pass through the skin effectively.
  • a formulation of said polypeptide construct for example, a cream, film, spray, drop, patch, is placed on the skin and passes through.
  • An aspect of the invention is a method for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by a therapeutic compound that is able pass through the skin effectively, by topically administering to a subject a polypeptide construct as disclosed herein comprising one or more single domain antibodies specific for an antigen related to the disorder.
  • Another aspect of the invention is the use of a polypeptide construct as disclosed herein as a topical ophthalmic composition for the treatment of ocular disorder, such as allergic disorders, which method comprises the topical administration of an ophthalmic composition comprising polypeptide construct as disclosed herein, said construct comprising one or more anti-IgE VHH (Example 1, Example 2).
  • Another embodiment of the present invention is a use of a polypeptide construct as disclosed herein for the preparation of a medicament for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound that is able pass through the skin effectively.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the skin without being inactivated, by administering topically to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the bloodstream of a subject, by administering topically to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • Another aspect of the present invention is a method to determine which single domain antibodies (e.g. VHHs) molecules cross a natural barrier into the bloodstream upon administration using, for example, oral, nasal, lung, skin.
  • the method comprises administering a na ⁇ ve, synthetic or immune single domain antibody phage library to a small animal such as a mouse.
  • a small animal such as a mouse.
  • blood is retrieved to rescue phages that have been actively transferred to the bloodstream.
  • organs can be isolated and bound phages can be stripped off.
  • a non-limiting example of a receptor for active transport from the lung lumen to the bloodstream is the Fc receptor N (FcRn).
  • the method of the invention thus identifies single domain antibodies which are not only actively transported to the blood, but are also able to target specific organs.
  • the method may identify which VHH are transported across the gut and into the blood; across the tongue (or beneath) and into the blood; across the skin and into the blood etc.
  • One aspect of the invention are the single domain antibodies obtained by using said method.
  • said single domain antibody may be used as a single domain antibody in a polypeptide construct of the invention.
  • Said construct, further comprising another single domain antibody, a therapeutic agent, or polypeptide carrier directed against a target accessible via or in the blood may be administered by the route most efficient for said single domain antibody.
  • “therapeutically effective amount”, “therapeutically effective dose” and “effective amount” means the amount needed to achieve the desired result or results (such as for instance modulating IFN-gamma binding; treating or preventing inflammation).
  • an “effective amount” can vary for the various compounds that modulate ligand-target binding, such as for instance IFN-gamma binding used in the invention.
  • One skilled in the art can readily assess the potency of the compound.
  • the term “compound” refers to a polypeptide construct of the present invention, or a nucleic acid capable of encoding said polypeptide construct.
  • pharmaceutically acceptable is meant a material that is not biologically or otherwise undesirable, i.e., the material may be administered to an individual along with the compound without causing any undesirable biological effects or interacting in a deleterious manner with any of the other components of the pharmaceutical composition in which it is contained.
  • polypeptide constructs of the present invention are useful for treating or preventing conditions in a subject and comprises administering a pharmaceutically effective amount of a compound or composition.
  • polypeptide constructs as disclosed here in are useful for treating or preventing conditions in a subject and comprises administering a pharmaceutically effective amount of a compound combination with another, such as, for example, doxorubicin.
  • the present invention is not limited to the administration of formulations comprising a single compound of the invention. It is within the scope of the invention to provide combination treatments wherein a formulation is administered to a patient in need thereof that comprises more than one compound of the invention.
  • a compound useful in the present invention can be formulated as pharmaceutical compositions and administered to a mammalian host, such as a human patient or a domestic animal in a variety of forms adapted to the chosen route of administration, i.e., parenterally, intravenously, intramuscularly, subcutaneously, to the vaginal and/or rectal tract, nasally, by inhalation though the mouth or nose, to the tissues beneath the tongue, or topically.
  • a mammalian host such as a human patient or a domestic animal in a variety of forms adapted to the chosen route of administration, i.e., parenterally, intravenously, intramuscularly, subcutaneously, to the vaginal and/or rectal tract, nasally, by inhalation though the mouth or nose, to the tissues beneath the tongue, or topically.
  • a compound of the present invention can also be administered using gene therapy methods of delivery. See, e.g., U.S. Pat. No. 5,399,346, which is incorporated by reference in its entirety.
  • gene therapy methods of delivery See, e.g., U.S. Pat. No. 5,399,346, which is incorporated by reference in its entirety.
  • primary cells transfected with the gene for the compound of the present invention can additionally be transfected with tissue specific promoters to target specific organs, tissue, grafts, tumors, or cells.
  • the present compound may be administered in combination with a pharmaceutically acceptable vehicle such as an inert diluent or an assimilable edible carrier. They may be enclosed in hard or soft shell gelatin capsules, may be compressed into tablets, or may be incorporated directly with the food of the patient's diet.
  • a pharmaceutically acceptable vehicle such as an inert diluent or an assimilable edible carrier. They may be enclosed in hard or soft shell gelatin capsules, may be compressed into tablets, or may be incorporated directly with the food of the patient's diet.
  • the active compound may be combined with one or more excipients and used in the form of ingestible tablets, buccal tablets, troches, capsules, elixirs, suspensions, syrups, wafers, and the like.
  • Such compositions and preparations should contain at least 0.1% of active compound.
  • the percentage of the compositions and preparations may, of course, be varied and may conveniently be between about 2 to about 60% of the weight of a given unit dosage form.
  • the tablets, troches, pills, capsules, and the like may also contain the following: binders such as gum tragacanth, acacia, corn starch or gelatin; excipients such as dicalcium phosphate; a disintegrating agent such as corn starch, potato starch, alginic acid and the like; a lubricant such as magnesium stearate; and a sweetening agent such as sucrose, fructose, lactose or aspartame or a flavoring agent such as peppermint, oil of wintergreen, or cherry flavoring may be added.
  • a liquid carrier such as a vegetable oil or a polyethylene glycol.
  • any material used in preparing any unit dosage form should be pharmaceutically acceptable and substantially non-toxic in the amounts employed.
  • the active compound may be incorporated into sustained-release preparations and devices.
  • the active compound may also be administered intravenously or intraperitoneally by infusion or injection.
  • Solutions of the active compound or its salts can be prepared in water, optionally mixed with a nontoxic surfactant.
  • Dispersions can also be prepared in glycerol, liquid polyethylene glycols, triacetin, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.
  • the pharmaceutical dosage forms suitable for injection or infusion can include sterile aqueous solutions or dispersions or sterile powders comprising the active ingredient which are adapted for the extemporaneous preparation of sterile injectable or infusible solutions or dispersions, optionally encapsulated in liposomes.
  • the liquid carrier or vehicle can be a solvent or liquid dispersion medium comprising, for example, water, ethanol, a polyol (for example, glycerol, propylene glycol, liquid polyethylene glycols, and the like), vegetable oils, nontoxic glyceryl esters, and suitable mixtures thereof.
  • the proper fluidity can be maintained, for example, by the formation of liposomes, by the maintenance of the required particle size in the case of dispersions or by the use of surfactants.
  • the prevention of the action of microorganisms can be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars, buffers or sodium chloride. Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminum monostearate and gelatin.
  • Sterile injectable solutions are prepared by incorporating the active compound in the required amount in the appropriate solvent with various of the other ingredients enumerated above, as required, followed by filter sterilization.
  • the preferred methods of preparation are vacuum drying and the freeze drying techniques, which yield a powder of the active ingredient plus any additional desired ingredient present in the previously sterile-filtered solutions.
  • the present compound may be applied in pure form, i.e., when they are liquids. However, it will generally be desirable to administer them to the skin as compositions or formulations, in combination with a dermatologically acceptable carrier, which may be a solid or a liquid.
  • a dermatologically acceptable carrier which may be a solid or a liquid.
  • Useful solid carriers include finely divided solids such as talc, clay, microcrystalline cellulose, silica, alumina and the like.
  • Useful liquid carriers include water, hydroxyalkyls or glycols or water-alcohol/glycol blends, in which the present compound can be dissolved or dispersed at effective levels, optionally with the aid of non-toxic surfactants.
  • Adjuvants such as fragrances and additional antimicrobial agents can be added to optimize the properties for a given use.
  • the resultant liquid compositions can be applied from absorbent pads, used to impregnate bandages and other dressings, or sprayed onto the affected area using pump-type or aerosol sprayers.
  • Thickeners such as synthetic polymers, fatty acids, fatty acid salts and esters, fatty alcohols, modified celluloses or modified mineral materials can also be employed with liquid carriers to form spreadable pastes, gels, ointments, soaps, and the like, for application directly to the skin of the user.
  • Examples of useful dermatological compositions which can be used to deliver the compound to the skin are known to the art; for example, see Jacquet et al. (U.S. Pat. No. 4,608,392), Geria (U.S. Pat. No. 4,992,478), Smith et al. (U.S. Pat. No. 4,559,157) and Wortzman (U.S. Pat. No. 4,820,508).
  • Useful dosages of the compound can be determined by comparing their in vitro activity, and in vivo activity in animal models. Methods for the extrapolation of effective dosages in mice, and other animals, to humans are known to the art; for example, see U.S. Pat. No. 4,938,949.
  • the concentration of the compound(s) in a liquid composition will be from about 0.1-25 wt-%, preferably from about 0.5-10 wt-%.
  • concentration in a semi-solid or solid composition such as a gel or a powder will be about 0.1-5 wt-%, preferably about 0.5-2.5 wt-%.
  • the amount of the compound, or an active salt or derivative thereof, required for use in treatment will vary not only with the particular salt selected but also with the route of administration, the nature of the condition being treated and the age and condition of the patient and will be ultimately at the discretion of the attendant physician or clinician. Also the dosage of the compound varies depending on the target cell, tumor, tissue, graft, or organ.
  • the desired dose may conveniently be presented in a single dose or as divided doses administered at appropriate intervals, for example, as two, three, four or more sub-doses per day.
  • the sub-dose itself may be further divided, e.g., into a number of discrete loosely spaced administrations; such as multiple inhalations from an insufflator or by application of a plurality of drops into the eye.
  • An administration regimen could include long-term, daily treatment.
  • long-term is meant at least two weeks and preferably, several weeks, months, or years of duration. Necessary modifications in this dosage range may be determined by one of ordinary skill in the art using only routine experimentation given the teachings herein. See Remington's Pharmaceutical Sciences (Martin, E. W., ed. 4), Mack Publishing Co., Easton, Pa. The dosage can also be adjusted by the individual physician in the event of any complication.
  • FIG. 1 Schematic illustrating the regions of IgE
  • FIG. 2 ELISA of reference and pepsin-treated TNF3E at pH2.2, pH3.2 and pH4.2 (100% is the signal measured at a 1/100 dilution)
  • FIG. 3 Experimental setting
  • FIG. 4 Capacity of VHH clones to inhibit the proteolytic activity of human catalytic domain of MMP12
  • FIG. 5 ELISA to detect A431 specific antibody titers in llama serum.
  • FIG. 6 Detection of EGFR specific antibody titers in llama serum.
  • FIG. 7 Detection of EGFR specific antibody titers in serum of llama 024 and 025 and of llama 026 and 027.
  • FIG. 8 Phage response to EGFR
  • FIG. 9 Amino acid alignment of 31 clones identified by the epitope specific elution selection procedure
  • FIG. 10 Phage ELISA on cells (panel A) or on solid-phase immobilized EGFR (panel B) of the 20 unique EGFR specific clones identified via the epitope specific elution selection procedure
  • FIG. 11 Effect of nanobody EGFR-IIIa42 on receptor internalization and signalling. Fluorescence microscopy visualization of EGFR-IIIa42 under conditions that allow internalization, with Her-14 (panel A) or 3T3 (panel B). A Western blot that shows the effect of EGFR-IIIa42 on receptor tyrosin kinase activity is represented in panel C.
  • FIG. 12 Schematic illustrating a use of VHHs directed towards internalising receptors to deliver therapeutic protein, toxic compound, drug or polynucleotide.
  • Table 5 Second round selection using neutravidine coated tubes as described in Example 1
  • Table 8 Overview of the libraries, their diversity and % insert derived from different llama's and tissues as described in Example 7 and 8
  • Example 1 VHH directed against IgE
  • Example 7 Efficacy in an animal model for IBD
  • Example 10 Rescue of the library and phage preparation
  • Example 15 Functional characterization of selected VHH's: inhibition of MMP-12 proteolytic activity by a VHH in a calorimetric assay.
  • Example 16 Formulation of anti-MMP12 VHH for pulmonary delivery
  • Example 23 Topical applications of anti-IFN gamma VHH's
  • Example 29 Multiple selection strategies to identify EGFR specific nanobodies
  • Example 38 Screen for VHH inhibiting PDK1-Akt interaction
  • Example 39 Making a bispecific construct
  • Example 40 Endocytosis and lysis of tumor cells
  • Example 42 Construction of a bispecific constructs containing a VHH-CDR3 fragment fused to an anti-serum albumin VHH
  • PBLs Peripheral blood lymphocytes
  • MMLV Reverse Transcriptase Gibco BRL
  • oligo d(T) oligonucleotides de Haard et al., 1999.
  • the cDNA was purified with a phenol/chloroform extraction, followed by an ethanol precipitation and subsequently used as template to amplify the VHH repertoire.
  • a first PCR the repertoire of both conventional (1.6 kb) and heavy-chain (1.3 kb) antibody gene segments were amplified using a leader specific primer (5′-GGCTGAGCTCGGTGGTCCTGGCT-3′) and the oligo d(T) primer (5′-MCTGGAAGMTTCGCGGCCGCAGGAATTTTTTTTTTTTTTTTTTTT-3′).
  • the resulting DNA fragments were separated by agarose gel electrophoresis and the 1.3 kb fragment encoding heavy-chain antibody segments was purified from the agarose gel.
  • a second PCR was performed using a mixture of FR1 reverse primers (WO03/054016 sequences ABL037 to ABL043) and the same oligo d(T) forward primer.
  • PCR products were digested with SfiI (introduced in the FR1 primer) and BstEII (naturally occurring in framework 4). Following gel electrophoresis, the DNA fragments of approximately 400 basepairs were purified from gel and ligated into the corresponding restriction sites of phagemid pAX004 to obtain a library of cloned VHHs after electroporation of Escherichia coli TG1.
  • pAX004 allows the production of phage particles, expressing the individual VHHs as a fusion protein with a c-myc tag, a hexahistidine tag and the geneIII product. The percentage insert was determined in PCR using a combination of vector based primers.
  • a first selection was performed using the pool of PBL day4, PBL day10 and lymph node day4 libraries for each of the two llama's.
  • a second selection was performed using the rescued phages from the first selection using 5 ⁇ g/ml.
  • Chimaeric IgE was solid phase coated at 1 ⁇ g/ml and specific phages were eluted using buffy coat cells or lysozyme for 1 hr.
  • Buffy coat cells contain cells expressing the Fc ⁇ receptor, while lysozyme is an irrelevant protein and serves as a control. The results obtained are shown in Table 4.
  • Another second round selection was performed using neutravidine coated tubes and 2 nM biotinylated IgE. Specific phages were eluted using buffy coat cells or lysozyme for 1 hr. Buffy coat cells contain cells expressing the Fc ⁇ receptor, while lysozyme is an irrelevant protein and serves as a control. The results obtained are shown in Table 5.
  • Anti-IgE VHH's that block binding of IgE to its high-affinity receptor are of potential therapeutic value in the treatment of allergy.
  • VHH#2H11 was dialysed into formulation buffer, followed by addition of lyoprotectant at an isotonic concentration.
  • Isotonic formulation was performed as follows: VHH#2H11 at 25 mg/ml was formulated in 5 mM histidine buffer at pH 6 with 500 moles of sugar per mole antibody. This formulation is reconstututed with BWFI (0.9% benzyl alcohol) at a volume which results in a 100 mg/ml of antibody in 20 mM histidine at pH 6 with an isotonic sugar concentration of 340 nM.
  • BWFI 0.9% benzyl alcohol
  • the binding activity of the anti-IgE VHH in the isotonic formulations was measured in an IgE receptor inhibition assay. It was found that binding activity was essentially unchanged following storage at 4° C. for up to 3 months.
  • Two llamas were immunized with 100 ⁇ g human TNF-alpha per injection according to the schedule described in Example 1.
  • the libraries (short and long immunization procedure) were constructed and selected with in vitro biotinylated TNF-alpha.
  • the biotinylation was carried out as described by Magni et al (Anal Biochem 2001, 298, 181-188).
  • the functionality of the modified protein was evaluated for its ability to bind to the solid phase coated recombinant a p75 receptor.
  • biotinylation In the first round of selection 400 ng and 50 ng of biotinylated TNF-alpha was captured on neutravidin (Pierce; 10 ⁇ g/ml in PBS) coated on the wells of a microtiter plate (NUNC maxisorb). Phage (1.2 ⁇ 10 10 TU-s) were added to the wells and incubated for two hours at room temperature.
  • phage After washing (20 times with PBS-tween and two times with PBS) bound phage was eluted by adding an excess of receptor (extracellular domain of CD120b or p75; 10 ⁇ M) or with cells expressing the intact TNF receptor. Between 30,000 and 100,000 phage clones were eluted with TNF from the library derived from the llama immunized using the rapid scheme, while about 10% of these numbers were obtained when eluted with BSA (3 ⁇ M; negative control).
  • receptor extracellular domain of CD120b or p75; 10 ⁇ M
  • phage 2.5 ⁇ 10 7 phage were eluted with receptor (10 ⁇ M) from the well containing 400 ng and 50 ng of captured TNF and about 2 ⁇ 10 6 from the well with 10 ng of TNF, while the negative control (elution with 10 ⁇ M of BSA) gave only 5 to 10% of those numbers.
  • the observed numbers of eluted phage suggest that the elution with receptor is specific and that those VHH fragments should be eluted that bind to the receptor binding site of TNF.
  • Periplasmic fractions were prepared, the VHH fragments purified with IMAC and used in an assay to analyze their antagonistic characteristics, i.e. preventing the interaction of TNF with its receptor.
  • the VHH (1 ⁇ M and 0.3 ⁇ M) was incubated with TNF-alpha (3 and 0.7 nM) for 1.5 hours at room temperature (in 0.2% casein/PBS). 100 ⁇ l of this mixture was transferred to a well of a microtiter plate, in which the extracellular domain of the receptor was immobilized. After an incubation of one hour the plate was washed and bound TNF was detected with alkaline phosphatase conjugated streptavidin.
  • VHH fragments gave antagonistic profiles similar as obtained with 3 and 0.3 ⁇ M intact mAB Remicade (Infliximab; Centercor) in spite of the fact that the VHH is truly monomeric, whereas the dimeric appearance of the mAB probably favors the binding of the trimeric TNF-molecule.
  • Similar experiments showing the efficacy of the VHH were performed using the murine sarcoma cell line WEHI and a human cell line expressing the TNF receptor. The sequences obtained are shown in Table 14 SEQ ID NOs: 12 to 13.
  • Orally administered proteins are subject to denaturation at the acidic pH of the stomach and as well to degradation by pepsin.
  • TNF3E a VHH specific to human TNF ⁇ was produced as recombinant protein in E. coli and purified to homogeneity by IMAC and gelfiltration chromatography. The protein concentration after purification was determined spectrophotometrically by using the calculated molar exctinction coefficient at 280 nm. Diluted solutions at 100 microgram/ml were prepared in McIlvaine buffer (J. Biol. Chem. 49, 1921, 183) at pH 2, pH3 and 4 respectively.
  • An antibody solution containing the anti-human TNF ⁇ specific VHH#TNF3E (100 microgram per milliliter in 100-fold diluted PBS) was prepared. Three mice which were first deprived from drinking water for 12 hours and subsequently allowed to freely access the antibody solution during the next two hours. Afterwards the mice were sacrificed and their stomachs were dissected. Immediately the content of the stomachs was collected by flushing the stomach with 500 microliter PBS containing 1% BSA. This flushed material was subsequently used to prepare serial three-fold dilutions, starting at a 1/5 dilution from the undiluted material. One hundred microliter of these samples was transferred to individual wells of a microtiter plater coated with human TNF ⁇ .
  • Each cycle consisted of a DSS treatment interval (7 days) where DSS was provided with the drinking water at a concentration of 5% (w/v) and a recovery interval (12 days) with no DSS present in the drinking water.
  • the last recovery period was prolonged from 12 to 21 days to provide for an inflammation status rather representing a chronic than an acute inflammation at the time of the treatment.
  • mice were randomly assigned to groups of 8 mice and treatment with the VHH-constructs was started.
  • the treatment interval was 2 weeks.
  • One week after the end of the treatment interval the animals were sacrificed, the intestine was dissected and histologically examined.
  • the experimental setting is shown schematically in FIG. 3 .
  • mice 8 animals per group were treated daily for 14 consecutive days with bivalent VHH#3F (VHH#3F-VHH#3F; SEQ ID No. 14) by intra-gastric or intra-venous application of 100 ⁇ g bivalent VHH 3F.
  • An additional group of animals was treated rectally with the bivalent VHH#3F every other day for a period of 14 days.
  • a dose of 100 ⁇ g of the bivalent VHH#3F was applied at a concentration of 1 mg/ml in a buffered solution.
  • the negative control groups received 100 ⁇ l of PBS under otherwise identical conditions.
  • the treatment schedule is shown in Table 7.
  • mice After the mice were sacrificed the body weight was determined and the colon was dissected. The length of the dissected colon was determined and the histology of the colon was assessed by Haematoxilin-Eosin (HE) stain (standard conditions). As compared to the negative controls (PBS treatment) the groups treated with bivalent nanobody 3F showed a prorogued colon length as well as an improved histological score [G. Kojouharoff et al. Clin. Exp. Immunol. 1997; 107: 353-8] thereby demonstrating efficacy of the treatment.
  • HE Haematoxilin-Eosin
  • llama 5 One llama's (llama 5) was immunized intramuscularly with recombinant human catalytic domain of MMP12 using an appropriate animal-friendly adjuvant Stimune (Cedi Diagnostics BV, The Netherlands).
  • the llama received 6 injections at weekly intervals, the first two injections containing each 10 ⁇ g of MMP-12, the last four injections containing each 5 ⁇ g of MMP-12.
  • lymph node biopsy LN
  • PBL1 blood sample
  • PBL2 blood sample
  • HcAbs llama heavy chain immunoglobulins
  • cDNA was prepared on 200 ⁇ g total RNA with MMLV Reverse Transcriptase (Gibco BRL) using oligo d(T) oligonucleotides (de Haard et al., 1999).
  • the cDNA was purified with a phenol/chloroform extraction, followed by an ethanol precipitation and subsequently used as template to amplify the VHH repertoire.
  • a first PCR the repertoire of both conventional (1.6 kb) and heavy-chain (1.3 kb) antibody gene segments were amplified using a leader specific primer (5′-GGCTGAGCTCGGTGGTCCTGGCT-3′) and the oligo d(T) primer (5′-AACTGGAGAATTCGCGGCCGCAGGAATTTTTTTTTTTTTTTTTTTTTTTTT-3′).
  • the resulting DNA fragments were separated by agarose gel electrophoresis and the 1.3 kb fragment encoding heavy-chain antibody segments was purified from the agarose gel.
  • a second PCR was performed using a mixture of FR1 reverse primers (WO03/054016 sequences ABL037 to ABL043) and the same oligo d(T) forward primer.
  • the PCR products were digested with SfiI (introduced in the FR1 primer) and BstEII (naturally occurring in framework 4). Following gel electrophoresis, the DNA fragments of approximately 400 basepairs were purified from gel and ligated into the corresponding restriction sites of phagemid pAX004 to obtain a library of cloned VHHs after electroporation of Escherichia coli TG1.
  • pAX004 allows the production of phage particles, expressing the individual VHHs as a fusion protein with a c-myc tag, a hexahistidine tag and the geneIII product.
  • the diversity obtained after electroporation of TG1 cells is presented in Table 8. The percentage insert was determined in PCR using a combination of vector based primers.
  • the library was grown at 37° C. in 10 ml 2 ⁇ TY medium containing 2% glucose, and 100 ⁇ g/ml ampicillin, until the OD 600nm reached 0.5.
  • M13KO7 phages (10 12 ) were added and the mixture was incubated at 37° C. for 2 ⁇ 30 minutes, first without shaking, then with shaking at 100 rpm. Cells were centrifuged for 5 minutes at 4,500 rpm at room temperature. The bacterial pellet was resuspended in 50 ml of 2 ⁇ TY medium containing 100 ⁇ g/ml ampicillin and 25 ⁇ g/ml kanamycin, and incubated overnight at 37° C. with vigorously shaking at 250 rpm.
  • Phages were rescued and prepared as described above in Example 10.
  • Detection was performed using anti-c-myc antibody, followed by anti-mouse-HRP and DAP as substrate. Membranes were incubated with substrate at room temperature until clear spots were visible. Seven clones which were found to be MMP-12 specific binders are shown in Table 14 SEQ ID NOs 15 to 21.
  • Detection was performed using anti-c-myc antibody, followed by anti-mouse-HRP and DAP as substrate. Membranes were incubated with substrate at room temperature until clear spots were visible. No significant detection of the seven selected VHH clones was observed on any of the MMPs other than MMP-12.
  • the supernatant containing the VHH was loaded on Ni-NTA (Qiagen) and purified to homogeneity on an ⁇ kta FPLC chromatography system (Amersham Biosciences).
  • VHH were eluted with 1M NaCl in PBS and further purified on a size exclusion column (Superdex 75 HR10/30, Amersham Biosciences) equilibrated in MMP-12 assay buffer [50 mM HEPES, 100 mM NaCl, 0,05% Brij-35]. The yield of VHH was calculated according to the extinction coefficient and peak surface area.
  • VHHs were expressed and purified as described in Example 13. Purified VHH was analyzed for the ability to inhibit human MMP-12 catalytic domain using the MMP-12 Colorimetric Assay Kit for Drug Discovery (AK-402) from BIOMOL Research Laboratories. The experimental method conditions described in the Kit were followed.
  • the inhibitor supplied with the Kit (PI115-9090) was used as positive control at the recommended concentration. VHH were applied at a concentration of 7 ⁇ M.
  • the assay was performed in the microtiterplate supplied with the BIOMOL Kit and MMP-12 proteolytic activity was followed in a plate reader (405 nm) at 37° C.
  • VHH molecule Only one VHH molecule (clone P5-29) from selections using active MMP-12 coated on nitrocellulose (Example 12) showed inhibition of human MMP-12 catalytic domain. All other MMP-12 binders (only clone P5-5 is shown), although they bind MMP-12, did not inhibit MMP-12.
  • a 100% formulation of antibody was prepared by dissolving 5 mg of VHH in 1.0 ml of deionized water. The pH of the solution was 6.5. A 90% formulation of antibody was prepared by dissolving 4.5 mg of VHH in 1.0 ml of 2 mM citrate buffer. A 70% formulation of antibody was prepared by dissolving 3.5 mg of VHH in 1 mg/ml of excipient in 1 ml of citrate buffer at pH 6.5.
  • the various classes of excipients used were as follows: Sugar excipients: sucrose, lactose, mannitol, raffinose and trehalose. Polymeric excipients: ficoll and PVP. Protein excipients: HSA.
  • Dry powders of the above formulations were produced by spray drying using a Buchi Spray Dryer.
  • the particle size distribution was measure by centrifugal sedimentation.
  • llama's Four llama's (llama 5, 6, 22 and 23) were immunized intramuscularly with human IFN- ⁇ (PeproTech Inc, USA, Cat Nr: 300-02) using an appropriate animal-friendly adjuvant Stimune (Cedi Diagnostics BV, The Netherlands). Two llama's (llama 29 and 31) were immunized intramuscularly with mouse IFN- ⁇ (Protein Expression & Purification core facility, VIB-RUG, Belgium) using an appropriate animal-friendly adjuvant Stimune (Cedi Diagnostics BV, The Netherlands).
  • the llama's received 6 injections at weekly intervals, the first two injections containing each 100 ⁇ g of IFN- ⁇ , the last four injections containing each 50 ⁇ g of IFN-v.
  • a blood sample (PBL1) of 150 ml and a lymph node biopsy (LN) was collected from each animal and sera were prepared.
  • PBL2 a second blood sample of 150 ml was taken from each animal and sera were prepared.
  • Peripheral blood lymphocytes as the genetic source of the llama heavy chain immunoglobulins (HcAbs), were isolated from the blood sample using a Ficoll-Paque gradient (Amersham Biosciences) yielding 5 ⁇ 10 8 PBLs.
  • the maximal diversity of antibodies is expected to be equal to the number of sampled B-lymphocytes, which is about 10% of the number of PBLs (5 ⁇ 10 7 ).
  • the fraction of heavy-chain antibodies in llama is up to 20% of the number of B-lymphocytes. Therefore, the maximal diversity of HcAbs in the 150 ml blood sample is calculated as 10 7 different molecules.
  • Total RNA was isolated from PBLs and lymph nodes according to the method of Chomczynski and Sacchi (1987).
  • cDNA was prepared on 200 ⁇ g total RNA with MMLV Reverse Transcriptase (Gibco BRL) using oligo d(T) oligonucleotides (de Haard et al., 1999).
  • the cDNA was purified with a phenol/chloroform extraction, followed by an ethanol precipitation and subsequently used as template to amplify the VHH repertoire.
  • a first PCR the repertoire of both conventional (1.6 kb) and heavy-chain (1.3 kb) antibody gene segments were amplified using a leader specific primer (5′-GGCTGAGCTCGGTGGTCCTGGCT-3′) and the oligo d(T) primer (5′-AACTGGAAGAATTCGCGGCCGCAGGAATTTTTTTTTTTTTTTTTTTT-3′).
  • the resulting DNA fragments were separated by agarose gel electrophoresis and the 1.3 kb fragment encoding heavy-chain antibody segments was purified from the agarose gel.
  • a second PCR was performed using a mixture of FR1 reverse primers (WO03/054016 sequences ABL037 to ABL043) and the same oligo d(T) forward primer.
  • the PCR products were digested with SfnI (introduced in the FR1 primer) and BstEII (naturally occurring in framework 4). Following gel electrophoresis, the DNA fragments of approximately 400 basepairs were purified from gel and ligated into the corresponding restriction sites of phagemid pAX004 to obtain a library of cloned VHHs after electroporation of Escherichia coli TG1.
  • pAX004 allows the production of phage particles, expressing the individual VHHs as a fusion protein with a c-myc tag, a hexahistidine tag and the geneIII product.
  • the diversity obtained after electroporation of TG1 cells is presented in Table 1. The percentage insert was determined in PCR using a combination of vector based primers.
  • the library was grown at 37° C. in 10 ml 2 ⁇ TY medium containing 2% glucose, and 100 ⁇ g/ml ampicillin, until the OD 600nm reached 0.5.
  • M13KO7 phages (10 12 ) were added and the mixture was incubated at 37° C. for 2 ⁇ 30 minutes, first without shaking, then with shaking at 100 rpm. Cells were centrifuged for 5 minutes at 4,500 rpm at room temperature. The bacterial pellet was resuspended in 50 ml of 2 ⁇ TY medium containing 100 ⁇ g/ml ampicillin and 25 ⁇ g/ml kanamycin, and incubated overnight at 37° C. with vigorously shaking at 250 rpm.
  • topical preparations of the present invention contained at least one anti-IFN gamma VHH and a pharmaceutically acceptable carrier. They were prepared as follows:
  • the reagents for preparing the base cream are as follows (contents for 100 kg base cream): Dimethyl silicon oil (17 kg), Liquid paraffin (9 kg), Stearic acid (7.5 kg), Cetyl alcohol (1 kg), Stearyl alcohol (3 kg), Glycerol (20 kg), Ethylparaben (0.1 kg), Peregal A-20 (0.45 kg), Softener SG (0.85 kg), 0.01 M Phosphate Buffer (pH 7.2)(41.1 kg)
  • the stainless steel tank was placed into a thermostat water bath and heated to 80° C., which took approximately 10 minutes. The liquid was thoroughly mixed. Then, emulsifying and homogenizing equipment was placed into the open stainless steel tank, the mixture was stirred for 20 minutes at 3500 rpm until fully emulsified. The temperature of the thermostat water bath was cooled naturally to room temperature, until the mixture became a semi-solid cream. The mixture was being continually stirred.
  • VHH#MP3B1SRA was prepared in accordance with Example 22.
  • the lyophilized antibodies were reconstituted with 0.01 M phosphate buffer (pH 7.2) to a concentration of 2 mg/ml.
  • 0.01 M phosphate buffer pH 7.2
  • the CDR3 region of VHH#3E was amplified by using a sense primer located in the framework 4 region (Forward: CCCCTGGCCCCAGTAGTTATACG) and an anti-sense primer located in the framework 3 region (Reverse: TGTGCAGCAAGAGACGG).
  • Reverse primer Sfi1 GTCCTCGCAACTGCGGCCCAGCCGGCCTGTGCAGCAAGAGACGG
  • Forward primer Not1 GTCCTCGCAACTGCGCGGCCGCCCCCTGGCCCCAGTAGTTATACG
  • the PCR reactions were performed in 50 ⁇ l reaction volume using 50 pmol of each primer.
  • the reaction conditions for the primary PCR were 11 min at 94° C., followed by 30/60/120 sec at 94/55/72° C. for 30 cycles, and 5 min at 72° C. All reaction were performed wit 2.5 mM MgCl2, 200 mM dNTP and 1.25 U AmpliTaq God DNA Polymerase (Roche Diagnostics, Brussels, Belgium).
  • the dose for immunization with membrane extracts consisted of vesicles prepared from 10 8 A431 cells. Vesicles were prepared according to Cohen and colleagues (Cohen S, Ushiro H, Stoscheck C, Chinkers M, 1982. A native 170,000 epidermal growth factor receptor-kinase complex from shed plasma membrane vesicles. J. Biol. Chem. 257:1523-31). Vesicles were stored at ⁇ 80° C. before administration. Two extra injections of eight microgram purified EGFR (Sigma) in an emulsion with the adjuvant Stimune (CEDI Diagnostics B. V., Lelystad, The Netherlands) were administered intramuscularly to llama 025 (Table 9).
  • antibody titers in serum was evaluated on mouse fibroblasts expressing human EGFR (Her-14) and compared to the parental mouse fibroblasts cell line NIH3T3 clone 2.2 (3T3), similarly performed as described above ( FIG. 6 ). Again, the serum titer of antibodies binding to Her-14 was higher compared to the titer for the parental 3T3 cells, indicating that circulating serum antibodies were EGFR specific.
  • VHH Heavy-Chain Antibody Fragment
  • cDNA was prepared on total RNA with MMLV Reverse Transcriptase (Invitrogen) using oligo d(T) oligonucleotides (de Haard H J, van Neer N, Reurs A, Hufton S E, Roovers R C, Henderikx P, de Bruine A P, Arends J W, Hoogenboom H R. 1999. A large non-immunized human Fab fragment phage library that permits rapid isolation and kinetic analysis of high affinity antibodies. J. Biol. Chem. 274:18218-30). The amounts of RNA of the distinct tissues used for cDNA synthesis is listed in Table 10. The cDNA was purified with a phenol/chloroform extraction, followed by an ethanol precipitation and subsequently used as template to amplify the VHH repertoire.
  • the PCR products were digested with SfiI (introduced in the FR1 primer) and BstEII (naturally occurring in FR4). Following gel electrophoresis, the DNA fragment of approximately 400 basepairs was purified from gel and 330 ng of amplified VHH repertoire was ligated into the corresponding restriction sites of one microgram of phagemid pAX004 to obtain a library after electroporation of Escherichia coli TG1. pAX004 allows the production of phage particles, expressing the individual VHHs as a fusion protein with the geneIII product.
  • Table 10 The size of the libraries obtained from the distinct tissues collected from the immunized llamas.
  • a polyclonal phage ELISA the specificity of the cloned phage repertoire was evaluated on EGFR and on an irrelevant antigen (TNF ⁇ ).
  • TNF ⁇ irrelevant antigen
  • the library was grown at 37° C. in 10 ml 2 ⁇ TY medium containing 2% glucose, and 100 ⁇ g/ml ampicillin, until the OD 600nm reached 0.5.
  • M13KO7 phages (10 12 ) were added and the mixture was incubated at 37° C. for 2 ⁇ 30 minutes, first without shaking, then with shaking at 100 rpm. Cells were centrifuged for 5 minutes at 4,500 rpm at room temperature.
  • the bacterial pellet was resuspended in 50 ml of 2 ⁇ TY medium containing 100 ⁇ g/ml ampicillin and 25 ⁇ g/ml kanamycin, and incubated overnight at 37° C. with vigorously shaking at 250 rpm. The overnight cultures were centrifuged for 15 minutes at 4,500 rpm at 4° C. and supernatant was used to concentrate the phages. Phages were PEG precipitated (20% poly-ethylene-glycol and 1.5 M NaCl) for 30 minutes on ice and centrifuged for 20 minutes at 4,500 rpm. The pellet was resuspended in 1 ml PBS.
  • Phages were again PEG precipitated for 10 minutes on ice and centrifuged for 10 minutes at 14,000 rpm and 4° C. The pellet was dissolved in 1 ml PBS.
  • One ⁇ g/ml of EGFR or TNF ⁇ was immobilized in a 96 well Maxisorp plate (Nunc) and incubated overnight at 4° C. Plates were washed 5 times with PBS/0.05% Tween-20 and wells were blocked with a casein solution (1% in PBS) and phage dilutions were added for 2 hrs at room temperature.
  • Bound phages were detected using the anti-M13 gpVIII-HRP conjugated monoclonal antibody (Amersham Biosciences) and ABTS/H 2 O 2 as substrate. Plates were read at 405 nm after 15 minutes incubation at room temperature. An example of a phage response from a pool of phages rescued from PBL1 libraries of animals 024 and 025 is depicted in FIG. 8 .
  • a first selection strategy was based on the fact that EGFR can be purified by affinity chromatography through ligand elution.
  • Four different elution conditions, applying an excess of molecules that compete for the ligand binding site or overlapping epitope(s) were carried out (Table 11).
  • unselected recombinant phages were mixed for 20 minutes at 4° C. with 6 ⁇ 10 6 blood cells (mainly monocytes, T- and B-cells) or 2 ⁇ 10 7 3T3s, respectively, to deplete for recombinant phages that recognize common, non EGFR-specific epitopes.
  • a second selection strategy was based on the observation that after binding of the ligand to the receptor, EGFR mediated cell signaling can be downregulated by the mechanism of receptor internalization.
  • the protocol described by Poul and colleagues Pier M A, Becerril B, Nielsen U B, Morisson P, Marks J D. 2000. Selection of tumor-specific internalizing human antibodies from phage libraries. J. Mol. Biol. 301:1149-61. was followed. Unselected recombinant phages were added to approximately 2 ⁇ 10 7 mouse fibroblast 3T3s for 30 minutes at 4° C.
  • a phage ELISA was performed both on solid-phase coated EGFR (comparing to non-coated well) as on gelatin coated Her-14 cells (comparing to 3T3).
  • the nucleotide sequence was determined for a representative clone of each distinct fingerprint, resulting in 5, 8, 3, 4, 7, and 4 different sequences for conditions, 1, Ia, 2, IIIa, 3 and 4, respectively. Amino acid sequence alignment of these 31 binders ( FIG. 9 ) indicated that 20 of them were unique (listed in Table 14 SEQ ID Nos 23 to 42). The EGFR specificity of the 20 unique clones in phage ELISA (both on cells and on solid-phase coated EGFR) is shown in FIG. 10 .
  • a phage ELISA on cells with a total of 84 individual clones was performed, similarly as for the clones identified by the epitope specific elution selection procedure.
  • HinfI fingerprint analysis nucleotide sequence determination and amino acid sequence alignment to the above described panel of 20 unique binders (data not shown), 2 new anti-EGFR clones, EGFR-B11 and clone EGFR-F11, were identified (Table 14 SEQ ID NOs: 43 to 44).
  • the EGFR specificity of both clones in phage ELISA on cells is shown in FIG. 10 , panel A.
  • Her-14 and 3T3 cells were grown overnight on glass cover slips, washed with binding medium (see Example 19) and cooled down to 4° C. for 20 minutes.
  • Phages were prepared of nanobody EGFR-IIIa42 as described in Example 18 and approximately 10 12 recombinant virions, diluted in binding medium supplemented with 2% skim milk, were added to the ice cold cells for 1 hour at 4° C.
  • Cells were washed once with ice cold PBS to remove non bound phages. Subsequently, the cells were shifted to 37° C. for 20 minutes to allow phage internalization and again cooled down to 4° C. Cells were washed twice with PBS.
  • cell surface bound phages were removed by two acid washes with stripping buffer (150 mM NaCl, 125 mM HAc) for seven minutes at room temperature. After two washes with PBS, cells were fixed with 4% paraformaldehyde in PBS for 30 minutes at room temperature, and again washed twice with PBS. Fixed cells were then permeabilized in 0.2% Triton X-100 in PBS for 5 minutes at room temperature, followed by two washes with PBS and remaining fixative was blocked with 100 mM glycin in PBS for 10 minutes at room temperature.
  • stripping buffer 150 mM NaCl, 125 mM HAc
  • FIG. 11 shows that EGFRIIIa42 is able to internalize Her-14 (panel A) but not 3T3 cells (panel B).
  • nanobody EGFR-IIIa42 is able to bind both A431 and Her-14, but not 3T3 (data not shown).
  • Blots were stained for total amount of EGFR with a rabbit polyclonal antiserum to the receptor (Santa Cruz) and for phosphorylated receptor using a monoclonal anti phospho-tyrosine antibody (PY-20; Transduction Labs), followed by an appropriate in donkey developped and peroxidase conjugated secondary antibody (anti-rabbit or anti-mouse).
  • the detection was performed by enhanced chemoluminiscence using Western LightningTM substrate (Perkin Elmer Life Sciences).
  • anti-EGFR-IIIa42 nanobody did not activate EGFR + cells deprived from EGF, indicated by the lack of receptor Tyr kinase phosphorylation ( FIG. 11 , panel C).
  • the positive control in which EGF was added in two concentrations to the cells, clearly induced phosphorylation of the receptor and thus induces activation of the cells.
  • 2 llamas are immunised with a cocktail of recombinant EGF receptor and with PDK1.
  • the lamas are boosted with a cell line overexpressing the EGF receptor.
  • the immunization schemes are summarised in Table 15.
  • PBLs Peripheral blood lymphocytes
  • FBLs and lymph node are used to extract total RNA (Chomczynski and Sacchi 1987) followed by synthesis of cDNA using a hexanucleotide random primer.
  • the repertoire is amplified using two hinge-specific primers: AACAGTTAAGCTTCCGCTTGCGGCCGCGGAGCTGGGGTCTTCGCTGTGGTGCG and AACAGTTAAGCTTCCGCTTGCGGCCGCTGGTTGTGGTTTTGGTGTCTTGGGTT and a framework 1 specific primer: GAGGTBCARCTGCAGGASTCYGG.
  • Fragments are digested with PstI and NotI and cloned into a phagemid vector.
  • the repertoire is transformed in TG1 electrocompetent cells and plated on LB agar plates containing 100 ⁇ g/ml ampicillin and 2% glucose. Colonies are screened for the presence of insert by PCR with vector specific primers.
  • Libraries are grown at 37° C. in 60 ml 2 ⁇ TY medium containing 2% glucose, and 100 ⁇ g/ml ampicillin, until the OD600 nm reached 0.5.
  • M13KO7 phages (1012) are added and the mixture is incubated at 37° C. for 2 ⁇ 30 minutes, first without shaking, then with shaking at 100 rpm.
  • Cells are centrifuged for 10 minutes at 4500 rpm at room temperature. The bacterial pellet is resuspended in 300 ml of 2 ⁇ TY medium containing 100 ⁇ g/ml ampicillin and 25 ⁇ g/ml kanamycin, and incubated overnight at 30° C. with vigorously shaking at 250 rpm.
  • Immunotubes are coated with 2 ⁇ g/ml EGFR, 2 ⁇ g/ml PDK1 or with PBS containing 1% casein. After overnight incubation at 4° C., the tubes are blocked with PBS containing 1% casein, for 3 hours at RT. 200 ⁇ l phages of the three libraries of llama 005 and of the three libraries of llama006 are pooled and added to the immunotubes with a final volume of 2 ml in PBS for EGFR and in 50 mM Tris HCl (pH 7.4), 150 mM KCl, 1.0 mM DTT, 1 mM MgCl2 and 0.3 mg/ml BSA for PDK1.
  • a microtiter plate is coated with 2 ⁇ g/ml EGFR or 2 ⁇ g/ml PDK1, overnight at 4° C. Plates are blocked for two hours at room temperature with 300 ⁇ l 1% casein in PBS. The plates are washed three times with PBS-Tween. Periplasmic extracts are prepared from single colonies and applied to the wells of the microtiter plate. Plates are washed six times with PBS-Tween, after which binding of VHH is detected by incubation with mouse anti-Histidine mAB 1/1000 in PBS for 1 hour at RT followed by anti-mouse-alkaline phosphatase conjugate 1/2000 in PBS, also for 1 hour at RT.
  • PNPP p-nitrophenyl-phosphate, 2 mg/ml in 1M diethanolamine, 1 mM Mg 2 SO 4 , pH9.8 and the signals are measured after 30 minutes at 405 nm.
  • Table 18 An example of the expected number of positive clones versus the number of clones tested in ELISA for each selection is presented in Table 18.
  • PDK1 is coated in a microliter plate as described above and after blocking the plates, the wells are incubated with 100 ⁇ g/ml Akt for one hour at RT. Then (without washing) 100 ⁇ l periplasmic extract is added to those wells and VHH binding is measured as described above. VHH that are not able to bind to PDK1 would be scored as inhibitors for the interaction between PDK1 and Akt.
  • the expected number of inhibiting VHH versus the number of VHH tested in inhibition ELISA is summarized in Table 19.
  • a bispecific construct is prepared (Conrath et al, J Biol Chem, 2001, 276: 7346-7350) of EGFR-21 and 5 different strong inhibiting VHHs (PD-1, PD-7, PD-32, PD-33 and PD-72) for PDK1.
  • Protein is prepared and purified to homogeneity for the 5 bispecific constructs and shown to be stable by western blot analysis.
  • Bispecific constructs are incubated with tumor cells (A431) overexpressing EGFR. All constructs that successfully endocytosed would be shown by confocal microscopy. One of the constructs, EGFR-21-PD-32, would be expected to able to inhibit cell growth and finally lead to cell death.
  • the degree of amino acid sequence homology between anti-target single domain antibodies of the invention was calculated using the Bioedit Sequence Alignment Editor. The calculations indicate the proportion of identical residues between all of the sequences as they are aligned by ClustalW. (Thompson, J. D., Higgins, D. G. and Gibson, T. J. (1994) CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position specific gap penalties and weight matrix choice. Nucleic Acids Research, submitted, June 1994).
  • Table 20 indicates the fraction homology between anti-TNF-alpha VHHs of the invention.
  • Table 21 indicates the percentage homology between anti-IFN-gamma VHHs of the invention.
  • F6 CDR3 Reverse primer Sfi1 GTCCTCGCAACTGCGGCCCAGCCGGCCTGTGCATGTGCAGCAAACC
  • F6 CDR3 Forward primer Not1 GTCCTCGCAACTGCGCGGCCGCCTGGCCCCAGAAGTCATACC
  • the PCR reactions were performed in 50 ml reaction volume using 50 pmol of each primer.
  • the reaction conditions for the primary PCR were 11 min at 94° C., followed by 30/60/120 sec at 94/55/72° C. for 30 cycles, and 5 min at 72° C. All reaction were performed wit 2.5 mM MgCl2, 200 mM dNTP and 1.25 U AmpliTaq God DNA Polymerase (Roche Diagnostics, Brussels, Belgium).

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Hematology (AREA)
  • Biomedical Technology (AREA)
  • Epidemiology (AREA)
  • Urology & Nephrology (AREA)
  • Diabetes (AREA)
  • Microbiology (AREA)
  • Pulmonology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Neurology (AREA)
  • General Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Biotechnology (AREA)
  • Food Science & Technology (AREA)
  • Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Cell Biology (AREA)
  • Vascular Medicine (AREA)
  • Endocrinology (AREA)

Abstract

The invention relates to a method suitable for administering protein therapeutic molecules orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation so as to avoid inactivation, by using VHH polypeptides derived from Camelidae antibodies. The invention further relates to the said therapeutic molecules. The invention further a method for delivering therapeutic molecules to the interior of cells. The invention furthe relates to anti-IgE therapeutic molecules.

Description

    BACKGROUND
  • Polypeptide therapeutics and in particular antibody-based therapeutics have significant potential as drugs because they have exquisite specificity to their target and a low inherent toxicity. However, they have one important drawback: these are complex, large molecules and therefore relatively unstable, and they are sensitive to breakdown by proteases. Because the degradation they undergo during passage through, for instance, the gastrointestinal tract, administration of conventional antibodies and their derived fragments or single-chain formats (e.g. scFv's) is not very effective. This means that conventional antibody drugs cannot be administered orally, sublingually, topically, nasally, vaginally, rectally or by inhalation because they are not resistant to the low pH at these sites, the action of proteases at these sites and in the blood and/or because of their large size. They have to be administered by injection (intravenously, subcutaneously, etc.) to overcome some of these problems. Administration by injection is therefore the most frequently used method of administration although the method has many disadvantages, for example: (a) poor tolerance by patients, especially when treating chronic disorder; (b) a consequent risk of poor compliance with the dosage when the drug is not a ‘life saver’; (c) difficulty of carrying out self-administration by the patient; (d) possible non-availability of suitable surroundings for carrying out the procedure in an aseptic manner; (e) requires specialist training in order to use a hypodermic syringe or needle correctly and safely. A method for the delivery of therapeutic polypeptides which avoids the need for injection has not only cost/time savings, but would also be more convenient and more comfortable for the subject.
  • In most animal cells, a specialised pathway is present for uptake of specific macromolecules from the extracellular fluid. The macromolecules that bind to specific cell-surface receptors are internalized, a process called receptor-mediated endocytosis. Receptor internalization is based on the principle of regulation of signal transduction by a process called sequestration, whereby bound agonistic (i.e. receptor activation) ligands are recovered from the cell surface in complex with the receptor. For many applications it is necessary to deliver effector molecules across the cell membrane and into the cytosol. This can be achieved by taking advantage of such internalizing receptors. Antibodies have been described that internalize upon binding to internalizing receptors. However, they have important drawbacks: these antibodies are complex, large molecules and therefore relatively unstable, and they are sensitive to breakdown by proteases. Moreover, the domains of such antibodies are held together by disulphide bonds that dissociate in the reducing environment of the cytoplasm leading to a substantial loss of binding activity. Therefore, they cannot be used to target intracellular proteins.
  • Another process that relies on internalisation is the efficient induction of an immune response. In particular, a T-cell response depends heavily on efficient presentation of certain epitopes to the T cells by antigen presenting cells (APCs). In the case of a protein antigen this means that the APC has to take up the protein, internally process it (this is cleaving it) and express certain peptide fragments on its surface in association with MHC (major histocompatibility complex) or HLA molecules. One major and critical event in this process is the efficient uptake of the protein antigen by its APC. Techniques which can enhance antigen uptake by APCs enables an immune response to be elicited against antigens which naturally elicit a weak or no immune response. Therefore, a technique which can boost an immune response against antigenic antigens, naturally weak or non-immunogenic antigens has important implications for vaccination programs.
  • IgE plays a major role in allergic disease by causing the release of histamine and other inflammatory mediatord from mast cells. A mainstay of treatment of allergic disease, including asthma, is allergen avoidance and treatment of symptoms. Presently, the most effective treatments of allergic diseases are directed towards a regulation of the inflammatory process with corticosteroids. A more direct approach without the negative effects of corticosteroids consists in regulating the allergic process at the level of the initiatior of the allergic inflammation, IgE, via an anti-IgE.
  • The concept of using anti-IgE antibodies as a treatment for allergy has been widely disclosed in the scientific literature. A few representative examples are as follows. Baniyash and Eshhar (European Journal of Immunology 14:799-807 (1984)) demonstrated that an anti-IgE monoclonal antibody could specifically block passive cutaneous anaphylaxis reaction when injected intradermally before challenging with the antigen; U.S. Pat. No. 4,714,759 discloses a product and process for treating allergy, using an antibody specific for IgE; and Rup and Kahn (International Archives Allergy and Applied Immunology, 89:387-393 (1989) discuss the prevention of the development of allergic responses with monoclonal antibodies which block mast cell-IgE sensitization.
  • Anti-IgE antibodies which block the binding of IgE to its receptor on basophils and which fail to bind to IgE bound to the receptor, thereby avoiding histamine release are disclosed, for example, by Rup and Kahn (supra), by Baniyash et al. (Molecular Immunology 25:705-711, 1988), and by Hook et al. (Federation of American Societies for Experimental Biology, 71st Annual Meeting, Abstract #6008, 1987).
  • Antagonists of IgE in the form of receptors, anti-IgE antibodies, binding factors, or fragments thereof have been disclosed in the art. For example, U.S. Pat. No. 4,962,035 discloses DNA encoding the alpha-subunit of the mast cell IgE receptor or an IgE binding fragment thereof. Hook et al. (Federation Proceedings Vol. 40, No. 3, Abstract #4177) disclose monoclonal antibodies, of which one type is anti-idiotypic, a second type binds to common IgE determinants, and a third type is directed towards determinants hidden when IgE is on the basophil surface.
  • U.S. Pat. No. 4,940,782 discloses monoclonal antibodies which react with free IgE and thereby inhibit IgE binding to mast cells, and react with IgE when it is bound to the B-cell FcE receptor, but do not bind with IgE when it is bound to the mast cell FcE receptor, nor block the binding of IgE to the B-cell receptor.
  • U.S. Pat. No. 4,946,788 discloses a purified IgE binding factor and fragments thereof, and monoclonal antibodies which react with IgE binding factor and lymphocyte cellular receptors for IgE, and derivatives thereof.
  • U.S. Pat. No. 5,091,313 discloses antigenic epitopes associated with the extracellular segment of the domain which anchors immunoglobulins to the B cell membrane. The epitopes recognized are present on IgE-bearing B cells but not basophils or in the secreted, soluble form of IgE. U.S. Pat. No. 5,252,467 discloses a method for producing antibodies specific for such antigenic epitopes. U.S. Pat. No. 5,231,026 discloses DNA encoding murine-human antibodies specific for such antigenic epitopes.
  • U.S. Pat. No. 4,714,759 discloses an immunotoxin in the form of an antibody or an antibody fragment coupled to a toxin to treat allergy.
  • Presta et al. (J. Immunol. 151:2623-2632 (1993)) disclose a humanized anti-IgE antibody that prevents the binding of free IgE to FceRI but does not bind to FcERI-bound IgE. Copending WO93/04173 discloses polypeptides which bind differentially to the high- and low-affinity IgE receptors.
  • U.S. Pat. No. 5,428,133 discloses anti-IgE antibodies as a therapy for allergy, especially antibodies which bind to IgE on B cells, but not IgE on basophils. This publication mentions the possibility of treating asthma with such antibodies. U.S. Pat. No. 5,422,258 discloses a method for making such antibodies.
  • EP0841946 discloses methods for treating allergic asthma using IgE antagonists.
  • AIMS OF THE INVENTION
  • The aim of the invention is to provide a method of administering protein therapeutic molecules orally, sublingually, topically, nasally, vaginally, rectally, intraveneously, subcutaneously or by inhalation which overcomes the problems of the prior art. It is a further aim to provide said therapeutic molecules.
  • Another aim of the invention is to provide a method for delivering therapeutic substances to the interior of cells via internalizing receptors without receptor activation.
  • It is further aim of the invention to provide a therapeutic agent for the treatment of allergies.
  • It is a further aim of the invention to provide therapeutic nanobodies.
  • SUMMARY OF THE INVENTION
  • One embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against IgE.
  • Another embodiment of the present invention is a polypeptide construct as described above wherein at least one single domain antibody is a Camelidae VHH.
  • Another embodiment of the present invention is a polypeptide construct as described above wherein at least one single domain antibody corresponds to a sequence represented by any of SEQ ID NOs: 1 to 11.
  • Another embodiment of the present invention is a polypeptide construct as described above, wherein the number of anti-IgE single domain antibodies is at least two.
  • Another embodiment of the present invention is a polypeptide construct as described above, wherein at least one single domain antibody is a humanized Camelidae VHH.
  • Another embodiment of the present invention is a polypeptide construct as described above, wherein a single domain antibody is an homologous sequence, a functional portion, or a functional portion of an homologous sequence of the full length single domain antibody.
  • Another embodiment of the present invention is a polypeptide construct as described above, wherein the polypeptide construct is an homologous sequence, a functional portion, or a functional portion of an homologous sequence of the full length polypeptide construct.
  • Another embodiment of the present invention is a nucleic acid encoding a polypeptide construct as described above.
  • Another embodiment of the present invention is a polypeptide construct as described above for treating and/or preventing and/or alleviating disorders relating to inflammatory processes.
  • Another embodiment of the present invention is a use of a polypeptide construct as described above for the preparation of a medicament for treating and/or preventing and/or alleviating disorders relating to inflammatory reactions.
  • Another embodiment of the present invention is a method for delivering an anti-target compound to a subject for the treatment of a disorder without being inactivated by administering thereto a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • Another embodiment of the present invention is a method as described above wherein said target is located in the gut system, and said a polypeptide construct is delivered orally.
  • Another embodiment of the present invention is a method as described above wherein said target is located in vaginal and/or rectal tract, and said a polypeptide construct is delivered to the vaginal and/or rectal tract.
  • Another embodiment of the present invention is a method as described above wherein said target is located in nose, upper respiratory tract and/or lung; and said a polypeptide construct is delivered to nose, upper respiratory tract and/or lung.
  • Another embodiment of the present invention is a method as described above wherein said target is located in intestinal mucosa, and said a polypeptide construct is delivered orally.
  • Another embodiment of the present invention is a method as described above wherein said target is located in the tissues beneath the tongue, and said a polypeptide construct is delivered to the tissues beneath the tongue.
  • Another embodiment of the present invention is a method as described above wherein said target is located in the skin, and said a polypeptide construct is delivered topically.
  • Another embodiment of the present invention is a method as described above wherein said target is in, or accessible via the blood, and said a polypeptide construct is delivered orally, to the vaginal and/or rectal tract, nasally, by inhalation though the mouth or nose, to the tissues beneath the tongue, or topically.
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target, for use in treating, preventing and/or alleviating the symptoms of disorders which are susceptible to modulation by an anti-target therapeutic compound that is able pass through the gastric environment without being inactivated.
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target for use in treating, preventing and/or alleviating the symptoms of disorders which are susceptible to modulation by an anti-target therapeutic compound that is able pass through the wall of the intestinal mucosa without being inactivated
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target for use in treating, preventing and/or alleviating the symptoms of disorders which are susceptible to modulation by an anti-target therapeutic compound that is able pass through the wall of the nose, upper respiratory tract and/or lung without being inactivated
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target for use in treating, preventing and/or alleviating the symptoms of disorders which are susceptible to modulation by an anti-target therapeutic compound that is able pass through the wall of virginal and/or rectal tract without being inactivated
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target for use in treating, preventing and/or alleviating the symptoms of disorders which are susceptible to modulation by a therapeutic compound that is able pass through the tissues beneath the tongue without being inactivated
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target for use in treating, preventing and/or alleviating the symptoms of disorders which are susceptible to modulation by a therapeutic compound that is able pass through the skin without being inactivated
  • Another embodiment of the present invention is a method as described above or polypeptide construct as described above, wherein said target is TNF-alpha and the disorder is inflammation.
  • Another embodiment of the present invention is a method or polypeptide as described above, wherein a single domain antibody corresponds to a sequence represented by any of SEQ ID NOs: 12 to 14.
  • Another embodiment of the present invention is a method as described above or polypeptide construct as described above, wherein said target is CEA and the disorder colon cancer.
  • Another embodiment of the present invention is a method as described above or polypeptide construct as described above, wherein said target is EGFR and the disorder is any of head, neck, lung and colon cancer.
  • Another embodiment of the present invention is a method or polypeptide construct as described above, wherein a single domain antibody corresponds to a sequence represented by any of SEQ ID NOs: 23 to 44
  • Another embodiment of the present invention is a method as described above or polypeptide construct as described above, wherein said target is antigen of Helicobacter pylori and the disorder is any of indigestion, gastritis.
  • Another embodiment of the present invention is a method as described above or polypeptide construct as described above, wherein said target is antigen of Mycobacterium tuberculosis and the disorder is tuberculosis.
  • Another embodiment of the present invention is a method as described above or polypeptide construct as described above, wherein said target is antigen of influenza virus and the disorder is flu.
  • Another embodiment of the present invention is a method as described above or polypeptide construct as described above, wherein said target is antigen of IgE and the disorder is allergic response.
  • Another embodiment of the present invention is a method or polypeptide construct as described above, wherein a single domain antibody corresponds to a sequence represented by any of SEQ ID NOs: 1 to 11
  • Another embodiment of the present invention is a method as described above or polypeptide construct as described above, wherein said target is antigen of MMP and the disorder is cancer.
  • Another embodiment of the present invention is a method or polypeptide construct as described above, wherein a single domain antibody corresponds to a sequence represented by any of SEQ ID NOs: 15 to 22
  • Another embodiment of the present invention is a method as described above or polypeptide construct as described above, wherein said target is antigen of IFN-gamma and the disorder is any of cancer, transplant rejection, auto immune disorder.
  • Another embodiment of the present invention is a method or polypeptide construct as described above, wherein a single domain antibody corresponds to a sequence represented by any of SEQ ID NOs: 45 to 70
  • Another embodiment of the present invention is a method as described above or polypeptide construct as described above wherein said target is any of antigen of Helicobacter pylori, antigen of Mycobacterium tuberculosis, antigen of influenza virus.
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against an internalising cellular receptor, and at least one single domain antibody directed against a therapeutic target.
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against an internalising cellular receptor, and at least one therapeutic polypeptide or agent.
  • Another embodiment of the present invention is a polypeptide construct as described above wherein said internalising cellular receptor is Epidermal Growth Factor receptor.
  • Another embodiment of the present invention is a polypeptide as described above wherein a single domain antibody directed against an internalising cellular receptor corresponds to a sequence represented by SEQ ID NO: 23 to 44.
  • Another embodiment of the present invention is a polypeptide construct as described above wherein said internalising cellular receptor is any of LDL receptor, FGF2r, ErbB2r, transferring receptor, PDGr, VEGr, or PsmAr.
  • Another embodiment of the present invention is a polypeptide construct as described above wherein a single domain antibody directed against a therapeutic target, is directed against PDK1.
  • Another embodiment of the present invention is a polypeptide construct as described above use in treating cancer
  • Another embodiment of the present invention is a polypeptide construct as described above wherein a single domain antibody directed against a therapeutic target is directed against any of GSK1, Bad, caspase and Forkhead.
  • Another embodiment of the present invention is a polypeptide construct as described above use in treating cancer.
  • Another embodiment of the present invention is a method for delivering an anti-target therapeutic compound to the interior of a cell comprising administering to a subject a polypeptide construct as described above.
  • Another embodiment of the present invention is a method for delivering an anti-target therapeutic compound to the interior of a cell without being inactivated comprising administering to a subject a polypeptide construct as described above.
  • Another embodiment of the present invention is a method as described above wherein said cell is located in the gut system, and said a polypeptide construct is delivered orally.
  • Another embodiment of the present invention is a method as described above wherein said cell is located in vaginal and/or rectal tract, and said a polypeptide construct is delivered to the vaginal and/or rectal tract.
  • Another embodiment of the present invention is a method as described above wherein said cell is located in nose, upper respiratory tract and/or lung, and said a polypeptide construct is delivered to nose, upper respiratory tract and/or lung.
  • Another embodiment of the present invention is a method as described above wherein said cell is located in intestinal mucosa, and said a polypeptide construct is delivered orally.
  • Another embodiment of the present invention is a method as described above wherein said cell is located in the tissues beneath the tongue, and said a polypeptide construct is delivered to the tissues beneath the tongue.
  • Another embodiment of the present invention is a method as described above wherein said cell is located in the skin, and said a polypeptide construct is delivered topically.
  • Another embodiment of the present invention is a method as described above wherein said cell is in, or accessible via the blood, and said a polypeptide construct is delivered orally, to the vaginal and/or rectal tract, nasally, by inhalation though the mouth or nose, to the tissues beneath the tongue, or topically.
  • Another embodiment of the present invention is a polypeptide construct as described above, or a method as described above, wherein the single domain antibodies are humanized Camelidae VHHs.
  • Another embodiment of the present invention is a polypeptide construct as described above, or a method as described above, wherein said single domain antibody is an homologous sequence, a functional portion, or a functional portion of an homologous sequence of the full length single domain antibody.
  • Another embodiment of the present invention is a polypeptide construct as described above or a method as described above, wherein the polypeptide construct is an homologous sequence, a functional portion, or a functional portion of an homologous sequence of the full length polypeptide construct.
  • Another embodiment of the present invention is a polypeptide construct as described above or a method as described above wherein said single domain antibodies are Camelidae VHHs.
  • Another embodiment of the present invention is a nucleic acid capable of encoding a polypeptide construct as described above.
  • Another embodiment of the present invention is a composition comprising a polypeptide construct as defined above, together with a pharmaceutical carrier.
  • DETAILED DESCRIPTION OF THE INVENTION
  • The present invention relates to a polypeptide construct comprising one or more single domain antibodies directed to one or more target molecule(s), each in a suitable dosage form either directly or as part of a composition containing an ingredient which facilitates delivery.
  • The invention further relates to polypeptide constructs comprising one or more single domain antibodies, for administration to a subject by non-invasive methods, such as orally, sublingually, topically, nasally, vaginally, rectally or by inhalation. Such non-invasive routes of delivery unexpectly provide an effective means to conveniently deliver therapeutic compounds
  • The present invention also relates to constructs comprising one or more single domain antibodies, for administration to a subject by normal invasive methods such as intravenously and subcutaneously.
  • The invention further relates to a method for delivering therapeutic peptides comprises the steps of administering a polypeptide construct comprising one or more single domain antibodies orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation to a subject.
  • The invention further relates to polypeptide constructs comprising anti-IgE single domain antibodies.
  • Single domain antibodies are antibodies whose complementary determining regions are part of a single domain polypetide. Examples include, but are not limited to, heavy chain antibodies, antibodies naturally devoid of light chains, single domain antibodies derived from conventional 4-chain antibodies, engineered antibodies and single domain scaffolds other than those derived from antibodies. Single domain antibodies may be any of the art, or any future single domain antibodies. Single domain antibodies may be derived from any species including, but not limited to mouse, human, camel, llama, goat, rabbit, bovine. According to one aspect of the invention, a single domain antibody as used herein is a naturally occurring single domain antibody known as heavy chain antibody devoid of light chains. Such single domain antibodies are disclosed in WO 9404678 for example. For clarity reasons, this variable domain derived from a heavy chain antibody naturally devoid of light chain is known herein as a VHH or nanobody to distinguish it from the conventional VH of four chain immunoglobulins. Such a VHH molecule can be derived from antibodies raised in Camelidae species, for example in camel, llama, dromedary, alpaca and guanaco. Other species besides Camelidae may produce heavy chain antibodies naturally devoid of light chain; such VHHs are within the scope of the invention.
  • VHHs, according to the present invention, and as known to the skilled addressee are heavy chain variable domains derived from immunoglobulins naturally devoid of light chains such as those derived from Camelidae as described in WO 94/04678 (and referred to hereinafter as VHH domains or nanobodies). VHH molecules are about 10× smaller than IgG molecules. They are single polypeptides and very stable, resisting extreme pH and temperature conditions. Moreover, they are resistant to the action of proteases which is not the case for conventional antibodies. Furthermore, in vitro expression of VHHs produces high yield, properly folded functional VHHs. In addition, antibodies generated in Camelids will recognize epitopes other than those recognised by antibodies generated in vitro through the use of antibody libraries or via immunisation of mammals other than Camelids (WO 9749805). As such, anti-albumin VHH's may interact in a more efficient way with serum albumin which is known to be a carrier protein. As a carrier protein some of the epitopes of serum albumin may be inaccessible by bound proteins, peptides and small chemical compounds. Since VHH's are known to bind into ‘unusual’ or non-conventional epitopes such as cavities (WO 97/49805), the affinity of such VHH's to circulating albumin may be increased.
  • The present invention further relates to a polypeptide construct, wherein a single domain antibody is a VHH directed against a target, wherein the VHH belongs to a class having human-like sequences. The class is characterised in that the VHHs carry an amino acid from the group consisting of glycine, alanine, valine, leucine, isoleucine, proline, phenylalanine, tyrosine, tryptophan, methionine, serine, threonine, asparagine, or glutamine at position 45, such as, for example, L45 according to the Kabat numbering. A VHH sequence represented by SEQ ID NO: 15 which binds to MMP-12, belongs to this human-like class of VHH polypeptides. As such, peptides belonging to this class show a high amino acid sequence homology to human VH framework regions and said peptides might be administered to a human directly without expectation of an unwanted immune response therefrom, and without the burden of further humanisation.
  • Another human-like class of Camelidae single domain antibodies represented by sequences 68 which binds to IFN gamma, have been described in WO03035694 and contain the hydrophobic FR2 residues typically found in conventional antibodies of human origin or from other species, but compensating this loss in hydrophilicity by the charged arginine residue on position 103 that substitutes the conserved tryptophan residue present in VH from conventional antibodies. As such, peptides belonging to these two classes show a high amino acid sequence homology to human VH framework regions and said peptides might be administered to a human directly without expectation of an unwanted immune response therefrom, and without the burden of further humanisation.
  • Any of the VHHs as used by the invention may be of the traditional class or of the classes of human-like Camelidae antibodies. Said antibodies may be directed against whole target or a fragment thereof, or a fragment of a homologous sequence thereof. These polypeptides include the full length Camelidae antibodies, namely Fc and VHH domains, chimeric versions of heavy chain Camelidae antibodies with a human Fc domain.
  • Targets of the invention are any which are of pharmaceutical interest. Examples are provided here of several targets, and are not intended to limit the invention thereto. Examples of targets include, TNF-alpha, IgE, IFN-gamma, MMP-12, EGFR, CEA, H. pylori, TB, influenza.
  • A single domain antibody directed against a target means a single domain antibody that is capable of binding to said target with an affinity of better than 10−6 M.
  • Targets may also be fragments of said targets. Thus a target is also a fragment of said target, capable of eliciting an immune response. A target is also a fragment of said target, capable of binding to a single domain antibody raised against the full length target.
  • A fragment as used herein refers to less than 100% of the sequence (e.g., 99%, 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 10% etc.), but comprising 5, 6, 7, 8, 9, 10, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more amino acids. A fragment is of sufficient length such that the interaction of interest is maintained with affinity of 1×10−6 M or better.
  • A fragment as used herein also refers to optional insertions, deletions and substitutions of one or more amino acids which do not substantially alter the ability of the target to bind to a single domain antibody raised against the wild-type target. The number of amino acid insertions deletions or substitutions is preferably up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69 or 70 amino acids.
  • One embodiment of the present invention is a polypeptide construct as disclosed herein, wherein the number of single domain antibodies directed to a target is two or more. Such multivalent polypeptide constructs have the advantage of unusually high functional affinity for the target, displaying much higher than expected inhibitory properties compared to their monovalent counterparts.
  • Multivalent polypeptide constructs have functional affinities that are several orders of magnitude higher than polypeptide constructs which are monovalent. The inventors have found that the functional affinities of these multivalent polypeptides are much higher than those reported in the prior art for bivalent and multivalent antibodies. Surprisingly, the multivalent polypeptide constructs of the present invention linked to each other directly or via a short linker sequence show the high functional affinities expected theoretically with multivalent conventional four-chain antibodies.
  • The inventors have found that such large increased functional activities can be detected preferably with antigens composed of multidomain and multimeric proteins, either in straight binding assays or in functional assays, e.g. animal model of chronic colitis.
  • A multivalent anti-target polypeptide as used herein refers to a polypeptide comprising two or more anti-target polypeptides which have been covalently linked. The anti-target polypeptides may be identical in sequence or may be different in sequence, but are directed against the same target or antigen. Depending on the number of anti-target polypeptides linked, a multivalent anti-target polypeptide may be bivalent (2 anti-target polypeptides), trivalent (3 anti-target polypeptides), tetravalent (4 anti-target polypeptides) or have a higher valency molecules.
  • An example of a multivalent polypeptide construct of the invention, comprising more than one anti-TNF-alpha VHHs is described in Example 7.
  • The single domain antibodies may be joined to form any of the polypeptide constructs disclosed herein comprising more than one single domain antibody using methods known in the art or any future method. They may be joined non-covalently (e.g. using streptavidin/biotin combination, antibody/tag combination) or covalently. They may be fused by chemical cross-linking by reacting amino acid residues with an organic derivatising agent such as described by Blattler et al, Biochemistry 24, 1517-1524; EP294703. Alternatively, the single domain antibody may be fused genetically at the DNA level i.e. a polynucleotide construct formed which encodes the complete polypeptide construct comprising one or more anti-target single domain antibodies. A method for producing bivalent or multivalent VHH polypeptide constructs is disclosed in PCT patent application WO 96/34103. One way of joining VHH antibodies is via the genetic route by linking a VHH antibody coding sequences either directly or via a peptide linker. For example, the C-terminal end of the VHH antibody may be linked to the N-terminal end of the next single domain antibody.
  • This linking mode can be extended in order to link additional single domain antibodies for the construction and production of tri-, tetra-, etc. functional constructs.
  • According to one aspect of the present invention, the single domain antibodies are linked to each other via a peptide linker sequence. Such linker sequence may be a naturally occurring sequence or a non-naturally occurring sequence. The linker sequence is expected to be non-immunogenic in the subject to which the multivalent anti-target polypeptide is administered. The linker sequence may provide sufficient flexibility to the multivalent anti-target polypeptide, at the same time being resistant to proteolytic degradation. A non-limiting example of a linker sequences is one that can be derived from the hinge region of VHHs described in WO 96/34103.
  • The polypeptide constructs disclosed herein may be made by the skilled artisan according to methods known in the art or any future method. For example, VHHs may be obtained using methods known in the art such as by immunising a camel and obtaining hybridomas therefrom, or by cloning a library of single domain antibodies using molecular biology techniques known in the art and subsequent selection by using phage display.
  • According to an aspect of the invention a polypeptide construct may be a homologous sequence of a full-length polypeptide construct. According to another aspect of the invention, a polypeptide construct may be a functional portion of a full-length polypeptide construct. According to another aspect of the invention, a polypeptide construct may be a homologous sequence of a full length polypeptide construct. According to another aspect of the invention, a polypeptide construct may be a functional portion of a homologous sequence of a full length polypeptide construct. According to an aspect of the invention a polypeptide construct may comprise a sequence of a polypeptide construct.
  • According to an aspect of the invention a single domain antibody used to form a polypeptide construct may be a complete single domain antibody (e.g. a VHH) or a homologous sequence thereof. According to another aspect of the invention, a single domain antibody used to form the polypeptide construct may be a functional portion of a complete single domain antibody. According to another aspect of the invention, a single domain antibody used to form the polypeptide construct may be a homologous sequence of a complete single domain antibody. According to another aspect of the invention, a single domain antibody used to form the polypeptide construct may be a functional portion of a homologous sequence of a complete single domain antibody.
  • As used herein, a homologous sequence of the present invention may comprise additions, deletions or substitutions of one or more amino acids, which do not substantially alter the functional characteristics of the polypeptides of the invention. The number of amino acid deletions or substitutions is preferably up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69 or 70 amino acids.
  • A homologous sequence according to the present invention may be a sequence of an anti-target polypeptide modified by the addition, deletion or substitution of amino acids, said modification not substantially altering the functional characteristics compared with the unmodified polypeptide.
  • A homologous sequence of the present invention may be a polypeptide which has been humanised. The humanisation of antibodies of the new class of VHHs would further reduce the possibility of unwanted immunological reaction in a human individual upon administration.
  • A homologous sequence according to the present invention may be a sequence which exists in other Camelidae species such as, for example, camel, llama, dromedary, alpaca, guanaco etc.
  • Where homologous sequence indicates sequence identity, it means a sequence which presents a high sequence identity (more than 70%, 75%, 80%, 85%, 90%, 95% or 98% sequence identity) with the parent sequence and is preferably characterised by similar properties of the parent sequence, namely affinity, said identity calculated using known methods.
  • Alternatively, a homologous sequence may also be any amino acid sequence resulting from allowed substitutions at any number of positions of the parent sequence according to the formula below:
  • Ser substituted by Ser, Thr, Gly, and Asn;
  • Arg substituted by one of Arg, His, Gin, Lys, and Glu;
  • Leu substituted by one of Leu, lie, Phe, Tyr, Met, and Val;
  • Pro substituted by one of Pro, Gly, Ala, and Thr;
  • Thr substituted by one of Thr, Pro, Ser, Ala, Gly, His, and Gin;
  • Ala substituted by one of Ala, Gly, Thr, and Pro;
  • Val substituted by one of Val, Met, Tyr, Phe, lie, and Leu;
  • Gly substituted by one of Gly, Ala, Thr, Pro, and Ser; lie substituted by one of lie, Met, Tyr, Phe, Val, and Leu;
  • Phe substituted by one of Phe, Trp, Met, Tyr, lie, Val, and Leu;
  • Tyr substituted by one of Tyr, Trp, Met, Phe, lie, Val, and Leu;
  • His substituted by one of His, Glu, Lys, Gln, Thr, and Arg;
  • Gin substituted by one of Gin, Glu, Lys, Asn, His, Thr, and Arg;
  • Asn substituted by one of Asn, Glu, Asp, Gin, and Ser;
  • Lys substituted by one of Lys, Glu, Gin, His, and Arg;
  • Asp substituted by one of Asp, Glu, and Asn;
  • Glu substituted by one of Glu, Asp, Lys, Asn, Gin, His, and Arg;
  • Met substituted by one of Met, Phe, lie, Val, Leu, and Tyr.
  • A homologous nucleotide sequence according to the present invention may refer to nucleotide sequences of more than 50, 100, 200, 300, 400, 500, 600, 800 or 1000 nucleotides able to hybridize to the reverse-complement of the nucleotide sequence capable of encoding the patent sequence, under stringent hybridisation conditions (such as the ones described by Sambrook et al., Molecular Cloning, Laboratory Manuel, Cold Spring, Harbor Laboratory press, New York).
  • As used herein, a functional portion refers to a sequence of a single domain antibody that is of sufficient size such that the interaction of interest is maintained with affinity of 1×10−6 M or better.
  • Alternatively, a functional portion comprises a partial deletion of the complete amino acid sequence and still maintains the binding site(s) and protein domain(s) necessary for the binding of and interaction with its target.
  • As used herein, a functional portion refers to less than 100% of the complete sequence (e.g., 99%, 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 10%, 5%, 1% etc.), but comprising 5 or more amino acids or 15 or more nucleotides.
  • Anti-IgE Single Domain Antibodies
  • One aspect of the present invention relates to therapeutic compounds which are suitable for alleviating the symptoms, for the treatment and prevention of allergies. Said therapeutic compounds interact with IgE, and modulate the cascade of immunological responses that is responsible for an allergic response.
  • Another aspect of the present invention relates to the use of anti-IgE single domain antibodies (e.g. VHHs) in the preparation of topical ophthalmic compositions for the treatment of an ocular allergic disorder (Example 2). Given the ease of production and the low cost using bacterial or yeast expression systems for VHHs, for example, compared to production of conventional antibodies in mammalian cells, the economics of preparing such compositions using VHHs of the invention are much more favourable then for conventional antibodies.
  • Ocular penetration and consequently ocular efficacy is highly unexpected with conventional antibodies and derived fragments given their large size. The polypeptide constructs of the invention however are expected to be highly efficient given their high potency, stability combined with a low molecular weigth. Therefore, applications for such indications other than topical can be envisaged with polypeptide constructs of the invention.
  • One embodiment of the present invention is a polypeptide construct comprising one or more single domain antibodies directed against IgE.
  • Another embodiment of the present invention is a polypeptide construct comprising one or more single domain antibodies directed against IgE, wherein a single domain antibody corresponds to a sequence represented by any of SEQ ID NOs: 1 to 11. Said sequences are derived from Camelidae VHHs.
  • The present invention also relates to the finding that a polypeptide construct comprising one or more single domain antibodies directed against IgE and further comprising one or more single domain antibodies directed against one or more serum proteins of a subject, surprisingly has significantly prolonged half-life in the circulation of said subject compared with the half-life of the anti-IgE single domain antibody when not part of said construct. Furthermore, such polypeptide constructs were found to exhibit the same favourable properties of VHHs such as high stability remaining intact in mice, extreme pH resistance, high temperature stability and high target affinity.
  • Another embodiment of the present invention is a polypeptide construct comprising one or more single domain antibodies directed against IgE further comprising one or more single domain antibodies directed against one or more serum proteins.
  • The serum protein may be any suitable protein found in the serum of subject, or fragment thereof. In one aspect of the invention, the serum protein is serum albumin, serum immunoglobulins, thyroxine-binding protein, transferrin, or fibrinogen. Depending on the intended use such as the required half-life for effective treatment and/or compartimentalisation of the target antigen, the VHH-partner can be directed to one of the above serum proteins.
  • One aspect of the invention, is a polypeptide construct comprising one or more single domain antibodies directed against IgE, further comprising an anti-serum albumin single domain antibody corresponding to a sequence represented by any of SEQ ID NO: 71 to 84.
  • Delivery of Polypeptide Constructs
  • The aspect of the invention relating to the delivery of polypeptide constructs of the invention is not limited to a polypeptide construct comprising anti-IgE single domain antibodies disclosed herein, but, as shown below, is applicable to any target. The polypeptide constructs may comprise single domain antibodies directed against more than one target, optionally with the variations described above.
  • One embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target for use in treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound that is able pass through the gastric environment without being inactivated.
  • As known by persons skilled in the art, once in possession of said polypeptide construct, formulation technology may be applied to release a maximum amount of VHHs in the right location (in the stomach, in the colon, etc.). This method of delivery is important for treating, prevent and/or alleviate the symptoms of disorder whose targets that are located in the gut system.
  • An aspect of the invention is a method for treating, preventing and/or alleviating the symptoms of a disorder susceptible to modulation by a therapeutic compound that is able pass through the gastric environment without being inactivated, by orally administering to a subject a polypeptide construct comprising one or more single domain antibodies specific for antigen related to the disorder.
  • Another embodiment of the present invention is a use of a polypeptide construct as disclosed herein for the prepararion of a medicament for treating, preventing and/or aleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound that is able pass through the gastric environment without being inactivated.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the gut system without being inactivated, by orally administering to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the bloodstream of a subject without being inactivated, by orally administering to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target herein for use in treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound to the vaginal and/or rectal tract.
  • In a non-limiting example, a formulation according to the invention comprises a polypeptide construct as disclosed herein comprising one or more VHHs directed against one or more targets in the form of a gel, cream, suppository, film, or in the form of a sponge or as a vaginal ring that slowly releases the active ingredient over time (such formulations are described in EP 707473, EP 684814, U.S. Pat. No. 5,629,001).
  • An aspect of the invention is a method for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by a therapeutic compound to the vaginal and/or rectal tract, by vaginally and/or rectally administering to a subject a polypeptide construct comprising one or more single domain antibodies specific for antigen related to the disorder.
  • Another embodiment of the present invention is a use of a polypeptide construct as disclosed herein for the prepararion of a medicament for treating, preventing and/or aleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound to the vaginal and/or rectal tract without being inactivated.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the vaginal and/or rectal tract without being inactivated, by administering to the vaginal and/or rectal tract of a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the bloodstream of a subject without being inactivated, by administering to the vaginal and/or rectal tract of a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target comprising at least one single domain antibody directed against a target, for use in treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound to the nose, upper respiratory tract and/or lung.
  • In a non-limiting example, a formulation according to the invention, comprises a polypeptide construct as disclosed herein directed against one or more targets in the form of a nasal spray (e.g. an aerosol) or inhaler. Since the construct is small, it can reach its target much more effectively than therapeutic IgG molecules.
  • An aspect of the invention is a method for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by a therapeutic compound to the upper respiratory tract and lung, by administering to a subject a polypeptide construct as disclosed herein wherein one or more single domain antibodies are specific for an antigen related to the disorder, by inhalation through the mouth or nose.
  • Another aspect of the invention is a dispersible VHH composition, in particular dry powder dispersible VHH compositions, such as those described in U.S. Pat. No. 6,514,496. These dry powder compositions comprise a plurality of discrete dry particles with an average particle size in the range of 0.4-10 μm. Such powders are capable of being readily dispersed in an inhalation device. VHH's are particularly suited for such composition as lyophilized material can be readily dissolved (in the lung subsequent to being inhaled) due to its high solubilisation capacity (Muyldermans, S., Reviews in Molecular Biotechnology, 74, 277-303, (2001)). Alternatively, such lyophilized VHH formulations can be reconstituted with a diluent to generate a stable reconstituted formulation suitable for subcutaneous administration. For example, anti-IgE antibody formulations (Example 1; U.S. Pat. No. 6,267,958, EP 841946) have been prepared which are usefull for treating allergic asthma.
  • Another embodiment of the present invention is a use of a polypeptide construct as disclosed herein for the prepararion of a medicament for treating, preventing and/or aleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound to to the nose, upper respiratory tract and/or lung without being inactivated.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the nose, upper respiratory tract and lung, by administering to the nose, upper respiratory tract and/or lung of a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the nose, upper respiratory tract and/or lung without being inactivated, by administering to the nose, upper respiratory tract and/or lung of a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the bloodstream of a subject without being inactivated by administering to the nose, upper respiratory tract and/or lung of a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • One embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target for use in treating, preventing and/or alleviating the symptoms of disorders wherein the permeability of the intestinal mucosa is increased. Because of their small size, a polypeptide construct as disclosed herein can pass through the intestinal mucosa and reach the bloodstream more efficiently in subjects suffering from disorders which cause an increase in the permeability of the intestinal mucosa, for example Crohn's disease.
  • An aspect of the invention is a method for treating, preventing and/or alleviating the symptoms of disorders wherein the permeability of the intestinal mucosa is increased, by orally administering to a subject a polypeptide construct as disclosed herein comprising one or more single domain antibodiesspecific for an antigen related to the disorder.
  • This process can be even further enhanced by an additional aspect of the present invention—the use of active transport carriers. In this aspect of the invention, VHH is fused to a carrier that enhances the transfer through the intestinal wall into the bloodstream. In a non-limiting example, this “carrier” is a second VHH which is fused to the therapeutic VHH. Such fusion constructs made using methods known in the art. The “carrier” VHH binds specifically to a receptor on the intestinal wall which induces an active transfer through the wall.
  • Another embodiment of the present invention is a use of a polypeptide construct as disclosed herein for the prepararion of a medicament for treating, preventing and/or aleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound to the intestinal mucosa, wherein said disorder increases the permeability of the intestinal mucosa.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the intestinal mucosa without being inactivated, by administering orally to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the bloodstream of a subject without being inactivated, by administering orally to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • One embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target for use in treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound that is able pass through the tissues beneath the tongue effectively. A formulation of said polypeptide construct as disclosed herein, for example, a tablet, spray, drop is placed under the tongue and adsorbed through the mucus membranes into the capillary network under the tongue.
  • An aspect of the invention is a method for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by a therapeutic compound that is able pass through the tissues beneath the tongue effectively, by sublingually administering to a subject a VHH specific for an antigen related to the disorder.
  • Another embodiment of the present invention is a use of a polypeptide construct as disclosed herein for the preparation of a medicament for treating, preventing and/or aleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound that is able to pass through the tissues beneath the tongue.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the tissues beneath the tongue without being inactivated, by administering orally to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the bloodstream of a subject without being inecativated, by administering orally to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • One embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody for use in treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound that is able, pass through the skin effectively. A formulation of said polypeptide construct, for example, a cream, film, spray, drop, patch, is placed on the skin and passes through.
  • An aspect of the invention is a method for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by a therapeutic compound that is able pass through the skin effectively, by topically administering to a subject a polypeptide construct as disclosed herein comprising one or more single domain antibodies specific for an antigen related to the disorder.
  • Another aspect of the invention is the use of a polypeptide construct as disclosed herein as a topical ophthalmic composition for the treatment of ocular disorder, such as allergic disorders, which method comprises the topical administration of an ophthalmic composition comprising polypeptide construct as disclosed herein, said construct comprising one or more anti-IgE VHH (Example 1, Example 2).
  • Another embodiment of the present invention is a use of a polypeptide construct as disclosed herein for the preparation of a medicament for treating, preventing and/or aleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound that is able pass through the skin effectively.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the skin without being inactivated, by administering topically to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the bloodstream of a subject, by administering topically to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • A non-limiting example of a therapeutic target against which a polypeptide construct of the invention may be used is TNF, which is involved in inflammatory processes. The blocking of TNF action can have an anti-inflammatory effect, which is highly desirable in certain disease states such as, for example, Crohn's disease. Current therapy consists of intravenous administration of anti-TNF antibodies. Our Examples (Example 4) demonstrate VHHs according to the invention which bind TNF and moreover, block its binding to the TNF receptor. Oral delivery of these anti-TNF polypeptide constructs results in the delivery of such molecules in an active form in the colon at sites that are affected by the disorder. These sites are highly inflamed and contain TNF-producing cells. These anti-TNF polypeptide constructs can neutralise the TNF locally, avoiding distribution throughout the whole body and thus limiting negative side-effects. Genetically modified microorganisms such as Micrococcus lactis are able to secrete antibody fragments (U.S. Pat. No. 6,190,662, WO 0023471). Such modified microorganisms can be used as vehicles for local production and delivery of antibody fragments in the intestine. By using a strain which produces a TNF neutralizing antibody fragment, inflammatory bowel disorder could be treated. Another aspect of the invention is a polypeptide construct comprising at least one single domain antibody specific for TNF-alpha for use in the treatment, prevention and/or alleviation of disorders relating to inflammatory processes, wherein said polypeptide construct is administered orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation. Another aspect of the invention is a method of treating, preventing and/or alleviating disorders relating to inflammatory processes, comprising administering to a subject a polypeptide construct comprising at least one single domain antibody directed against for example TNF-alpha orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation.
  • According to one aspect of the invention, a polypeptide construct of the invention comprises at least one single domain antibody directed against TNF-alpha, said single domain antibody corresponding to a sequence represented by any of SEQ ID NOs: 12 to 14. Said sequences are anti-TNF-alpha Camelidae VHHs.
  • Further non-limiting examples of therapeutic targets against which a polypeptide construct of the invention may be used are certain colon cancer specific antigens, such as, for example, CEA or EGF receptors. In one aspect of the invention, therapeutic VHHs against colon cancer antigens are linked to or provided with one more tumor destroying reagents such as for example, a chemical compound or a radioactive compound.
  • As stated above a colon cancer specific antigen according to the invention is epidermal growth factor receptor (EGFR) which is an essential mediator of cell division in mammalian cells and is a recognised cellular oncogene. After the binding of EGF to its receptor (EGFR), a signaling cascade is initiated resulting in cell development. The EGFR is also involved in human tumorigenesis as it is overexpressed on cells associated with epithelial malignancies located in sites such as the head, neck, lung, colon. Another aspect of the invention is a polypeptide construct comprising at least one single domain antibody directed against EGFR for use in the treatment, prevention and/or alleviation of disorders relating to EGFR-mediated cancer, wherein said VHH is administered orally, sublingually, topically, nasally, intravenously, subcutaneously, vaginally, rectally or by inhalation (Examples 25 to 31). Another aspect of the invention is a method of treating, preventing and/or alleviating disorders relating to EGFR-mediated cancer, comprising administering to a subject a polypeptide construct comprising at least one single domain antibody directed against EGFR orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation.
  • According to one aspect of the invention, a polypeptide construct of the invention comprises at least one single domain antibody directed against EGFR, said single domain antibody corresponding to a sequence represented by any of SEQ ID NOs: 23 to 44. Said sequences are anti-EGRF Camelidae VHHs.
  • As stated above another colon cancer specific antigen according to the invention is carcinoembryonic antigen (CEA), a recognized tumor marker. Another aspect of the invention is a polypeptide construct comprising one or more single domain antibodies specific for CEA for use in the treatment, prevention and/or alleviation of disorders relating to CEA-mediated cancer, wherein said polypeptide is administered orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation. Another aspect of the invention is a method of treating, preventing and/or alleviating disorders relating to CEA-mediated cancer, comprising administering to a subject a polypeptide construct comprising at least one single domain antibody directed against CEA, orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation. A few VHHs specific for this glycoprotein have been isolated by selection on solid-phase coated with CEA out of a dedicated library obtained after immunization of a dromedary. By using FACS analysis it appeared that only two fragments recognized the cell-bound antigen. One of the VHHs, that recognised the native structure, has been used to construct a fusion protein with β-lactamase. The functionality of the purified fusion protein was tested in vitro in a prodrug converting cytotoxicity assay. In addition the immunoconjugate was tested in vivo in a tumor-targeting biodistribution study.
  • A non-limiting example of a therapeutic target against which a polypeptide construct of the invention may be used is Helicobacter pylori, which is a bacterium that lives in the mucus which coats the lining of the human stomach and duodenum. The normal human stomach has a very thin layer of mucus that coats the whole of its inside surface. This mucus has a protective role, acting as a barrier between the acid in the stomach and the sensitive stomach wall. H. pylori acts as an irritant to the lining of the stomach, and this causes inflammation of the stomach (gastritis). In one embodiment of the invention is a polypeptide construct comprising at least one single domain antibody directed against H. pylori, said construct and inhibits the enzymatic function of urease. Since single domain antibodies, in particular VHHs have the specific characteristic to occupy enzymatic sites, selected VHHs would inhibit the enzymatic activity and neutralize the virulence of a H. pylori infection. In another aspect of the invention is a polypeptide construct comprising at least one single domain antibody directed against H. pylori, said construct inhibiting the adhesion of the bacteria to the stomach wall so preventing irritation of the stomach wall and gastritis. One aspect of the invention is a polypeptide construct comprising one or more single domain antibodies directed against Helicobacter pylori for use in the treatment, prevention and/or alleviation of disorders relating to irritation of the stomach wall and gastritis, wherein said polypeptide construct is administered orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation, but preferably orally. Another aspect of the invention is a method of treating, preventing and/or alleviating disorders relating to irritation of the stomach wall and gastritis, comprising administering to a subject a polypeptide construct comprising one or more single domain antibodies directed against Helicobacter pylon, orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation, but preferably orally.
  • Another non-limiting example of a therapeutic target against which the VHH of the invention may be used is Hepatitis E, which is a viral disorder transmitted via the fecal/oral route. Symptoms increase with age and include abdominal pain, anorexia, dark urine, fever, hepatomegaly, jaundice, malaise, nausea, and vomiting. The overall fatality rate is 1-3%, but 15-25% in pregnant women. Once encountered, most patients develop a neutralizing IgG response which gives life-long protection Neutralizing VHH molecules have the advantage over conventional IgG molecules because they may be administered orally. Since most infections with hepatitis E occur in North-Africa, Central-Africa, Asia and Central-America, oral administration is a significant advantage, since medical logistics are less developed in those countries. One aspect of the invention is one or more VHHs specific for HEV capsid protein (56 kDa) for use in the treatment, prevention and/or alleviation of disorders relating hepatitis E, wherein said VHH is administered orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation. Another aspect of the invention is a method of treating, preventing and/or alleviating disorders relating to hepatitis E, comprising administering to a subject said VHH orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation.”
  • Other non-limiting examples of therapeutic targets against which a polypeptide construct of the invention may be used are micro-organisms induce respiratory disorders such as the TB bacterium and influenza virus. TB or tuberculosis, is a disorder caused by bacteria called Mycobacterium tuberculosis. The bacteria can attack any part of the body, but they usually attack the lungs. Influenza is a viral disorder that causes ‘flu’. Influenza viruses are also present in the lung. One aspect of the invention is a polypeptide construct comprising at least one single domain antibody directed against Mycobacterium tuberculosis epitope for use in the treatment, prevention and/or alleviation of disorders relating TB, wherein said polypeptide construct is administered orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation. Another aspect of the invention is a method of treating, preventing and/or alleviating disorders relating to TB, comprising administering to a subject said polypeptide construct orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation. Another aspect of the invention is a polypeptide construct comprising at least one single domain antibody directed against an influenza virus epitope for use in the treatment, prevention and/or alleviation of disorders relating flu, wherein said polypeptide construct is administered orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation. Another aspect of the invention is a method of treating, preventing and/or alleviating disorders relating to flu, comprising administering to a subject said polypeptide construct orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation.
  • Another non-limiting example of a therapeutic target against which a polypeptide of the invention may be used is IgE in relation to allergies. During their lifetime, subjects may develop an allergic response to harmless parasites (e.g. Dermatophagoides pteronyssinus, house dust mite) or substances (clumps, plastics, metals). This results in the induction of IgE molecules that initiate a cascade of immunological responses. One aspect of the present invention is a polypeptide construct comprising at least one single domain antibody directed against IgE, said polypeptide preventing the interaction of IgE with their receptor(s) on mast cells and basophils. As such they prevent the initiation of the immunological cascade, an allergic reaction. Since IgE molecules are present in the bloodstream, it is within the scope of the invention to fuse the VHH one or more active transport carriers in order to reach their target. Another aspect of the invention is a polypeptide construct comprising at least one single domain antibody directed against an IgE epitope for use in the treatment, prevention and/or alleviation of disorders relating to allergies, wherein said polypeptide construct is administered orally, sublingually, topically, nasally, vaginally, rectally or by inhalation. Another aspect of the invention is a method of treating, preventing and/or alleviating disorders relating to allergies, comprising administering to a subject said polypeptide construct orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation.
  • According to one aspect of the invention, a polypeptide construct of the invention comprises at least one single domain antibody directed against IgE, said single domain antibody corresponding to a sequence represented by any of SEQ ID NOs: 1 to 11. Said sequences are anti-IgE Camelidae VHHs.
  • Another non-limiting example of a therapeutic target against which a polypeptide construct of the invention may be used is human macrophage elastase (MMP-12), which is a member of the family of matrix metalloproteases (MMPs). These enzymes play an important role in normal and inflammatory processes contributing to tissue remodeling and destruction. MMPs play besides proper extracellular matrix remodeling also an important role in diverse disease states such as cancer and inflammation. Macrophage elastase or MMP-12 has a large specificity pocket and broad substrate specificity. It plays a role in several disorders owing to excessive protein degradation of extracellular proteins (e.g. lung damage in smoke induced emphysema, Churg et al, A. 2003) or increased matrix degradation (e.g. higher MMP-12 enzymatic activity in obesity, Chavey et al, 2003). Other clinical indications include coeliac disorder and dermatitis herpetiformis (Salmela et al, 2001), glomerulo nephritis (Kaneko et al, 2003), esophageal squamous cell carcinoma (Ding et al, 2002) and skin cancer (Kerkela et al, 2000).
  • MMP-12 is secreted into the extracellular space by lung alveolar macrophages and dysregulation of MMP-12 is a possible reason for degradation of the alveolar membrane leading to lung emphysema. Target substrates of MMP-12 include extracellular matrix proteins such as elastin, fibronectin and laminin, but also α1-antitrypsin and tissue factor protease inhibitor. One aspect of the invention is a polypeptide construct comprising at least one single domain antibody directed against MMP-12 for use in the treatment, prevention and/or alleviation of disorders relating to inflammatory processes, wherein said polypeptide construct is administered orally, sublingually, topically, nasally, vaginally, rectally or by inhalation. Another aspect of the invention is a method of treating, preventing and/or alleviating disorders relating to inflammatory processes, comprising administering to a subject said polypeptide construct orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation.
  • Another aspect of this invention consists of (1) VHH's that specifically bind to a metalloproteinase and are not degraded by a metalloproteinase, (2) VHH's which inhibit the proteolytic activity of one or more metalloproteinase and (3) inhibitory VHH's which are highly specific for one MMP (e.g. MMP-12 specific antagonist), unlike none-specific chemical inhibitors (e.g. batimastat, merimastat . . . )
  • According to one aspect of the invention, a polypeptide construct of the invention comprises at least one single domain antibody directed against human MMP-12, said single domain antibody corresponding to a sequence represented by any of SEQ ID NOs: 15 to 22. Said sequences are anti-MMP-12 Camelidae VHHs.
  • Another non-limiting example of a therapeutic target against which a polypeptide construct of the invention may be used is IFN-gamma, which is secreted by some T cells. In addition to its anti-viral activity, IFN gamma stimulates natural killer (NK) cells and T helper 1 (Th1) cells, and activates macrophages and stimulates the expression of MHC molecules on the surface of cells. Hence, IFN gamma generally serves to enhance many aspects of immune function, and is a candidate for treatment of disease states where the immune system is over-active (e.g. Crohn's disease), e.g., autoimmune disorders and organ plant rejection. One aspect of the invention is a polypeptide construct comprising at least one single domain antibody directed against IFN-gamma for use in the treatment, prevention and/or alleviation of disorders relating to the immune response, wherein said polypeptide construct is administered orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation. Another aspect of the invention is a method of treating, preventing and/or alleviating disorders relating to the immune response, comprising administering to a subject said polypeptide construct orally, sublingually, topically, intravenously, subcutaneously, nasally, vaginally, rectally or by inhalation. In other embodiments of the present invention polypeptide constructs that neutralize IFN gamma are used to treat patients with psoriasis.
  • According to one aspect of the invention, a polypeptide construct of the invention comprises at least one single domain antibody directed against IFN-gamma, said single domain antibody corresponding to a sequence represented by any of SEQ ID NOs: 45 to 70. Said sequences are anti-IFN-gamma Camelidae VHHs.
  • The invention also relates to a method of identifying single domain antibodies (e.g. VHHs) harbouring specific sequences which facilitates the delivery or transport of the anti-target single domain antibodies across human or animal tissues (as described in U.S. Pat. No. 6,361,938), including without limitation GIT epithelial layers, alveolar cells, endothelial of the blood-brain barrier, vascular smooth muscle cells, vascular endothelial cells, renal epithelial cells, M cells of the Peyers Patch, and hepatocytes. Furthermore, delivery systems could be used in conjunction with the VHH's of the invention, comprising nanoparticles, microparticles, liposomes, micelles, cyclodextrines. Only small (<600 daltons) and hydrophobic (Partridge et al, Adv. Drug Delivery Reviews, 15, 5-36 (1995)) molecules can easily pass the blood-brain barrier, severely limiting the development of novel brain drugs which can be used without the use of invasive neurosurgical procedures.
  • Delivering Polypeptide Constructs to the Interior of Cells
  • Another aspect of the present invention is a method and molecules for delivering therapeutic polypeptides and/or agents to the inside of cells. A further aspect of the invention is a method and molecules for delivering antigens to the inside of antigen presenting cells, and thereby eliciting a powerful immune response thereto. A still further aspect of the invention is to provide a method and molecules for delivery of therapeutic polypeptides and/or agents across natural barriers such as the blood-brain barrier, lung-blood barrier.
  • One aspect of the invention is a polypeptide construct comprising one or more single domain antibodies directed against a target and comprising one or more single domain antibodies directed against an internalising cellular receptor, wherein said polypeptide construct internalises upon binding to said receptor.
  • The targets inside cells may affect the functioning of said cell, or binding thereto may lead to a change in the phenotype of the cell itself by itself. This can be for example, cell death, effects on cell cycling or cell growth or interference with intracellular signaling pathways (see, for example, Poul M A et al, J Mol Biol, 2000, 301, 1149-1161).
  • One embodiment of the present invention is a polypeptide construct comprising one or more single domain antibodies specific for an internalising cellular receptor, wherein said construct internalises upon binding to said receptor, wherein the polypeptide construct comprises a therapeutic polypeptide or agent which is covalently or non-covalently linked thereto. Said therapeutic polypeptide or agent has one or more targets which acts intracellularly. See, for example, FIG. 12. Said therapeutic polypeptides may harbour specific sequences which target the polypeptide to specific compartiments in the cell, comprising vesicles, organelles and other cytoplasmic structures, membrane-bound structures, the nucleus.
  • An internalising receptor according to the invention is a receptor displayed on the surface of a cell which upon binding to a ligand, mediates the internalisation of said ligand into the cytoplasm of the cell. Internalising receptors according to the invention include, but are not limited to, LDL receptors, EGFr, FGF2r, ErbB2r, transferrin receptor, PDGFr, VEGFr, PsmAr or antigen presenting cell internalising receptors.
  • One embodiment of the present invention is a polypeptide construct comprising one or more single domain antibodies specific for an internalising cellular receptor as disclosed herein, further comprising an antigen.
  • One embodiment of the present invention is a polypeptide construct comprising one or more single domain antibodies specific for an internalising cellular receptor as disclosed herein, wherein said receptor is an internalising receptor on an antigen presenting cell (APC). Preferably the receptor is highly specific for APCs and not present or is present in lower amounts on other cell types.
  • Another embodiment of the invention is a polypeptide construct comprising one or more anti-receptor single domain antibodies and an antigen. Thus by linking an antigen to a VHH directed towards an internalising receptor on an APC, antigen uptake by APC is not determined by the passive interaction between APC and antigen, but by the “active” binding between VHH and said receptor. This not only makes the process more efficient, but also more reproducible and not dependent on the antigen structure which causes great variability in the T-cell activation from antigen to antigen.
  • After internalization, the complex is digested by the APC and pieces of the antigen can be exposed on the surface in association with MHC/HLA and elicit a more powerful immune response.
  • Another embodiment of the present invention is a method for immunising a subject against an antigen comprising administering to a subject in need thereof a polypeptide construct comprising at least one single domain antibody directed against an antigen present on an APC, wherein said single domain antibody further comprises the antigen of interest.
  • One embodiment of the present invention is a polypeptide construct comprising one or more single domain antibodies specific for an internalising cellular receptor as disclosed herein, wherein said receptor is EGFR. In general internalization of receptors occurs upon binding of the agonistic ligand in a proces called sequestration. In order to ensure that extracellular signals are translated into intracellular signals of appropriate magnitude and specificity, the signalling cascades are tightly regulated via the process of sequestration, whereby receptors are physically removed from the cell surface by internalization to a cytosolic compartment (Carman, C. V. and Benovic, J. L. Current Opinion in Neurobiology 1998, 8: 335-344). This implies that only agonistic ligands or antibodies indeed are expected to internalize via such receptors. In terms of therapeutic use it is not a desired effect that the antibody first triggers proliferation of the tumorcells, before it can deliver a toxic payload to the interiour of the cell.
  • Some of internalising receptors are over-expressed on certain cells, such as the epidermal growth factor receptor (EGFR) or ErBb2 receptor on tumor cells. Epidermal growth factor (EGF) is an essential mediator of cell division in mammalian cells and is a recognized cellular oncogene and is therefore an appropriate target for anti-receptor therapy. After the binding of EGF to its receptor (EGFR), a signaling cascade is initiated resulting in cell development. The EGFR is involved in human tumorigenesis as it is overexpressed on cells of many epithelial malignancies such as head, neck, lung, colon. VHH that are internalised upon binding to one of these receptors can be used to deliver molecules inside the cell.
  • One embodiment of the present invention a polypeptide construct comprising one or more single domain antibodies directed against EGFR, wherein a single domain antibody corresponds to a sequence represented by any of SEQ ID NOs: 23 to 44. Surprisingly, one of the single domain antibodies, did not activate the EGFR, despite the fact that it was internalized efficiently. Such types of antibodies are preferred for therapeutic applications, since these can deliver toxic payloads into cells without stimulating its proliferation.
  • Another embodiment of the present invention is a polypeptide construct construct comprising one or more single domain antibodies directed against for EGFR, wherein said anti-EGFR single domain antibody does not activate the EGFR. Said polypeptide construct may be used for the delivery of a therapeutic agents and/or polypeptides into a cell, as mentioned herein, without stimulating the EGFR.
  • Another embodiment of the present is a polypeptide construct construct comprising one or more single domain antibodies directed against for EGFR, wherein said anti-EGFR single domain antibody does not activate the EGFR and corresponds to a sequence represented by SEQ ID NO: 31.
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against an internalising cellular receptor, wherein said construct internalises upon binding to said receptor, and further comprising one or more single domain antibodies directed against an intracellular target, said single domain antibodies covalently or non-covalently linked. This multispecific polypeptide construct may be used in the treatment, prevention and/or alleviation of disorders, according to the target of the non-receptor specific single domain antibody. This target can be, for example, a kinase such as PDK1. PDK1 is over-expressed in breast tumor cells. It activates Akt by phosphorylating T308 in the activation loop. A number of downstream substrates of Akt play a direct role in promoting cell survival. These include GSK3, Bad, caspase-9 and Forkhead.
  • One embodiment of the present invention is a polypeptide construct comprising a single domain antibody directed against an internalising cellular receptor, wherein said construct internalises upon binding to said receptor, and further comprising one or more single domain antibodies directed against any of PDK1, GSK1, Bad, caspase-9 and Forkhead. Another aspect of the invention the use of said construct for treating cancer. Another aspect of the invention is said construct for the preparation of a medicament for treating cancer.
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against an internalising cellular receptor, wherein said construct internalises upon binding to said receptor, wherein the construct further comprises a drug or a toxic compound covalently or non-covalently linked thereto. One example of a toxic compound is a compound that is only active intracellularly due to reducing environment (e.g. an enzyme recombinantly modified with additional cysteins resulting in inactive enzyme, but active in reducing environment). Another example of a toxic compound is a one that is specifically toxic only to a particular cell-type. An example of a toxic compound or a drug is a compound activated by a ligand present inside the cell and leading to the phenotype of interest. Other examples include prodrugs, small organic molecules. One aspect of the invention the use of said construct in the treatment of disorder requiring administration of the same. Another aspect of the invention is said construct for the preparation of a medicament for the treatment of disorder requiring administration of the same.
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against an internalising cellular receptor, wherein said construct internalises upon binding to said receptor, and wherein a filamentous phage expresses said construct on its surface. Said construct may be attached to the tip of the phage. In one aspect of the invention, construct-phage assembly can be used to package and deliver DNA to the cell for use as a gene therapy vector. According to the invention, the phage may carry DNA in additional to that encoding said construct, for use therapeutically. According to the invention, the phage may carry a gene encoding a therapeutic polypeptide controlled by a promoter for the expression of said gene inside the cell. An example of said promoter includes, but is not limited to, the CMV promoter (Kassner et al, Biochem Biophys Res Commun, 1999, 264: 921-928). Phage have distinct advantages over existing gene therapy vectors because they are simple, economical to produce at high titer, have no intrinsic tropism for mammalian cells, and are relatively simple to genetically modify and evolve (Larocca D et al, Curr. Pharm. Biotechnol, 2002: 3: 45-57).
  • Another embodiment of the present invention is a polypeptide construct as disclosed herein, wherein said single domain antibody is a peptide derived from a VHH specific for an internalising cellular receptor. Said VHH peptide may bind their antigen almost only through the peptide. Internalising VHHs may be prepared from a peptide library which is screened for internalising properties. It is an aspect of the invention that these VHH peptides can be added as a tag to therapeutic polypeptides or agents, for intracellular uptake. The VHH peptide, may, for example, be used to transport a therapeutic VHH into a cell. In one embodiment of the invention, the VHH peptide is the CDR3. In another one embodiment of the invention, the VHH peptide is any other CDR.
  • Another embodiment of the present invention is a method of selecting for VHHs specific for an internalising cellular receptor, wherein said VHH internalise upon binding to said receptor, comprising panning receptor-displaying cells with a phage library (naïve or immune) of VHH, and selecting for internalising VHH by recovering the endocytosed phage from within the cell. The invention includes a selection method which uses cell lines that overexpress a receptor or cell lines transfected with a receptor gene to allow the easy selection of phage antibodies binding to the receptor. This avoids the need for protein expression and purification, speeding up significantly the generation of internalizing VHH.
  • Another embodiment of the present invention is a method for delivering a therapeutic polypeptide, agent or antigen for uptake by cellular internalisation by covalently or non-covalently attaching thereto a polypeptide construct comprising at least one single domain antibody specific for an internalising cellular receptor, wherein said construct internalises upon binding to said receptor.
  • The VHHs according to the invention may be used to treat, prevent and/or alleviate symptoms of disorders requiring the administration of the same.
  • Another embodiment of the present invention is a method for delivering a therapeutic polypeptide or agent that interacts with intracellular targets molecules comprising administering to a subject in need thereof one or more VHHs specific for an internalising cellular receptor, wherein said VHH internalise upon binding to said receptor, wherein said VHH is fused to said polypeptide or agent.
  • Another embodiment of the present invention is a method for delivering a therapeutic polypeptide, agent or antigen across a natural barrier by covalently or non-covalently attaching thereto a polypeptide construct comprising at least one single domain antibody directed against an internalising cellular receptor, wherein said construct internalises upon binding to said receptor. According to the invention, a natural barrier includes, but is not limited to, the blood-brain, lung-blood, gut-blood, vaginal-blood, rectal-blood and nasal-blood barriers.
  • For example, a peptide construct delivered via the upper respiratory tract and lung can be used for transport of therapeutic polypeptides or agents from the lung lumen to the blood. The construct binds specifically to a receptor present on the mucosal surface (bronchial epithelial cells) resulting in transport, via cellular internalisation, of the therapeutic polypeptides or agents specific for bloodstream targets from the lung lumen to the blood. In another example, a therapeutic polypeptide or agent is linked to a polypeptide construct comprising at least one single domain antibody directed against an internalising cellular receptor present on the intestinal wall into the bloodstream. Said construct induces a transfer through the wall, via cellular internalization, of said therapeutic polypeptide or agent.
  • Another embodiment of the present invention is a VHH specific for an internalising cellular receptor, wherein said VHH internalises upon binding to said receptor, said VHH is covalently or non-covalently attached to a therapeutic polypeptide or agent, and said VHH crosses a natural barrier.
  • Another embodiment of the present invention is a method for delivering a therapeutic polypeptide, agent or antigen for uptake at a local by covalently or non-covalently attaching it to a VHH specific for an internalising cellular receptor, wherein said VHH internalises upon binding to said receptor. A local area, according to the invention, includes, but is not limited to, the brain, lung, gut, vaginal, rectal and nasal areas.
  • One embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target for use in treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound that is able pass through the gastric environment without being inactivated.
  • As known by persons skilled in the art, once in possession of said polypeptide construct, formulation technology may be applied to release a maximum amount of VHHs in the right location (in the stomach, in the colon, etc.). This method of delivery is important for treating, prevent and/or alleviate the symptoms of disorder whose targets that are located in the gut system.
  • An aspect of the invention is a method for treating, preventing and/or alleviating the symptoms of a disorder susceptible to modulation by a therapeutic compound that is able pass through the gastric environment without being inactivated, by orally administering to a subject a polypeptide construct comprising one or more single domain antibodies specific for antigen related to the disorder.
  • Another embodiment of the present invention is a use of a polypeptide construct as disclosed herein for the prepararion of a medicament for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound that is able pass through the gastric environment without being inactivated.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the gut system without being inactivated, by orally administering to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the bloodstream of a subject without being inactivated, by orally administering to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target for use in treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound delivered to the vaginal and/or rectal tract.
  • In a non-limiting example, a formulation according to the invention comprises a polypeptide construct as disclosed herein comprising one or more VHHs directed against one or more targets in the form of a gel, cream, suppository, film, or in the form of a sponge or as a vaginal ring that slowly releases the active ingredient over time (such formulations are described in EP 707473, EP 684814, U.S. Pat. No. 5,629,001).
  • An aspect of the invention is a method for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound delivered to the vaginal and/or rectal tract, by vaginally and/or rectally administering to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • Another embodiment of the present invention is a use of a polypeptide construct as disclosed herein for the preparation of a medicament for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound delivered to the vaginal and/or rectal tract without being inactivated.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the vaginal and/or rectal tract without being inactivated, by administering to the vaginal and/or rectal tract of a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the bloodstream of a subject without being inactivated, by administering to the vaginal and/or rectal tract of a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • Another embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target comprising at least one single domain antibody directed against a target, for use in treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound delivered to the nose, upper respiratory tract and/or lung.
  • In a non-limiting example, a formulation according to the invention, comprises a polypeptide construct as disclosed herein directed against one or more targets in the form of a nasal spray (e.g. an aerosol) or inhaler. Since the construct is small, it can reach its target much more effectively than therapeutic IgG molecules.
  • An aspect of the invention is a method for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic delivered to the nose, upper respiratory tract and lung, by administering to a subject a polypeptide construct as disclosed herein wherein one or more single domain antibodies are specific for an antigen related to the disorder, by inhalation through the mouth or nose.
  • Another aspect of the invention is a dispersible VHH composition, in particular dry powder dispersible VHH compositions, such as those described in U.S. Pat. No. 6,514,496. These dry powder compositions comprise a plurality of discrete dry particles with an average particle size in the range of 0.4-10 mm. Such powders are capable of being readily dispersed in an inhalation device. VHH's are particularly suited for such composition as lyophilized material can be readily dissolved (in the lung subsequent to being inhaled) due to its high solubilisation capacity (Muyldermans, S., Reviews in Molecular Biotechnology, 74, 277-303, (2001)). Alternatively, such lyophilized VHH formulations can be reconstituted with a diluent to generate a stable reconstituted formulation suitable for subcutaneous administration. For example, anti-IgE antibody formulations (Example 1; U.S. Pat. No. 6,267,958, EP 841946) have been prepared which are usefull for treating allergic asthma.
  • Another embodiment of the present invention is a use of a polypeptide construct as disclosed herein for the preparation of a medicament for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound delivered to the nose, upper respiratory tract and/or lung without being inactivated.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the nose, upper respiratory tract and lung, by administering to the nose, upper respiratory tract and/or lung of a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the nose, upper respiratory tract and/or lung without being inactivated, by administering to the nose, upper respiratory tract and/or lung of a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the bloodstream of a subject without being inactivated by administering to the nose, upper respiratory tract and/or lung of a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • One embodiment of the present invention is a polypeptide construct as disclosed herein for use in treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound delivered to the intestinal mucosa, wherein said disorder increases the permeability of the intestinal mucosa. Because of their small size, a polypeptide construct as disclosed herein can pass through the intestinal mucosa and reach the bloodstream more efficiently in subjects suffering from disorders which cause an increase in the permeability of the intestinal mucosa, for example, Crohn's disease.
  • An aspect of the invention is a method for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound delivered to the intestinal mucosa, wherein said disorder increases the permeability of the intestinal mucosa, by orally administering to a subject a polypeptide construct as disclosed herein.
  • Another embodiment of the present invention is a use of a polypeptide construct as disclosed herein for the preparation of a medicament for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound delivered to the intestinal mucosa, wherein said disorder increases the permeability of the intestinal mucosa.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the intestinal mucosa without being inactivated, by administering orally to a subject a polypeptide construct of the invention.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the bloodstream of a subject without being inactivated, by administering orally to a subject a polypeptide construct of the invention.
  • This process can be even further enhanced by an additional aspect of the present invention—the use of active transport carriers. In this aspect of the invention, a polypeptide construct as described herein is fused to a carrier that enhances the transfer through the intestinal wall into the bloodstream. In a non-limiting example, this “carrier” is a VHH which is fused to said polypeptide. Such fusion constructs made using methods known in the art. The “carrier” VHH binds specifically to a receptor on the intestinal wall which induces an active transfer through the wall.
  • One embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody directed against a target for use in treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound that is able pass through the tissues beneath the tongue effectively. A formulation of said polypeptide construct as disclosed herein, for example, a tablet, spray, drop is placed under the tongue and adsorbed through the mucus membranes into the capillary network under the tongue.
  • An aspect of the invention is a method for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by a therapeutic compound that is able pass through the tissues beneath the tongue effectively, by sublingually administering to a subject a VHH specific for an antigen related to the disorder.
  • Another embodiment of the present invention is a use of a polypeptide construct as disclosed herein for the preparation of a medicament for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound that is able to pass through the tissues beneath the tongue.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the tissues beneath the tongue without being inactivated, by administering orally to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the bloodstream of a subject without being inactivated, by administering orally to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • One embodiment of the present invention is a polypeptide construct comprising at least one single domain antibody for use in treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound that is able pass through the skin effectively. A formulation of said polypeptide construct, for example, a cream, film, spray, drop, patch, is placed on the skin and passes through.
  • An aspect of the invention is a method for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by a therapeutic compound that is able pass through the skin effectively, by topically administering to a subject a polypeptide construct as disclosed herein comprising one or more single domain antibodies specific for an antigen related to the disorder.
  • Another aspect of the invention is the use of a polypeptide construct as disclosed herein as a topical ophthalmic composition for the treatment of ocular disorder, such as allergic disorders, which method comprises the topical administration of an ophthalmic composition comprising polypeptide construct as disclosed herein, said construct comprising one or more anti-IgE VHH (Example 1, Example 2).
  • Another embodiment of the present invention is a use of a polypeptide construct as disclosed herein for the preparation of a medicament for treating, preventing and/or alleviating the symptoms of disorders susceptible to modulation by an anti-target therapeutic compound that is able pass through the skin effectively.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the skin without being inactivated, by administering topically to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • An aspect of the invention is a method for delivering an anti-target therapeutic compound to the bloodstream of a subject, by administering topically to a subject a polypeptide construct comprising one or more single domain antibodies directed against said target.
  • Another aspect of the present invention is a method to determine which single domain antibodies (e.g. VHHs) molecules cross a natural barrier into the bloodstream upon administration using, for example, oral, nasal, lung, skin. In a non-limiting example, the method comprises administering a naïve, synthetic or immune single domain antibody phage library to a small animal such as a mouse. At different time points after administration, blood is retrieved to rescue phages that have been actively transferred to the bloodstream. Additionally, after administration, organs can be isolated and bound phages can be stripped off. A non-limiting example of a receptor for active transport from the lung lumen to the bloodstream is the Fc receptor N (FcRn). The method of the invention thus identifies single domain antibodies which are not only actively transported to the blood, but are also able to target specific organs. The method may identify which VHH are transported across the gut and into the blood; across the tongue (or beneath) and into the blood; across the skin and into the blood etc.
  • One aspect of the invention are the single domain antibodies obtained by using said method. According to the invention, said single domain antibody may be used as a single domain antibody in a polypeptide construct of the invention. Said construct, further comprising another single domain antibody, a therapeutic agent, or polypeptide carrier directed against a target accessible via or in the blood may be administered by the route most efficient for said single domain antibody.
  • In general, “therapeutically effective amount”, “therapeutically effective dose” and “effective amount” means the amount needed to achieve the desired result or results (such as for instance modulating IFN-gamma binding; treating or preventing inflammation). One of ordinary skills in the art will recognize that the potency and, therefore, an “effective amount” can vary for the various compounds that modulate ligand-target binding, such as for instance IFN-gamma binding used in the invention. One skilled in the art can readily assess the potency of the compound.
  • As used herein, the term “compound” refers to a polypeptide construct of the present invention, or a nucleic acid capable of encoding said polypeptide construct.
  • By “pharmaceutically acceptable” is meant a material that is not biologically or otherwise undesirable, i.e., the material may be administered to an individual along with the compound without causing any undesirable biological effects or interacting in a deleterious manner with any of the other components of the pharmaceutical composition in which it is contained.
  • The polypeptide constructs of the present invention are useful for treating or preventing conditions in a subject and comprises administering a pharmaceutically effective amount of a compound or composition.
  • The polypeptide constructs as disclosed here in are useful for treating or preventing conditions in a subject and comprises administering a pharmaceutically effective amount of a compound combination with another, such as, for example, doxorubicin.
  • The present invention is not limited to the administration of formulations comprising a single compound of the invention. It is within the scope of the invention to provide combination treatments wherein a formulation is administered to a patient in need thereof that comprises more than one compound of the invention.
  • A compound useful in the present invention can be formulated as pharmaceutical compositions and administered to a mammalian host, such as a human patient or a domestic animal in a variety of forms adapted to the chosen route of administration, i.e., parenterally, intravenously, intramuscularly, subcutaneously, to the vaginal and/or rectal tract, nasally, by inhalation though the mouth or nose, to the tissues beneath the tongue, or topically.
  • A compound of the present invention can also be administered using gene therapy methods of delivery. See, e.g., U.S. Pat. No. 5,399,346, which is incorporated by reference in its entirety. Using a gene therapy method of delivery, primary cells transfected with the gene for the compound of the present invention can additionally be transfected with tissue specific promoters to target specific organs, tissue, grafts, tumors, or cells.
  • Thus, the present compound may be administered in combination with a pharmaceutically acceptable vehicle such as an inert diluent or an assimilable edible carrier. They may be enclosed in hard or soft shell gelatin capsules, may be compressed into tablets, or may be incorporated directly with the food of the patient's diet. For oral therapeutic administration, the active compound may be combined with one or more excipients and used in the form of ingestible tablets, buccal tablets, troches, capsules, elixirs, suspensions, syrups, wafers, and the like. Such compositions and preparations should contain at least 0.1% of active compound. The percentage of the compositions and preparations may, of course, be varied and may conveniently be between about 2 to about 60% of the weight of a given unit dosage form. The amount of active compound in such therapeutically useful compositions is such that an effective dosage level will be obtained.
  • The tablets, troches, pills, capsules, and the like may also contain the following: binders such as gum tragacanth, acacia, corn starch or gelatin; excipients such as dicalcium phosphate; a disintegrating agent such as corn starch, potato starch, alginic acid and the like; a lubricant such as magnesium stearate; and a sweetening agent such as sucrose, fructose, lactose or aspartame or a flavoring agent such as peppermint, oil of wintergreen, or cherry flavoring may be added. When the unit dosage form is a capsule, it may contain, in addition to materials of the above type, a liquid carrier, such as a vegetable oil or a polyethylene glycol. Various other materials may be present as coatings or to otherwise modify the physical form of the solid unit dosage form. For instance, tablets, pills, or capsules may be coated with gelatin, wax, shellac or sugar and the like. A syrup or elixir may contain the active compound, sucrose or fructose as a sweetening agent, methyl and propylparabens as preservatives, a dye and flavoring such as cherry or orange flavor. Of course, any material used in preparing any unit dosage form should be pharmaceutically acceptable and substantially non-toxic in the amounts employed. In addition, the active compound may be incorporated into sustained-release preparations and devices.
  • The active compound may also be administered intravenously or intraperitoneally by infusion or injection. Solutions of the active compound or its salts can be prepared in water, optionally mixed with a nontoxic surfactant. Dispersions can also be prepared in glycerol, liquid polyethylene glycols, triacetin, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.
  • The pharmaceutical dosage forms suitable for injection or infusion can include sterile aqueous solutions or dispersions or sterile powders comprising the active ingredient which are adapted for the extemporaneous preparation of sterile injectable or infusible solutions or dispersions, optionally encapsulated in liposomes. In all cases, the ultimate dosage form must be sterile, fluid and stable under the conditions of manufacture and storage. The liquid carrier or vehicle can be a solvent or liquid dispersion medium comprising, for example, water, ethanol, a polyol (for example, glycerol, propylene glycol, liquid polyethylene glycols, and the like), vegetable oils, nontoxic glyceryl esters, and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the formation of liposomes, by the maintenance of the required particle size in the case of dispersions or by the use of surfactants. The prevention of the action of microorganisms can be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars, buffers or sodium chloride. Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminum monostearate and gelatin.
  • Sterile injectable solutions are prepared by incorporating the active compound in the required amount in the appropriate solvent with various of the other ingredients enumerated above, as required, followed by filter sterilization. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and the freeze drying techniques, which yield a powder of the active ingredient plus any additional desired ingredient present in the previously sterile-filtered solutions.
  • For topical administration, the present compound may be applied in pure form, i.e., when they are liquids. However, it will generally be desirable to administer them to the skin as compositions or formulations, in combination with a dermatologically acceptable carrier, which may be a solid or a liquid.
  • Useful solid carriers include finely divided solids such as talc, clay, microcrystalline cellulose, silica, alumina and the like. Useful liquid carriers include water, hydroxyalkyls or glycols or water-alcohol/glycol blends, in which the present compound can be dissolved or dispersed at effective levels, optionally with the aid of non-toxic surfactants. Adjuvants such as fragrances and additional antimicrobial agents can be added to optimize the properties for a given use. The resultant liquid compositions can be applied from absorbent pads, used to impregnate bandages and other dressings, or sprayed onto the affected area using pump-type or aerosol sprayers.
  • Thickeners such as synthetic polymers, fatty acids, fatty acid salts and esters, fatty alcohols, modified celluloses or modified mineral materials can also be employed with liquid carriers to form spreadable pastes, gels, ointments, soaps, and the like, for application directly to the skin of the user.
  • Examples of useful dermatological compositions which can be used to deliver the compound to the skin are known to the art; for example, see Jacquet et al. (U.S. Pat. No. 4,608,392), Geria (U.S. Pat. No. 4,992,478), Smith et al. (U.S. Pat. No. 4,559,157) and Wortzman (U.S. Pat. No. 4,820,508).
  • Useful dosages of the compound can be determined by comparing their in vitro activity, and in vivo activity in animal models. Methods for the extrapolation of effective dosages in mice, and other animals, to humans are known to the art; for example, see U.S. Pat. No. 4,938,949.
  • Generally, the concentration of the compound(s) in a liquid composition, such as a lotion, will be from about 0.1-25 wt-%, preferably from about 0.5-10 wt-%. The concentration in a semi-solid or solid composition such as a gel or a powder will be about 0.1-5 wt-%, preferably about 0.5-2.5 wt-%.
  • The amount of the compound, or an active salt or derivative thereof, required for use in treatment will vary not only with the particular salt selected but also with the route of administration, the nature of the condition being treated and the age and condition of the patient and will be ultimately at the discretion of the attendant physician or clinician. Also the dosage of the compound varies depending on the target cell, tumor, tissue, graft, or organ.
  • The desired dose may conveniently be presented in a single dose or as divided doses administered at appropriate intervals, for example, as two, three, four or more sub-doses per day. The sub-dose itself may be further divided, e.g., into a number of discrete loosely spaced administrations; such as multiple inhalations from an insufflator or by application of a plurality of drops into the eye.
  • An administration regimen could include long-term, daily treatment. By “long-term” is meant at least two weeks and preferably, several weeks, months, or years of duration. Necessary modifications in this dosage range may be determined by one of ordinary skill in the art using only routine experimentation given the teachings herein. See Remington's Pharmaceutical Sciences (Martin, E. W., ed. 4), Mack Publishing Co., Easton, Pa. The dosage can also be adjusted by the individual physician in the event of any complication.
  • BRIEF DESCRIPTION OF FIGURES
  • FIG. 1: Schematic illustrating the regions of IgE
  • FIG. 2: ELISA of reference and pepsin-treated TNF3E at pH2.2, pH3.2 and pH4.2 (100% is the signal measured at a 1/100 dilution)
  • FIG. 3: Experimental setting
  • FIG. 4: Capacity of VHH clones to inhibit the proteolytic activity of human catalytic domain of MMP12
  • FIG. 5: ELISA to detect A431 specific antibody titers in llama serum.
  • FIG. 6: Detection of EGFR specific antibody titers in llama serum.
  • FIG. 7: Detection of EGFR specific antibody titers in serum of llama 024 and 025 and of llama 026 and 027.
  • FIG. 8: Phage response to EGFR
  • FIG. 9: Amino acid alignment of 31 clones identified by the epitope specific elution selection procedure
  • FIG. 10: Phage ELISA on cells (panel A) or on solid-phase immobilized EGFR (panel B) of the 20 unique EGFR specific clones identified via the epitope specific elution selection procedure
  • FIG. 11: Effect of nanobody EGFR-IIIa42 on receptor internalization and signalling. Fluorescence microscopy visualization of EGFR-IIIa42 under conditions that allow internalization, with Her-14 (panel A) or 3T3 (panel B). A Western blot that shows the effect of EGFR-IIIa42 on receptor tyrosin kinase activity is represented in panel C.
  • FIG. 12: Schematic illustrating a use of VHHs directed towards internalising receptors to deliver therapeutic protein, toxic compound, drug or polynucleotide.
  • BRIEF DESCRIPTION OF TABLES
  • Table 1: Immunization scheme as described in Example 1
  • Table 2: Presence of insert by PCR with vector specific primers as described in Example 1
  • Table 3: First selection as described in Example 1
  • Table 4: Second selection using the rescued phages from the first selection as described in Example 1
  • Table 5: Second round selection using neutravidine coated tubes as described in Example 1
  • Table 6: Number of clones that score positive for binding to both human IgE and chimeric IgE versus the number of clones tested in ELISA as described in Example 1
  • Table 7: Treatment schedule
  • Table 8: Overview of the libraries, their diversity and % insert derived from different llama's and tissues as described in Example 7 and 8
  • Table 9: Immunization schedule and tissue collections
  • Table 10: Overview of constructed libraries
  • Table 11: Overview of epitope specific elution selection procedure
  • Table 12: Overview of ‘internalization’ selection procedure
  • Table 13: Primer sequences
  • Table 14: Sequence listing
  • EXAMPLES
  • Legend of Examples:
  • IgE
  • Example 1: VHH directed against IgE
  • Example 2: Formulation of VHH anti-IgE
  • Example 3: Anti-IgE formulation
  • TNF-alpha
  • Example 4: Selection of anti-TNF-alpha
  • Example 5: Stability testing of antibody fragments specific for human TNFα
  • Example 6: Oral administration of an anti-human TNFα specific VHH in mice
  • Example 7: Efficacy in an animal model for IBD
  • MMP12
  • Example 8: Immunization
  • Example 9: Repertoire cloning
  • Example 10: Rescue of the library and phage preparation
  • Example 11: Selection of human MMP-12 specific VHH
  • Example 12: Specificity of selected VHH's
  • Example 13: Diversity of selected VHH's
  • Example 14: Expression and purification of VHH
  • Example 15: Functional characterization of selected VHH's: inhibition of MMP-12 proteolytic activity by a VHH in a calorimetric assay.
  • Example 16: Formulation of anti-MMP12 VHH for pulmonary delivery
  • Interferon Gamma
  • Example 17: Immunization
  • Example 18: Repertoire cloning
  • Example 19: Rescue of the library and phage preperation
  • Example 20: Selection of human-IFN gamma VHH
  • Example 21: Diversity of selected VHH's
  • Example 22: Expression and purification of VHH
  • Example 23: Topical applications of anti-IFN gamma VHH's
  • Therapeutic VHH-Fragments
  • Example 24: Expression of VHH-CDR3 of anti-TNF alpha VHH#3E
  • EGFR
  • Example 25: Immunization
  • Example 26: Evaluation of Immune response
  • Example 27: Cloning of the heavy-chain antibody fragment (VHH) repertoire
  • Example 28: Evaluation of the cloned repertoire
  • Example 29: Multiple selection strategies to identify EGFR specific nanobodies
  • Example 30: Characterization of EGFR specific nanobodies
  • Example 31: EGF receptor mediated internalization of nanobodies
  • PDK1
  • Example 32: Immunisation of llamas
  • Example 33: Repertoire cloning
  • Example 34: Rescue of the library, phage preparation
  • Example 35: Selection
  • Example 36: Screening
  • Example 37: Screen for internalised VHH
  • Example 38: Screen for VHH inhibiting PDK1-Akt interaction
  • Example 39: Making a bispecific construct
  • Example 40: Endocytosis and lysis of tumor cells
  • Example 41: Calculation of homologies between anti-target-single domain antibodies of the invention
  • Example 42: Construction of a bispecific constructs containing a VHH-CDR3 fragment fused to an anti-serum albumin VHH
  • EXAMPLES
  • IgE
  • Example 1 VHH Directed Against IgE
  • Two llama's were immunized with human IgE, Scripps laboratories, Cat nr. 10224. The following immunization schemes were used according to Table 1.
  • Different sources for RNA extraction were used:
      • 150 ml immune blood, between 4 and 10 days after the last antigen injection
      • lymph node biopsy 4 days after the last antigen injection
  • Peripheral blood lymphocytes (PBLs) were isolated by centrifugation on a density gradient (Ficoll-Paque Plus Amersham Biosciences). PBLs and lymph node were used to extract total RNA (Chomczynski and Sacchi 1987). cDNA was prepared on 200 μg total RNA with MMLV Reverse Transcriptase (Gibco BRL) using oligo d(T) oligonucleotides (de Haard et al., 1999). The cDNA was purified with a phenol/chloroform extraction, followed by an ethanol precipitation and subsequently used as template to amplify the VHH repertoire.
  • In a first PCR, the repertoire of both conventional (1.6 kb) and heavy-chain (1.3 kb) antibody gene segments were amplified using a leader specific primer (5′-GGCTGAGCTCGGTGGTCCTGGCT-3′) and the oligo d(T) primer (5′-MCTGGAAGMTTCGCGGCCGCAGGAATTTTTTTTTTTTTTTTTT-3′). The resulting DNA fragments were separated by agarose gel electrophoresis and the 1.3 kb fragment encoding heavy-chain antibody segments was purified from the agarose gel. A second PCR was performed using a mixture of FR1 reverse primers (WO03/054016 sequences ABL037 to ABL043) and the same oligo d(T) forward primer.
  • The PCR products were digested with SfiI (introduced in the FR1 primer) and BstEII (naturally occurring in framework 4). Following gel electrophoresis, the DNA fragments of approximately 400 basepairs were purified from gel and ligated into the corresponding restriction sites of phagemid pAX004 to obtain a library of cloned VHHs after electroporation of Escherichia coli TG1. pAX004 allows the production of phage particles, expressing the individual VHHs as a fusion protein with a c-myc tag, a hexahistidine tag and the geneIII product. The percentage insert was determined in PCR using a combination of vector based primers.
  • Results are summarized in Table 2.
  • Selections were done using chimaeric IgE instead of human IgE, used for immunization, in order to select for VHH molecules directed against the constant region of IgE. The region interacting with the Fcε-receptor is located in the constant part of IgE, more in particular in the region covered by Cε2-Cε3 as shown in FIG. 1.
  • A first selection was performed using the pool of PBL day4, PBL day10 and lymph node day4 libraries for each of the two llama's. Chimaeric IgE was solid phase coated at 5 μg/ml and 0.5 μg/ml and specific phages were eluted using 0.1 M glycine pH=2.5.
  • The results obtained are shown in Table 3.
  • A second selection was performed using the rescued phages from the first selection using 5 μg/ml. Chimaeric IgE was solid phase coated at 1 μg/ml and specific phages were eluted using buffy coat cells or lysozyme for 1 hr. Buffy coat cells contain cells expressing the Fcεreceptor, while lysozyme is an irrelevant protein and serves as a control. The results obtained are shown in Table 4.
  • Another second round selection was performed using neutravidine coated tubes and 2 nM biotinylated IgE. Specific phages were eluted using buffy coat cells or lysozyme for 1 hr. Buffy coat cells contain cells expressing the Fcεreceptor, while lysozyme is an irrelevant protein and serves as a control. The results obtained are shown in Table 5.
  • Individual clones obtained from the first round of selection were screened in an ELISA using solid phase coated human IgE or chimaeric IgE. The number of clones that score positive for binding to both human IgE and chimeric IgE versus the number of clones tested in ELISA are summarized in Table 6.
  • Clones were picked which were positive for human and chimaeric IgE binding, amplified by PCR and digested with HinfI. HinfI profiles were determined on agarose gel and representative clones for different profiles were sequenced. The sequences obtained are shown in Table 14 SEQ ID NOs: 1 to 11.
  • Example 2 Topical Applications of Anti-IgE VHH's
  • To obtain anti-allergic pharmaceutical compositions for ophthalmic topical applications, a solution of anti-IgE VHH was prepared as follows:
      • eye drops containing a therapeutic dose of anti-IgE VHH dissolved in 100 ml of sterilized water containing 0.9 g sodium chloride, 0.02 g sodium citrate, 0.02 g methyl parahydroxybenzoate, 0.1 g chlorobutanol and acetic acid suitabe to obtain a pH of 6.5.
      • eye ointment containing a therapeutic dose of anti-IgE VHH was prepared according to the conventional method containing 1.0 g of liquid paraffin and a suitable amount of soft paraffin to obtain a total mixture of 100 g.
    Example 3 Anti-IgE Formulation
  • Anti-IgE VHH's that block binding of IgE to its high-affinity receptor are of potential therapeutic value in the treatment of allergy.
  • Highly purified VHH#2H11 was dialysed into formulation buffer, followed by addition of lyoprotectant at an isotonic concentration. Isotonic formulation was performed as follows: VHH#2H11 at 25 mg/ml was formulated in 5 mM histidine buffer at pH 6 with 500 moles of sugar per mole antibody. This formulation is reconstututed with BWFI (0.9% benzyl alcohol) at a volume which results in a 100 mg/ml of antibody in 20 mM histidine at pH 6 with an isotonic sugar concentration of 340 nM. The binding activity of the anti-IgE VHH in the isotonic formulations was measured in an IgE receptor inhibition assay. It was found that binding activity was essentially unchanged following storage at 4° C. for up to 3 months.
  • TNF-alpha
  • Example 4 Selection of Anti-TNF-alpha
  • Two llamas were immunized with 100 μg human TNF-alpha per injection according to the schedule described in Example 1. The libraries (short and long immunization procedure) were constructed and selected with in vitro biotinylated TNF-alpha. The biotinylation was carried out as described by Magni et al (Anal Biochem 2001, 298, 181-188).
  • The incorporation of biotin in TNF was evaluated by SDS-PAGE analysis and detection with Extravidin-alkaline phosphatase conjugate (Sigma).
  • The functionality of the modified protein was evaluated for its ability to bind to the solid phase coated recombinant a p75 receptor. {biotinylation} In the first round of selection 400 ng and 50 ng of biotinylated TNF-alpha was captured on neutravidin (Pierce; 10 μg/ml in PBS) coated on the wells of a microtiter plate (NUNC maxisorb). Phage (1.2×1010 TU-s) were added to the wells and incubated for two hours at room temperature. After washing (20 times with PBS-tween and two times with PBS) bound phage was eluted by adding an excess of receptor (extracellular domain of CD120b or p75; 10 μM) or with cells expressing the intact TNF receptor. Between 30,000 and 100,000 phage clones were eluted with TNF from the library derived from the llama immunized using the rapid scheme, while about 10% of these numbers were obtained when eluted with BSA (3 μM; negative control).
  • From the other library (long immunization scheme) 10-fold high numbers were eluted with receptor and BSA, yielding the same enrichment factor (10) as observed before. New phage was prepared from the elution of 50 ng TNF (rapid immunization scheme) and 400 ng TNF (slow scheme) and used for another round of selection on 400, 50 and 10 ng of captured TNF (input: 1.2×1010 phage per well). Approx. 2.5×107 phage were eluted with receptor (10 μM) from the well containing 400 ng and 50 ng of captured TNF and about 2×106 from the well with 10 ng of TNF, while the negative control (elution with 10 μM of BSA) gave only 5 to 10% of those numbers. The observed numbers of eluted phage suggest that the elution with receptor is specific and that those VHH fragments should be eluted that bind to the receptor binding site of TNF.
  • Individual clones were picked and grown in microtiter plate for the production of VHH in culture supernatants. ELISA screening with TNF captured on Extravidin coated plates revealed about 50% positive clones. HinFI-fingerprint analysis showed that 14 different clones were selected, which were grown and induced on 50 ml scale.
  • Periplasmic fractions were prepared, the VHH fragments purified with IMAC and used in an assay to analyze their antagonistic characteristics, i.e. preventing the interaction of TNF with its receptor. For this purpose the VHH (1 μM and 0.3 μM) was incubated with TNF-alpha (3 and 0.7 nM) for 1.5 hours at room temperature (in 0.2% casein/PBS). 100 μl of this mixture was transferred to a well of a microtiter plate, in which the extracellular domain of the receptor was immobilized. After an incubation of one hour the plate was washed and bound TNF was detected with alkaline phosphatase conjugated streptavidin. Two VHH fragments gave antagonistic profiles similar as obtained with 3 and 0.3 μM intact mAB Remicade (Infliximab; Centercor) in spite of the fact that the VHH is truly monomeric, whereas the dimeric appearance of the mAB probably favors the binding of the trimeric TNF-molecule. Similar experiments showing the efficacy of the VHH were performed using the murine sarcoma cell line WEHI and a human cell line expressing the TNF receptor. The sequences obtained are shown in Table 14 SEQ ID NOs: 12 to 13.
  • Example 5 Stability Testing of Antibody Fragments Specific for Human TNFα
  • Orally administered proteins are subject to denaturation at the acidic pH of the stomach and as well to degradation by pepsin. We have selected conditions to study the resistance of the VHH TNF3E to pepsin which are supposed to mimick the gastric environment. TNF3E a VHH specific to human TNFα was produced as recombinant protein in E. coli and purified to homogeneity by IMAC and gelfiltration chromatography. The protein concentration after purification was determined spectrophotometrically by using the calculated molar exctinction coefficient at 280 nm. Diluted solutions at 100 microgram/ml were prepared in McIlvaine buffer (J. Biol. Chem. 49, 1921, 183) at pH 2, pH3 and 4 respectively. These solutions were subsequently incubated for 15 minutes at 37° C., prior the addition of porcine gastric mucosa pepsin at a 1/30 w/w ratio. Sixty minutes after adding the protease a sample was collected and immediately diluted 100-fold in PBS pH7.4 containing 0.1% casein to inactivate the pepsin. Seven additional 3-fold dilutions were prepared from this sample for assessing the presence of functional antibody fragment by ELISA. Identical dilutions prepared from an aliquot collected prior the addition of the protease served as a reference. In the ELISA assay biotinylated TNFα was captured in wells of a microtiter plate coated with neutravidin. For both the pepsin-treated and reference samples similar serial dilutions of the samples were prepared and 100 microliter of those dilutions were added to the wells. After incubation for 1 hour the plates were washed. For the detection of VHH binding to of the captured TNFα a polyclonal rabbit anti-VHH antiserum (R42) and an anti-rabbit IgG alkaline phosphatase conjugate was used. After washing, the plates were developed with para nitrophenyl phosphate. The data plotted in FIG. 2 shows similar curves for all of the samples exposed to digestive conditions as well as for the reference samples. This indicates that the VHH 3E essentially retains its functional activity under all of the chosen conditions.
  • Example 6 Oral Administration of an Anti-Human TNFα Specific VHH in Mice
  • An antibody solution containing the anti-human TNFα specific VHH#TNF3E (100 microgram per milliliter in 100-fold diluted PBS) was prepared. Three mice which were first deprived from drinking water for 12 hours and subsequently allowed to freely access the antibody solution during the next two hours. Afterwards the mice were sacrificed and their stomachs were dissected. Immediately the content of the stomachs was collected by flushing the stomach with 500 microliter PBS containing 1% BSA. This flushed material was subsequently used to prepare serial three-fold dilutions, starting at a 1/5 dilution from the undiluted material. One hundred microliter of these samples was transferred to individual wells of a microtiter plater coated with human TNFα. After incubation for 1 hour and following extensive washing the presence of immuno-reactive material was assessed with a polyclonal rabbit anti-VHH antiserum (R42) followed by incubation with an anti-rabbit alkaline-phosphatase conjugate. The ELISA was developed with paranitrophenyl phosphate. The ELISA signals obtained after 10 minutes clearly demonstrated the presence of functional VHH TNF3E in the gastric flushings of these mice. By comparing to the standard curve we determined the concentration of the functional antibody fragment in the gastric flushing fluid to be 1.5, 12.6 and 8.6 microgram/ml for the three mice tested.
  • Example 7 Efficacy in an Animal Model for IBD
  • 1) Animal Model of Chronic Collitis
  • The efficacy of bivalent VHH constructs applied via various routes of administration was assessed in a DSS (dextran sodium sulfate) induced model of chronic colitis in BALB/c mice. This model was originally described by Okayasu et al. [Okayasu et al. Gastroenterology 1990; 98: 694-702] and modified by Kojouharoff et. al. [G. Kojouharoff et al. Clin. Exp. Immunol. 1997; 107: 353-8]. The animals were obtained from Charles River Laboratories, Germany, at an age of 11 weeks and kept in the animal facility until they reached a body weight between 21 and 22 g. Chronic colitis was induced in the animals by four DSS treatment cycles. Each cycle consisted of a DSS treatment interval (7 days) where DSS was provided with the drinking water at a concentration of 5% (w/v) and a recovery interval (12 days) with no DSS present in the drinking water. The last recovery period was prolonged from 12 to 21 days to provide for an inflammation status rather representing a chronic than an acute inflammation at the time of the treatment. Subsequent to the last recovery interval the mice were randomly assigned to groups of 8 mice and treatment with the VHH-constructs was started. The treatment interval was 2 weeks. One week after the end of the treatment interval the animals were sacrificed, the intestine was dissected and histologically examined. The experimental setting is shown schematically in FIG. 3.
  • 2) VHH Treatment Schedule
  • During the VHH treatment period the mice (8 animals per group) were treated daily for 14 consecutive days with bivalent VHH#3F (VHH#3F-VHH#3F; SEQ ID No. 14) by intra-gastric or intra-venous application of 100 μg bivalent VHH 3F. An additional group of animals was treated rectally with the bivalent VHH#3F every other day for a period of 14 days. In all treatment groups a dose of 100 μg of the bivalent VHH#3F was applied at a concentration of 1 mg/ml in a buffered solution. The negative control groups received 100 μl of PBS under otherwise identical conditions. The treatment schedule is shown in Table 7.
  • 3) Results
  • After the mice were sacrificed the body weight was determined and the colon was dissected. The length of the dissected colon was determined and the histology of the colon was assessed by Haematoxilin-Eosin (HE) stain (standard conditions). As compared to the negative controls (PBS treatment) the groups treated with bivalent nanobody 3F showed a prorogued colon length as well as an improved histological score [G. Kojouharoff et al. Clin. Exp. Immunol. 1997; 107: 353-8] thereby demonstrating efficacy of the treatment.
  • MMP12
  • Example 8 Immunization
  • One llama's (llama 5) was immunized intramuscularly with recombinant human catalytic domain of MMP12 using an appropriate animal-friendly adjuvant Stimune (Cedi Diagnostics BV, The Netherlands). The recombinant catalytic domain was acquired from Prof. H. Tschesche Universität Bielefeld and was supplied as a 56 μg/ml solution in 5 mM Tris/HCl pH=7.5, 100 mM NaCl, 5 mM CaCl2 (Lang, R. et al. (2001). The llama received 6 injections at weekly intervals, the first two injections containing each 10 μg of MMP-12, the last four injections containing each 5 μg of MMP-12. Four days after the last immunization a lymph node biopsy (LN) and a blood sample (PBL1) of 150 ml was collected from the animal and serum was prepared. Ten days after the last immunization a second blood sample (PBL2) of 150 ml was taken and serum was prepared. Peripheral blood lymphocytes (PBLs), as the genetic source of the llama heavy chain immunoglobulins (HcAbs), were isolated from the blood sample using a Ficoll-Paque gradient (Amersham Biosciences) yielding 5×108 PBLs. The maximal diversity of antibodies is expected to be equal to the number of sampled B-lymphocytes, which is about 10% of the number of PBLs (5×107). The fraction of heavy-chain antibodies in llama is up to 20% of the number of B-lymphocytes. Therefore, the maximal diversity of HcAbs in the 150 ml blood sample is calculated as 107 different molecules. Total RNA was isolated from PBLs and lymph nodes according to the method of Chomczynski and Sacchi (1987).
  • Example 9 Repertoire Cloning
  • cDNA was prepared on 200 μg total RNA with MMLV Reverse Transcriptase (Gibco BRL) using oligo d(T) oligonucleotides (de Haard et al., 1999). The cDNA was purified with a phenol/chloroform extraction, followed by an ethanol precipitation and subsequently used as template to amplify the VHH repertoire.
  • In a first PCR, the repertoire of both conventional (1.6 kb) and heavy-chain (1.3 kb) antibody gene segments were amplified using a leader specific primer (5′-GGCTGAGCTCGGTGGTCCTGGCT-3′) and the oligo d(T) primer (5′-AACTGGAGAATTCGCGGCCGCAGGAATTTTTTTTTTTTTTTTTTT-3′). The resulting DNA fragments were separated by agarose gel electrophoresis and the 1.3 kb fragment encoding heavy-chain antibody segments was purified from the agarose gel. A second PCR was performed using a mixture of FR1 reverse primers (WO03/054016 sequences ABL037 to ABL043) and the same oligo d(T) forward primer.
  • The PCR products were digested with SfiI (introduced in the FR1 primer) and BstEII (naturally occurring in framework 4). Following gel electrophoresis, the DNA fragments of approximately 400 basepairs were purified from gel and ligated into the corresponding restriction sites of phagemid pAX004 to obtain a library of cloned VHHs after electroporation of Escherichia coli TG1. pAX004 allows the production of phage particles, expressing the individual VHHs as a fusion protein with a c-myc tag, a hexahistidine tag and the geneIII product. The diversity obtained after electroporation of TG1 cells is presented in Table 8. The percentage insert was determined in PCR using a combination of vector based primers.
  • Example 10 Rescue of the Library and Phage Preparation
  • The library was grown at 37° C. in 10 ml 2×TY medium containing 2% glucose, and 100 μg/ml ampicillin, until the OD600nm reached 0.5. M13KO7 phages (1012) were added and the mixture was incubated at 37° C. for 2×30 minutes, first without shaking, then with shaking at 100 rpm. Cells were centrifuged for 5 minutes at 4,500 rpm at room temperature. The bacterial pellet was resuspended in 50 ml of 2×TY medium containing 100 μg/ml ampicillin and 25 μg/ml kanamycin, and incubated overnight at 37° C. with vigorously shaking at 250 rpm. The overnight cultures were centrifuged for 15 minutes at 4,500 rpm at 4° C. Phages were PEG precipitated (20% poly-ethylene-glycol and 1.5 M NaCl) for 30 minutes on ice and centrifuged for 20 minutes at 4,500 rpm. The pellet was resuspended in 1 ml PBS. Phages were again PEG precipitated for 10 minutes on ice and centrifuged for 10 minutes at 14,000 rpm and 4° C. The pellet was dissolved in 1 ml 0.5% skimmed milk or PBS-BSA [1 mg/ml] (Sigma, Cat Nr A3059).
  • Example 11 Selection of Human MMP-12 Specific VHH
  • Phages were rescued and prepared as described above in Example 10.
  • Two approaches were followed to obtain MMP-12 specific binders:
  • a. Inactive MMP-12 Coated on PVDF Membrane
      • 100 ng human MMP-12 catalytic domain (diluted in 33 μl PBS) was spotted on small pieces (1 cm2) of PVDF (Immobilon-P, Millipore, Cat Nr IPVH 15150) following the manufacturers guidelines, resulting in an inactive MMP due to the MeOH fixation. As controls an equal amount of lysozyme (Sigma, Cat Nr L-6876) and 33 μl PBS were also spotted and immobilized. The membrane pieces were blocked overnight in 5% skimmed milk at 4° C. and were washed 3 times with PBS before the phage preparation was applied (4×109 phages in 1 ml [5% skimmed milk]). Phages and membrane pieces (in 1,5 ml tubes) were incubated for 3 hrs at room temperature with rotation. Then the membranes were transferred to 15 ml tubes and were washed 6 times with 10 ml [PBS+0.05% Tween-20]. Phages were eluted by exposing the membranes to 500 μl TEA [70 μl in 5 ml H2O] for 10 min while rotating. The solution containing the eluted phages was removed and the pH was neutralized with 1 M Tris pH=7.5.
      • Log phase growing TG1 cells were infected with the eluted phages and serial dilutions were plated on selective medium. Enrichment was determined by the number of transfected TG1 colonies after selection obtained from the MMP-12 coated membrane as compared with the negative control where lysozyme was immobilized. Bacteria from MMP selections showing enrichment were scraped and used for a second round of selection.
      • The bacteria were superinfected with helperphage to produce recombinant phages to do a second selection against MMP-12 (as described in Example 9). MMP-12 was immobilized as above and the membrane was blocked overnight at 4° C. in 5% skim milk. Phages (2.5×109 in 1 ml) were prepared and exposed to the membranes and further selected for MMP binding as during the first round of selection. Log phase growing TG1 cells were infected with the eluted and pH neutralized phages and plated on selective medium. Enrichment was determined by the number of transfected TG1 colonies from the MMP-12 coated membrane as compared with the negative control (immobilized lysozyme).
  • b. Active MMP-12 Coated on Nitrocellulose Membrane
      • 250 ng human MMP-12 catalytic domain (Biomol Research laboratories Inc, SE 138-9090) was spotted directly on a piece of Hybond-C extra (Amersham Biosciences, Cat Nr RPN 303E) following the suppliers guidelines. As control an equal volume of PBS was spotted. A 5 mm diameter disk, containing the spotted area was cut out from each membrane and was transferred to a 1.5 ml tube and blocked overnight at 4° C. in 1 ml BSA-PBS [1 mg/ml]. The disks were washed three times in 15 ml PBS and subsequently transferred and exposed to the 200 ul phage preparation in a microtiterplate well. The phages were prepared as in Example 9 but were preincubated in BSA-PBS for 15 min at room temperature. The disks were washed 5 times with PBS/0.05% Tween-20 and were blocked with PBS-BSA for 2 hrs at room temperature. Phages were eluted by exposing the membranes to 100 μl TEA [70 μl in 5 ml H2O] for 10 min while rotating. The solution containing the eluted phages was removed and the pH was neutralized with 1M Tris pH=7.5.
      • Log phase growing TG1 cells were infected with the eluted phages and plated on selective medium. Enrichment was determined by the number of transfected TG1 colonies after selection on the MMP-12 membrane disk as compared with the negative control (PBS). Bacteria from selections with MMP-12 were scraped and used for a second round of selection.
      • The bacteria were superinfected with helperphage to produce recombinant phages to do a second selection against MMP-12 (as described in Example 9). MMP-12 was immobilized as above and the membrane was blocked overnight at 4° C. in PBS-BSA [1 mg/ml]. Phages (2.5×109 in 1 ml) were prepared and exposed to the membranes and further selected for MMP binding as during the first round of selection. Log phase growing TG1 cells were infected with the eluted and neutralized phages and plated on selective medium. Enrichment was determined by the number of transfected TG1 colonies from the MMP-12 coated membrane as compared with the negative control.
    Example 12 Specificity of Selected VHH's
  • Individual clones were picked, grown in 150 μl 2×TY containing 0.1% glucose and 100 μg/ml ampicillin in a microtiter plate at 37° C. until OD600nm=0.6. Then 1 mM IPTG and 5 mM MgSO4 was added and the culture was incubated 4 hours at 37° C. ELISA was performed on the periplasmic extracts (PE, preparation see Example 13) of the cells to examine specificity of the selected clones.
  • To examine the clones selected using solid phase coated human MMP-12, plates were coated with human MMP-12 catalytic domain at a concentration of 1 g/ml overnight at 4° C. Plates were washed 5 times with PBS/0.05% Tween-20. Wells were blocked with 1% skimmed milk for 2 hrs at room temperature. Periplasmic extracts (100 μl) were applied to the wells and incubated for 1 hour at room temperature. Plates were washed 5 times with PBS/0.05% Tween-20. Detection was performed using anti-c-myc antibody, followed by anti-mouse-HRP and ABTS/H2O2 as substrate. Plates were read at 405 nm after 30 minutes incubation at room temperature.
  • To examine the clones selected using membrane immobilized human MMP-12, 50 ng human MMP-12 catalytic domain samples were spotted on PVDF membrane as described in the manufacturers guidelines. 50 ng lysozyme was spotted as a negative control. The membranes were blocked with skimmed milk overnight at 4° C., washed 5 times with PBS and transferred to 1,5 ml tubes. Periplasmic extracts (100 μl) were tenfold diluted in 1% skimmed milk and 1 ml was applied per membrane (2 cm2) and rotated for 1 hour at room temperature. Membranes were washed 5 times with PBS/0.05% Tween-20. Detection was performed using anti-c-myc antibody, followed by anti-mouse-HRP and DAP as substrate. Membranes were incubated with substrate at room temperature until clear spots were visible. Seven clones which were found to be MMP-12 specific binders are shown in Table 14 SEQ ID NOs 15 to 21.
  • In order to check for non specific binding to other MMPs a similar approach was followed in which 50 ng of active catalytic domain of MMP 1, 2, 3, 7, 9 and 13 (all from Biomol Research laboratories Inc) was immobilized on Hybond C-extra. The membranes were blocked with skimmed milk overnight at 4° C., washed 5 times with PBS and transferred to 1,5 ml tubes. Periplasmic extracts (100 μl) were tenfold diluted in 1% skimmed milk and 1 ml was applied per membrane (2 cm2) and rotated for 1 hour at room temperature. Membranes were washed 5 times with PBS/0.05% Tween-20. Detection was performed using anti-c-myc antibody, followed by anti-mouse-HRP and DAP as substrate. Membranes were incubated with substrate at room temperature until clear spots were visible. No significant detection of the seven selected VHH clones was observed on any of the MMPs other than MMP-12.
  • Results on binders selected against PVDF membrane immobilized human MMP-12 catalytic domain are presented in Table 14 SEQ ID NOs 15 to 21.
  • Results on MMP-12 inhibitors selected via Hybond membrane immobilization are presented in Table 14 SEQ ID NO 22.
  • Example 13 Diversity of Selected VHH's
  • PCR was performed using M13 reverse and genIII forward primers. The clones were analyzed using Hinf1 fingerprinting and representative clones were sequenced. Sequence analysis was performed resulting in the sequences which are presented in Table 14 SEQ ID NOs 15 to 21 for Immobilon-P selections and in Table 14 SEQ ID NO 22 for Hybond-C.
  • Example 14 Expression and Purification of VHH
  • Clones were grown in 50 ml 2×TY containing 0.1% glucose and 100 μg/ml ampicillin in a shaking flask at 37° C. until OD600nm=2.1 mM IPTG and 5 mM MgSO4 was added and the culture was incubated for 3 more hours at 37° C. Cultures were centrifuged for 10 minutes at 4,500 rpm at 4° C. The pellet was frozen overnight at −20° C. Next, the pellet was thawed at room temperature for 40 minutes, re-suspended in 1 ml PBS/1 mM EDTA/1M NaCl and shaken on ice for 1 hour. Periplasmic fraction was isolated by centrifugation for 10 minutes at 4° C. at 4,500 rpm. The supernatant containing the VHH was loaded on Ni-NTA (Qiagen) and purified to homogeneity on an Äkta FPLC chromatography system (Amersham Biosciences). The VHH were eluted from the Ni-NTA using 25 mM citric acid pH=4,0 and directly applied on a cation exchange column equilibrated in 25 mM citric acid pH=4,0 (Source 30S in a HR5/5 column, Amersham Biosciences). The VHH were eluted with 1M NaCl in PBS and further purified on a size exclusion column (Superdex 75 HR10/30, Amersham Biosciences) equilibrated in MMP-12 assay buffer [50 mM HEPES, 100 mM NaCl, 0,05% Brij-35]. The yield of VHH was calculated according to the extinction coefficient and peak surface area.
  • Example 15 Functional Characterization of Selected VHH's: Inhibition of MMP-12 Proteolytic Activity by a VHH in a Colorimetric Assay
  • VHHs were expressed and purified as described in Example 13. Purified VHH was analyzed for the ability to inhibit human MMP-12 catalytic domain using the MMP-12 Colorimetric Assay Kit for Drug Discovery (AK-402) from BIOMOL Research Laboratories. The experimental method conditions described in the Kit were followed.
  • The inhibitor supplied with the Kit (PI115-9090) was used as positive control at the recommended concentration. VHH were applied at a concentration of 7 μM. The assay was performed in the microtiterplate supplied with the BIOMOL Kit and MMP-12 proteolytic activity was followed in a plate reader (405 nm) at 37° C.
  • The results of one inhibitory VHH and an inactive VHH are presented in FIG. 4 together with a positive control.
  • Only one VHH molecule (clone P5-29) from selections using active MMP-12 coated on nitrocellulose (Example 12) showed inhibition of human MMP-12 catalytic domain. All other MMP-12 binders (only clone P5-5 is shown), although they bind MMP-12, did not inhibit MMP-12.
  • Example 16 Formulation of Anti-MMP12 VHH for Pulmonary Delivery
  • A 100% formulation of antibody was prepared by dissolving 5 mg of VHH in 1.0 ml of deionized water. The pH of the solution was 6.5. A 90% formulation of antibody was prepared by dissolving 4.5 mg of VHH in 1.0 ml of 2 mM citrate buffer. A 70% formulation of antibody was prepared by dissolving 3.5 mg of VHH in 1 mg/ml of excipient in 1 ml of citrate buffer at pH 6.5. The various classes of excipients used were as follows: Sugar excipients: sucrose, lactose, mannitol, raffinose and trehalose. Polymeric excipients: ficoll and PVP. Protein excipients: HSA.
  • Dry powders of the above formulations were produced by spray drying using a Buchi Spray Dryer.
  • The particle size distribution was measure by centrifugal sedimentation.
  • Interferon-Gamma
  • Example 17 Immunization
  • Four llama's (llama 5, 6, 22 and 23) were immunized intramuscularly with human IFN-γ (PeproTech Inc, USA, Cat Nr: 300-02) using an appropriate animal-friendly adjuvant Stimune (Cedi Diagnostics BV, The Netherlands). Two llama's (llama 29 and 31) were immunized intramuscularly with mouse IFN-γ (Protein Expression & Purification core facility, VIB-RUG, Belgium) using an appropriate animal-friendly adjuvant Stimune (Cedi Diagnostics BV, The Netherlands). The llama's received 6 injections at weekly intervals, the first two injections containing each 100 μg of IFN-γ, the last four injections containing each 50 μg of IFN-v. Four days after the last immunization a blood sample (PBL1) of 150 ml and a lymph node biopsy (LN) was collected from each animal and sera were prepared. Ten days after the last immunization a second blood sample (PBL2) of 150 ml was taken from each animal and sera were prepared. Peripheral blood lymphocytes (PBLs), as the genetic source of the llama heavy chain immunoglobulins (HcAbs), were isolated from the blood sample using a Ficoll-Paque gradient (Amersham Biosciences) yielding 5×108 PBLs. The maximal diversity of antibodies is expected to be equal to the number of sampled B-lymphocytes, which is about 10% of the number of PBLs (5×107). The fraction of heavy-chain antibodies in llama is up to 20% of the number of B-lymphocytes. Therefore, the maximal diversity of HcAbs in the 150 ml blood sample is calculated as 107 different molecules. Total RNA was isolated from PBLs and lymph nodes according to the method of Chomczynski and Sacchi (1987).
  • Example 18 Repertoire Cloning
  • cDNA was prepared on 200 μg total RNA with MMLV Reverse Transcriptase (Gibco BRL) using oligo d(T) oligonucleotides (de Haard et al., 1999). The cDNA was purified with a phenol/chloroform extraction, followed by an ethanol precipitation and subsequently used as template to amplify the VHH repertoire.
  • In a first PCR, the repertoire of both conventional (1.6 kb) and heavy-chain (1.3 kb) antibody gene segments were amplified using a leader specific primer (5′-GGCTGAGCTCGGTGGTCCTGGCT-3′) and the oligo d(T) primer (5′-AACTGGAAGAATTCGCGGCCGCAGGAATTTTTTTTTTTTTTTTTT-3′). The resulting DNA fragments were separated by agarose gel electrophoresis and the 1.3 kb fragment encoding heavy-chain antibody segments was purified from the agarose gel. A second PCR was performed using a mixture of FR1 reverse primers (WO03/054016 sequences ABL037 to ABL043) and the same oligo d(T) forward primer.
  • The PCR products were digested with SfnI (introduced in the FR1 primer) and BstEII (naturally occurring in framework 4). Following gel electrophoresis, the DNA fragments of approximately 400 basepairs were purified from gel and ligated into the corresponding restriction sites of phagemid pAX004 to obtain a library of cloned VHHs after electroporation of Escherichia coli TG1. pAX004 allows the production of phage particles, expressing the individual VHHs as a fusion protein with a c-myc tag, a hexahistidine tag and the geneIII product. The diversity obtained after electroporation of TG1 cells is presented in Table 1. The percentage insert was determined in PCR using a combination of vector based primers.
  • Example 19 Rescue of the Library and Phage Preparation
  • The library was grown at 37° C. in 10 ml 2×TY medium containing 2% glucose, and 100 μg/ml ampicillin, until the OD600nm reached 0.5. M13KO7 phages (1012) were added and the mixture was incubated at 37° C. for 2×30 minutes, first without shaking, then with shaking at 100 rpm. Cells were centrifuged for 5 minutes at 4,500 rpm at room temperature. The bacterial pellet was resuspended in 50 ml of 2×TY medium containing 100 μg/ml ampicillin and 25 μg/ml kanamycin, and incubated overnight at 37° C. with vigorously shaking at 250 rpm. The overnight cultures were centrifuged for 15 minutes at 4,500 rpm at 4° C. Phages were PEG precipitated (20% poly-ethylene-glycol and 1.5 M NaCl) for 30 minutes on ice and centrifuged for 20 minutes at 4,500 rpm. The pellet was resuspended in 1 ml PBS. Phages were again PEG precipitated for 10 minutes on ice and centrifuged for 10 minutes at 14,000 rpm and 4° C. The pellet was dissolved in 1 ml PBS-0.1% casein.
  • Example 20 Selection of Human IFN-γ Specific VHH
  • Phages were rescued and prepared as described above in example 17
  • Two approaches were followed to obtain IFN-γ specific binders:
  • a. Solid Phase Coated IFN-γ
      • Microtiter wells were coated with human IFN-γ at different concentrations of 10-0.4 μg/well overnight at 4° C. Plates were washed 5 times with PBS/0.05% Tween-20. Wells were blocked with PBS+1% caseine for 2 hrs at room temperature. Phages were incubated for 2 hrs at room temperature. Wells were washed 20 times with PBS+0.05% Tween-20. The two final washes were performed using PBS. Specific phages were eluted using 1 to 2 μg of IFN-γ R1 (R&D Systems, Cat Nr: 673-IR/CF) for 1 hr. As negative control elutions were performed using 10 μg Ovalbumine (Sigma, A2512) as irrelevant protein. Log phase growing TG1 cells were infected with the eluted phages and plated on selective medium. Enrichment was determined by the number of transfected TG1 colonies after selection using the receptor for elution as compared with negative control using ovalbumine for elution. Bacteria from selections showing enrichment were scraped and used for a second round of selection.
      • The bacteria were superinfected with helperphage to produce recombinant phages as described in example 3. Microtiter wells were coated with IFN-γ at different concentrations of 2-0.1 μg/well overnight at 4° C. Plates were washed 5 times with PBS/0.05% Tween-20. Wells were blocked with PBS+1% caseine for 2 hrs at room temperature. Phages were incubated for 2 hrs at room temperature. Wells were washed 20 times with PBS+0.05% Tween-20. The two final washes were performed using PBS. Specific phages were eluted using 1 to 2 μg of IFN-γ R1 or 10 μg Ovalbumine as irrelevant protein for 1 hr, subsequently overnight at 4° C. and subsequently, phages were eluted using 0.1 M glycine pH 2.5 for 15 minutes at room temperature and neutralized with 1M Tris-HCl pH=7.5. Log phase growing TG1 cells were infected with the eluted and neutralized phages and plated on selective medium. Enrichment was determined by the number of transfected TG1 colonies after selection using the receptor for elution as compared with negative control using ovalbumine for elution.
  • b. Biotinylated IFN-γ
      • Microtiter wells were coated with neutravidine at a concentration of 2 ptg/ml overnight at 4° C. Plates were washed 5 times with PBS/0.05% Tween-20. Wells were blocked with PBS+1% caseine for 2 hrs at room temperature. Biotinylated human IFN-γ at a concentration of 100-10 ng/well was captured overnight at 4° C. Plates were washed 5 times with PBS/0.05% Tween-20. Phages were incubated for 2 hrs at room temperature. Wells were washed with PBS+0.05% Tween-20. The two final washes were performed using PBS. Specific phages were eluted using 1 to 2 μg of IFN-γ R1 (R&D Systems, Cat Nr 673-IR/CF) for 1 hr. As negative control elutions were performed using 10 μg Ovalbumine (Sigma, A2512) as irrelevant protein. Log phase growing TG1 cells were infected with the eluted phages and plated on selective medium. Enrichment was determined by the number of transfected TG1 colonies after selection using the receptor for elution as compared with negative control using ovalbumine for elution. Bacteria from selections showing enrichment were scraped and used for a second round of selection. Bacteria were superinfected with helperphage to produce recombinant phages. Microtiter wells were coated with neutravidine at a concentration of 2 μg/ml overnight at 4° C. Plates were washed 5 times with PBS/0.05% Tween-20. Wells were blocked with PBS+1% caseine for 2 hrs at room temperature. Biotinylated human IFN-γ at a concentration of 20-2.5 ng/100 μl was captured overnight at 4° C. Plates were washed 5 times with PBS/0.05% Tween-20. Phages were incubated for 2 hrs at room temperature. Wells were washed 20 times with PBS+0.05% Tween-20. The two final washes were performed using PBS. Specific phages were eluted using 1 to 2 μg of IFN-γ R1 or 10 μg Ovalbumine as irrelevant protein for 1 hr, subsequently overnight at 4° C. and subsequently, phages were eluted using 0.1 M glycine pH 2.5 for 15 minutes at room temperature and neutralized with 1M Tris-HCl pH=7.5. Log phase growing TG1 cells were infected with the eluted and neutralized phages and plated on selective medium. Enrichment was determined by the number of transfected TG1 colonies after selection using the receptor for elution as compared with negative control using ovalbumine for elution.
    Example 21 Diversity of Selected VHH's
  • PCR was performed using M13 reverse and genIII forward primers. The clones were analyzed using Hinf1 fingerprinting and representative clones were sequenced. Sequence analysis was performed resulting in the sequences presented in Table 4 for human IFN-γ (SEQ ID No. 45-70).
  • Example 22 Expression and Purification of VHH
  • Small scale expressions were started after transformation of DNA into WK6 Escherichia coli cells.
  • Clones were grown in 50 ml 2×TY containing 0.1% glucose and 100 μg/ml ampicillin in a shaking flask at 37° C. until OD600nm=2.1 mM IPTG and 5 mM MgSO4 was added and the culture was incubated for 3 more hours at 37° C. Cultures were centrifuged for 10 minutes at 4,500 rpm at 4° C. The pellet was frozen overnight at −20° C. Next, the pellet was thawed at room temperature for 40 minutes, re-suspended in 1 ml PBS/1 mM EDTA/1M NaCl and shaken on ice for 1 hour. Periplasmic fraction was isolated by centrifugation for 10 minutes at 4° C. at 4,500 rpm. The supernatant containing the VHH was loaded on TALON (Clontech) and purified to homogeneity. The yield of VHH was calculated according to the extinction coefficient.
  • Example 23 Topical Applications of Anti-IFN Gamma VHH's
  • 1: To obtain anti-allergic pharmaceutical compositions for ophthalmic topical applications, a solution of at least one anti-IFN gamma VHH was prepared as follows:
      • eye drops containing a therapeutic dose of anti-IFN gamma VHH dissolved in 100 ml of sterilized water containing 0.9 g sodium chloride, 0.02 g sodium citrate, 0.02 g methyl parahydroxybenzoate, 0.1 g chlorobutanol and acetic acid suitabe to obtain a pH of 6.5.
      • eye ointment containing a therapeutic dose of anti-IFN gamma VHH was prepared according to the conventional method containing 1.0 g of liquid paraffin and a suitable amount of soft paraffin to obtain a total mixture of 100 g.
  • 2: To obtain anti-inflammatory pharmaceutical applications, topical preparations of the present invention contained at least one anti-IFN gamma VHH and a pharmaceutically acceptable carrier. They were prepared as follows:
  • Preparation of Base Cream
  • The reagents for preparing the base cream are as follows (contents for 100 kg base cream): Dimethyl silicon oil (17 kg), Liquid paraffin (9 kg), Stearic acid (7.5 kg), Cetyl alcohol (1 kg), Stearyl alcohol (3 kg), Glycerol (20 kg), Ethylparaben (0.1 kg), Peregal A-20 (0.45 kg), Softener SG (0.85 kg), 0.01 M Phosphate Buffer (pH 7.2)(41.1 kg)
  • The stainless steel tank was placed into a thermostat water bath and heated to 80° C., which took approximately 10 minutes. The liquid was thoroughly mixed. Then, emulsifying and homogenizing equipment was placed into the open stainless steel tank, the mixture was stirred for 20 minutes at 3500 rpm until fully emulsified. The temperature of the thermostat water bath was cooled naturally to room temperature, until the mixture became a semi-solid cream. The mixture was being continually stirred.
  • Preparation of Liquid Antibody Mixture
  • VHH#MP3B1SRA was prepared in accordance with Example 22. The lyophilized antibodies were reconstituted with 0.01 M phosphate buffer (pH 7.2) to a concentration of 2 mg/ml. For 1000 gm of base cream, 45 mg of VHH#MP3B1SRA antibody was added.
  • Therapeutic VHH-Fragments
  • Example 24 Expression of a VHH-CDR3 Fragment of Anti-TNFα VHH#3E
  • The CDR3 region of VHH#3E was amplified by using a sense primer located in the framework 4 region (Forward: CCCCTGGCCCCAGTAGTTATACG) and an anti-sense primer located in the framework 3 region (Reverse: TGTGCAGCAAGAGACGG).
  • In order to clone the CDR-3 fragment in pAX10, a second round PCR amplification was performed with following primers introducing the required restriction sites:
    Reverse primer Sfi1:
    GTCCTCGCAACTGCGGCCCAGCCGGCCTGTGCAGCAAGAGACGG
    Forward primer Not1:
    GTCCTCGCAACTGCGCGGCCGCCCCCTGGCCCCAGTAGTTATACG
  • The PCR reactions were performed in 50 μl reaction volume using 50 pmol of each primer. The reaction conditions for the primary PCR were 11 min at 94° C., followed by 30/60/120 sec at 94/55/72° C. for 30 cycles, and 5 min at 72° C. All reaction were performed wit 2.5 mM MgCl2, 200 mM dNTP and 1.25 U AmpliTaq God DNA Polymerase (Roche Diagnostics, Brussels, Belgium).
  • After cleavage with Sfi1 and Not1 the PCR product was cloned in pAX10.
  • EGFR
  • Example 25 Immunization
  • After approval of the Ethical Committee of the Faculty of Veterinary Medicine (University Ghent, Belgium), 4 llamas (024, 025, 026 and 027) were immunized with the tumor antigen epidermal growth factor receptor (EGFR) according to all current animal welfare regulations. To generate an antibody dependent immune response (Table 9), two animals were injected with intact human vulvar squamous carcinoma cells (A431, ATCC CRL 1555), expressing EGFR on its cell surface, while A431 derived membrane extracts were administered to two other llamas (026 and 027). Each animal received seven doses of subcutaneously administered antigens at weekly intervals (Table 9). When immunizing with intact cells, each dose consisted of 108 freshly harvested A431 cells. The dose for immunization with membrane extracts consisted of vesicles prepared from 108 A431 cells. Vesicles were prepared according to Cohen and colleagues (Cohen S, Ushiro H, Stoscheck C, Chinkers M, 1982. A native 170,000 epidermal growth factor receptor-kinase complex from shed plasma membrane vesicles. J. Biol. Chem. 257:1523-31). Vesicles were stored at −80° C. before administration. Two extra injections of eight microgram purified EGFR (Sigma) in an emulsion with the adjuvant Stimune (CEDI Diagnostics B. V., Lelystad, The Netherlands) were administered intramuscularly to llama 025 (Table 9).
  • Example 26 Evaluation of Immune Response
  • At day 0, 28 and 42, 10 ml of (pre-)immune blood was collected and serum was used to evaluate the induction of the immune responses in the 4 animals. A first ELISA was performed to verify whether the animals generated antibodies that recognized A431 epitopes. After coating a tissue-culture treated 96-well plate with gelatin (0.5% in PBS for 10 minutes), the excess of gelatin was removed and A431 cells were grown overnight in the microwells to confluency. Cells were fixed with 4% paraformaldehyde in PBS for 30 minutes at room temperature. Subsequently, the fixative was blocked with 100 mM glycine in PBS for 10 minutes, followed by blocking of the wells with a 4% skim milk-PBS solution, again for 10 minutes. Serum dilutions of immunized animals were applied and A431 specific antibodies were detected with a polyclonal anti-llama antiserum developed in rabbit, followed by a secondary goat anti-rabbit horse radish peroxidase (HRP) conjugate (Dako, Denmark). For all four animals, immunization with intact cells or membrane vesicles resulted in the induction of a significant A431-specific antibody titer (FIG. 5).
  • To verify whether the induced llama antibodies were EGFR specific, antibody titers in serum was evaluated on mouse fibroblasts expressing human EGFR (Her-14) and compared to the parental mouse fibroblasts cell line NIH3T3 clone 2.2 (3T3), similarly performed as described above (FIG. 6). Again, the serum titer of antibodies binding to Her-14 was higher compared to the titer for the parental 3T3 cells, indicating that circulating serum antibodies were EGFR specific.
  • Finally, the serum response in immunized animals was verified on solid-phase coated purified EGFR. Purified EGFR (Sigma) and the irrelevant carcino embryonic antigen (CEA, Scripps), both at 1 μg/ml, were immobilized overnight at 4° C. in a 96 well Maxisorp plate (Nunc). Wells were blocked with a casein solution (1% in PBS). After addition of serum dilutions, specifically bound immunoglobulins were detected using a rabbit anti-llama antiserum followed by a goat anti-rabbit alkaline phosphatase conjugate (Sigma), showing that for all animals a significant antibody dependent immune response against EGFR was induced (FIG. 7).
  • Example 27 Cloning of the Heavy-Chain Antibody Fragment (VHH) Repertoire
  • Since little is known on the immunoglobulin ontogeny of camelids, B-cell containing tissues of distinct origin and of different time points were collected for each animal (Table 9). After tissue collection, total RNA was isolated according to the procedure described by Chomczynski and Sacchi. (Chomczynski P and Sacchi N. 1987. Single-step method of RNA isolation by acid guanidinium thiocyanate-phenol-chloroform extraction. Anal Biochem 162:156-159). The procedure to clone the VHH repertoire is based on a method described in patent application WO 03/054016. cDNA was prepared on total RNA with MMLV Reverse Transcriptase (Invitrogen) using oligo d(T) oligonucleotides (de Haard H J, van Neer N, Reurs A, Hufton S E, Roovers R C, Henderikx P, de Bruine A P, Arends J W, Hoogenboom H R. 1999. A large non-immunized human Fab fragment phage library that permits rapid isolation and kinetic analysis of high affinity antibodies. J. Biol. Chem. 274:18218-30). The amounts of RNA of the distinct tissues used for cDNA synthesis is listed in Table 10. The cDNA was purified with a phenol/chloroform extraction, followed by an ethanol precipitation and subsequently used as template to amplify the VHH repertoire.
  • In a first PCR, the repertoire of both conventional (1.6 kb) and heavy chain (1.3 kb) antibody gene segments were amplified using a leader specific primer (ABL002) and ABL010, an oligo d(T) primer (for a list of primers see Table 13). The resulting DNA fragments were separated by agarose gel electrophoresis. The amplified 1.3 kb fragment, encoding heavy chain antibody segments was purified from the agarose gel and used as template in a nested PCR using a mixture of FR1 primers (ABL037-ABL043) and ABL010. The PCR products were digested with SfiI (introduced in the FR1 primer) and BstEII (naturally occurring in FR4). Following gel electrophoresis, the DNA fragment of approximately 400 basepairs was purified from gel and 330 ng of amplified VHH repertoire was ligated into the corresponding restriction sites of one microgram of phagemid pAX004 to obtain a library after electroporation of Escherichia coli TG1. pAX004 allows the production of phage particles, expressing the individual VHHs as a fusion protein with the geneIII product. The size of the libraries obtained from the distinct tissues collected from the immunized llamas is described in Table 10. As a quality control, a colony PCR using the M13 reverse and a geneIII primer was performed on 24 randomly picked colonies of each library and the percentage of clones containing an insert of the correct size was calculated (Table 10).
  • Example 28 Evaluation of the Cloned Repertoire
  • In a polyclonal phage ELISA, the specificity of the cloned phage repertoire was evaluated on EGFR and on an irrelevant antigen (TNFα). To generate recombinant virions expressing the VHH repertoire as fusion proteins with the geneIII product, the library was grown at 37° C. in 10 ml 2×TY medium containing 2% glucose, and 100 μg/ml ampicillin, until the OD600nm reached 0.5. M13KO7 phages (1012) were added and the mixture was incubated at 37° C. for 2×30 minutes, first without shaking, then with shaking at 100 rpm. Cells were centrifuged for 5 minutes at 4,500 rpm at room temperature. The bacterial pellet was resuspended in 50 ml of 2×TY medium containing 100 μg/ml ampicillin and 25 μg/ml kanamycin, and incubated overnight at 37° C. with vigorously shaking at 250 rpm. The overnight cultures were centrifuged for 15 minutes at 4,500 rpm at 4° C. and supernatant was used to concentrate the phages. Phages were PEG precipitated (20% poly-ethylene-glycol and 1.5 M NaCl) for 30 minutes on ice and centrifuged for 20 minutes at 4,500 rpm. The pellet was resuspended in 1 ml PBS. Phages were again PEG precipitated for 10 minutes on ice and centrifuged for 10 minutes at 14,000 rpm and 4° C. The pellet was dissolved in 1 ml PBS. One μg/ml of EGFR or TNFα was immobilized in a 96 well Maxisorp plate (Nunc) and incubated overnight at 4° C. Plates were washed 5 times with PBS/0.05% Tween-20 and wells were blocked with a casein solution (1% in PBS) and phage dilutions were added for 2 hrs at room temperature. Bound phages were detected using the anti-M13 gpVIII-HRP conjugated monoclonal antibody (Amersham Biosciences) and ABTS/H2O2 as substrate. Plates were read at 405 nm after 15 minutes incubation at room temperature. An example of a phage response from a pool of phages rescued from PBL1 libraries of animals 024 and 025 is depicted in FIG. 8.
  • Example 29 Multiple Selection Strategies to Identify EGFR Specific Nanobodies
  • Libraries were rescued by growing the bacteria to logarithmic phase (OD600=0.5), followed by infection with helper phage to obtain recombinant phages expressing the repertoire of cloned VHHs on tip of the phage as gpIII fusion protein (as described in Example 18). When selecting for EGFR specific antibodies, two distinct selection strategies have been followed.
  • Selection by Epitope Specific Elution
  • A first selection strategy was based on the fact that EGFR can be purified by affinity chromatography through ligand elution. Four different elution conditions, applying an excess of molecules that compete for the ligand binding site or overlapping epitope(s) were carried out (Table 11). When selection was performed on A431 or Her-14 cells, unselected recombinant phages were mixed for 20 minutes at 4° C. with 6×106 blood cells (mainly monocytes, T- and B-cells) or 2×107 3T3s, respectively, to deplete for recombinant phages that recognize common, non EGFR-specific epitopes. Unbound phages were then incubated with EGFR+ selection cells for 2 hours followed by 6 washes with ice-cold PBS. Phages were subsequently eluted with an excess of EGF ligand, mouse monoclonal 2e9 (Defize L H, Moolenaar W H, van der Saag P T, de Laat S W 1986. Dissociation of cellular responses to epidermal growth factor using anti-receptor monoclonal antibodies. EMBO J. 5:1187-92) or EGFR antagonistic antibodies 225 and 528 (Sato J D, Kawamoto T, Le A D, Mendelsohn J, Polikoff J, Sato G H 1983. Biological effects in vitro of monoclonal antibodies to human epidermal growth factor receptors. Mol. Biol. Med. 1:511-529). All selection steps were performed at 4° C. to avoid receptor mediated phage internalization. Logarithmically grown E. coli TG1 was infected with the eluted phages and grown overnight at 37° C. on selective medium 2×TY Ap100 and 2% glucose. Cells were scraped and used in a next round of panning whenever required. Two or three rounds of panning were performed to enrich for EGFR specific recombinant phages (Table 11). Whenever purified antigen was used for selection (Table 11), EGFR was immobilized at 1 μg/ml on Maxisorp microtiter plates.
  • Selection for Internalizing VHH Fragments
  • A second selection strategy was based on the observation that after binding of the ligand to the receptor, EGFR mediated cell signaling can be downregulated by the mechanism of receptor internalization. To identify recombinant phages that are able to internalize through cell surface molecules, the protocol described by Poul and colleagues (Poul M A, Becerril B, Nielsen U B, Morisson P, Marks J D. 2000. Selection of tumor-specific internalizing human antibodies from phage libraries. J. Mol. Biol. 301:1149-61.) was followed. Unselected recombinant phages were added to approximately 2×107 mouse fibroblast 3T3s for 30 minutes at 4° C. in ice cold binding medium (bicarbonate buffered DMEM; 10% FCS (featal calf serum); 25 mM Hepes), supplemented with 2% skim milk to deplete for non-specific VHHs. Unbound phages were subsequently incubated with pre-cooled EGFR+ selection cells (Her-14 or A431) in binding medium for 1.5 hours at 4° C., followed by six washes with ice-cold PBS to remove non-bound phages. Cells were covered with pre-warmed binding medium and immediately transferred to 37° C. for 20 minutes, to allow internalization. Subsequently, cells were cooled down to 4° C. and were stripped with mild acid (500 mM NaCl; 100 mM glycine pH2.5) incubations during 10 minutes to remove surface bound recombinant phages. Cells were released from extracellular matrix by trypsinization. Resuspended cells were then lyzed during 4 minutes with 100 mM TEA at 4° C. to release internalized phages. Logarithmically grown E. coli TG1 was infected with the eluted phages and grown overnight at 37° C. on selective medium (2×TY Ap100 with 2% glucose). The libraries used for a single round of selection on A431 and in parallel on Her-14 are summarized in Table 12.
  • Example 30 Characterization of EGFR Specific Nanobodies
  • To verify EGFR specificity of individual clones after the epitope specific elution procedure of panning, a phage ELISA was performed on individual clones. 47 randomly picked clones for each selection procedure (1, 2, 3, 4, Ia and IIIa; Table 11) were grown to logarithmic phase (OD600=0.5), followed by infection with helper phage to obtain recombinant phages as described in Example 18. A phage ELISA was performed both on solid-phase coated EGFR (comparing to non-coated well) as on gelatin coated Her-14 cells (comparing to 3T3). The presence of EGFR specific VHH was verified by using approximately 109 recombinant phage particles of each clone before detection with an anti-M13 gpVIII-HRP conjugated monoclonal antibody. With clones that scored positive in phage ELISA on cells and/or on solid-phase immobilized EGFR (Table 11), a HinfI fingerprint analysis was performed (data not shown).
  • The nucleotide sequence was determined for a representative clone of each distinct fingerprint, resulting in 5, 8, 3, 4, 7, and 4 different sequences for conditions, 1, Ia, 2, IIIa, 3 and 4, respectively. Amino acid sequence alignment of these 31 binders (FIG. 9) indicated that 20 of them were unique (listed in Table 14 SEQ ID Nos 23 to 42). The EGFR specificity of the 20 unique clones in phage ELISA (both on cells and on solid-phase coated EGFR) is shown in FIG. 10.
  • For the selection according to the internalization protocol, a phage ELISA on cells with a total of 84 individual clones was performed, similarly as for the clones identified by the epitope specific elution selection procedure. After HinfI fingerprint analysis, nucleotide sequence determination and amino acid sequence alignment to the above described panel of 20 unique binders (data not shown), 2 new anti-EGFR clones, EGFR-B11 and clone EGFR-F11, were identified (Table 14 SEQ ID NOs: 43 to 44). The EGFR specificity of both clones in phage ELISA on cells is shown in FIG. 10, panel A.
  • Example 31 EGF Receptor Mediated Internalization of Nanobodies
  • Her-14 and 3T3 cells were grown overnight on glass cover slips, washed with binding medium (see Example 19) and cooled down to 4° C. for 20 minutes. Phages were prepared of nanobody EGFR-IIIa42 as described in Example 18 and approximately 1012 recombinant virions, diluted in binding medium supplemented with 2% skim milk, were added to the ice cold cells for 1 hour at 4° C. Cells were washed once with ice cold PBS to remove non bound phages. Subsequently, the cells were shifted to 37° C. for 20 minutes to allow phage internalization and again cooled down to 4° C. Cells were washed twice with PBS. Following, cell surface bound phages were removed by two acid washes with stripping buffer (150 mM NaCl, 125 mM HAc) for seven minutes at room temperature. After two washes with PBS, cells were fixed with 4% paraformaldehyde in PBS for 30 minutes at room temperature, and again washed twice with PBS. Fixed cells were then permeabilized in 0.2% Triton X-100 in PBS for 5 minutes at room temperature, followed by two washes with PBS and remaining fixative was blocked with 100 mM glycin in PBS for 10 minutes at room temperature. Cells were washed with PBS-0.5% (w/v) gelatin and internalized phage was visualized by staining with anti-M13 gpVIII-FITC (Amersham Biosciences) followed by an anti-mouse FITC labeled monoclonal antibody and subsequent visualization by fluorescence microscopy. FIG. 11 shows that EGFRIIIa42 is able to internalize Her-14 (panel A) but not 3T3 cells (panel B).
  • Subsequently, FACS analysis demonstrated that nanobody EGFR-IIIa42 is able to bind both A431 and Her-14, but not 3T3 (data not shown).
  • To demonstrate the effect of EGF receptor specific nanobodies on receptor signalling, cells were seeded at 100,000 cells per well in 12-well tissue culture plates in medium (DMEM) containing 10% (v/v) serum. After 8 hours, cells were washed once with medium (DMEM) containing low (0.5% v/v) serum and serum-starved overnight in the same medium. The day of the assay, medium was refreshed with binding medium (DMEM/0.5% FCS/25 mM Hepes and 2% skim milk) and when appropriate, ligand or nanobody (mono- or bivalent) was added at 37° C. After 15 minutes, cells were quickly cooled down on ice and washed twice with ice-cold PBS (10 mM Na-phosphate; 150 mM NaCl, pH 7.4). Total cell lysates were prepared by scraping the cells off the plate in 50 μl protein sample buffer. Proteins were size-separated on 6% (w/v) poly-acrylamide gels (20 μl loaded per gel on two parallel gels) and blotted to PVDF membrane (Roche). Blots were stained for total amount of EGFR with a rabbit polyclonal antiserum to the receptor (Santa Cruz) and for phosphorylated receptor using a monoclonal anti phospho-tyrosine antibody (PY-20; Transduction Labs), followed by an appropriate in donkey developped and peroxidase conjugated secondary antibody (anti-rabbit or anti-mouse). The detection was performed by enhanced chemoluminiscence using Western Lightning™ substrate (Perkin Elmer Life Sciences). Surprisingly, anti-EGFR-IIIa42 nanobody did not activate EGFR+ cells deprived from EGF, indicated by the lack of receptor Tyr kinase phosphorylation (FIG. 11, panel C). The positive control, in which EGF was added in two concentrations to the cells, clearly induced phosphorylation of the receptor and thus induces activation of the cells.
  • PDK1
  • Example 32 (1) Immunisation of Llamas
  • 2 llamas are immunised with a cocktail of recombinant EGF receptor and with PDK1. The lamas are boosted with a cell line overexpressing the EGF receptor. The immunization schemes are summarised in Table 15.
  • Example 33 Repertoire Cloning
  • Different sources for RNA extraction are used:
      • 150 ml immune blood, between 4 and 10 days after the last antigen injection
      • lymph node biopsy 4 days after the last antigen injection
  • Peripheral blood lymphocytes (PBLs) are isolated by centrifugation on a density gradient (Ficoll-Paque Plus Amersham Biosciences). PBLs and lymph node are used to extract total RNA (Chomczynski and Sacchi 1987) followed by synthesis of cDNA using a hexanucleotide random primer. The repertoire is amplified using two hinge-specific primers: AACAGTTAAGCTTCCGCTTGCGGCCGCGGAGCTGGGGTCTTCGCTGTGGTGCG and AACAGTTAAGCTTCCGCTTGCGGCCGCTGGTTGTGGTTTTGGTGTCTTGGGTT and a framework 1 specific primer: GAGGTBCARCTGCAGGASTCYGG. Fragments are digested with PstI and NotI and cloned into a phagemid vector. The repertoire is transformed in TG1 electrocompetent cells and plated on LB agar plates containing 100 μg/ml ampicillin and 2% glucose. Colonies are screened for the presence of insert by PCR with vector specific primers.
  • Example 34 Rescue of the Library, Phage Preparation
  • Libraries are grown at 37° C. in 60 ml 2×TY medium containing 2% glucose, and 100 μg/ml ampicillin, until the OD600 nm reached 0.5. M13KO7 phages (1012) are added and the mixture is incubated at 37° C. for 2×30 minutes, first without shaking, then with shaking at 100 rpm. Cells are centrifuged for 10 minutes at 4500 rpm at room temperature. The bacterial pellet is resuspended in 300 ml of 2×TY medium containing 100 μg/ml ampicillin and 25 μg/ml kanamycin, and incubated overnight at 30° C. with vigorously shaking at 250 rpm. The overnight cultures are centrifuged for 15 minutes at 10.000 rpm at 4° C. Phages are PEG precipitated (20% poly-ethylene-glycol and 1.5 M NaCl) and centrifuged for 30 minutes at 10.000 rpm. The pellet is resuspended in 20 ml PBS. Phages are again PEG precipitated and centrifuged for 30 minutes at 20,000 rpm and 4° C. The pellet is dissolved in 5 ml PBS.
  • Phages are titrated by infection of TG1 cells at OD600 nm=0.5 and plating on LB agar plates containing 100 μg/ml ampicillin and 2% glucose. The number of transformants indicates the number of phages (pfu). The phages are stored at −80° C. with 15% glycerol.
  • Example 35 Selection
  • Immunotubes are coated with 2 μg/ml EGFR, 2 μg/ml PDK1 or with PBS containing 1% casein. After overnight incubation at 4° C., the tubes are blocked with PBS containing 1% casein, for 3 hours at RT. 200 μl phages of the three libraries of llama 005 and of the three libraries of llama006 are pooled and added to the immunotubes with a final volume of 2 ml in PBS for EGFR and in 50 mM Tris HCl (pH 7.4), 150 mM KCl, 1.0 mM DTT, 1 mM MgCl2 and 0.3 mg/ml BSA for PDK1.
  • After 2 hours incubation at RT, the immunotubes are washed 10× with PBS-Tween and 10× with PBS. Bound phages are eluted with 2 ml 0.2 M glycin buffer pH=2.4. Eluted phages are allowed to infect exponentially growing TG1 cells, and are then plated on LB agar plates containing 100 μg/ml ampicillin and 2% glucose. Examples of results which might be obtained from the panning are presented in Tables 16 and 17.
  • Example 36 Screening
  • A microtiter plate is coated with 2 μg/ml EGFR or 2 μg/ml PDK1, overnight at 4° C. Plates are blocked for two hours at room temperature with 300 μl 1% casein in PBS. The plates are washed three times with PBS-Tween. Periplasmic extracts are prepared from single colonies and applied to the wells of the microtiter plate. Plates are washed six times with PBS-Tween, after which binding of VHH is detected by incubation with mouse anti-Histidine mAB 1/1000 in PBS for 1 hour at RT followed by anti-mouse-alkaline phosphatase conjugate 1/2000 in PBS, also for 1 hour at RT. Staining is performed with the substrate PNPP (p-nitrophenyl-phosphate, 2 mg/ml in 1M diethanolamine, 1 mM Mg2SO4, pH9.8) and the signals are measured after 30 minutes at 405 nm. An example of the expected number of positive clones versus the number of clones tested in ELISA for each selection is presented in Table 18.
  • Example 37 Screen for Internalized VHH
  • Individual clones specific for the EGFR are amplified by PCR and cloned in a phage engineered to package the green fluorescent protein reporter gene driven by the CMV promoter (Poul M A et al, J Mol Biol, 1999, 288: 203-211). Phages are prepared and incubated with tumor cells (A431) overexpressing EGFR. Phages that endergo EGFR mediated endocytosis are be measured by GFP expression. 1 VHH (EGFR-21) would be expected to show a very high expression of GFP and would be used for further analysis. In another approach internalised phage is stained with anti-phage antibodies (poly- or monoclonal) after permeabilization of cells by treatment with cold methanol as described by Larocca and colleagues (Larocco et al, Molecular Therapy, 2001, 3: 476-484) and by Poul and colleagues (Poul M A et al, J Mol Biol, 1999, 288: 203-211).
  • Example 38 Screen for VHH Inhibiting PDK1-Akt Interaction
  • PDK1 is coated in a microliter plate as described above and after blocking the plates, the wells are incubated with 100 μg/ml Akt for one hour at RT. Then (without washing) 100 μl periplasmic extract is added to those wells and VHH binding is measured as described above. VHH that are not able to bind to PDK1 would be scored as inhibitors for the interaction between PDK1 and Akt. The expected number of inhibiting VHH versus the number of VHH tested in inhibition ELISA is summarized in Table 19.
  • Example 39 Making a Bispecific Construct
  • A bispecific construct is prepared (Conrath et al, J Biol Chem, 2001, 276: 7346-7350) of EGFR-21 and 5 different strong inhibiting VHHs (PD-1, PD-7, PD-32, PD-33 and PD-72) for PDK1. Protein is prepared and purified to homogeneity for the 5 bispecific constructs and shown to be stable by western blot analysis.
  • Example 40 Endocytosis and Lysis of Tumor Cells
  • Bispecific constructs are incubated with tumor cells (A431) overexpressing EGFR. All constructs that successfully endocytosed would be shown by confocal microscopy. One of the constructs, EGFR-21-PD-32, would be expected to able to inhibit cell growth and finally lead to cell death.
  • Example 41 Calculation of Homologies Between Anti-Target-Single Domain Antibodies of the Invention
  • The degree of amino acid sequence homology between anti-target single domain antibodies of the invention was calculated using the Bioedit Sequence Alignment Editor. The calculations indicate the proportion of identical residues between all of the sequences as they are aligned by ClustalW. (Thompson, J. D., Higgins, D. G. and Gibson, T. J. (1994) CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position specific gap penalties and weight matrix choice. Nucleic Acids Research, submitted, June 1994). Table 20 indicates the fraction homology between anti-TNF-alpha VHHs of the invention. Table 21 indicates the percentage homology between anti-IFN-gamma VHHs of the invention.
  • Example 42 Construction of a Bispecific Constructs Containing a VHH-CDR3 Fragment Fused to an Anti-Serum Albumin VHH
  • A functional portion, the CDR3 region of MP2F6SR, was amplified by using a sense primer located in the framework 4 region (F6 CRD3 Forward:CTGGCCCCAGAAGTCATACC) and an anti-sense primer located in the framework 3 region (F6 CDR3 Reverse primer:TGTGCATGTGCAGCAAACC).
  • In order to fuse the CDR-3 fragment with the anti-serum albumin VHH MSA-21, a second round PCR amplification was performed with following primers:
    F6 CDR3 Reverse primer Sfi1:
    GTCCTCGCAACTGCGGCCCAGCCGGCCTGTGCATGTGCAGCAAACC
    F6 CDR3 Forward primer Not1:
    GTCCTCGCAACTGCGCGGCCGCCTGGCCCCAGAAGTCATACC
  • The PCR reactions were performed in 50 ml reaction volume using 50 pmol of each primer. The reaction conditions for the primary PCR were 11 min at 94° C., followed by 30/60/120 sec at 94/55/72° C. for 30 cycles, and 5 min at 72° C. All reaction were performed wit 2.5 mM MgCl2, 200 mM dNTP and 1.25 U AmpliTaq God DNA Polymerase (Roche Diagnostics, Brussels, Belgium).
  • After cleavage of the VHH gene of MSA clones with restriction enzymes Pst1/BstEII the digested products were cloned in pAX11 to obtain clones with a VHH at the C-terminus of the multicloning site. The clones were examined by PCR using vector based primers. From clones yielding a 650 bp product, DNA was prepared and used as acceptor vector to clone the CDR3 of MP2F6SR, after cleavage of the PCR product with restriction enzymes Sfi1/Not1 to allow N-terminal expression of CDR3 in fusion with a MSA VHH.
  • Tables
    TABLE 1
    Immunization scheme as described in Example 1
    Day Llama 2 Llama 4
    0 100 μg 100 μg
    7 100 μg 
    14 50 μg
    21 50 μg 100 μg
    28 50 μg
    35 50 μg
    42  50 μg
    70  50 μg
  • TABLE 2
    Presence of insert by PCR with vector specific primers as
    described in Example 1
    #days after
    last injection Source RNA Size of the library % insert
    Llama002
    4 Lymph 1.3 × 107 89
    4 PBL 1.9 × 107 95
    10 PBL 1.1 × 109 70
    Llama004 4 PBL 1.7 × 108 96
    4 Lymph 4.9 × 107 >95
    10 PBL 2.2 × 106 >95
  • TABLE 3
    First selection as described in Example 1
    0 μg/ml
    5 μg/ml 0.5 μg/ml (blanco)
    Llama 2 1.4 106 2.7 105 1.5 104
    (pool PBL day4, PBLday10,
    lymph node day4)
    Enrichment compared to blanco 400 x   18 x
    Llama
    4 3.3 106 4.5 105 7.2 104
    (pool PBL day4, PBLday10,
    lymph node day4)
    Enrichment compared to blanco 140 x 6.25 x
  • TABLE 4
    Second selection using the rescued phages from the first selection
    as described in Example 1
    1 μg/ml 0 μg/ml
    Elution
    1 μg/ml Elution 0 μg/ml
    buffy Elution buffy Elution
    coat cells Lysozyme coat cells Lysozyme
    Llama
    2 1.2 108 1.2 108 6 103 3 103
    (selection 5 μg/ml IgE:
    400 × enrichment)
    Enrichment compared to No 2 x
    lysozyme elution enrich-
    ment
    Llama
    4 1.3 108   2 107 3 103 3 103
    (selection 5 μg/ml IgE:
    140 × enrichment)
    Enrichment compared to 6.5 x No
    lysozyme elution enrich-
    ment
  • TABLE 5
    Second round selection using neutravidine coated tubes as
    described in Example 1
    2 nM IgE 0 nM IgE
    Elution
    2 nM IgE Elution 0 nM IgE
    buffy Elution buffy Elution
    coat cells Lysozyme coat cells Lysozyme
    Llama
    2 1.5 108 1.5 107 3 105 3 103
    (selection 5 μg/ml IgE:
    400 × enrichment)
    Enrichment compared to  10 x
    lysozyme elution
    Llama
    4 3.3 107 2.2 107 3 103 6 103
    (selection 5 μg/ml IgE:
    140 × enrichment)
    Enrichment compared to 1.5 x
    lysozyme elution
  • TABLE 6
    Number of clones that score positive for binding to both human IgE
    and chimeric IgE versus the number of clones tested in ELISA as
    described in Example 1
    Selection Selection
    with 5 μg/ml with 0.5 μg/ml
    Llama 002 39/47 21/47
    Llama 004 45/47 46/47
  • TABLE 7
    Treatment schedule
    Group Animals Description Schedule
    1 8 negative control 1 daily 100 μl PBS i.p.+
    ip
    2 8 negative control 2 every other day 100 μl PBS rectal
    rectal for 2 weeks
    3 8 negative control 3 daily 100 μl PBS intragastric
    intragastric for 14 consecutive days
    4 8 positive control 1 5 μg i.p. for 7 consecutive days
    dexamethasone
    5 8 positive control 2 applied orally once per day for 14
    IL10 expressing consecutive days
    l. lactis
    6 8 bivalent VHH 3F daily 100 μg bivalent VHH 3F2
    intra-gastric intragastric
    on 14 consecutive days
    7 8 bivalent VHH 3F daily 100 μg bivalent VHH 3F i.p.
    i.p. for 14 consecutive days
    8 8 bivalent VHH 3F 100 μg bivalent VHH 3F rectally in
    rectally 100 μl PBS
    every other day for two weeks
  • TABLE 8
    Overview of the libraries, their diversity and % insert derived from
    different llama's and tissues as described in Example 7 and 8
    Animal Antigen Source Titer % Insert
    Llama 5 Human MMP-12 PBL time 1 2.1 108 94%
    Llama 5 Human MMP-12 PBL time 2 7.5 106 92%
    Llama 5 Human MMP-12 Lymph node 7.8 108 100% 
  • TABLE 9
    Immunization schedule and tissue collections
    Day Llama 024 Llama
    025 Llama 026 Llama 027
    0 intact cells intact cells vesicles vesicles
    7 intact cells intact cells vesicles vesicles
    14 intact cells intact cells vesicles vesicles
    21 intact cells intact cells vesicles vesicles
    28 intact cells intact cells vesicles vesicles
    35 intact cells intact cells vesicles vesicles
    42 intact cells intact cells vesicles vesicles
    46 150 ml blood 150 ml blood 150 ml blood 150 ml blood
    sample (PBL1) sample (PBL1) sample (PBL1) sample (PBL1)
    lymph node lymph node
    47 lymph node
    spleen
    bone marrow
    49 purified EGFR 150 ml blood 150 ml blood
    sample (PBL2) sample (PBL2)
    55 purified EGFR
    59 150 ml blood
    sample (PBL2)
    60 lymph node
    spleen
    bone marrow
  • TABLE 10
    Overview of constructed libraries
    Animal Tissue RNA (μg) Size (×108) % Insert
    Llama
    024 PBL1 200 0.25 83
    Llama 024 Lymph node ileum  40 2.3 78
    Llama 024 Lymph node bow 150 0.17 100
    Llama 024 Bone marrow  97 1.5 83
    Llama 024 Spleen 160 0.16 95
    Llama 025 PBL1 200 0.06 95
    Llama 025 Lymph node 200 0.8 96
    (ileum + bow)
    Llama 025 Bone marrow 200 0.045 88
    Llama 025 Spleen 200 2 86
    Llama 025 PBL2 200 0.13 83
    Llama 026 PBL1 + lymph node 100 + 200 2.46 85
    Llama 027 PBL1 + lymph node 100 + 200 1.08 92
  • TABLE 11
    Overview of epitope specific elution selection procedure
    Elution Elution Selection: antigen format φELISA φELISA Binder
    condition molecule Round I Round II Round III Her-14 EGFR families
    1 EGF A431 Her-14  1/47 24/47 6
    Ia EGFR  5/47 23/47 8
    2 2e9 A431 Her-14  2/47 32/47 5
    IIIa EGFR 11/47 32/47 4
    3 225 A431 A431 Her-14  8/47 28/47 5
    EGFR 20/47 31/47
    4 528 A431 A431 Her-14 16/47 10/47 5
    EGFR 22/47 29/47
  • TABLE 12
    Overview of ‘internalization’ selection procedure
    Library Selection cells Selected antibody fragment
    Pool lymph node, bone Her-14 A2
    marrow, spleen and PBL1
    (024 + 025)
    Pool bone marrow A431 A4, A9, B11
    (024 + 025)
    Pool PBL1 (024 + 025) A431 F11
  • TABLE 13
    Primer sequences
    Name Sequence 5′-3′
    ABL002 GGCTGAGCTCGGTGGTCCTGGCT
    ABL010 AACTGGAAGAATTCGCGGCCGCAGGAATTTTTTTTTTTTTTT
    TTT
    ABL037 CATGCCATGACTCGCGGCCCAGCCGGCCATGGCCGAGGTGCA
    GCTGGTGGAGTCTGG
    ABL038 CATGCCATGACTCGCGGCCCAGCCGGCCATGGCCGATGTGCA
    GCTGGTGGAGTCTGG
    ABL039 CATGCCATGACTCGCGGCCCAGCCGGCCATGGCCGCGGTGCA
    GCTGGTGGAGTCTGG
    ABL040 CATGCCATGACTCGCGGCCCAGCCGGCCATGGCCGCCGTGCA
    GCTGGTGGATTCTGG
    ABL041 CATGCCATGACTCGCGGCCCAGCCGGCCATGGCCCAGGTGCA
    GCTGGTGGAGTCTGG
    ABL042 CATGCCATGACTCGCGGCCCAGCCGGCCATGGCCCAGGTACA
    GCTGGTGGAGTCTGG
    ABL043 CATGCCATGACTCGCGGCCCAGCCGGCCATGGCCCAGGTAAA
    GCTGGAGGAGTCTGG
    geneIII CCACAGACAGCCCTCATAG
    M13 rev GGATAACAATTTCACACAGG
  • TABLE 14
    Sequence listing
    SEQ
    ID NO NAME SEQUENCE
    Anti-IgE VHH
    1 VHH#2C3 QVQLQDSGGGLVQPGGSLRLSCRASGRIFRINAMGWYRQAPGKQRELVATI
    TSTGSTNFADSVKGRFTIYRDGAKRTVDLRLNSLKPEDTAVYFCNADVREY
    DLGPWRQYWGQGTQVTVSS
    2 VHH#4G12 QVQLQESGGGVVQPGGSLRLSCSVSGTSISNRVMAWFRQAPGKQRDFVAYI
    TSAVNTDYADFVKGRFTISRDNAQNMVHLQMNSLKPEDTAVYYCNVLKDTW
    FRTPYDYYWGQGTQVTVSS
    3 VHH#2C1 QVQLQESGGGLVQPGDSLRLSCVVSGRTLSYSSLAWFRQAPGKERDFVAAL
    SLTTYY
    ADSVKGRFTISRDNAKNTVYLQMNSLKPDDTADYFCATARTRTDYAPLLSA
    ASTYDAWGQGTQVTVSL
    4 VHH#2H3 QVQLQESGGGLVQAGGSLRLSCAASGRSSRYYAMGWFRQGPGKEREFVAAV
    NWNGDSTYYADSVKGRFTISRGNAENTAYLQMNSLVPEDTAVYYCAMRMNA
    GLGYSAASYQYWGQGTQVTVSL
    5 VHH#2D12 QVQLQESGGGLVQAGDSLRLSCAASGLTFLEHVMAWFRQTPGKEREFVGAI
    DWSGRRITYTDSVKGRFTISRDNAKNTVYLQMNTLKPEDTAVYYCAADRTY
    SYSSTGYYYWGQGTQVTVSS
    6 VHH#2G4 QVQLQDSGGGLVQAGDSLRLSCAASGLTFLEHVMAWFRQTPGKEREFVGAI
    DWSGRRITYTDSVKGRFTISRDNAKNTVYLQMNTLKPEDTAVYYCAADRTY
    SYSSTGYYYWGQGTQVTVSS
    7 VHH#4C5 QVQLQESGGGLVQAGGSLRLSCAASGRTLSSYTMAWFRQAPGKEREFVASI
    SSSGISTYYADSVKGRFTISRDIAKNTVYLQMNSLKPEDTAVYYCAAKYRY
    YSTLYTKSGEYDYWGQGTQVTVSS
    8 VHH#4A2 QVQLQDSGGGLVQAGGSLRLSCEASGRTISSYAMAWFRQAPGKEREFVASI
    SSSGVSKHYADSVKGRFTISNDKVKNTVYLQMNSLKPEDTAVYFCAAKYRY
    YSSYYTKSGDYDYWGQGTQVTVSS
    9 VHH#2D4 QVQLQESGGGLVQAGGSLRLSCAASGLTFSTYAMGWFRQAPGKEREFVAAV
    SYSGSYYADSVKGRFTISRDNAKNTVYLQMASLKPEDTAVYYCAARNRGYS
    TYAGVYDYWGQGTQVTVSS
    10 VHH#2B6 QVQLQDSGGGLVQAGGSLRLSCAASGVTFSSYAMGWFRQAPGKEREFVASI
    TWIGGGTYYADSVKGRFTISRDHAGNTVYLQMNTLKPDDTAVYYCALDRRS
    STYYLMKGEYDYRGRGTQVTVSS
    11 VHH#2H11 QVQLQESGGGLVQAGGSLRLSCAASGVTFSSYAMGWFRQAPGKEREFVASI
    TWTGTGTYYADSVKGRFTISRDHAGTTVYLQMNSLKPEDTAVYYCAVDRRS
    STYYLMKGEYDYRGRGTQVTVSS
    Anti-TNF alpha VHH
    12 VHH#3E- QVQLQESGGGLVQPGGSLRLSCAASGRTFSDHSGYTYTIGWFRQAPKEREF
    His tag VARIYWSSGNTYYADSVKGRFAISRDIAKNTVDLTMNNLEPEDTAVYYCAA
    RDGIPTSRSVESYNYWGQGTQVTVSSAAAEQKLISEEDLNGAAHHHHHH
    13 VHH#3F QVQLQDSGGGLVQAGGSLRLSCAASGGTFSSIIMAWFRQAPGKEREFVGAV
    SWSGGTTVYADSVLGRFEISRDSARKSVYLQMNSLKPEDTAVYYCAARPYQ
    KYNWASASYNVWGQGTQVTVSS
    14 VHH#3F/ QVQLQDSGGGLVQAGGSLRLSCAASGGTFSSIIMAWFRQAPGKEREFVGAV
    VHH#3F SWSGGTTVYADSVLGRFEISRDSARKSVYLQMNSLKPEDTAVYYCAARPYQ
    KYNWASASYNVWGQGTQVTVSSEPKTPKPQPAAAQVQLQDSGGGLVQAGGS
    LRLSCAASGGTFSSIIMAWFRQAPGKEREFVGAVSWSGGTTVYADSVLGRF
    EISRDSARKSVYLQMNSLKPEDTAVYYCAARPYQKYNWASASYNVWGQGTQ
    VTVSS
    Human MMP-12 specific VHH
    15 MMP-12 QVQLQESGGGLVQPGGSLRLSCVASGFTFSDYPMAWVRQAPGKGLEWISVI
    P1-1 NSGGVNTSYAASVKGRFTISRDNAKNTLFLQMNSLKPEDTAVYYCAKYSLK
    NEQYWRGQGTQVTVSS
    16 MMP-12 QVQLQESGGGLVQPGGSLRLSCAASGSIFSIDGMGWYRQAPGKQRERKQRE
    P1-3 LVAAITSGGSTKYADSVKGRFTISRDNANDTVYLQMNTLKPEDTAVYYCNA
    VLLRRGIVYDYWGQGKQVTVSS
    17 MMP-12 QVQLQESGGGSVKAGGSLRLSCAASGSIFSIDGMGWYRQAPGKQRERKQRE
    P1-7 LVAAITSGGSTKYADSVKGRFTISRLNANDTVYLQMNTLKPEDTAVYYCNA
    VLLRRGIVYDYWGQGKQVTVSS
    18 MMP-12 QVQLQESGGGLVRAGGSLRLSCVASGRTLSKYRMGWFRQFPGKERELVAEI
    P1-26 EWKSSSTWYRDSVKGRFTISRDNAKNTVYLRMNSLKPEDTAVYYCAAATLG
    EPLVKYTYWGQGTQVTVSS
    19 MMP-12 QVQLQESGGGLVQPGGSLRLSCAASGSIFSIDGMGWYRQAPGKQRERKQRE
    P1-33 LVAAITSGGSTKYADSVKGRFTISRDNANDTVYLQMNTLKPEDTAVYYCNA
    VLLRRGIVYDYWGQGKQVTVSS
    20 MMP-12 QVQLQDSGGGLVRTGDSLRLSCVVFGGTISTYAMGWFRRAPGKEREFVAAI
    P1-41 DASGGFTEYADSVRGRFRIARDNPLSAVYLQMNSLKPEDTAFYYCAADKDR
    DTVVRFTTTPNEYDYWGQGTQVTVSS
    21 MMP-12 QVQLQESGGGLVQPGGSLRLSCAASGFTFNNHWLYWVRQAQGKGLEWVSAI
    P1-44 NPGGSTVYLDSVKGRFTISRGNTKNTLYLQMNSLKSEDTAVYYCTKAMAWA
    TDWDEYDLWGQGTQVTVSS
    22 MMP-12 QVQLQESGGGLVQAGGSLRLSCAASGRTFTVYTTGWFRQAPGKEREFVAAI
    P5-29 DWSGSSTYYTDSVKGRFTISRDNTKNTVYLQMNSLKPEDTAVYYCAARDAI
    VGVTDTSGYRYWGQGTQVTVSS
    Anti-EGFR VHH
    23 EGFR-1.4 EVQLVESGGGLVQAGGSLRLSCAASGRTFSNYVMGWFRQAPGKERDFVVGI
    GRSGGDNTYYADSVKGRFTISWDNAKNTMYLQMNSLKPEDTAVYYCAASTY
    SRDTIFTKWANYNYWGQGTQVTVSS
    24 EGFR-1.9 QVQLQESGGGLVKAGGSLRLSCAASGRTFSSYVMGWFRQAPGKEREFVGAI
    HWSGGRTYYADSVKGRFTISSDNAKNTLYLQMNSLKPEDTAVYYCAASRII
    YSYVNYVNPGEYDYWGQGTQVTVSS
    25 EGFR-1.33 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSHYMSWFRQAPGKEREFVAAI
    TSSSRTYYTESVKGRFTISRDNAKNTVYLQMNSLKSEDTAVYYCAADRTFY
    GSTWSKYDYRGQGTQVTVSS
    26 EGFR-1.34 QVQLQESGGGLVQAGGSLRLSCAASGRTFSKYAMGWFRQAPGKEREFVAII
    SWSDGSTYYADSVKGRFTISRDNAKNTVYLQVNSLKPEDTAVYYCAATYLV
    DVWAVHVPIRPYEYDYWGQGTQVTVSS
    27 EGFR-1.38 QVQLQDSGGGLVQAGDSLRLSCAASGRSFGGYAMGWFRQAPGKEREFVAAI
    SWSGGSTYYADSLKGRFTISRDNAKNTVYLQMNSLKPEDTALYYCAAGLRP
    SPNYNHERSYDYWGQGTQVTVSS
    28 EGFR-Ia1 QVQLQESGGGLVQAGGSLLLSCAASGRTFSSYAMGWFRQAPGKEREFVAAI
    NWSGGSTSYADSVKGRFTISRDNTKNTVYLQMNSLKPEDTAAFYCAATYNP
    YSRDHYFPRMTTEYDYWGQGTQVTVSS
    29 EGFR-Ia7 QVQLQESGGRLVQTGGSLRLSCAASGGTFGTYALGWFRQAPGKEREFVAAI
    SRFGSTYYADSVKGRFTISRDNANNTVYLEMNSLKPEDTAVYYCAAREGVA
    LGLRNDANYWGQGTQVTVSS
    30 EGFR-Ia15 QVQLQDSGGGLVQAGGSLRLSCAASGGTFSSYAMGWFRQAPGKEREFVAAI
    GLNTYYADSVKGRFTISRDNAKNTVYLQNNSLKPEDTAVYYCAARTSGVVG
    GTPKRYDYWGQGTQVTVSS
    31 EGFR- EVQLVESGGGSVQAGGSLKLSCAASGRSFSTYAMGWFRQAPGQDREFVATI
    IIIa42 SWTDSTDYADSVKGRFTISRDNAKNTGYLQMNSLKPEDTAVYYCAADRWAS
    SRRNVDYDYWGQGTQVTVSS
    32 EGFR-2.6 QVQLQESGGGLVQAGGSLRLSCAASGRTFSNYAMGWFRQAPGKEREFVAAI
    NWGGGNTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAASEWG
    GSDYDHDYDYWGQGTQVTVSS
    33 EGFR-2.20 EVQLVESGGGLVQAGGSLRLSCAASGRSFSSYAMAWFRQAPGKEREFVAAI
    SWGGGSTYYAVSVKGRFTISRDNAKNTVYLQMNSLKPEDTARYYCAADETF
    HSSAYGEYEYWGQGTQVTVSS
    34 EGFR- EVQLVESGGGLVQAGGSLRLSCTASGRTFSSYAMGWFRQTPGKEREFVAAI
    IIIa5 TSSGGSTYYADSVKGRFTISRDNAKSTMYLQMDSLMLDDTSVYYCAADSSR
    PQYSDSALRRILSLSNSYPYWGQGTQVTVSS
    35 EGFR-3.18 EVQLVESGGGLVQPGGSLRLSCVASGFTFADYAMSWVRQAPGKGLQWVSSI
    SYNGDTTYYAESMKDRFTISRDNAKNTLYLQMNSLKSEDTAVYYCASSGSY
    YPGHFESWGQGTQVTVSS
    36 EGFR-3.32 QVQLQESGGGLVQAGGSLRLSCAASGRTFSGYAMGWFROAPGEEREFVAAI
    SWRGTSTYYGDSAKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAGSHS
    DYAPDYDYWGQGTQVTVSS
    37 EGFR-3.34 QVQLQESGGGLVQAGGSLRLSCAASGRTFSSYAIGWFRQAPGKEREFVAAI
    SWGGSNTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAGEVS
    NSDYAYEYDYWGQGTQVTVSS
    38 EGFR-3.39 QVQLQESGGGLVQTGGSLRLSCAASGRYIMGWFRQAPGKEREFVAGISRSG
    ASTAYADSVKDRFTISRDSALNTVYLQMNSLKAEDTAVYFCAAALAIRLGI
    PRGETEYEYWGQGTQVTVSS
    39 EGFR-3.40 QVKLEESGGGLVQAGGSLRLSCSASGLTFSNYAMAWFRQAPGKEREFVATI
    SQRGGMRHYLDSVKDRFTISRDNAKNTVYLQMNSLKPDDTAVYYCAADLMY
    GVDRRYDYWGRGTQVTVSS
    40 EGFR-4.11 QVKLEESGGGLVQAGDSLRLSCAASGRSFSSITMGWFRQAPGKERQFVSAI
    NSNGNRYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAVQAYS
    SSSDYYSQEGAYDYWGQGTQVTVSS
    41 EGFR-4.21 EVQLVESGGGLVQAGGSLRLSCAVSGRTFSSMGWFRQAPGKEREFVATINL
    SGDRTDYADSVKGRFTISRDNPKNTVYLQMDSLEPEDSAVYYCAGTSLYPS
    NLRYYTLPGTYADWGQGTQVTVSS
    42 EGFR-4.22 QVKLEESGGGLVQAGGSLRLSCAASGSIFSINAMGWYRQAPGKQRELVARI
    TGTGTGITGAVSTNYADSVKGRFTISRDNARNTVYLQMNSLKPEDTAVYYC
    AADRSRTIVVPDYWGQGTQVTVSS
    43 EGFR-B11 QVQLQDSGGGLVQAGGSLRLSCAASRFSSAQYAIGWFRQAPGKEREGVSYI
    TFSGGPTGYADSVKGRFTVSRDNAKNTVYLQMNSLKPEDTAVYYCAARPYT
    RPGSMWVSSLYDISIWGQGTQVTVSS
    44 EGFR-F11 QVQLQESGGRLVQAGGSLRLSCAASEHTFRGYAIGWFRQAPGKEREFVSSI
    TYDGTLTNYADSVTGRFTISRDNAKNTVYLQMNSLKPEDTAVYVCAAGYSY
    RYTTLNQYDSWGQGTQVTVSS
    Anti-human IFN gamma VHH
    45 MP3D2SRA QVQLQDSGGGTVQAGGSLRLSCAASGRTFSDYAVGWFRQAPGKEREFVARI
    LWTGASRSYANSVDGRFTVSTDNAKNTVYLQMNSLKPEDTAIYYCAALPSN
    IITTDYLRVYYWGQGTQVTVSS
    46 MP3A3SR QVQLQDSGGGTVQAGGSLRLSCAASGRTFSNYAVGWFRQAPGKEREFVARI
    KWSGGSRSYANSVDGRFTVSTDNAKNTVYLQMNSLKPEDTAIYYCA?LPSN
    IITTDYLRVYYWGQGTQVTVSS
    47 MP3C5SR QVQLQESGGGLVQAGGSLRLSCAAAGISGSVFSRTPMGWYRQAPGKQRELV
    AGILTSGATSYAESVKGRFTISRDNAKNTVYLQMNSLSPEDTAEYYCNTYP
    TWVLSWGQGTQVTVSS
    48 MP3C1SR QVQLQDSGGGLVQAGGSLRLSCAAAGISGSVFSRTPMGWYRQAPGKQRELV
    AGILSSGATVYAESVKGRFTISRDNAKNTVYLQMNSLSPEDTAEYYCNTYP
    TWVLSWGQGTQVTVSS
    49 MP3G8SR QVQLQESGGGLVQAGGSLRLSCAAAGISGSVFSRTPMGWYRQAPGKQRELV
    AGILSSGATAYAESVKGRFTISRDNAKNTVYLQMNSLSPEDTAEYYCNTYP
    TWVLSWGQGTQVTVSS
    50 MP3D2BR QVQLQESGGGLVQPGESLRLSCAASRGIFRFNAGGWYRQAPGKQRELVAFI
    GVDNTTRYIDSVKGRFTISRDNAKTTVYLQMNSLQPEDTAVYYCNKVPYID
    WGQGTQVTVSS
    51 MP3H6SRA QVQLQESGGGLVQAGGSLRLSCAASGRTFSTYNMGWFRQAPGKEREFVAGI
    SWNGGSIYYTSSVEGRFTISRDNAENTVYLQMNSLKPEDTGVYYCASKGRP
    YGVPSPRQGDYDYWGQGTQVTVSS
    52 MP3B4SRA QVQLQESGGGLVQAGGSLRLSCAASGRTFSTYNMGWFRQAPGKEREFVAGI
    SWNGGSIYYTSSVEGRFTISRDNAENTVYLQMNSLKPEDTGVYYCASKGRP
    YGVPSPRQGDYDYWGQGTQVTVSS
    53 MP4E4BR QVQLQESGGGLVQAGGSLRLSCAASGRTFSIYNMGWFRQAPGKEREFVAAI
    SWNGGSIYYTSSVEGRFTISRDNAINTVYLQMNSLKPEDTGVYYCASKGRP
    YGVPSPRQGEYDYWGQGTQVTVSS
    54 MP4H8SR QVQLQESGGGLVQAGGSLRLSCAASGRTFNIYNMGWFRQAPGKERDFVAAI
    SWNGGSIYYTSSVEGRFTISRDNAENTVYLQMNSLKPEDTGVYYCASKGRP
    YGVPSPRQGDYDYWGQGTQVTVSS
    55 MP2F6SR QVKLEESGGGLVQAGGSLRLSCAASGRTFNNYNMGWFRQAPGKEREFVAAI
    SWNGGSTYYDDSVKGRFTISRDNANNLVYLQMNSLNFEDTAVYYCACAANP
    YGIPQYRENRYDFWGQGTQVTVSS
    56 MP3D1BR QVQLQESGGGLVQAGGSLRLSCAASGRTFDNYNMGWFRQAPGKEREFVAAI
    SWNGGSTYYDDSVKGRFTISRDNFQKLVYLQMNSLKLEDTAVYYCACAANP
    YGIPQYRENRYDFWGQGTQVTVSS
    57 MP2B5BR QVQLVESGGRLVQAGGSLRLSCIASGRTISDYAAGWFRQAPGKEREFLASV
    TWGFGSTSYADSVKGRFTISRDKAKDTVYLQMNTLEPDDTSVYYCASSPRY
    CAGYRCYVTASEFDSWGQGTQVTVSS
    58 MP2C1BR QVKLEESGGRLVQAGGSLRLSCIASGRTISDYAAGWFRQAPGKEREFLASV
    SWGFGSTYYADSVKGRFTISRDTAKDTVYLQMNTLEPDDTSVYYCASSPRY
    CAGYRCYATASEFDSWGQGTQVTVSS
    59 MP4A12SR QVQLQESGGRLVQAGGSLRLSCIASGRTISDYAAGWFRQAPGKEREFLASV
    TWGFGSTYYADSVKGRFTISRDKAKDTVYLQMNTLEPDDTSAYYCASSPRY
    CAGYRCYVTASEFDSWGPGTQVTVSS
    60 MP3F4SRA QVQLQDSGGGLVQAGDSLRLSCAASGRSFSSYGMGWFRQAPGKEHEFVAGI
    WRSGVSLYYTDSVKGRPTISRDDAKMTVSLQMNSLKPEDTAVYYCAAEATF
    PTWSRGRFADYDYRGQGTQVTVSS
    61 MP3D3BR QVQLQESGGGLVQAGDSLRLSCTASGRSFSSYGMGWFRQAPGKDHEFVAGI
    WRSGVSLYYADSVKGRFTISRDDAKMTVSLQMNGLKPEDTAVYYCAAEATF
    PTWNRGTFADYDYRGQGTQVTVSS
    62 MP3E5BR QVQLQESGGGLVQAGDSLRLSCAASGRSFSSYGMGWFRQAPGKEHEFVAGI
    WRSGVSLYYADSVKGRFTISRDDAKMTVSLQMNGLKPEDTAVYYCAAEATF
    PTWNRGSFADYDYRGQGTQVTVSS
    63 MP3C7SRA QVQLQESGGGLVQAGDSLRLSCAASGRSFSSYGMGWFRQAPGKEHEFVAGI
    WRSGVSLYYADSVKGRFTISRDDAKMTVSLQMNSLKPEDTAVYYCAAEATF
    PTWNRGRFADYDYSGQGTQVTVSS
    64 MP2F1BR AVQLVESGGGLVQTGDSLRLSCVASGGTFSRYAMGWFRQAPGKEREFVARI
    GYSGRSISYATSVEGRFAISRDNAKNTVYLQMNSLKPEDTAVYYCASLVSG
    TLYQADYWGQGTQVTVSS
    65 MP2C5BR QVQLVESGGGLVQTGDSLRLSCVASGGTFSRYAMGWFRQPPGKERDFVARI
    GYSGQSISYATSVEGRFAISRDNAKNTVYLQMNSLKPEDTAVYYCASLVSG
    TLYKPNYWGQGTQVTVSS
    66 MP2C10BR QVKLEESGGGLVQAGGSLRLSCAASGLTYTVGWFRQAPGKEREFVAAISWS
    GGSALYADSVKGRFTISRDNAKNTVTLQMGSLEPEDTAYYSCAAPGTRYYG
    SNQVNYNYWGQGTQVTVSS
    67 MP2G5SR QVKLEESGGGLVQAGDSLRLSCAASGLTYTVGWFRQAPGKEREFVAAIDWS
    GGSALYADSVKGRFTISRDNTKNTVYLQMGSLEPEDTAVYWCAAPGTRYHG
    RNQVNYNYWGQGTQVTVSS
    68 MP3B1SRA QVQLQESGGGLVQPGGSLRLSCAASGFTSSNYAMSWVRQAPGKGLEWVSSI
    NSRTGSITYADSVKGRFTITLDNAKNTLYLQMNSLKPEDTAVYYCASRVDD
    RVSRGQGTQVTVSS
    69 MP2F10SR QVQLVESGGGLVQAGGSLRLSCAASGRTISSFRMGWFRRAPGEEREFVAFV
    RSNGTSTYYADSVEGRFTITRDNAKNTVYLRMDSLKPEDTAVYYCAAATTD
    YGGSFDYWGQGTQVTVSS
    70 MP3A7SRA QVQLQDSGGGLVQAGGSLRLSCAASGRTFSSFRMGWFRRAPGEEREFVAFV
    RSNGTSTYYADSVEGRFTITRDNAKNTVYLRMDSLKPEDTAVYYCAAATRD
    YGGSFDYWGQGTQVIVSS
    Anti-mouse serum albumin VHH
    71 MSA21 QVQLQESGGGLVQPGGSLRLSCEASGFTFSRFGMTWVRQAPGKGVEWVSGI
    SSLGDSTLYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCTIGGSL
    NPGGQGTQVTVSS
    72 MSAc16 AVQLVESGGGLVQAGDSLRLSCVVSGTTFSSAAMGWFRQAPGKEREFVGAI
    KWSGTSTYYTDSVKGRFTISRDNVKNTVYLQMNNLKPEDTGVYTCAADRDR
    YRDRMGPMTTTDFRFWGQGTQVTVSS
    73 MSAc112 QVKLEESGGGLVQTGGSLRLSCAASGRTFSSFAMGWFRQAPGRBREFVASI
    GSSGITTNYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTGLCYCAVNRYG
    IPYRSGTQYQNWGQGTQVTVSS
    74 MSAc110 EVQLEESGGGLVQPGGSLRLSCAASGLTFNDYAMGWYRQAPGKEPDMVATI
    SIGGRTYYADSNKGRFTISRDNAKNTVYLQMNSLKPEDTAIYYCVAHRQTV
    VRGPYLLWGQGTQVTVSS
    75 MSAc114 QVQLVESGGKLVQAGGSLRLSCAASGRTFSNYAMGWFRQAPGKEREFVAGS
    GRSNSYNYYSDSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAASTNL
    WPRDRNLYAYWGQGTQVTVSS
    76 MSAc116 EVQLVESGGGLVQAGDSLRLSCAASGRSLGIYRMGWFRQVPGKEREFVAAI
    SWSGGTTRYLDSVKGRFTISRDSTKNAVYLQMNSLKPEDTAVYYCAVDSSG
    RLYWTLSTSYDYWGQGTQVTVSS
    77 MSAc119 QVQLVEFGGGLVQAGDSLRLSCAASGRSLGIYKMAWFRQVPGKEREFVAAI
    SWSGGTTRYIDSVKGRFTLSRDNTKNMVYLQMNSLKPDDTAVYYCAVDSSG
    RLYWTLSTSYDYWGQGTQVTVSS
    78 MSAc15 EVQLVESGGGLVQAGGSLSLSCAASGRTFSPYTMGWFRQAPGKEREFLAGV
    TWSGSSTFYGDSVKGRFTASRDSAKNTVTLEMNSLNPEDTAVYYCAAAYGG
    GLYRDPRSYDYWGRGTQVTVSS
    79 MSc111 AVQLVESGGGLVQAGGSLRLSCAASGFTLDAWPIAWFRQAPGKEREGVSCI
    RDGTTYYADSVKGRFTISSDNANNTVYLQTNSLKPEDTAVYYCAAPSGPAT
    GSSHTFGIYWNLRDDYDNWGQGTQVTVSS
    80 MSAc115 EVQLVESGGGLVQAGGSLRLSCAASGFTFDHYTIGWFRQVPGKEREGVSCI
    SSSDGSTYYADSVKGRFTISSDNAKNTVYLQMNTLEPDDTAVYYCAAGGLL
    LRVEELQASDYDYWGQGIQVTVSS
    81 MSAc18 AVQLVDSGGGLVQPGGSLRLSCTASGFTLDYYAIGWFRQAPGKEREGVACI
    SNSDGSTYYGDSVKGRFTISRDNAKTTVYLQMNSLKPEDTAVYYCATADRH
    YSASHHPFADFAFNSWGQGTQVTVSS
    82 MSAc17 EVQLVESGGGLVQAGGSLRLSCAAYGLTFWRAAMAWFRRAPGKERELVVAR
    NWGDGSTRYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAACRTY
    GSATYDIWGQGTQVTVSS
    83 MSAc120 EVQLVESGGGLVQDGGSLRLSCIFSGRTFANYAMGWFRQAPGKEREFVAAI
    NRNGGTTNYADALKGRFTISRDNTKNTAFLQMNSLKPDDTAVYYCAAREWP
    FSTIPSGWRYWGQGTQVTVSS
    84 MSAc14 DVQLVESGGGWVQPGGSLRLSCAASGPTASSHAIGWFRQAPGKEREFVVGI
    NRGGVTRDYADSVKGRFAVSRDNVKNTVYLQMNRLKPEDSAIYICAARPEY
    SFTAMSKGDMDYWGKGTLVTVSS
  • TABLE 15
    Immunisation scheme according to Example 32
    Day of Llama 005 Llama006 Llama005 Llama006
    immunization EGFr EGFr PDK1 PDK1
    0 100 μg 40 μg 40 μg 40 μg
    7 100 μg 40 μg
    14 50 μg 20 μg
    21 50 μg 40 μg 20 μg 40 μg
    28 50 μg 20 μg
    35 50 μg 20 μg
    42 20 μg 20 μg
    70 20 μg 20 μg
  • TABLE 16
    Results of panning according to Example 35
    Pfu Pfu
    llama Source RNA Elution conditions EGFr casein Enrichment
    005 Pool of the 3 0.2 M glycin, pH 1 × 107 1 × 104 1000
    libraries 2.4
    006 Pool of the 3 0.2 M glycin, pH 5 × 106 1 × 104 500
    libraries 2.4
  • TABLE 17
    Results of panning according to Example 35
    Pfu Pfu
    llama Source RNA Elution conditions PDK1 casein Enrichment
    005 Pool of the 3 0.2 M glycin, pH 1 × 108 1 × 104 10000
    libraries 2.4
    006 Pool of the 3 0.2 M glycin, pH 9 × 107 1 × 104 9000
    libraries 2.4
  • TABLE 18
    Number of positive clones after screening
    according to Example 36
    target Llama005 Llama006
    EGFr 26/95 38/95
    PDK1 93/95 87/95
  • TABLE 19
    Number of inhibiting VHH vs number of VHH tested
    in inhibition ELISA according to Example 38.
    target Llama005 Llama006
    PDK1 56/93 63/87
  • TABLE 20
    Fractional homologies between anti-TNF-alpha VHHs of the invention.
    SEQ VHH#1A VHH#7B VHH#2B VHH#3E VHH#3G VHH#10A VHH#2G VHH#1F
    VHH#1A 1.000 0.601 0.764 0.596 0.622 0.600 0.682 0.629
    VHH#7B 1.000 0.604 0.635 0.645 0.943 0.653 0.616
    VHH#2B 1.000 0.620 0.645 0.611 0.682 0.661
    VHH#3E 1.000 0.875 0.641 0.713 0.689
    VHH#3G 1.000 0.651 0.779 0.740
    VHH#10A 1.000 0.658 0.614
    VHH#2G 1.000 0.741
    VHH#1F 1.000
    VHH#9C
    VHH#11E
    VHH#10C
    VHH#4B
    VHH#10D
    VHH#12B
    VHH#9E
    VHH#3F
    VHH#3E
    SEQ VHH#9C VHH#11E VHH#10C VHH#4B VHH#10D VHH#12B VHH#9E VHH#3F
    VHH#1A 0.609 0.601 0.614 0.818 0.642 0.747 0.596 0.604
    VHH#7B 0.933 0.933 0.719 0.593 0.614 0.620 0.616 0.624
    VHH#2B 0.629 0.620 0.637 0.796 0.634 0.951 0.620 0.645
    VHH#3E 0.620 0.643 0.612 0.604 0.648 0.596 0.674 0.682
    VHH#3G 0.637 0.637 0.653 0.645 0.689 0.622 0.708 0.716
    VHH#10A 0.935 0.935 0.725 0.592 0.612 0.626 0.622 0.637
    VHH#2G 0.653 0.669 0.685 0.666 0.746 0.650 0.701 0.717
    VHH#1F 0.616 0.616 0.664 0.661 0.714 0.645 0.709 0.717
    VHH#9C 1.000 0.941 0.743 0.601 0.622 0.645 0.600 0.616
    VHH#11E 1.000 0.719 0.601 0.622 0.637 0.608 0.624
    VHH#10C 1.000 0.650 0.606 0.637 0.600 0.632
    VHH#4B 1.000 0.611 0.796 0.588 0.629
    VHH#10D 1.000 0.619 0.674 0.674
    VHH#12B 1.000 0.604 0.637
    VHH#9E 1.000 0.854
    VHH#3F 1.000
  • TABLE 21
    Percentage homologies between anti-IFN-gamma VHHs of the invention
    % Homology
    MP3D2SRA MP3A3SR MP3C5SR MP3C1SR MP3G8SR P3D2BR MP3H6SRA MP3B4SRA MP4E4BR
    MP3D2SRA X 96 66 66 66 62 71 71 71
    MP3A3SR X 66 66 66 62 72 72 72
    MP3C5SR X 97 98 73 65 65 64
    MP3C1SR X 98 72 64 64 64
    MP3G8SR X 73 65 65 64
    MP3D2BR X 63 63 63
    MP3H6SRA X 100  97
    MP3B4SRA X 97
    MP4E4BR X
    MP4H8SR
    MP2F6SR
    MP3D1BR
    MP2B5BR
    MP2C1BR
    MP4A12SR
    MP3F4SRA
    MP3D3BR
    MP3E5BR
    MP3C7SRA
    MP2F1BR
    MP2C5BR
    MP2C10BR
    MP2G5SR
    MP3B1SRA
    MP2F10SR
    MP3A7SRA
    MP4C10SR
    MP4D5BR
    MP3F1SRA
    MP6D8BR
    MP6B1BR
    MP6A8BR
    MP6B12BR
    MP6C11BR
    MP6B10BR
    % Homology
    MP4H8SR MP2F6SR MP3D1BR MP2B5BR MP2C1BR MP4A12SR MP3F4SRA MP3D3BR MP3E5BR
    MP3D2SRA 70 68 69 65 63 64 68 66 67
    MP3A3SR 71 70 71 65 63 64 68 66 67
    MP3C5SR 63 63 63 60 58 59 64 64 65
    MP3C1SR 62 62 62 58 57 58 65 64 64
    MP3G8SR 63 63 63 59 58 59 64 64 65
    MP3D2BR 62 63 64 59 58 58 62 61 62
    MP3H6SRA 97 80 81 67 68 67 75 71 73
    MP3B4SRA 97 80 81 67 68 67 75 71 73
    MP4E4BR 97 81 82 68 69 68 73 70 71
    MP4H8SR X 81 81 66 66 66 72 69 71
    MP2F6SR X 94 65 68 64 70 67 69
    MP3D1BR X 65 66 65 71 69 71
    MP2B5BR X 95 97 63 64 64
    MP2C1BR X 95 63 64 64
    MP4A12SR X 63 64 64
    MP3F4SRA X 94 96
    MP3D3BR X 98
    MP3E5BR X
    MP3C7SRA
    MP2F1BR
    MP2C5BR
    MP2C10BR
    MP2G5SR
    MP3B1SRA
    MP2F10SR
    MP3A7SRA
    MP4C10SR
    MP4D5BR
    MP3F1SRA
    MP6D8BR
    MP6B1BR
    MP6A8BR
    MP6B12BR
    MP6C11BR
    MP6B10BR
    % Homology
    MP3C7SRA MP2F1BR MP2C5BR MP2C10BR MP2G5SR MP3B1SRA MP2F10SR MP3A7SRA MP4C10SR
    MP3D2SRA 68 71 70 68 67 63 67 68 60
    MP3A3SR 68 72 72 69 67 64 66 67 60
    MP3C5SR 66 65 65 65 63 63 64 64 61
    MP3C1SR 65 64 63 64 62 63 64 65 60
    MP3G8SR 66 65 64 65 63 63 65 65 61
    MP3D2BR 63 64 63 63 63 64 63 63 63
    MP3H6SRA 75 73 71 73 71 66 75 75 63
    MP3B4SRA 75 73 71 73 71 66 75 75 63
    MP4E4BR 73 73 71 73 71 66 75 75 63
    MP4H8SR 72 71 71 72 71 64 73 73 62
    MP2F6SR 71 67 65 73 71 63 71 70 62
    MP3D1BR 72 67 65 70 69 63 71 71 62
    MP2B5BR 64 65 63 64 63 60 66 63 57
    MP2C1BR 64 63 61 66 65 59 66 63 56
    MP4A12SR 64 62 60 63 62 59 65 63 56
    MP3F4SRA 97 69 67 68 68 62 67 69 60
    MP3D3BR 96 70 68 67 67 62 67 67 60
    MP3E5BR 98 70 68 68 69 63 68 68 60
    MP3C7SRA X 71 69 69 70 63 69 69 61
    MP2F1BR X 94 66 67 63 68 67 61
    MP2C5BR X 66 67 63 67 65 62
    MP2C10BR X 94 62 68 66 59
    MP2G5SR X 62 67 65 59
    MP3B1SRA X 66 65 91
    MP2F10SR X 97 61
    MP3A7SRA X 61
    MP4C10SR X
    MP4D5BR
    MP3F1SRA
    MP6D8BR
    MP6B1BR
    MP6A8BR
    MP6B12BR
    MP6C11BR
    MP6B10BR
    % Homology
    MP4D5BR MP3F1SRA MP6D6BR MP6B1BR MP6A8BR MP6B12BR MP6C11BR MP6B10BR
    MP3D2SRA 72 65 68 67 66 67 76 70
    MP3A3SR 73 65 67 67 65 66 77 71
    MP3C5SR 67 60 74 63 60 63 70 64
    MP3C1SR 67 59 73 63 60 62 70 65
    MP3G8SR 66 60 73 63 61 63 71 64
    MP3D2BR 65 58 73 64 60 63 68 67
    MP3H6SRA 71 69 71 71 68 70 82 70
    MP3B4SRA 71 69 71 71 68 70 82 70
    MP4E4BR 72 70 71 71 68 70 80 71
    MP4H8SR 70 67 69 70 67 70 79 71
    MP2F6SR 69 66 67 69 68 67 78 69
    MP3D1BR 68 66 67 71 69 69 79 70
    MP2B5BR 63 84 65 63 63 62 70 65
    MP2C1BR 61 85 65 64 63 62 70 65
    MP4A12SR 61 84 64 63 63 62 70 65
    MP3F4SRA 72 63 67 68 65 65 76 71
    MP3D3BR 70 64 66 66 64 64 75 69
    MP3E5BR 72 64 67 68 65 66 77 71
    MP3C7SRA 72 64 68 68 66 66 78 71
    MP2F1BR 70 64 68 65 64 64 74 67
    MP2C5BR 69 63 67 64 62 63 73 67
    MP2C10BR 67 66 69 68 64 68 74 73
    MP2G5SR 67 65 67 66 64 66 73 73
    MP3B1SRA 67 60 67 69 68 69 69 65
    MP2F10SR 67 65 71 66 65 67 77 68
    MP3A7SRA 68 63 71 65 65 67 77 69
    MP4C10SR 64 58 65 64 63 66 66 63
    MP4D5BR X 64 69 68 65 67 76 73
    MP3F1SRA X 65 64 64 63 71 68
    MP6D8BR X 70 65 70 77 73
    MP6B1BR X 78 81 76 71
    MP6A8BR X 75 74 66
    MP6B12BR X 73 68
    MP6C11BR X 77
    MP6B10BR X
  • REFERENCES
    • Okayasu I, Hatakeyama S, Yamada M, Ohkusa T. Inagaki Y. Nakaya R. A novel method in the induction of reliable experimental acute and chronic ulcerative colitis in mice. Gastroenterology 1990;98:694-702.
    • Kojouharoff G, Hans W, Obermeier F, Mannel D N, Andus T, Scholmerich J, Gross V, Falk W. Neutralization of tumour necrosis factor (TNF) but not of IL-1 reduces inflammation in chronic dextran sulphate sodium-induced colitis in mice. Clin Exp Immunol 1997;107:353-8.
      MMP12
    • Salmela M T, Pender S L, Reunala T, MacDonald T, Saarialho-Kere U. Gut, 2001;48(4):496-502
    • Parallel expression of macrophage metalloelastase (MMP-12) in duodenal and skin lesions of patients with dermatitis herpetiformis.
    • Chavey C, Mari B, Monthouel M N, Bonnafous S, Anglard P, Van Obberghen E, Tartare-Deckert S.
    • J. Biol. Chem., 2003; 278: 11888-11896.
    • Matrix metalloproteinases are differentially expressed in adipose tissue during obesity and modulate adipocyte differentiation.
    • Churg A, Wang R D, Tai H, Wang X, Xie C, Dai J, Shapiro S D, Wright J L.
    • Am. J. Respir. Crit. Care Med., 2003; 167: 1083-1089.
    • Macrophage Metalloelastase Mediates Acute Cigarette Smoke-Induced Inflammation Via TNF-alpha Release.
    • R Lang, A Kocourek, M Braun, H Tschesche, R Huber, W Bode, K Maskos
    • J Mol Biol, September 2001; 312(4): 731-42.
    • Substrate specificity determinants of human macrophage elastase (MMP-12) based on the 1.1 A crystal structure.
    • Yoshikatsu Kaneko, Minoru Sakatsume, Yuansheng Xie, Takeshi Kuroda, Michiko Igashima, Ichiel Narita and Fumitake Gejyo
    • The Journal of Immunology, 2003, 170: 3377-3385.
    • Macrophage Metalloelastase as a Major Factor for Glomerular Injury in Anti-Glomerular Basement Membrane Nephritis
    • Ding Y, Shimada Y, Gorrin-Rivas M J, Itami A, Li Z, Hong T. Maeda M, Komoto I, Kawabe A, Kaganoi J, Imamura M.
    • Oncology 2002;63(4):378-84.
    • Clinicopathological significance of human macrophage metalloelastase expression in esophageal squamous cell carcinoma.
    • Kerkela E, Ala-Aho R, Jeskanen L, Rechardt O, Grenman R, Shapiro S D, Kahari V M, Saarialho-Kere U.
    • J Invest Dermatol 2000 June; 114(6):1113-9
    • Expression of human macrophage metalloelastase (MMP-12) by tumor cells in skin cancer.

Claims (57)

1. A method for delivering an anti-target compound to a subject for the treatment of a disorder without being inactivated by administering thereto a polypeptide construct comprising one or more single domain antibodies directed against said target.
2. A method according to claim 1 wherein said target is located in the gut system, and said polypeptide construct is delivered orally.
3. A method according to claim 1 wherein said target is located in vaginal and/or rectal tract, and said polypeptide construct is delivered to the vaginal and/or rectal tract.
4. A method according to claim 1 wherein said target is located in nose, upper respiratory tract and/or lung, and said polypeptide construct is delivered to nose, upper respiratory tract and/or lung.
5. A method according to claim 1 wherein said target is located in intestinal mucosa, and said polypeptide construct is delivered orally.
6. A method according to claim 1 wherein said target is located in the tissues beneath the tongue, and said polypeptide construct is delivered to the tissues beneath the tongue.
7. A method according to claim 1 wherein said target is located in the skin, and said polypeptide construct is delivered topically.
8. A method according to claim 1 wherein said target is in, or accessible via the blood, and said polypeptide construct is delivered orally, to the vaginal and/or rectal tract, nasally, by inhalation though the mouth or nose, to the tissues beneath the tongue, or topically.
9. A polypeptide construct comprising at least one single domain antibody directed against a target, wherein the single domain antibody corresponds to a sequence represented by any of SEQ ID NOs: 12 to 70.
10.-14. (canceled)
15. A method according to claim 1, wherein said target is TNF-alpha and the disorder is inflammation.
16. A method according to claim 15, wherein the single domain antibody corresponds to a sequence represented by any of SEQ ID NOs: 12 to 14.
17. A method according to claim 1, wherein said target is CEA and the disorder is colon cancer.
18. A method according to claim 1, wherein said target is EGFR and the disorder is any of head, neck, lung and colon cancer.
19. A method according to claim 18, wherein the single domain antibody corresponds to a sequence represented by any of SEQ ID NOs: 23 to 44.
20. A method according to claim 1, wherein said target is antigen of Helicobacter pylori and the disorder is any of indigestion and gastritis.
21. A method according to claim 1, wherein said target is antigen of Mycobacterium tuberculosis and the disorder is tuberculosis.
22. A method according to claim 1, wherein said target is antigen of influenza virus and the disorder is flu.
23. A method according to claim 1, wherein said target is antigen of MMP and the disorder is cancer.
24. A method according to claim 23, wherein the single domain antibody corresponds to a sequence represented by any of SEQ ID NOs: 15 to 22.
25. A method according to claim 1, wherein said target is an antigen of IFN-gamma and the disorder is any of cancer, transplant rejection, auto immune disorder.
26. A method according to claim 25, wherein the single domain antibody corresponds to a sequence represented by any of SEQ ID NOs: 45 to 70.
27. A method according to claim 1, wherein said target is any of an antigen of Helicobacter pylori, an antigen of Mycobacterium tuberculosis, and an antigen of influenza virus.
28. A polypeptide construct comprising (a) at least one single domain antibody directed against an internalising cellular receptor, and (b) at least one single domain antibody directed against a therapeutic target, or at least one therapeutic polypeptide or agent.
29. (canceled)
30. A polypeptide construct according to claim 28 wherein said internalising cellular receptor is Epidermal Growth Factor receptor.
31. A polypeptide construct according to claim 30 wherein a single domain antibody directed against an internalising cellular receptor corresponds to a sequence represented by SEQ ID NO: 23 to 44.
32. A polypeptide construct according to claim 28 wherein said internalising cellular receptor is any of LDL receptor, FGF2 receptor, ErbB2 receptor, transferrin receptor, PDGF receptor, VEGF receptor, or PsmAr.
33. A polypeptide construct according to claim 28 wherein a single domain antibody directed against a therapeutic target, is directed against PDK1.
34. (canceled)
35. A polypeptide construct according to claim 28 wherein a single domain antibody directed against a therapeutic target is directed against any of GSK1, Bad, caspase and Forkhead.
36. (canceled)
37. Method for delivering an anti-target therapeutic compound to the interior of a cell comprising administering to a subject a polypeptide construct according to claim 28.
38. (canceled)
39. A method according to claim 37 wherein said cell is located in the gut system, and said polypeptide construct is delivered orally.
40. A method according to claim 37 wherein said cell is located in vaginal and/or rectal tract, and said polypeptide construct is delivered to the vaginal and/or rectal tract.
41. A method according to claim 37 wherein said cell is located in nose, upper respiratory tract and/or lung, and said polypeptide construct is delivered to nose, upper respiratory tract and/or lung.
42. A method according to claim 37 wherein said cell is located in intestinal mucosa, and said polypeptide construct is delivered orally.
43. A method according to claim 37 wherein said cell is located in the tissues beneath the tongue, and said polypeptide construct is delivered to the tissues beneath the tongue.
44. A method according to claim 37 wherein said cell is located in the skin, and said polypeptide construct is delivered topically.
45. A method according to claim 37 wherein said cell is in, or accessible via the blood, and said polypeptide construct is delivered orally, to the vaginal and/or rectal tract, nasally, by inhalation though the mouth or nose, to the tissues beneath the tongue, or topically.
46. A polypeptide construct according to any of claims 9 or 28, or as used in a method according to claim 1, wherein the single domain antibodies are humanized Camelidae VHHs an homologous sequence a functional portion or a functional portion of an homologous sequence of the full length single domain antibody or wherein the polypeptide construct is an homologous sequence a functional portion, or a functional portion of an homologous sequence of the full length polypeptide construct.
47.-49. (canceled)
50. A nucleic acid encoding a polypeptide construct according to any of claims 9, 28, or 46.
51. A composition comprising a polypeptide construct according to any of claims 9, 28 or 46, together with a pharmaceutical carrier.
52. A method according to claim 1, wherein said target is antigen of IgE and the disorder is allergic response.
53. A method according to claim 52, wherein a single domain antibody corresponds to a sequence represented by any of SEQ ID NOs: 1 to 11.
54. A polypeptide construct comprising at least one single domain antibody directed against IgE.
55. A polypeptide construct according to claim 54 wherein at least one single domain antibody is a Camelidae VHH.
56. A polypeptide construct according to claim 54 wherein at least one single domain antibody corresponds to a sequence represented by any of SEQ ID NOs: 1 to 11.
57. A polypeptide construct according to claim 54, wherein the number of anti-IgE single domain antibodies is at least two.
58. A polypeptide construct according to claim 57, wherein at least one single domain antibody is a humanized Camelidae VHH.
59. A polypeptide construct according to claim 54, wherein a single domain antibody is an homologous sequence, a functional portion, or a functional portion of an homologous sequence of the full length single domain antibody.
60. A polypeptide construct according to claim 54, wherein the polypeptide construct is an homologous sequence, a functional portion, or a functional portion of an homologous sequence of the full length polypeptide construct.
61. A nucleic acid encoding a polypeptide construct according to claim 54.
62. A method for treating and/or preventing and/or alleviating disorders relating to inflammatory processes comprising administering to a subject in need of such treatment a polypeptide construct according to claim 54.
63. A composition comprising a polypeptide construct according to claim 54 together with a pharmaceutical carrier.
US10/534,292 2002-11-08 2003-11-07 Camelidae antibodies against imminoglobulin e and use thereof for the treatment of allergic disorders Abandoned US20060115470A1 (en)

Priority Applications (12)

Application Number Priority Date Filing Date Title
US10/534,292 US20060115470A1 (en) 2002-11-08 2003-11-07 Camelidae antibodies against imminoglobulin e and use thereof for the treatment of allergic disorders
US12/431,403 US20100003253A1 (en) 2002-11-08 2009-04-28 Single domain antibodies directed against epidermal growth factor receptor and uses therefor
US12/487,949 US20090324512A1 (en) 2002-11-08 2009-06-19 Polypeptide constructs for nasal administration
US12/487,895 US20100003249A1 (en) 2002-11-08 2009-06-19 Polypeptide constructs for topical administration
US12/487,712 US20100003248A1 (en) 2002-11-08 2009-06-19 Polypeptide constructs for rectal and/or vaginal administration
US12/488,077 US20100040613A1 (en) 2002-11-08 2009-06-19 Polypeptide constructs for sublingual administration
US12/487,684 US9243065B2 (en) 2002-11-08 2009-06-19 Polypeptide constructs including VHH directed against EGFR for intracellular delivery
US13/016,709 US20110123529A1 (en) 2002-11-08 2011-01-28 Single domain antibodies directed against epidermal growth factor receptor and uses therefor
US13/078,184 US20110184145A1 (en) 2002-11-08 2011-04-01 Method of administering therapeutic polypeptides, and polypeptides therefor
US13/078,703 US20110184151A1 (en) 2002-11-08 2011-04-01 Single domain antibodies directed against epidermal growth factor receptor and uses therefor
US13/761,554 US9320792B2 (en) 2002-11-08 2013-02-07 Pulmonary administration of immunoglobulin single variable domains and constructs thereof
US15/063,961 US9725522B2 (en) 2002-11-08 2016-03-08 Pulmonary administration of immunoglobulin single variable domains and constructs thereof

Applications Claiming Priority (10)

Application Number Priority Date Filing Date Title
US42506302P 2002-11-08 2002-11-08
US42507302P 2002-11-08 2002-11-08
EP03447005 2003-01-10
EP03447005.4 2003-01-10
EPPCT/EP03/06581 2003-06-23
WOPCT/EP03/06581 2003-06-23
WOPCT/EP03/07313 2003-07-08
EPPCT/EP2003/007313 2003-07-08
PCT/BE2003/000190 WO2004041867A2 (en) 2002-11-08 2003-11-07 Camelidae antibodies against imminoglobulin e and use thereof for the treatment of allergic disorders
US10/534,292 US20060115470A1 (en) 2002-11-08 2003-11-07 Camelidae antibodies against imminoglobulin e and use thereof for the treatment of allergic disorders

Related Parent Applications (3)

Application Number Title Priority Date Filing Date
PCT/BE2003/000190 A-371-Of-International WO2004041867A2 (en) 2002-11-08 2003-11-07 Camelidae antibodies against imminoglobulin e and use thereof for the treatment of allergic disorders
PCT/EP2010/050414 Continuation-In-Part WO2010081856A1 (en) 2002-11-08 2010-01-14 Pulmonary administration of immunoglobulin single variable domains and constructs thereof
US201113143736A Continuation-In-Part 2002-11-08 2011-09-02

Related Child Applications (8)

Application Number Title Priority Date Filing Date
US10/553,105 Continuation-In-Part US20060228355A1 (en) 2002-11-08 2003-11-07 Camelidae single domain antibodies vhh directed against epidermal growth factor receptor and uses therefor
PCT/BE2003/000189 Continuation-In-Part WO2005044858A1 (en) 2002-11-08 2003-11-07 Camelidae single domain antibodies vhh directed against epidermal growth factor receptor and uses therefor
US12/431,403 Continuation-In-Part US20100003253A1 (en) 2002-11-08 2009-04-28 Single domain antibodies directed against epidermal growth factor receptor and uses therefor
US12/488,077 Continuation US20100040613A1 (en) 2002-11-08 2009-06-19 Polypeptide constructs for sublingual administration
US12/487,949 Continuation US20090324512A1 (en) 2002-11-08 2009-06-19 Polypeptide constructs for nasal administration
US12/487,684 Continuation US9243065B2 (en) 2002-11-08 2009-06-19 Polypeptide constructs including VHH directed against EGFR for intracellular delivery
US12/487,895 Continuation US20100003249A1 (en) 2002-11-08 2009-06-19 Polypeptide constructs for topical administration
US12/487,712 Continuation US20100003248A1 (en) 2002-11-08 2009-06-19 Polypeptide constructs for rectal and/or vaginal administration

Publications (1)

Publication Number Publication Date
US20060115470A1 true US20060115470A1 (en) 2006-06-01

Family

ID=32893039

Family Applications (11)

Application Number Title Priority Date Filing Date
US10/534,349 Abandoned US20070178082A1 (en) 2002-11-08 2003-11-07 Stabilized single domain antibodies
US10/534,292 Abandoned US20060115470A1 (en) 2002-11-08 2003-11-07 Camelidae antibodies against imminoglobulin e and use thereof for the treatment of allergic disorders
US10/541,708 Active 2027-05-22 US9028816B2 (en) 2003-01-10 2004-01-09 Polypeptides and polypeptide constructs comprising single domain antibodies directed against von Willebrand factor
US12/487,684 Expired - Lifetime US9243065B2 (en) 2002-11-08 2009-06-19 Polypeptide constructs including VHH directed against EGFR for intracellular delivery
US12/488,077 Abandoned US20100040613A1 (en) 2002-11-08 2009-06-19 Polypeptide constructs for sublingual administration
US12/487,895 Abandoned US20100003249A1 (en) 2002-11-08 2009-06-19 Polypeptide constructs for topical administration
US12/487,949 Abandoned US20090324512A1 (en) 2002-11-08 2009-06-19 Polypeptide constructs for nasal administration
US12/487,712 Abandoned US20100003248A1 (en) 2002-11-08 2009-06-19 Polypeptide constructs for rectal and/or vaginal administration
US13/078,184 Abandoned US20110184145A1 (en) 2002-11-08 2011-04-01 Method of administering therapeutic polypeptides, and polypeptides therefor
US14/669,025 Expired - Lifetime US10112989B2 (en) 2003-01-10 2015-03-26 Polypeptides and polypeptide constructs comprising single domain antibodies directed against von Willebrand factor
US16/142,063 Expired - Fee Related US11034755B2 (en) 2003-01-10 2018-09-26 Polypeptides and polypeptide constructs comprising single domain antibodies directed against von willebrand factor

Family Applications Before (1)

Application Number Title Priority Date Filing Date
US10/534,349 Abandoned US20070178082A1 (en) 2002-11-08 2003-11-07 Stabilized single domain antibodies

Family Applications After (9)

Application Number Title Priority Date Filing Date
US10/541,708 Active 2027-05-22 US9028816B2 (en) 2003-01-10 2004-01-09 Polypeptides and polypeptide constructs comprising single domain antibodies directed against von Willebrand factor
US12/487,684 Expired - Lifetime US9243065B2 (en) 2002-11-08 2009-06-19 Polypeptide constructs including VHH directed against EGFR for intracellular delivery
US12/488,077 Abandoned US20100040613A1 (en) 2002-11-08 2009-06-19 Polypeptide constructs for sublingual administration
US12/487,895 Abandoned US20100003249A1 (en) 2002-11-08 2009-06-19 Polypeptide constructs for topical administration
US12/487,949 Abandoned US20090324512A1 (en) 2002-11-08 2009-06-19 Polypeptide constructs for nasal administration
US12/487,712 Abandoned US20100003248A1 (en) 2002-11-08 2009-06-19 Polypeptide constructs for rectal and/or vaginal administration
US13/078,184 Abandoned US20110184145A1 (en) 2002-11-08 2011-04-01 Method of administering therapeutic polypeptides, and polypeptides therefor
US14/669,025 Expired - Lifetime US10112989B2 (en) 2003-01-10 2015-03-26 Polypeptides and polypeptide constructs comprising single domain antibodies directed against von Willebrand factor
US16/142,063 Expired - Fee Related US11034755B2 (en) 2003-01-10 2018-09-26 Polypeptides and polypeptide constructs comprising single domain antibodies directed against von willebrand factor

Country Status (19)

Country Link
US (11) US20070178082A1 (en)
EP (10) EP2284192A3 (en)
JP (5) JP2006524036A (en)
KR (2) KR20050092029A (en)
CN (3) CN102584997A (en)
AT (1) ATE517922T1 (en)
AU (2) AU2004204262B2 (en)
BR (1) BRPI0406694B8 (en)
CA (4) CA2505326A1 (en)
DK (1) DK2316852T3 (en)
ES (4) ES2655912T3 (en)
IL (1) IL168357A (en)
MX (2) MXPA05004955A (en)
NO (1) NO337265B1 (en)
NZ (5) NZ540196A (en)
PT (1) PT2316852E (en)
RU (2) RU2357974C2 (en)
WO (4) WO2004041863A2 (en)
ZA (1) ZA200504996B (en)

Cited By (34)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20060034833A1 (en) * 2002-11-08 2006-02-16 Els Beirnaert Single domain antibodies directed against interferron-gamma and uses therefor
US20060034845A1 (en) * 2002-11-08 2006-02-16 Karen Silence Single domain antibodies directed against tumor necrosis factor alpha and uses therefor
US20060228355A1 (en) * 2003-11-07 2006-10-12 Toon Laeremans Camelidae single domain antibodies vhh directed against epidermal growth factor receptor and uses therefor
US20070178082A1 (en) * 2002-11-08 2007-08-02 Ablynx N.V. Stabilized single domain antibodies
US20080267949A1 (en) * 2006-12-05 2008-10-30 Ablynx N.V. Peptides capable of binding to serum proteins
EP2080770A1 (en) * 2008-01-21 2009-07-22 MorphoSys AG Proteinaceous binding molecules comprising purification tags
US20090238829A1 (en) * 2002-11-08 2009-09-24 Ablynx N.V. Stabilized single domain antibodies
US20100003253A1 (en) * 2002-11-08 2010-01-07 Ablynx N.V. Single domain antibodies directed against epidermal growth factor receptor and uses therefor
US20100172894A1 (en) * 2008-10-29 2010-07-08 Wyeth Methods for purification of single domain antigen binding molecules
WO2010100135A1 (en) * 2009-03-05 2010-09-10 Ablynx N.V. Novel antigen binding dimer-complexes, methods of making/avoiding and uses thereof
WO2009074634A3 (en) * 2007-12-13 2010-09-23 Glaxo Group Limited Polypeptides, antibody variable domains & antagonists
WO2011049449A1 (en) * 2009-10-22 2011-04-28 University Of Twente Vhh for application in tissue repair, organ regeneration, organ replacement and tissue engineering
US20110311515A1 (en) * 2009-01-14 2011-12-22 Ablynx N.V. Pulmonary administration of immunoglobulin single variable domains and constructs thereof
WO2012022814A1 (en) 2010-08-20 2012-02-23 Novartis Ag Antibodies for epidermal growth factor receptor 3 (her3)
EP2262530A4 (en) * 2008-03-03 2012-12-05 Dyax Corp Metalloproteinase 12 binding proteins
WO2013084147A2 (en) 2011-12-05 2013-06-13 Novartis Ag Antibodies for epidermal growth factor receptor 3 (her3)
WO2013084148A2 (en) 2011-12-05 2013-06-13 Novartis Ag Antibodies for epidermal growth factor receptor 3 (her3) directed to domain ii of her3
US8603824B2 (en) 2004-07-26 2013-12-10 Pfenex, Inc. Process for improved protein expression by strain engineering
WO2014159239A2 (en) 2013-03-14 2014-10-02 Novartis Ag Antibodies against notch 3
US20140363434A1 (en) * 2012-01-06 2014-12-11 Complix Nv Binding agents to intracellular target molecules
WO2015090229A1 (en) 2013-12-20 2015-06-25 Novartis Ag Regulatable chimeric antigen receptor
WO2016014553A1 (en) 2014-07-21 2016-01-28 Novartis Ag Sortase synthesized chimeric antigen receptors
AU2013202856B2 (en) * 2008-10-29 2016-02-11 Ablynx N.V. Formulations of single domain antigen binding molecules
US9265834B2 (en) 2009-03-05 2016-02-23 Ablynx N.V. Stable formulations of polypeptides and uses thereof
US9320792B2 (en) 2002-11-08 2016-04-26 Ablynx N.V. Pulmonary administration of immunoglobulin single variable domains and constructs thereof
US9393304B2 (en) 2008-10-29 2016-07-19 Ablynx N.V. Formulations of single domain antigen binding molecules
US9453251B2 (en) 2002-10-08 2016-09-27 Pfenex Inc. Expression of mammalian proteins in Pseudomonas fluorescens
US9580719B2 (en) 2007-04-27 2017-02-28 Pfenex, Inc. Method for rapidly screening microbial hosts to identify certain strains with improved yield and/or quality in the expression of heterologous proteins
EP3192808A1 (en) 2007-11-27 2017-07-19 The University Of British Columbia 14-3-3 antagonists for the prevention and treatment of arthritis
US9884117B2 (en) 2009-09-03 2018-02-06 Ablynx N.V. Stable formulations of polypeptides and uses thereof
EP3660042A1 (en) 2014-07-31 2020-06-03 Novartis AG Subset-optimized chimeric antigen receptor-containing t-cells
EP3811970A1 (en) 2014-03-15 2021-04-28 Novartis AG Regulatable chimeric antigen receptor
US11891433B2 (en) 2012-05-31 2024-02-06 United States Of America As Represented By The Secretary Of The Air Force Camelidae single-domain antibodies against Yersinia pestis and methods of use
US20250019464A1 (en) * 2023-07-13 2025-01-16 Phylaxis Bioscience, Llc IgE BINDING PROTEINS AND USES THEREOF

Families Citing this family (552)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090311267A1 (en) * 1999-08-10 2009-12-17 University Of Wurzburg Inhibition of VWF - GPIb/V/IX interaction and platelet-collagen interaction for prevention and treatment of cerebral attacks
US20060073141A1 (en) * 2001-06-28 2006-04-06 Domantis Limited Compositions and methods for treating inflammatory disorders
JP2005289809A (en) 2001-10-24 2005-10-20 Vlaams Interuniversitair Inst Voor Biotechnologie Vzw (Vib Vzw) Mutant heavy chain antibody
US9028822B2 (en) 2002-06-28 2015-05-12 Domantis Limited Antagonists against TNFR1 and methods of use therefor
EP1600459A3 (en) 2002-06-28 2005-12-07 Domantis Limited Ligand
US9321832B2 (en) 2002-06-28 2016-04-26 Domantis Limited Ligand
AU2003251238A1 (en) 2002-08-07 2004-02-25 Umc Utrecht Holding B.V. Modulation of platelet adhesion based on the surface exposed beta-switch loop of platelet glycoprotein ib-alpha
SI1639011T1 (en) 2003-06-30 2009-04-30 Domantis Ltd Pegylated single domain antibodies (dAb)
WO2005077980A2 (en) * 2004-02-13 2005-08-25 Bioceros Bv Soluble tcr-like molecules and their uses
US20050260155A1 (en) * 2004-05-18 2005-11-24 Gopala Kovvali Compositions and methods for treatment of ulcerative colitis
US8921528B2 (en) * 2004-06-01 2014-12-30 Domantis Limited Bispecific fusion antibodies with enhanced serum half-life
JP2008504356A (en) * 2004-06-30 2008-02-14 ドマンティス リミテッド Compositions and methods for treating inflammatory diseases
US7563443B2 (en) 2004-09-17 2009-07-21 Domantis Limited Monovalent anti-CD40L antibody polypeptides and compositions thereof
EP1841452B8 (en) 2004-10-08 2014-06-11 Domantis Limited Single domain antibodies against tnfr1 and methods of use therefor
WO2006040153A2 (en) * 2004-10-13 2006-04-20 Ablynx N.V. Single domain camelide anti -amyloid beta antibodies and polypeptides comprising the same for the treatment and diagnosis of degenarative neural diseases such as alzheimer's disease
BRPI0518761A2 (en) * 2004-12-02 2008-12-09 Domantis Ltd drug fusion, drug conjugate, Recombinant Nucleic Acid, Nucleic Acid Construction, Host Cell, Method for Producing a Drug Fusion, Pharmaceutical Composition, Drug, Method of Treatment and / or Prevention of a Condition in a Patient, Delay Method or prevention of disease progression, and a method for decreasing food absorption by a patient
CA2588892A1 (en) * 2004-12-02 2006-06-08 Dormantis Limited Anti-il-1r1 single domain antibodies and therapeutic uses
US20090111745A1 (en) * 2004-12-02 2009-04-30 Domantis Limited Plad Domain Peptides With Increased Serum Half Life Due To Conjugation To Domain Antibodies
CA2589839C (en) * 2004-12-02 2016-04-05 Unilever N.V. Method for affinity purification
US20090298195A1 (en) 2005-01-05 2009-12-03 F-Star Biotechnologische Forschungs-Und Entwicklun Gseges M.B.H. Synthetic immunoglobulin domains with binding properties engineered in regions of the molecule different from the complementarity determining regions
CA2593328C (en) 2005-01-14 2018-02-06 Ablynx N.V. Methods and assays for distinguishing between different forms of diseases and disorders characterized by thrombocytopenia and/or by spontaneous interaction between von willebrand factor (vwf) and platelets
JP4913034B2 (en) * 2005-02-14 2012-04-11 アルフレッサファーマ株式会社 ADAMTS13 activity assay antibody and activity assay method
WO2006097689A2 (en) * 2005-03-18 2006-09-21 Domantis Limited Antibodies against candida antigens
AU2012200682B2 (en) * 2005-05-18 2014-11-27 Ablynx Nv Improved NanobodiesTM against Tumor Necrosis Factor-alpha
AU2006249144B2 (en) * 2005-05-18 2011-11-17 Ablynx Nv Improved NanobodiesTM against Tumor Necrosis Factor-alpha
MX2007014564A (en) * 2005-05-20 2008-02-07 Ablynx Nv VHH ANTIBODIES OF SINGLE DOMAIN AGAINST VON WILLEBRAND FACTOR.
DE102005023617A1 (en) * 2005-05-21 2006-11-23 Aspre Ag Method for mixing colors in a display
US9017662B2 (en) 2005-08-30 2015-04-28 Actogenix N.V. Anti-TNF alpha producing lactic acid bacteria for the treatment of chronic enterocolitis
WO2007026972A2 (en) * 2005-09-01 2007-03-08 Canon Kabushiki Kaisha Binding protein molecule
US20100323905A1 (en) * 2005-09-23 2010-12-23 Academisch Ziekenhuis Leiden Vhh for the Diagnosis, Prevention and Treatment of Diseases Associated with Protein Aggregates
EP1940880A2 (en) * 2005-10-14 2008-07-09 Novo Nordisk A/S Treating diabetes using inhibitors of il-1
GB0521958D0 (en) * 2005-10-27 2005-12-07 Ares Trading Sa vWFA, collagen and kunitz domain containing protein
AR056806A1 (en) 2005-11-14 2007-10-24 Amgen Inc RANKL- PTH / PTHRP ANTIBODY CHEMICAL MOLECULES
NZ568992A (en) * 2005-11-17 2012-01-12 Biogen Idec Inc Platelet aggregation assays comprising platelet activiating agents and agents that cross-links the CD40L-binding moiety
JP2007172129A (en) * 2005-12-20 2007-07-05 Sony Corp Nonvolatile memory access control device and nonvolatile memory control system
EP2004690A2 (en) * 2006-03-13 2008-12-24 Ablynx N.V. Amino acid sequences directed against il-6 and polypeptides comprising the same for the treatment of diseases and disorders associated with il-6-mediated signalling
EP1999147A1 (en) * 2006-03-27 2008-12-10 Ablynx N.V. Medical delivery device for therapeutic proteins based on single domain antibodies
WO2007112940A2 (en) * 2006-03-31 2007-10-11 Ablynx N.V. Albumin-derived amino acid sequence, use thereof for increasing the half-life of therapeutic proteins and of other therapeutic compounds and entities, and constructs comprising the same
EP2010568A1 (en) * 2006-04-14 2009-01-07 Ablynx N.V. Dp-78-like nanobodies
US20070269422A1 (en) * 2006-05-17 2007-11-22 Ablynx N.V. Serum albumin binding proteins with long half-lives
AT503889B1 (en) 2006-07-05 2011-12-15 Star Biotechnologische Forschungs Und Entwicklungsges M B H F MULTIVALENT IMMUNE LOBULINE
AT503902B1 (en) 2006-07-05 2008-06-15 F Star Biotech Forsch & Entw METHOD FOR MANIPULATING IMMUNE LOBULINS
US20080015145A1 (en) 2006-07-11 2008-01-17 Maria Gyongyossy-Issa Mimotope receptors and inhibitors for platelet-platelet and platelet-endothelium interactions
CN101646689A (en) * 2006-09-08 2010-02-10 埃博灵克斯股份有限公司 Serum albumin binding proteins with long half-lives
SI3028716T1 (en) 2006-10-10 2021-01-29 Regenesance B.V. Complement inhibition for improved nerve regeneration
JP2010505435A (en) * 2006-10-11 2010-02-25 アブリンクス エン.ヴェー. Amino acid sequences that bind to serum proteins essentially independently of pH, compounds containing them, and uses thereof
WO2008049881A2 (en) * 2006-10-25 2008-05-02 Umc Utrecht Holding Bv Polypeptides and pharmaceutical compositions comprising the same for the prevention and treatment of complications associated with infectious diseases
US20100129354A1 (en) * 2006-10-27 2010-05-27 Ablynx N.V. Intranasal delivery of polypeptides and proteins
GB0621513D0 (en) 2006-10-30 2006-12-06 Domantis Ltd Novel polypeptides and uses thereof
WO2008071751A1 (en) * 2006-12-14 2008-06-19 Actogenix N.V. Delivery of binding molecules to induce immunomodulation
CA2673331A1 (en) 2006-12-19 2008-06-26 Ablynx N.V. Amino acid sequences directed against gpcrs and polypeptides comprising the same for the treatment of gpcr-related diseases and disorders
AU2007336243B2 (en) * 2006-12-19 2012-07-26 Ablynx N.V. Amino acid sequences directed against a metalloproteinase from the ADAM family and polypeptides comprising the same for the treatment of ADAM-related diseases and disorders
US9023352B2 (en) 2007-02-20 2015-05-05 Tufts University Methods, compositions and kits for treating a subject using a recombinant heteromultimeric neutralizing binding protein
SI2308514T1 (en) 2007-03-23 2013-09-30 To-Bbb Holding B.V. Conjugates for targeted drug delivery across the blood-brain barrier
WO2008121814A1 (en) * 2007-03-28 2008-10-09 Ats Medical, Inc. Method for inhibiting platelet interaction with biomaterial surfaces
WO2008124858A2 (en) * 2007-04-11 2008-10-23 F-Star Biotechnologische Forschungs- Und Entwicklungsges. M.B.H. Targeted receptor
US9394571B2 (en) * 2007-04-27 2016-07-19 Pfenex Inc. Method for rapidly screening microbial hosts to identify certain strains with improved yield and/or quality in the expression of heterologous proteins
KR101264473B1 (en) 2007-05-24 2013-05-29 아블린쓰 엔.브이. Amino acid sequences directed against rank-l and polypeptides comprising the same for the treatment of bone diseases and disorders
WO2008150431A1 (en) * 2007-05-29 2008-12-11 Yale University Il- 18 and protein kinase r inhibition for the treatment of copd
AU2008259590A1 (en) 2007-06-06 2008-12-11 Domantis Limited Methods for selecting protease resistant polypeptides
PL3241842T3 (en) 2007-06-26 2024-06-10 F-Star Therapeutics Limited Display of binding agents
AU2008270274B2 (en) 2007-07-03 2012-06-28 Ablynx N.V. Providing improved immunoglobulin sequences by mutating CDR and/or FR positions
US8629246B2 (en) * 2007-09-26 2014-01-14 Ucb Pharma S.A. Dual specificity antibody fusions
GB2453589A (en) 2007-10-12 2009-04-15 King S College London Protease inhibition
WO2009068631A1 (en) 2007-11-27 2009-06-04 Ablynx N.V. Method for obtaining polypeptide constructs comprising two or more single domain antibodies
WO2009086400A2 (en) * 2007-12-28 2009-07-09 Baxter International Inc. Recombinant vwf formulations
CA2717015A1 (en) 2008-03-05 2009-09-11 Ablynx Nv Novel antigen binding dimer-complexes, methods of making and uses thereof
CA2718081A1 (en) * 2008-03-21 2009-09-24 Ablynx Nv Von willebrand factor specific binders and methods of use therefor
GB0805608D0 (en) * 2008-03-28 2008-04-30 Sec Dep For Environment Food & Detection method
GB0809069D0 (en) 2008-05-19 2008-06-25 Univ Leuven Kath Gene signatures
AU2009235467A1 (en) 2008-04-07 2009-10-15 Ablynx Nv Single variable domains against the Notch pathways
CN102089325A (en) 2008-04-17 2011-06-08 埃博灵克斯股份有限公司 Peptides capable of binding to serum proteins and compounds, constructs and polypeptides comprising the same
US9296810B2 (en) 2008-05-02 2016-03-29 Novartis Ag Fibronectin-based binding molecules and uses thereof
EP2113255A1 (en) 2008-05-02 2009-11-04 f-star Biotechnologische Forschungs- und Entwicklungsges.m.b.H. Cytotoxic immunoglobulin
PE20091931A1 (en) 2008-05-22 2009-12-31 Bristol Myers Squibb Co MULTIVALENT FIBRONECTIN-BASED FRAME DOMAIN PROTEINS
US8444976B2 (en) 2008-07-02 2013-05-21 Argen-X B.V. Antigen binding polypeptides
EP2700651B1 (en) 2008-07-18 2019-04-10 Bristol-Myers Squibb Company Compositions monovalent for CD28 binding and methods of use
WO2010035012A1 (en) 2008-09-26 2010-04-01 Ucb Pharma S.A. Biological products
CA2740561C (en) 2008-10-14 2021-01-19 National Research Council Of Canada Bsa-specific antibodies
WO2010043057A1 (en) * 2008-10-14 2010-04-22 National Research Counsil Of Canada Bsa-specific antibodies
JP2012506237A (en) * 2008-10-21 2012-03-15 ドマンティス リミテッド Ligand with binding specificity for DC-SIGN
TWI496582B (en) 2008-11-24 2015-08-21 必治妥美雅史谷比公司 Bispecific egfr/igfir binding molecules
WO2010063818A2 (en) 2008-12-05 2010-06-10 Glaxo Group Limited Methods for selecting protease resistant polypeptides
EA022925B1 (en) 2009-02-19 2016-03-31 Глаксо Груп Лимитед Improved anti-tnfr1 polypeptides, antibody variable domains & antagonists
US8748581B2 (en) 2009-04-10 2014-06-10 Ablynx N.V. Anti-IL-6R polypeptides and pharmaceutical compositions thereof
AU2010236256C1 (en) * 2009-04-16 2015-10-22 Abbvie Biotherapeutics Inc. Anti-TNF-alpha antibodies and their uses
HUE053480T2 (en) 2009-04-30 2021-06-28 Ablynx Nv Method for the production of domain antibodies
KR101852204B1 (en) 2009-06-05 2018-04-26 아블린쓰 엔.브이. Monovalent, bivalent and trivalent anti human respiratory syncytial virus (hrsv) nanobody constructs for the prevention and/or treatment of respiratory tract infections
US9150640B2 (en) 2009-07-10 2015-10-06 Ablynx N.V. Method for the production of variable domains
WO2011006914A2 (en) 2009-07-16 2011-01-20 Glaxo Group Limited Antagonists, uses & methods for partially inhibiting tnfr1
JP5426026B2 (en) 2009-07-28 2014-02-26 エフ・ホフマン−ラ・ロシュ・アクチェンゲゼルシャフト Non-invasive in vivo optical imaging method
KR20120063475A (en) 2009-07-29 2012-06-15 글락소 그룹 리미티드 Anti-tgf-beta receptor type ii single domain antibodies
GB201005063D0 (en) 2010-03-25 2010-05-12 Ucb Pharma Sa Biological products
US20110195494A1 (en) 2009-10-02 2011-08-11 Boehringer Ingelheim International Gmbh Dll4-binging molecules
UY32920A (en) 2009-10-02 2011-04-29 Boehringer Ingelheim Int BISPECIFIC UNION MOLECULES FOR ANTI-ANGIOGENESIS THERAPY
WO2011042398A1 (en) 2009-10-09 2011-04-14 Ablynx Nv Immunoglobulin single variable domain directed against human cxcr4 and other cell associated proteins and methods to generate them
TW201125877A (en) 2009-10-27 2011-08-01 Glaxo Group Ltd Stable anti-TNFR1 polypeptides, antibody variable domains & and antagonists
ES2860453T3 (en) 2009-10-30 2021-10-05 Novartis Ag Universal libraries of type III fibronectin underside binding domain
WO2011051327A2 (en) * 2009-10-30 2011-05-05 Novartis Ag Small antibody-like single chain proteins
WO2011064382A1 (en) 2009-11-30 2011-06-03 Ablynx N.V. Improved amino acid sequences directed against human respiratory syncytial virus (hrsv) and polypeptides comprising the same for the prevention and/or treatment of respiratory tract infections
US20120321640A1 (en) 2009-12-01 2012-12-20 Ablynx N.V. Von willebrand factor specific binding agents and uses thereof
HRP20251657T1 (en) 2009-12-14 2026-02-13 Ablynx N.V. SINGLE VARIABLE DOMAIN IMMUNOGLOBULIN ANTIBODIES AGAINST OX40L, CONSTRUCTS AND THEIR THERAPEUTIC USE
WO2011083141A2 (en) 2010-01-08 2011-07-14 Ablynx Nv Method for generation of immunoglobulin sequences by using lipoprotein particles
TWI513466B (en) 2010-01-20 2015-12-21 Boehringer Ingelheim Int Anticoagulant antidotes
CN102781959A (en) 2010-02-05 2012-11-14 埃博灵克斯股份有限公司 Peptides capable of binding to serum albumin and compounds, constructs and polypeptides comprising the same
US9120855B2 (en) 2010-02-10 2015-09-01 Novartis Ag Biologic compounds directed against death receptor 5
ES2738114T3 (en) 2010-02-11 2020-01-20 Ablynx Nv Methods and compositions for aerosol preparation
EP2533814A2 (en) 2010-02-11 2012-12-19 Ablynx N.V. Delivery of immunoglobulin variable domains and constructs thereof
KR20130010461A (en) 2010-02-18 2013-01-28 브리스톨-마이어스 스큅 컴퍼니 Fibronectin based scaffold domain proteins that bind il-23
US8337845B2 (en) 2010-03-03 2012-12-25 Boehringer Ingelheim International Gmbh A-beta binding polypeptides
EP2552962B1 (en) 2010-03-26 2016-03-23 Ablynx N.V. Immunoglobulin single variable domains directed against cxcr7
CA2794551A1 (en) 2010-03-26 2011-09-29 Westfaelische Wilhelms-Universitaet Muenster Substitute therapy for glucocorticoids
US9101674B2 (en) 2010-03-29 2015-08-11 Vib Vzw Targeting and in vivo imaging of tumor-associated macrophages
US9556273B2 (en) 2010-03-29 2017-01-31 Vib Vzw Anti-macrophage mannose receptor single variable domains for targeting and in vivo imaging of tumor-associated macrophages
ES2689875T3 (en) 2010-04-13 2018-11-16 Bristol-Myers Squibb Company Proteins with a fibronectin-based framework domain that bind PCSK9
CA2798432A1 (en) 2010-05-06 2011-11-10 Novartis Ag Compositions and methods of use for therapeutic low density lipoprotein -related protein 6 (lrp6) antibodies
CN102939538A (en) 2010-05-07 2013-02-20 霍夫曼-拉罗奇有限公司 Diagnostic method for the detection of cells ex vivo
MX2012013490A (en) 2010-05-20 2013-01-29 Ablynx Nv BIOLOGICAL MATERIALS RELATED TO HER3.
US9562089B2 (en) 2010-05-26 2017-02-07 Bristol-Myers Squibb Company Fibronectin based scaffold proteins having improved stability
WO2011161263A1 (en) 2010-06-25 2011-12-29 Ablynx Nv Pharmaceutical compositions for cutaneous administration
WO2012007880A2 (en) 2010-07-16 2012-01-19 Ablynx Nv Modified single domain antigen binding molecules and uses thereof
MX345300B (en) 2010-07-30 2017-01-24 Novartis Ag * Fibronectin cradle molecules and libraries thereof.
US20120225081A1 (en) 2010-09-03 2012-09-06 Boehringer Ingelheim International Gmbh Vegf-binding molecules
US20120244141A1 (en) 2010-09-28 2012-09-27 Boehringer Ingelheim International Gmbh Stratification of cancer patients for susceptibility to therapy with PTK2 inhibitors
US11644471B2 (en) 2010-09-30 2023-05-09 Ablynx N.V. Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains
EP2621953B1 (en) 2010-09-30 2017-04-05 Ablynx N.V. Biological materials related to c-met
ES2660895T3 (en) 2010-10-29 2018-03-26 Ablynx N.V. Method for the production of individual variable domains of immunoglobulin
EA037063B1 (en) 2010-11-08 2021-02-01 Аблинкс Н.В. Cxcr2 binding polypeptides
CN113278077A (en) 2010-11-26 2021-08-20 分子组合公司 Designed repeat proteins that bind to serum albumin
WO2012088006A1 (en) 2010-12-22 2012-06-28 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind il-23
US9598499B2 (en) * 2010-12-30 2017-03-21 Institut National De La Santé Et De La Recherche Médicale (Inserm) Antigen binding formats for use in therapeutic treatments or diagnostic assays
PE20140982A1 (en) 2011-01-06 2014-08-22 Glaxo Group Ltd LINKS THAT JOIN THE TRANSFORMANT GROWTH FACTOR-BETA RECEPTOR II
EP2683413A1 (en) 2011-03-07 2014-01-15 F.Hoffmann-La Roche Ag In vivo selection of therapeutically active antibodies
US20140099264A1 (en) 2011-03-07 2014-04-10 F. Hoffman-La Roche Ag Means and methods for in vivo testing of therapeutic antibodies
EP2691418A1 (en) 2011-03-28 2014-02-05 Ablynx N.V. Bispecific anti-cxcr7 immunoglobulin single variable domains
US9468679B2 (en) 2011-03-28 2016-10-18 Ablynx N.V. Method for producing solid formulations comprising immunoglobulin single variable domains
PE20140964A1 (en) 2011-03-30 2014-08-17 Boehringer Ingelheim Int ANTICOAGULANT ANTIDOTES
CN106039306A (en) 2011-03-30 2016-10-26 埃博灵克斯股份有限公司 Methods of treating immune disorders with single domain antibodies against TNF-alpha
US20130078247A1 (en) * 2011-04-01 2013-03-28 Boehringer Ingelheim International Gmbh Bispecific binding molecules binding to dii4 and ang2
US9527925B2 (en) 2011-04-01 2016-12-27 Boehringer Ingelheim International Gmbh Bispecific binding molecules binding to VEGF and ANG2
UA117218C2 (en) 2011-05-05 2018-07-10 Мерк Патент Гмбх POLYPEPTIDE AGAINST IL-17A, IL-17F AND / OR IL17-A / F
US9534039B2 (en) 2011-05-09 2017-01-03 Ablynx N.V. Method for the production of immunoglobulin single variable domains
KR102072250B1 (en) 2011-05-27 2020-03-02 아블린쓰 엔.브이. Inhibition of bone resorption with rankl binding peptides
US9580480B2 (en) 2011-05-31 2017-02-28 Massachusetts Institute Of Technology Cell-directed synthesis of multifunctional nanopatterns and nanomaterials
EP4350345A3 (en) 2011-06-23 2024-07-24 Ablynx N.V. Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobin single variable domains
JP2014525736A (en) * 2011-06-23 2014-10-02 アブリンクス エン.ヴェー. Immunoglobulin single variable domain for IgE
EP2944654A1 (en) 2011-06-23 2015-11-18 Ablynx N.V. Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobin single variable domains
EP3466972B1 (en) 2011-06-23 2026-03-04 Ablynx NV Serum albumin binding proteins
HUE031828T2 (en) 2011-06-23 2017-08-28 Ablynx Nv Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains
AU2012311286B2 (en) 2011-09-19 2018-07-26 Kymab Limited Antibodies, variable domains and chains tailored for human use
EP2747782B1 (en) 2011-09-23 2018-01-17 Ablynx NV Prolonged inhibition of interleukin-6 mediated signaling
WO2013045916A1 (en) 2011-09-26 2013-04-04 Kymab Limited Chimaeric surrogate light chains (slc) comprising human vpreb
CN103889451B (en) 2011-09-30 2016-06-29 埃博灵克斯股份有限公司 Biological substances associated with C-Met
US9346884B2 (en) 2011-09-30 2016-05-24 Ablynx N.V. Biological materials related to c-Met
GB2496375A (en) 2011-10-28 2013-05-15 Kymab Ltd A non-human assay vertebrate comprising human antibody loci and human epitope knock-in, and uses thereof
JP2015504038A (en) 2011-10-31 2015-02-05 ブリストル−マイヤーズ スクイブ カンパニーBristol−Myers Squibb Company Fibronectin binding domain with reduced immunogenicity
KR20140091031A (en) 2011-11-04 2014-07-18 노파르티스 아게 Low density lipoprotein-related protein 6 (lrp6) - half life extender constructs
GB201122047D0 (en) 2011-12-21 2012-02-01 Kymab Ltd Transgenic animals
AU2013216943B2 (en) 2012-02-10 2018-04-19 Research Corporation Technologies, Inc. Fusion proteins comprising immunoglobulin constant domain-derived scaffolds
WO2013138338A2 (en) 2012-03-12 2013-09-19 Massachusetts Institute Of Technology Methods for treating tissue damage associated with ischemia with apoliporotein d
CA2865464C (en) 2012-03-30 2022-07-12 Boehringer Ingelheim International Gmbh Ang2-binding molecules
US9328174B2 (en) 2012-05-09 2016-05-03 Novartis Ag Chemokine receptor binding polypeptides
KR20220051197A (en) 2012-05-17 2022-04-26 익스텐드 바이오사이언시즈, 인크. Carriers for improved drug delivery
US9844582B2 (en) 2012-05-22 2017-12-19 Massachusetts Institute Of Technology Synergistic tumor treatment with extended-PK IL-2 and therapeutic agents
AU2013265665B2 (en) 2012-05-24 2017-10-26 Vib Vzw Anti-macrophage mannose receptor single variable domains for targeting and in vivo imaging of tumor-associated macrophages
WO2014030780A1 (en) * 2012-08-22 2014-02-27 Mogam Biotechnology Research Institute Screening and engineering method of super-stable immunoglobulin variable domains and their uses
EP2977386A1 (en) * 2012-08-31 2016-01-27 Argen-X Nv Method for producing antibody molecules having inter-species, intra-target cross-reactivity
US20140161796A1 (en) * 2012-09-13 2014-06-12 Andreas Loew Single chain proteins with c-terminal modifications
HUE043482T2 (en) 2012-09-13 2019-08-28 Bristol Myers Squibb Co Fibronectin based scaffold domain proteins that bind to myostatin
RU2530553C2 (en) * 2012-11-07 2014-10-10 Федеральное государственное бюджетное образовательное учреждение высшего профессионального образования "Московский государственный университет имени М.В. Ломоносова" (МГУ) Recombinant single-domain antibody able to bind human tumour necrosis factor specifically and its derivatives
WO2014087010A1 (en) 2012-12-07 2014-06-12 Ablynx N.V. IMPROVED POLYPEPTIDES DIRECTED AGAINST IgE
EP2752426A1 (en) 2013-01-03 2014-07-09 Covagen AG Human serum albumin binding compounds and fusion proteins thereof
WO2014111550A1 (en) 2013-01-17 2014-07-24 Glaxosmithkline Intellectual Property Development Limited Modified anti-serum albumin binding proteins
CN112858672A (en) 2013-01-30 2021-05-28 弗拉芒区生物技术研究所 Novel chimeric polypeptides for screening and drug discovery purposes
WO2014120891A2 (en) 2013-02-01 2014-08-07 Bristol-Myers Squibb Company Fibronectin based scaffold proteins
WO2014120916A1 (en) 2013-02-01 2014-08-07 Bristol-Myers Squibb Company Pegylated domain antibodies monovalent for cd28 binding and methods of use
PL2953973T3 (en) 2013-02-05 2020-01-31 Vib Vzw Muscarinic acetylcholine receptor binding agents and uses thereof
EP2968587A2 (en) 2013-03-13 2016-01-20 Bristol-Myers Squibb Company Fibronectin based scaffold domains linked to serum albumin or a moiety binding thereto
WO2014140376A1 (en) 2013-03-15 2014-09-18 Vib Vzw Anti-macrophage mannose receptor single variable domains for use in cardiovascular diseases
JP6967347B2 (en) 2013-04-29 2021-11-17 バイオタリス・エン・フェー Agricultural chemical composition containing an antibody that binds to sphingolipids
NL1040254C2 (en) 2013-05-17 2014-11-24 Ablynx Nv Stable formulations of immunoglobulin single variable domains and uses thereof.
JP6449272B2 (en) * 2013-07-08 2019-01-09 ナンジン レジェンド バイオテック カンパニー,リミテッドNanjing Legend Biotech Co.,Ltd. Compositions and methods for increasing the serum half-life of proteins
CN103454413B (en) * 2013-09-04 2015-03-11 吉日木图 Bactrian camel specific antibody preparation and immunodetection method
EP2883883A1 (en) 2013-12-16 2015-06-17 Cardio3 Biosciences S.A. Therapeutic targets and agents useful in treating ischemia reperfusion injury
US10501540B2 (en) * 2014-04-10 2019-12-10 Lava Therapeutics B.V. Immunoglobulins binding human Vγ9 Vδ2 T cell receptors
SG11201609162SA (en) 2014-05-16 2016-12-29 Ablynx Nv Improved immunoglobulin variable domains
AU2015261467B2 (en) 2014-05-16 2020-12-17 Ablynx Nv Methods for detecting and/or measuring anti-drug antibodies, in particular treatment-emergent anti-drug antibodies
IL318433A (en) 2014-05-16 2025-03-01 Ablynx Nv Improved immunoglobulin variable domains
NL2013007B1 (en) 2014-06-16 2016-07-05 Ablynx Nv Methods of treating TTP with immunoglobulin single variable domains and uses thereof.
NL2013661B1 (en) 2014-10-21 2016-10-05 Ablynx Nv KV1.3 Binding immunoglobulins.
WO2016012363A1 (en) 2014-07-22 2016-01-28 Vib Vzw Methods to select for agents that stabilize protein complexes
JP6289733B2 (en) 2014-07-29 2018-03-07 フレイエ ユニヴェルシテイト ブリュッセルVrije Universiteit Brussel Radiolabeled antibody fragments for use in the prevention and / or treatment of cancer
US20180036442A1 (en) 2014-07-29 2018-02-08 Vrije Universiteit Brussel Radio-labelled antibody fragments for use in the prognosis, diagnosis of cancer as well as for the prediction of cancer therapy response
WO2016025642A1 (en) 2014-08-12 2016-02-18 Massachusetts Institute Of Technology Synergistic tumor treatment with il-2 and integrin-binding-fc-fusion protein
WO2016025647A1 (en) 2014-08-12 2016-02-18 Massachusetts Institute Of Technology Synergistic tumor treatment with il-2, a therapeutic antibody, and a cancer vaccine
US11111284B2 (en) 2014-08-21 2021-09-07 The General Hospital Corporation Tumor necrosis factor superfamily and TNF-like ligand muteins and methods of preparing
WO2016065052A1 (en) 2014-10-22 2016-04-28 Extend Biosciences, Inc. Insulin vitamin d conjugates
US9585934B2 (en) 2014-10-22 2017-03-07 Extend Biosciences, Inc. Therapeutic vitamin D conjugates
US9789197B2 (en) 2014-10-22 2017-10-17 Extend Biosciences, Inc. RNAi vitamin D conjugates
US20170267784A1 (en) 2014-10-23 2017-09-21 Singh Molecular Medicine, Llc Single domain antibodies directed against intracellular antigens
DK3590962T3 (en) 2014-10-23 2021-12-13 Singh Molecular Medicine Llc SINGLE DOMAIN ANTIBODIES TARGETED TO INTRACELLULAR ANTIGENS
AR102550A1 (en) 2014-11-05 2017-03-08 Agrosavfe Nv TRANSGENIC PLANT THAT INCLUDES A POLINUCLEOTIDE THAT CODIFIES A VARIABLE DOMAIN OF HEAVY CHAIN ANTIBODY
WO2016086021A1 (en) 2014-11-25 2016-06-02 Bristol-Myers Squibb Company Novel pd-l1 binding polypeptides for imaging
WO2016094602A1 (en) 2014-12-10 2016-06-16 Tufts University Vhh based binding antibodies for anthrax and botulinum toxins and methods of making and using therefor
CN107406497A (en) 2014-12-19 2017-11-28 埃博灵克斯股份有限公司 The nano antibody dimer of cysteine connection
AU2016212777B2 (en) 2015-01-27 2021-11-18 LAVA Therapeutics N.V. Single domain antibodies targeting CD1d
KR102789821B1 (en) 2015-03-31 2025-04-02 소리소 파마슈티컬스 인크. Peptide constructs having protease-cleavable linkers
MX2017012662A (en) 2015-03-31 2018-05-11 Vhsquared Ltd POLYPEPTIDES
JP2018511346A (en) 2015-03-31 2018-04-26 ブイエイチスクエアード リミテッド Polypeptide
CR20170482A (en) 2015-04-24 2018-03-07 Viiv Healthcare Uk No 5 Ltd POLIPEPTIDES DIRECTED TO HIV FUSION
PT3294768T (en) 2015-05-13 2019-11-05 Ablynx Nv T cell recruiting polypeptides based on tcr alpha/beta reactivity
US11046767B2 (en) 2015-05-13 2021-06-29 Ablynx N.V. T cell recruiting polypeptides based on CD3 reactivity
BR112017024757A2 (en) 2015-05-18 2018-11-13 TCR2 Therapeutics Inc. compositions and methods for reprogramming tcr using fusion proteins
MX383614B (en) 2015-05-21 2025-03-14 Harpoon Therapeutics Inc TRISPECIFIC BINDING PROTEINS AND METHODS OF USE.
WO2017013026A1 (en) 2015-07-17 2017-01-26 Vrije Universiteit Brussel Radiolabelled antibody fragments for use in treating cancer
BR102016018074A2 (en) 2015-08-07 2021-11-16 ALX Oncology Inc. SIRP-ALFA VARIANT CONSTRUCTION, ITS METHOD OF PREPARATION AND USES, NUCLEIC ACID MOLECULE, VECTOR, HOST CELL, AND PHARMACEUTICAL COMPOSITION
WO2017027422A1 (en) 2015-08-07 2017-02-16 Alexo Therapeutics Inc. Constructs having a sirp-alpha domain or variant thereof
EP3353198B1 (en) 2015-09-23 2020-06-17 Bristol-Myers Squibb Company Glypican-3binding fibronectin based scafflold molecules
TWI746473B (en) 2015-11-02 2021-11-21 美商辛分子醫藥有限公司 Single domain antibodies directed against intracellular antigens
NO2768984T3 (en) 2015-11-12 2018-06-09
ES2905912T3 (en) 2015-11-13 2022-04-12 Ablynx Nv Enhanced serum albumin-binding immunoglobulin variable domains
US11077187B2 (en) * 2015-11-17 2021-08-03 Oklahoma Medical Research Foundation Epitope of optimized humanized monoclonal antibodies against activated protein C and uses thereof
EP3377525A2 (en) 2015-11-18 2018-09-26 Ablynx NV Improved serum albumin binders
MY189590A (en) 2015-11-18 2022-02-18 Merck Sharp & Dohme Ctla4 binders
CA3132021C (en) 2015-11-18 2024-03-12 Merck Sharp & Dohme Corp. Pd1 and/or lag3 binders
CA3003777A1 (en) 2015-11-18 2017-05-26 Merck Sharp & Dohme Corp. Pd1/ctla4 binders
CN108473561B (en) 2015-11-27 2022-12-16 埃博灵克斯股份有限公司 Polypeptide inhibiting CD40L
IL298686A (en) * 2016-01-11 2023-01-01 Inhibrx Inc Multispecific and multivalent ox40-binding fusion proteins
WO2017124001A2 (en) * 2016-01-14 2017-07-20 Memorial Sloan-Kettering Cancer Center T cell receptor-like antibodies specific for foxp3-derived peptides
EP3408299A1 (en) 2016-01-26 2018-12-05 INSERM - Institut National de la Santé et de la Recherche Médicale Anti-vwf d'd3 single-domain antibodies and polypeptides comprising thereof
CN116769054A (en) 2016-02-05 2023-09-19 奥里尼斯生物科学私人有限公司 Bispecific signaling agents and uses thereof
EP4276114A3 (en) 2016-03-07 2024-02-21 Vib Vzw Cd20 binding single domain antibodies
WO2017182605A1 (en) 2016-04-22 2017-10-26 Université Libre de Bruxelles A new biomarker expressed in pancreatic beta cells useful in imaging or targeting beta cells
US11243214B2 (en) 2016-04-22 2022-02-08 Université Libre de Bruxelles Biomarker expressed in pancreatic beta cells useful in imaging or targeting beta cells
CA3022697A1 (en) 2016-05-02 2017-11-09 Ablynx Nv Treatment of rsv infection
US11753463B2 (en) 2016-05-13 2023-09-12 Orionis Biosciences BV Therapeutic targeting of non-cellular structures
UA127200C2 (en) 2016-05-18 2023-06-07 Бьорінгер Інгельхайм Інтернаціональ Гмбх Anti pd-1 and anti-lag3 antibodies for cancer treatment
US11623958B2 (en) 2016-05-20 2023-04-11 Harpoon Therapeutics, Inc. Single chain variable fragment CD3 binding proteins
AU2017267793B2 (en) 2016-05-20 2024-01-25 Harpoon Therapeutics, Inc. Single chain variable fragment CD3 binding proteins
US10100106B2 (en) 2016-05-20 2018-10-16 Harpoon Therapeutics, Inc. Single domain serum albumin binding protein
CN109313183B (en) 2016-06-23 2022-10-21 埃博灵克斯股份有限公司 Improved pharmacokinetic assay for immunoglobulin single variable domains
WO2018007442A1 (en) 2016-07-06 2018-01-11 Ablynx N.V. Treatment of il-6r related diseases
WO2018026953A1 (en) 2016-08-02 2018-02-08 TCR2 Therapeutics Inc. Compositions and methods for tcr reprogramming using fusion proteins
WO2018029182A1 (en) 2016-08-08 2018-02-15 Ablynx N.V. Il-6r single variable domain antibodies for treatment of il-6r related diseases
RU2762835C2 (en) 2016-08-24 2021-12-23 Тенеобио, Инк. Transgenic animals, other than humans, producing modified antibodies containing only heavy chains
CN106267191A (en) * 2016-09-03 2017-01-04 山西纳安生物科技有限公司 Nano antibody biological medicament Percutaneously administrable preparation system and preparation method and application
CN106265480A (en) * 2016-09-03 2017-01-04 山西纳安生物科技有限公司 Nano antibody vaginal drug delivery systems and preparation method and application
US11098113B2 (en) 2016-09-15 2021-08-24 Vib Vzw Immunoglobulin single variable domains directed against macrophage migration inhibitory factor
WO2018060453A1 (en) 2016-09-30 2018-04-05 Vhsquared Limited Compositions
MX2019003899A (en) 2016-10-07 2019-08-14 Tcr2 Therapeutics Inc Compositions and methods for t-cell receptors reprogramming using fusion proteins.
IL317416A (en) 2016-11-16 2025-02-01 Ablynx Nv T cell recruiting polypeptides capable of binding cd123 and tcr alpha/beta
AU2017363311A1 (en) 2016-11-22 2019-06-13 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
KR102275008B1 (en) 2016-11-23 2021-07-13 하푼 테라퓨틱스, 인크. prostate specific membrane antigen binding protein
US10844134B2 (en) 2016-11-23 2020-11-24 Harpoon Therapeutics, Inc. PSMA targeting trispecific proteins and methods of use
WO2018099968A1 (en) 2016-11-29 2018-06-07 Ablynx N.V. Treatment of infection by respiratory syncytial virus (rsv)
EP3551656A1 (en) 2016-12-07 2019-10-16 Ablynx NV Improved serum albumin binding immunoglobulin single variable domains
EP3360898A1 (en) 2017-02-14 2018-08-15 Boehringer Ingelheim International GmbH Bispecific anti-tnf-related apoptosis-inducing ligand receptor 2 and anti-cadherin 17 binding molecules for the treatment of cancer
CN107674122A (en) * 2016-12-28 2018-02-09 天津天锐生物科技有限公司 A kind of single domain antibody for identifying human serum albumins
US10350266B2 (en) 2017-01-10 2019-07-16 Nodus Therapeutics, Inc. Method of treating cancer with a multiple integrin binding Fc fusion protein
US10603358B2 (en) 2017-01-10 2020-03-31 Nodus Therapeutics Combination tumor treatment with an integrin-binding-Fc fusion protein and immune stimulator
CN117285623A (en) 2017-01-17 2023-12-26 埃博灵克斯股份有限公司 Improved serum albumin conjugate
DK3571224T3 (en) 2017-01-17 2024-11-11 Ablynx Nv IMPROVED SERUM ALBUMIN BINDERS
GB201701404D0 (en) * 2017-01-27 2017-03-15 Micropharm Ltd Therapies for treating inflammatory disorders
MX2019009255A (en) 2017-02-06 2019-11-05 Orionis Biosciences Nv Targeted chimeric proteins and uses thereof.
BR112019017853A2 (en) 2017-02-28 2021-04-27 Vib Vzw MEANS AND METHODS FOR ORAL RELEASE OF PROTEIN
WO2018160754A2 (en) 2017-02-28 2018-09-07 Harpoon Therapeutics, Inc. Inducible monovalent antigen binding protein
JP7165717B2 (en) 2017-03-15 2022-11-04 パンディオン・オペレーションズ・インコーポレイテッド target immune tolerance
EP3600453A1 (en) 2017-03-30 2020-02-05 Duke University Radiolabeled biomolecules and their use
AU2018241286B2 (en) 2017-03-31 2025-03-13 Ablynx N.V. Improved immunogenicity assays
EP3612648A1 (en) 2017-04-18 2020-02-26 Université Libre de Bruxelles Biomarkers and targets for proliferative diseases
CA3062238A1 (en) 2017-05-11 2018-11-15 Vib Vzw Glycosylation of variable immunoglobulin domains
AU2018265856B2 (en) 2017-05-12 2023-04-27 Harpoon Therapeutics, Inc. Mesothelin binding proteins
CA3063362A1 (en) 2017-05-12 2018-11-15 Harpoon Therapeutics, Inc. Msln targeting trispecific proteins and methods of use
AU2018273914A1 (en) 2017-05-24 2019-11-14 Pandion Operations, Inc. Targeted immunotolerance
CN110997001A (en) 2017-06-02 2020-04-10 默克专利股份有限公司 MMP13 binding to immunoglobulins
MX2019014504A (en) 2017-06-02 2020-07-20 Merck Patent Gmbh AGRECAN-BINDING IMMUNOGLOBULINS.
CN111032695B (en) 2017-06-02 2024-06-25 默克专利股份有限公司 ADAMTS-binding immunoglobulin
MX2019014397A (en) 2017-06-02 2020-02-10 Merck Patent Gmbh Polypeptides binding adamts5, mmp13 and aggrecan.
CN107356572A (en) * 2017-06-28 2017-11-17 成都理工大学 The FRET method of carrier is used as by the use of nucleic acid
GB201710973D0 (en) 2017-07-07 2017-08-23 Avacta Life Sciences Ltd Scaffold proteins
CN108570095B (en) * 2017-07-10 2019-12-31 昆明医科大学第一附属医院 A Polypeptide SITE2 Promoting Platelet Aggregation
CN111201246B (en) 2017-07-11 2023-10-27 亚力兄制药公司 Polypeptides that bind complement component C5 or serum albumin and their fusion proteins
CA3070253A1 (en) 2017-07-19 2019-01-24 Vib Vzw Serum albumin binding agents
US11485781B2 (en) 2017-08-17 2022-11-01 Massachusetts Institute Of Technology Multiple specificity binders of CXC chemokines
IL315737A (en) 2017-10-13 2024-11-01 Harpoon Therapeutics Inc B cell maturation antigen binding proteins
SI3694529T1 (en) 2017-10-13 2024-10-30 Harpoon Therapeutics, Inc. Trispecific proteins and methods of use
EP4635987A3 (en) 2017-10-31 2026-01-14 Vib Vzw Novel antigen-binding chimeric proteins and methods and uses thereof
CN111386285B (en) * 2017-11-15 2024-08-27 诺和诺德股份有限公司 Factor X binders that enhance FX activation
US10946068B2 (en) 2017-12-06 2021-03-16 Pandion Operations, Inc. IL-2 muteins and uses thereof
USRE50550E1 (en) 2017-12-06 2025-08-26 Pandion Operations, Inc. IL-2 muteins and uses thereof
US10174091B1 (en) 2017-12-06 2019-01-08 Pandion Therapeutics, Inc. IL-2 muteins
CN109970860A (en) * 2017-12-27 2019-07-05 信达生物制药(苏州)有限公司 Three chain antibodies, Its Preparation Method And Use
WO2019148089A1 (en) 2018-01-26 2019-08-01 Orionis Biosciences Inc. Xcr1 binding agents and uses thereof
CN112074267B (en) 2018-02-05 2024-06-28 奥里尼斯生物科学公司股份有限公司 Fibroblast binding agent and use thereof
CN111670202A (en) 2018-02-06 2020-09-15 埃博灵克斯股份有限公司 Methods of treating initial episodes of TTP with immunoglobulin single variable domains
AU2019219200B2 (en) 2018-02-12 2025-02-13 BioNTech SE Treatment using cytokine encoding RNA
WO2019155041A1 (en) 2018-02-12 2019-08-15 Vib Vzw Gβγ COMPLEX ANTIBODIES AND USES THEREOF
TW202000238A (en) 2018-02-26 2020-01-01 比利時商艾伯林克斯公司 Improved nucleotide sequences encoding peptide linkers
EP3758742A1 (en) 2018-03-01 2021-01-06 Vrije Universiteit Brussel Human pd-l1-binding immunoglobulins
JP7390729B2 (en) 2018-03-23 2023-12-04 ユニヴェルシテ リブル ドゥ ブリュッセル Wnt signaling agonist molecules
MX2020010091A (en) * 2018-03-27 2021-01-15 Umc Utrecht Holding Bv Targeted thrombolysis for treatment of microvascular thrombosis.
BR112020023330A2 (en) 2018-05-14 2021-04-20 Harpoon Therapeutics, Inc. binding portion for conditional activation of immunoglobulin molecules
US20210130430A1 (en) 2018-05-14 2021-05-06 Werewolf Therapeutics, Inc. Activatable cytokine polypeptides and methods of use thereof
CN113840832A (en) 2018-05-14 2021-12-24 狼人治疗公司 Activatable interleukin-2 polypeptides and methods of using the same
WO2019222294A1 (en) 2018-05-14 2019-11-21 Werewolf Therapeutics, Inc. Activatable cytokine polypeptides and methods of use thereof
EP3569618A1 (en) 2018-05-19 2019-11-20 Boehringer Ingelheim International GmbH Antagonizing cd73 antibody
MX2020013248A (en) * 2018-06-05 2021-04-13 Novobind Livestock Therapeutics Inc Antibodies against aquaculture disease-causing agents and uses thereof.
JP7122672B2 (en) * 2018-06-08 2022-08-22 パナソニックIpマネジメント株式会社 VHH antibodies
EP3807321A4 (en) 2018-06-18 2022-03-02 Anwita Biosciences, Inc. ANTI-MESOTHELIN CONSTRUCTIONS AND ASSOCIATED USES
UA130214C2 (en) 2018-07-20 2025-12-24 Момента Фармасьютикалз, Інк. PHARMACEUTICAL COMPOSITION OF ANTIBODY AGAINST FCRN
JP7550745B2 (en) 2018-07-24 2024-09-13 バイオエヌテック エスエー IL2 agonist
JP2021530503A (en) * 2018-07-26 2021-11-11 ティーシーアール2 セラピューティクス インク. Compositions and Methods for Reprogramming TCRs Using Target-Specific Fusion Proteins
CN112601761A (en) 2018-08-13 2021-04-02 印希比股份有限公司 Polypeptides that bind OX40 and uses thereof
JP7190675B2 (en) * 2018-08-23 2022-12-16 パナソニックIpマネジメント株式会社 Antibody and complex that bind to norovirus, detection device and detection method using the same
BR112021005184A8 (en) 2018-09-19 2022-08-16 Lava Therapeutics B V DUAL-ACTING CD1D IMMUNOGLOBULIN
US12195544B2 (en) 2018-09-21 2025-01-14 Harpoon Therapeutics, Inc. EGFR binding proteins and methods of use
EP3856771A4 (en) 2018-09-25 2022-06-29 Harpoon Therapeutics, Inc. Dll3 binding proteins and methods of use
MX2021003543A (en) 2018-09-27 2021-06-23 Xilio Dev Inc Masked cytokine polypeptides.
AU2019346335B2 (en) 2018-09-28 2024-07-25 Massachusetts Institute Of Technology Collagen-localized immunomodulatory molecules and methods thereof
EP3636657A1 (en) 2018-10-08 2020-04-15 Ablynx N.V. Chromatography-free antibody purification method
CA3118892A1 (en) 2018-11-08 2020-05-14 Orionis Biosciences, Inc. Modulation of dendritic cell lineages
CA3118819A1 (en) * 2018-11-13 2020-05-22 Novobind Livestock Therapeutics Inc. Antibodies against disease causing agents of canines and felines and uses thereof
GB201818477D0 (en) 2018-11-13 2018-12-26 Emstopa Ltd Tissue plasminogen activator antibodies and method of use thereof
WO2020114616A1 (en) * 2018-12-07 2020-06-11 Tillotts Pharma Ag Topical treatment of immune checkpoint inhibitor induced diarrhoea, colitis or enterocolitis using antibodies and fragments thereof
CN112830967B (en) * 2019-01-10 2022-06-24 瑞阳(苏州)生物科技有限公司 Affinity chromatography purification method of anti-HSA single domain antibody and fusion protein thereof
WO2020154032A1 (en) 2019-01-23 2020-07-30 Massachusetts Institute Of Technology Combination immunotherapy dosing regimen for immune checkpoint blockade
KR20210124236A (en) 2019-02-08 2021-10-14 비온테크 쎌 & 제네 테라피스 게엠베하 Treatment with CAR-engineered T cells and cytokines
AU2020242254B2 (en) 2019-03-18 2026-03-12 Biontech Cell & Gene Therapies Gmbh Interleukin-2 receptor (il2r) and interleukin-2 (il2) variants for specific activation of immune effector cells
JP7773372B2 (en) 2019-03-28 2025-11-19 オリオニス バイオサイエンシズ,インコーポレイテッド Fibroblast activation protein binding substances and uses thereof
WO2020200481A1 (en) 2019-04-05 2020-10-08 Biontech Rna Pharmaceuticals Gmbh Treatment involving interleukin-2 (il2) and interferon (ifn)
CN114041057A (en) 2019-04-29 2022-02-11 康福治疗有限公司 Chimeric proteins and methods for screening compounds and ligands that bind to GPCRs
US20220289837A1 (en) 2019-04-30 2022-09-15 Vib Vzw Cystic Fibrosis Transmembrane Conductance Regulator Stabilizing Agents
KR20220023988A (en) 2019-05-14 2022-03-03 웨어울프 세라퓨틱스, 인크. Separation moieties and methods of use thereof
KR20220008866A (en) 2019-05-14 2022-01-21 하푼 테라퓨틱스, 인크. EpCAM binding proteins and methods of use
CA3141327A1 (en) 2019-05-20 2020-11-26 Pandion Operations, Inc. Madcam targeted immunotolerance
WO2020239934A1 (en) 2019-05-28 2020-12-03 Vib Vzw Cd8+ t-cells lacking plexins and their application in cancer treatment
EP3976650A1 (en) 2019-05-28 2022-04-06 Vib Vzw Cancer treatment by targeting plexins in the immune compartment
KR20220044904A (en) 2019-05-31 2022-04-12 알렉소 온콜로지 인크. How to treat cancer with SIRP alpha FC fusion in combination with immune checkpoint inhibitors
CA3138805A1 (en) 2019-06-04 2020-12-10 Johannes Schilling Designed ankyrin repeat domain with improved stability
EP3986571A1 (en) 2019-06-21 2022-04-27 Sorriso Pharmaceuticals, Inc. Polypeptides
EP3986570A1 (en) 2019-06-21 2022-04-27 Sorriso Pharmaceuticals, Inc. Compositions
CN114514243B (en) 2019-06-21 2025-01-24 索瑞索制药公司 Polypeptides
TW202115105A (en) 2019-06-24 2021-04-16 德商拜恩迪克Rna製藥有限公司 Il2 agonists
WO2021058091A1 (en) 2019-09-24 2021-04-01 Biontech Rna Pharmaceuticals Gmbh Treatment involving therapeutic antibody and interleukin-2 (il2)
CN110624105B (en) * 2019-09-24 2021-06-11 苏州大学 Sequences of structurally sensitive polypeptide antigens of von Willebrand factor
CN115052884B (en) * 2019-09-27 2026-03-17 北京烁星生物医药科技有限公司 Monospecific and multispecific antibodies
TW202128775A (en) 2019-10-16 2021-08-01 英商阿法克塔生命科學有限公司 Pd-l1 inhibitor - tgfβ inhibitor bispecific drug moieties
EP4048703A1 (en) 2019-10-21 2022-08-31 Vib Vzw Nanodisc-specific antigen-binding chimeric proteins
IL292879B2 (en) 2019-11-11 2025-08-01 Ibi Ag Innovative Bio Insecticides Ltd Insect control nanobodies and uses thereof
CN112851805B (en) * 2019-11-12 2025-09-09 四川科伦博泰生物医药股份有限公司 Protein combined with serum albumin and application thereof
BR112022009110A2 (en) 2019-11-14 2022-07-26 Werewolf Therapeutics Inc ACTIVABLE CYTOKINE POLYPEPTIDES AND METHODS OF USE THEREOF
EP4065603A1 (en) 2019-11-27 2022-10-05 Vib Vzw Positive allosteric modulators of the calcium-sensing receptor
CN114845710A (en) 2019-11-27 2022-08-02 Alx肿瘤生物技术公司 Combination therapy for the treatment of cancer
MX2022006881A (en) 2019-12-06 2022-07-11 Ablynx Nv POLYPEPTIDES COMPRISING SINGLE VARIABLE DOMAINS OF IMMUNOGLOBULIN TARGETTING TNF ALFA AND OX40L.
JP7657797B2 (en) 2019-12-06 2025-04-07 アブリンクス エン.ヴェー. Polypeptides Comprising Immunoglobulin Single Variable Domains That Target TNFα and IL-23 - Patent application
IL293548A (en) 2019-12-09 2022-08-01 Ablynx Nv Polypeptides comprising immunoglobulin single variable domains targeting il-13 and tslp
GB201918279D0 (en) 2019-12-12 2020-01-29 Vib Vzw Glycosylated single chain immunoglobulin domains
EP4077372A1 (en) 2019-12-20 2022-10-26 Vib Vzw Nanobody exchange chromatography
IL293978A (en) 2019-12-20 2022-08-01 Regeneron Pharma Novel il2 agonists and methods of use thereof
WO2021129927A1 (en) 2019-12-23 2021-07-01 Biontech Cell & Gene Therapies Gmbh Treatment with immune effector cells engineered to express an antigen receptor
GB201919294D0 (en) * 2019-12-24 2020-02-05 Eco Animal Health Ltd Antibodies or binding proteins
WO2021129945A1 (en) 2019-12-27 2021-07-01 Biontech Cell & Gene Therapies Gmbh In vitro and in vivo gene delivery to immune effector cells using nanoparticles functionalized with designed ankyrin repeat proteins (darpins)
WO2021140205A1 (en) 2020-01-10 2021-07-15 Confo Therapeutics N.V. Methods for generating antibodies and antibody fragments and libraries comprising same
WO2021156490A2 (en) 2020-02-06 2021-08-12 Vib Vzw Corona virus binders
CA3170833A1 (en) 2020-02-21 2021-08-26 Harpoon Therapeutics, Inc. Flt3 binding proteins and methods of use
WO2021168079A1 (en) 2020-02-21 2021-08-26 Pandion Operations, Inc. Tissue targeted immunotolerance with a cd39 effector
JP7814714B2 (en) 2020-02-25 2026-02-17 ブイアイビー ブイゼットダブリュ Allosteric regulator of leucine-rich repeat kinase 2
CA3171066A1 (en) 2020-03-11 2021-09-16 Saar GILL Methods and composition for gene delivery using an engineered viral particle
CA3171370A1 (en) 2020-03-16 2021-09-23 Ugur Sahin Antigen-specific t cell receptors and t cell epitopes
EP4125379B1 (en) 2020-03-31 2024-08-21 Biotalys NV Anti-fungal polypeptides
WO2021197589A1 (en) 2020-03-31 2021-10-07 BioNTech SE Treatment involving non-immunogenic rna for antigen vaccination
CN113461824A (en) 2020-03-31 2021-10-01 普米斯生物技术(珠海)有限公司 Platform for constructing multispecific antibody
CN113527488B (en) 2020-04-22 2026-04-17 迈威(上海)生物科技股份有限公司 A monovariable domain antibody targeting human programmed death-ligand 1 (PD-L1) and its derivatives
US11673930B2 (en) 2020-05-12 2023-06-13 Regeneran Pharmaceuticals, Inc. IL10 agonists and methods of use thereof
WO2021229104A1 (en) 2020-05-15 2021-11-18 Université de Liège Anti-cd38 single-domain antibodies in disease monitoring and treatment
CA3180665A1 (en) 2020-05-19 2021-11-25 Boehringer Ingelheim International Gmbh Binding molecules for the treatment of cancer
GB202101299D0 (en) 2020-06-09 2021-03-17 Avacta Life Sciences Ltd Diagnostic polypetides and methods
WO2024133935A1 (en) 2022-12-23 2024-06-27 Ablynx Nv Protein-based conjugation carriers
WO2021258160A1 (en) * 2020-06-26 2021-12-30 Monash University Anti-vwf antibodies and uses thereof
WO2022003156A1 (en) 2020-07-02 2022-01-06 Oncurious Nv Ccr8 non-blocking binders
US12077576B2 (en) 2020-07-02 2024-09-03 Trustees Of Tufts College VHH polypeptides that bind to Clostridium difficile toxin b and methods of use thereof
IL299748A (en) 2020-07-08 2023-03-01 Lava Therapeutics N V Antibodies that bind psma and gamma-delta t cell receptors
WO2022023583A1 (en) 2020-07-31 2022-02-03 Biotalys NV Expression host
WO2022063947A1 (en) 2020-09-24 2022-03-31 Vib Vzw Combination of p2y6 inhibitors and immune checkpoint inhibitors
WO2022063957A1 (en) 2020-09-24 2022-03-31 Vib Vzw Biomarker for anti-tumor therapy
WO2022063984A1 (en) 2020-09-25 2022-03-31 Ablynx Nv Polypeptides comprising immunoglobulin single variable domains targeting il-13 and ox40l
JP7633397B2 (en) 2020-10-21 2025-02-19 ベーリンガー インゲルハイム インターナショナル ゲゼルシャフト ミット ベシュレンクテル ハフツング Bispecific anti-VEGF and anti-TrkB binding molecules for the treatment of ocular diseases - Patents.com
WO2022098745A1 (en) 2020-11-03 2022-05-12 Indi Molecular, Inc. Compositions, delivery systems, and methods useful in tumor therapy
WO2022098743A1 (en) 2020-11-03 2022-05-12 Indi Molecular, Inc. Compositions, imaging, and therapeutic methods targeting folate receptor 1 (folr1)
JP2023553323A (en) 2020-11-25 2023-12-21 エクシリオ デベロップメント, インコーポレイテッド Tumor-specific cleavable linker
EP4255929A2 (en) 2020-12-02 2023-10-11 Vib Vzw An ltbr agonist in combination therapy against cancer
WO2022117569A1 (en) 2020-12-02 2022-06-09 Oncurious Nv A ccr8 antagonist antibody in combination with a lymphotoxin beta receptor agonist antibody in therapy against cancer
JP7842101B2 (en) 2020-12-18 2026-04-07 アブリンクス エン.ヴェー. polypeptide containing a single variable immunoglobulin domain that targets IL-6 and TNF-α
TW202241947A (en) 2020-12-18 2022-11-01 比利時商艾伯霖克斯公司 Polypeptides comprising immunoglobulin single variable domains targeting glypican-3 and t cell receptor
CA3203141A1 (en) 2020-12-18 2022-06-23 Ablynx Nv T cell recruiting polypeptides based on tcr alpha/beta reactivity
WO2022135667A1 (en) 2020-12-21 2022-06-30 BioNTech SE Therapeutic rna for treating cancer
WO2022135666A1 (en) 2020-12-21 2022-06-30 BioNTech SE Treatment schedule for cytokine proteins
TW202245808A (en) 2020-12-21 2022-12-01 德商拜恩迪克公司 Therapeutic rna for treating cancer
GB202020502D0 (en) 2020-12-23 2021-02-03 Vib Vzw Antibody composistion for treatment of corona virus infection
EP4267617A1 (en) 2020-12-24 2023-11-01 Vib Vzw Human ccr8 binders
EP4267621A1 (en) 2020-12-24 2023-11-01 Vib Vzw Murine cross-reactive human ccr8 binders
US20240052044A1 (en) 2020-12-24 2024-02-15 Vib Vzw Non-blocking human ccr8 binders
CN117794566A (en) 2021-02-05 2024-03-29 Vib研究所 Sabei virus binding agent
CA3207548A1 (en) 2021-02-05 2022-08-11 Xavier Saelens Sarbecovirus binders
EP4294407A1 (en) 2021-02-17 2023-12-27 Vib Vzw Inhibition of slc4a4 in the treatment of cancer
IL305318A (en) 2021-02-19 2023-10-01 Vib Vzw Cation-independent mannose-6-phosphate receptor binders
WO2022199804A1 (en) 2021-03-24 2022-09-29 Vib Vzw Nek6 inhibition to treat als and ftd
AU2022256732A1 (en) 2021-04-12 2023-10-19 Biontech Delivery Technologies Gmbh Rna compositions comprising a buffer substance and methods for preparing, storing and using the same
CN117750974A (en) 2021-04-20 2024-03-22 生物技术欧洲股份公司 Viral vaccine
WO2022234003A1 (en) 2021-05-07 2022-11-10 Avacta Life Sciences Limited Cd33 binding polypeptides with stefin a protein
BR112023022774A2 (en) 2021-05-13 2024-01-02 Alx Oncology Inc COMBINATION THERAPIES FOR CANCER TREATMENT
US20240261446A1 (en) 2021-05-17 2024-08-08 Université de Liège Anti-cd38 single domain antibodies in disease monitoring and treatment
TW202317625A (en) 2021-06-17 2023-05-01 德商百靈佳殷格翰國際股份有限公司 Novel tri-specific binding molecules
WO2022268993A1 (en) 2021-06-23 2022-12-29 Vib Vzw Means and methods for selection of specific binders
US20240343811A1 (en) 2021-06-29 2024-10-17 Shandong Simcere Biopharmacutical Co., Ltd. Cd16 antibody and use thereof
CA3226924A1 (en) 2021-07-19 2023-01-26 Regeneron Pharmaceuticals, Inc. Il12 receptor agonists and methods of use thereof
WO2023016828A2 (en) 2021-07-30 2023-02-16 Vib Vzw Cation-independent mannose-6-phosphate receptor binders for targeted protein degradation
EP4378954A4 (en) 2021-07-30 2025-05-21 Shandong Simcere Biopharmaceutical Co., Ltd. BISPECIFIC ANTI-PVRIG/ANTI-TIGIT ANTIBODY AND USE
KR20240046251A (en) 2021-08-16 2024-04-08 리제너론 파아마슈티컬스, 인크. Novel IL27 receptor agonists and methods of use thereof
WO2023051926A1 (en) 2021-09-30 2023-04-06 BioNTech SE Treatment involving non-immunogenic rna for antigen vaccination and pd-1 axis binding antagonists
WO2023057601A1 (en) 2021-10-06 2023-04-13 Biotalys NV Anti-fungal polypeptides
TW202334196A (en) 2021-10-07 2023-09-01 英商阿法克塔生命科學有限公司 Pd-l1 binding polypeptides
EP4412711A1 (en) 2021-10-07 2024-08-14 Avacta Life Sciences Limited Serum half-life extended pd-l1 binding polypeptides
AU2021470029A1 (en) 2021-10-21 2024-05-02 BioNTech SE Coronavirus vaccine
WO2023067193A2 (en) 2021-10-22 2023-04-27 BioNTech SE Compositions for administration of different doses of rna
WO2023083434A1 (en) 2021-11-09 2023-05-19 BioNTech SE Rna encoding peptidoglycan hydrolase and use thereof for treating bacterial infection
JP2024544534A (en) 2021-11-11 2024-12-03 リジェネロン・ファーマシューティカルズ・インコーポレイテッド CD20-PD1 binding molecules and methods of use thereof
CN118696058A (en) 2021-12-03 2024-09-24 山东先声生物制药有限公司 Anti-BCMA nanoantibodies and their applications
CN118715246A (en) * 2021-12-10 2024-09-27 李人浩 Polypeptides, variants and uses thereof that bind to the A1 domain or auto-inhibitory module of von Willebrand factor (VWF)
JP2024546914A (en) 2021-12-15 2024-12-26 インテリウス・バイオセラピューティクス・インコーポレイテッド Pseudotyped virus particles, compositions containing same, and uses thereof
AU2022409733A1 (en) 2021-12-17 2024-08-01 Ablynx Nv POLYPEPTIDES COMPRISING IMMUNOGLOBULIN SINGLE VARIABLE DOMAINS TARGETING TCRαβ, CD33 AND CD123
WO2023126053A1 (en) 2021-12-28 2023-07-06 BioNTech SE Lipid-based formulations for administration of rna
US20250145705A1 (en) 2021-12-31 2025-05-08 Shandong Simcere Biopharmaceutical Co., Ltd. Gprc5d antibody and application thereof
EP4460516A2 (en) * 2022-01-03 2024-11-13 Twist Bioscience Corporation Bispecific sars-cov-2 antibodies and methods of use
CA3248241A1 (en) 2022-01-12 2023-07-20 Vib Vzw Human ntcp binders for therapeutic use and liver-specific targeted delivery
EP4473108A1 (en) 2022-02-02 2024-12-11 Biotalys NV Methods for genome editing
EP4476250A1 (en) 2022-02-07 2024-12-18 Vib Vzw Engineered stabilizing aglycosylated fc-regions
WO2023153876A1 (en) 2022-02-10 2023-08-17 주식회사 아피셀테라퓨틱스 Stefin a protein variants specifically binding to cd40l, and uses thereof
WO2023165681A1 (en) 2022-03-01 2023-09-07 BioNTech SE Rna lipid nanoparticles (lnps) comprising a polyoxazoline and/or polyoxazine polymer
WO2023193892A1 (en) 2022-04-05 2023-10-12 BioNTech SE Nucleic acid compositions comprising an inorganic polyphosphate and methods for preparing, storing and using the same
US20250235534A1 (en) 2022-04-13 2025-07-24 Vib Vzw An LTBR Agonist In Combination Therapy Against Cancer
EP4519324A1 (en) 2022-05-02 2025-03-12 UMC Utrecht Holding B.V. Single domain antibodies for the detection of plasmin-cleaved vwf
EP4519311A1 (en) * 2022-05-05 2025-03-12 Inhibrx Biosciences, Inc. Albumin-binding polypeptides and uses thereof
WO2023218243A1 (en) 2022-05-12 2023-11-16 Avacta Life Sciences Limited Lag-3/pd-l1 binding fusion proteins
EP4526340A1 (en) 2022-05-18 2025-03-26 Vib Vzw Sarbecovirus spike s2 subunit binders
KR20250021313A (en) 2022-06-06 2025-02-12 산둥심시어 바이오파마슈티칼 씨오., 엘티디. Multispecific antibodies targeting BCMA, GPRC5D and T cells and their applications
CA3259417A1 (en) 2022-06-14 2023-12-21 Ablynx Nv Immunoglobulin single variable domains targeting t cell receptor
WO2024002985A1 (en) 2022-06-26 2024-01-04 BioNTech SE Coronavirus vaccine
WO2024003873A1 (en) * 2022-06-30 2024-01-04 Intrexon Actobiotics Nv D/B/A Precigen Actobio Single variable domain antibodies against tumor necrosis factor-alpha
JP2025523630A (en) 2022-07-04 2025-07-23 ブイアイビー ブイゼットダブリュ Blood-cerebrospinal fluid barrier crossing antibodies
US12098400B2 (en) 2022-07-08 2024-09-24 Novo Nordisk A/S Highly potent ISVD compounds capable of substituting for FVIII(A)
EP4554677A1 (en) 2022-07-15 2025-05-21 Boehringer Ingelheim International GmbH Binding molecules for the treatment of cancer
WO2024017479A1 (en) 2022-07-21 2024-01-25 BioNTech SE Multifunctional cells transiently expressing an immune receptor and one or more cytokines, their use and methods for their production
CA3262768A1 (en) 2022-07-25 2024-02-01 Interius Biotherapeutics, Inc. Mutated polypeptides, compositions comprising the same, and uses thereof
KR20250042176A (en) 2022-07-27 2025-03-26 아블린쓰 A polypeptide that binds to a specific epitope of the neonatal FC receptor
AU2023317702A1 (en) 2022-08-01 2025-01-09 BioNTech SE Nucleic acid compositions comprising amphiphilic oligo ethylene glycol (oeg)-conjugated compounds and methods of using such compounds and compositions
WO2024027910A1 (en) 2022-08-03 2024-02-08 BioNTech SE Rna for preventing or treating tuberculosis
US20260048110A1 (en) 2022-08-03 2026-02-19 BioNTech SE Rna for preventing or treating tuberculosis
EP4594348A1 (en) 2022-09-27 2025-08-06 Vib Vzw Antivirals against human parainfluenza virus
EP4593867A2 (en) 2022-09-30 2025-08-06 Extend Biosciences, Inc. Long-acting parathyroid hormone
WO2024083843A1 (en) 2022-10-18 2024-04-25 Confo Therapeutics N.V. Amino acid sequences directed against the melanocortin 4 receptor and polypeptides comprising the same for the treatment of mc4r-related diseases and disorders
KR20250102088A (en) 2022-11-09 2025-07-04 메르크 파텐트 게엠베하 Toll-like receptor 7 agonist as an immunostimulant for inducing innate antitumor immunity
WO2024105091A1 (en) 2022-11-15 2024-05-23 Imec Vzw Method and system for droplet manipulation
EP4634232A1 (en) * 2022-12-15 2025-10-22 Institut National de la Santé et de la Recherche Médicale Single-domain antibody targeting von wilebrand factor a3-domain
US20240200085A1 (en) 2022-12-15 2024-06-20 Aarhus Universitet Synthetic activation of multimeric transmembrane receptors
WO2024133937A1 (en) 2022-12-22 2024-06-27 Biotalys NV Methods for genome editing
WO2024141921A1 (en) * 2022-12-26 2024-07-04 National Institute Of Pharmaceutical Education And Research (Niper) Tumour necrosis factor alpha domain antibody
US20260026500A1 (en) 2022-12-29 2026-01-29 Biotalys NV Agrochemical compositions
EP4642233A1 (en) 2022-12-30 2025-11-05 Biotalys NV Agglomerate
WO2024141638A1 (en) 2022-12-30 2024-07-04 Biotalys NV Self-emulsifiable concentrate
EP4642916A2 (en) 2022-12-30 2025-11-05 Biotalys NV Secretion signals
CN120529914A (en) 2023-01-09 2025-08-22 奥德赛治疗股份有限公司 Anti-TNFR2 antigen binding protein and its use
IL322055A (en) 2023-01-13 2025-09-01 Regeneron Pharma Il12 receptor agonists and methods of use thereof
WO2024153324A1 (en) 2023-01-18 2024-07-25 BioNTech SE Rna formulations for pharmaceutical use
EP4655323A1 (en) 2023-01-27 2025-12-03 Vrije Universiteit Brussel Cd8b-binding polypeptides
WO2024156888A1 (en) 2023-01-27 2024-08-02 Vib Vzw Cd163-binding conjugates
WO2024163894A1 (en) 2023-02-04 2024-08-08 Momenta Pharmaceuticals, Inc. Compositions and methods for treating hemolytic disease of the fetus and newborn
WO2024165710A1 (en) 2023-02-09 2024-08-15 Seni-Preps B.V. Immunoglobulin single variable domains that inhibit urease and use thereof
AR131869A1 (en) 2023-02-17 2025-05-07 Ablynx Nv POLYPEPTIDES THAT BIND TO THE NEONATAL Fc RECEPTOR
WO2024175787A1 (en) 2023-02-24 2024-08-29 Vrije Universiteit Brussel Anti-inflammatory pannexin 1 channel inhibitors
AU2024236537A1 (en) 2023-03-14 2025-09-04 Aarhus Universitet Genetically altered nfr5 receptor kinases
IL323035A (en) 2023-03-14 2025-10-01 Odyssey Therapeutics Inc Anti-cd25 antigen-binding proteins and uses thereof
FR3147278A1 (en) 2023-03-31 2024-10-04 Avacta Life Sciences Limited TNFR2-BINDING POLYPEPTIDES AND METHODS OF USE
EP4688825A1 (en) 2023-03-31 2026-02-11 AffyXell Therapeutics Co., Ltd. Tnfr2 binding polypeptides and methods of use
JP2026513540A (en) 2023-03-31 2026-04-28 オクタファルマ アクチェン ゲゼルシャフト FVIII-VWF fusion protein with improved pharmacokinetics
WO2024208816A1 (en) 2023-04-03 2024-10-10 Vib Vzw Blood-brain barrier crossing antibodies
CN121398842A (en) 2023-04-14 2026-01-23 百欧恩泰欧洲股份公司 RNA for preventing or treating tuberculosis
EP4694919A1 (en) 2023-04-14 2026-02-18 BioNTech SE Rna for preventing or treating tuberculosis
WO2024213776A1 (en) 2023-04-14 2024-10-17 BioNTech SE Rna for preventing or treating tuberculosis
AR132494A1 (en) 2023-04-24 2025-07-02 Merck Sharp & Dohme Llc TROP2 BINDERS AND CONJUGATES THEREOF
EP4709756A1 (en) 2023-05-10 2026-03-18 Regeneron Pharmaceuticals, Inc. Cd20-pd1 binding molecules and methods of use thereof
CN121511260A (en) 2023-05-11 2026-02-10 非营利性组织佛兰芒综合大学生物技术研究所 SLC4A4/NBCe1 inhibitors
CN121511255A (en) 2023-05-17 2026-02-10 奥德赛治疗股份有限公司 Modified single-domain antibodies
AU2024276787A1 (en) 2023-05-23 2026-01-15 Allygen Group Pd-l1 and trop-2 targeting conjugates comprising effector molecules and uses thereof
EP4731770A1 (en) 2023-06-22 2026-04-29 Ablynx NV Chimeric proteins for modulating cytokine receptor activity
WO2024261344A1 (en) 2023-06-23 2024-12-26 Vib Vzw Novel binders targeting the multi-drug resistant pathogen acinetobacter baumannii
WO2025006676A2 (en) 2023-06-27 2025-01-02 Firecyte Therapeutics, Inc. Insulin-like growth factor binding protein like 1 (igfbpl1) compositions and methods of use thereof
KR20260032566A (en) 2023-06-29 2026-03-09 오디세이 테라퓨틱스, 인코포레이티드 Anti-TRAILR2 antigen-binding protein and uses thereof
EP4483951A1 (en) 2023-06-30 2025-01-01 Université de Liège Single-domain antibody for inhibition of neutrophil elastase activity
CN121443644A (en) 2023-07-05 2026-01-30 阿布林克斯有限公司 FcRn antagonists for the treatment of IgG-related diseases and disorders.
WO2025021277A1 (en) 2023-07-21 2025-01-30 BioNTech SE Agents and methods for targeted delivery of cytokines to immune cells
WO2025026866A1 (en) 2023-07-28 2025-02-06 BioNTech SE Rna therapeutics with reduced toxicity
CN121925428A (en) 2023-07-30 2026-04-24 詹森生物科技公司 Molecules that bind mutant calreticulin and uses thereof
TW202521562A (en) 2023-08-11 2025-06-01 美商默沙東有限責任公司 Monovalent interleukin 12 (il-12) heterodimeric fc proteins
AR133725A1 (en) 2023-09-04 2025-10-29 Sanofi Sa POLYPEPTIDES FOR USE IN THE TREATMENT OF GLYPICAN-3 EXPRESSING TUMORS
TW202527982A (en) 2023-09-11 2025-07-16 美商默門塔醫藥公司 Pharmaceutical compositions of fcrn antibodies
EP4626931A1 (en) * 2023-09-17 2025-10-08 Ji Yan Biomedical Co., Ltd Recombinant antibodies and uses thereof
CN121986112A (en) 2023-09-22 2026-05-05 阿布林克斯有限公司 Divalent and multivalent albumin binders
NL2036011B1 (en) 2023-10-12 2025-04-30 Synapse Res Institute Molecules for reversing anti-coagulant activity of direct oral anticoagulants
WO2025080751A2 (en) 2023-10-13 2025-04-17 Odyssey Therapeutics, Inc. Anti-cdh17 antigen-binding proteins and uses thereof
WO2025093683A1 (en) 2023-11-03 2025-05-08 Neuvasq Biotechnologies Sa Wnt7 signaling agonists
WO2025099576A1 (en) 2023-11-06 2025-05-15 Momenta Pharmaceuticals, Inc. Compositions and methods for treating rheumatoid arthritis
WO2025099632A1 (en) 2023-11-08 2025-05-15 Sanofi Cd25 based lysosomal degrader and uses thereof
US20250154487A1 (en) 2023-11-10 2025-05-15 Regeneron Pharmaceuticals, Inc. Engineered alpha klotho polypeptides and uses thereof
CN117229423B (en) * 2023-11-10 2024-02-06 北京科技大学 A polypeptide nanomaterial for binding collagen and its preparation method and application
TW202539697A (en) 2023-11-15 2025-10-16 德商拜恩技術股份公司 Coronavirus vaccine
US20250376509A1 (en) 2023-11-21 2025-12-11 Janssen Biotech, Inc. Methods for treatment of myeloproliferative neoplasms
WO2025109176A1 (en) 2023-11-22 2025-05-30 Exevir Bio Bv Optimized sarbecovirus spike s2 subunit binders and compositions comprising the same
AR134512A1 (en) 2023-12-01 2026-01-21 Ablynx Nv PRECISION-ACTIVATED POLYPEPTIDES
WO2025125577A1 (en) 2023-12-14 2025-06-19 Vib Vzw Antibodies against influenza b virus
TW202543670A (en) 2023-12-22 2025-11-16 比利時商艾伯霖克斯公司 Protein-based conjugation carriers for intranuclear delivery
AR134804A1 (en) 2023-12-22 2026-04-01 Ablynx Nv PROTEIN-BASED CARRIERS FOR SITE-SPECIFIC AMINE CONJUGATION
US12378306B2 (en) 2023-12-22 2025-08-05 Biotalys NV Anti-fungal VHH antibodies
WO2025149667A1 (en) 2024-01-12 2025-07-17 Pheon Therapeutics Ltd Antibody drug conjugates and uses thereof
WO2025154056A1 (en) 2024-01-21 2025-07-24 Ibi-Ag Innovative Bio Insecticides Ltd. Anti-insect cda nanobodies and uses thereof
WO2025154058A1 (en) 2024-01-21 2025-07-24 Ibi-Ag Innovative Bio Insecticides Ltd. Anti-insect hsp70 nanobodies and uses thereof
WO2025163617A1 (en) 2024-02-04 2025-08-07 Momenta Pharmaceuticals, Inc. Compositions and methods for treating sjögren's disease
WO2025181155A1 (en) 2024-02-26 2025-09-04 Vib Vzw Human beta-glucocerebrosidase binders and uses thereof
AU2025229047A1 (en) 2024-02-29 2026-03-05 Octapharma Ag Cystine knot domain fusion protein dimers
WO2025186787A1 (en) 2024-03-08 2025-09-12 Momenta Pharmaceuticals, Inc. Compositions and methods for treating fetal and neonatal alloimmune thrombocytopenia
GB202403780D0 (en) 2024-03-15 2024-05-01 Avacta Life Sciences Ltd Polypeptides and methods for detecting and quantifying small molecules
WO2025196308A1 (en) 2024-03-22 2025-09-25 Vib Vzw Means and methods for displaying fc-containing proteins on cells and selection thereof
WO2025207946A1 (en) 2024-03-28 2025-10-02 Genzyme Corporation Polypeptides binding to a specific epitope of the transferrin receptor 1
TW202602941A (en) 2024-04-10 2026-01-16 美商奧迪希治療公司 Anti-tnfr2 antigen-binding proteins and uses thereof
WO2025217497A1 (en) 2024-04-12 2025-10-16 Paragon Therapeutics, Inc. Albumin binding proteins and methods of use
WO2025219231A1 (en) 2024-04-15 2025-10-23 Vib Vzw Computer-implemented means and methods for the de novo design of antibodies targeting a specific epitope
WO2025229160A1 (en) 2024-05-01 2025-11-06 Commit Biologics Aps Engineered proteins that engage complement factor and a protein antigen, methods, and uses thereof
WO2025255558A2 (en) 2024-06-07 2025-12-11 Odyssey Therapeutics, Inc. Anti-thymic stromal lymphopoietin (tslp) antigen-binding proteins and uses thereof
WO2025255508A1 (en) 2024-06-07 2025-12-11 Regeneron Pharmaceuticals, Inc. Engineered alpha klotho polypeptides and uses thereof
WO2025255435A2 (en) 2024-06-07 2025-12-11 Odyssey Therapeutics, Inc. Antigen-binding proteins against serum albumin and uses thereof
WO2026006708A2 (en) 2024-06-27 2026-01-02 Odyssey Therapeutics, Inc. Anti-cd25 antigen-binding proteins and uses thereof
WO2026006809A1 (en) 2024-06-27 2026-01-02 Odyssey Therapeutics, Inc. Multispecific molecules binding tnfr2 and cd25 and uses thereof
WO2026008665A1 (en) 2024-07-01 2026-01-08 Vib Vzw Binders of the pd-1•pd-l1 complex and their use
WO2026008785A1 (en) 2024-07-03 2026-01-08 Biotalys NV Agrochemical compositions
WO2026017728A1 (en) 2024-07-16 2026-01-22 Synapse Research Institute Polypeptide for treatment of microvascular thrombosis
WO2026030375A2 (en) 2024-07-30 2026-02-05 Genzyme Corporation Lipid nanoparticles and methods of manufacture and use thereof
WO2026027659A1 (en) 2024-07-31 2026-02-05 Seni-Preps B.V. Improved immunoglobulin single variable domains that inhibit urease and use thereof
WO2026052756A1 (en) 2024-09-05 2026-03-12 Ablynx Nv Her2 binding immunoglobulin single variable domains, constructs comprising the same and uses thereof
WO2026068859A1 (en) 2024-09-30 2026-04-02 Université Libre de Bruxelles Wnt signaling agonist molecules in the treatment of a bone-related disease or disorder
WO2026082899A2 (en) 2024-10-16 2026-04-23 BioNTech SE Rna for preventing or treating tuberculosis
WO2026083290A1 (en) 2024-10-16 2026-04-23 Momenta Pharmaceuticals, Inc. Compositions and methods for treating sjögren's disease
WO2026087355A1 (en) 2024-10-22 2026-04-30 Biotalys NV Downstream processing

Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5976532A (en) * 1988-05-18 1999-11-02 Centocor, Inc. Method of antithrombotic therapy using anti-GPIIb/IIIa antibodies or fragments thereof, including c7E3
US20020001587A1 (en) * 2000-03-16 2002-01-03 Sharon Erickson Methods of treatment using anti-ErbB antibody-maytansinoid conjugates
US20020054878A1 (en) * 1997-07-02 2002-05-09 Genentech, Inc. Anti-IgE antibodies
US6419934B1 (en) * 1999-02-24 2002-07-16 Edward L. Tobinick TNF modulators for treating neurological disorders associated with viral infection
US20020165387A1 (en) * 1996-10-31 2002-11-07 Kerr Anderson W. H. High affinity humanized anti-CEA monoclonal antibodies
US20030092892A1 (en) * 1997-10-27 2003-05-15 Frenken Leon Gerardus Multivalent antigen-binding proteins
US6759518B1 (en) * 1998-04-09 2004-07-06 Vectron Therapeutics Ag Single-chain multiple antigen-binding molecule, its preparation and use
US20060034845A1 (en) * 2002-11-08 2006-02-16 Karen Silence Single domain antibodies directed against tumor necrosis factor alpha and uses therefor
US20060034833A1 (en) * 2002-11-08 2006-02-16 Els Beirnaert Single domain antibodies directed against interferron-gamma and uses therefor
US20070031424A1 (en) * 2001-10-24 2007-02-08 Vlaams Interuniversitair Instituut Voor Biotechnogie Vzw Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof

Family Cites Families (192)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US460167A (en) 1891-09-29 Car-mover
SE307996B (en) 1965-11-30 1969-01-27 Asea Ab
CU22545A1 (en) * 1994-11-18 1999-03-31 Centro Inmunologia Molecular OBTAINING A CHEMICAL AND HUMANIZED ANTIBODY AGAINST THE RECEPTOR OF THE EPIDERMAL GROWTH FACTOR FOR DIAGNOSTIC AND THERAPEUTIC USE
US4179337A (en) 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
US4405306A (en) * 1981-12-08 1983-09-20 Beecham Inc. Medicated disposable douche product
CA1204148A (en) 1982-05-26 1986-05-06 Petrus R. Nelen Apparatus for transferring xerographic images
US4559157A (en) 1983-04-21 1985-12-17 Creative Products Resource Associates, Ltd. Cosmetic applicator useful for skin moisturizing
LU84979A1 (en) 1983-08-30 1985-04-24 Oreal COSMETIC OR PHARMACEUTICAL COMPOSITION IN AQUEOUS OR ANHYDROUS FORM WHOSE FATTY PHASE CONTAINS OLIGOMER POLYETHER AND NEW OLIGOMER POLYETHERS
GB2148299B (en) 1983-09-01 1988-01-06 Hybritech Inc Antibody compositions of therapeutic agents having an extended serum half-life
US5672347A (en) 1984-07-05 1997-09-30 Genentech, Inc. Tumor necrosis factor antagonists and their use
US4946788A (en) 1985-06-11 1990-08-07 Ciba-Geigy Corporation Purified immunoglobulin-related factor, novel monoclonal antibodies, hybridoma cell lines, processes and applications
US4714759A (en) 1985-12-02 1987-12-22 Whitaker Jr Robert B Immunotoxin therapy of allergy
JPS62175426A (en) 1986-01-27 1987-08-01 Kazufumi Shimizu Antibody and spraying agent containing said substance as active component
US5238919A (en) 1986-05-30 1993-08-24 Scipps Clinic And Research Foundation Peptides that inhibit von Willebrand Factor binding to the platelet SPIB receptor
JP2647427B2 (en) 1987-04-24 1997-08-27 帝人株式会社 Detection method, monoclonal antibody, and detection kit for determining disease state of subject
US5091513A (en) * 1987-05-21 1992-02-25 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US4940782A (en) 1987-06-08 1990-07-10 G. D. Searle & Co. Monoclonal antibodies against IgE-associated determinants, hybrid cell lines producing these antibodies, and use therefore
DE3853740T2 (en) 1987-06-10 1995-11-09 Dana Farber Cancer Inst Inc Bifunctional antibody designs and methods for the selective killing of cell populations.
US5200510A (en) 1987-06-16 1993-04-06 Zymogenetics, Inc. Method for purifying factor viii:c, von willebrand factor and complexes thereof
US4820508A (en) 1987-06-23 1989-04-11 Neutrogena Corporation Skin protective composition
EP0300191A1 (en) 1987-07-17 1989-01-25 Siemens Aktiengesellschaft Device for storing, isolating and feeding components loadable in bulk
GB8725529D0 (en) 1987-10-30 1987-12-02 Delta Biotechnology Ltd Polypeptides
US4962035A (en) 1987-12-01 1990-10-09 President And Fellows Of Harvard College DNA encoding IgE receptor alpha-subunit or fragment thereof
US5428133A (en) 1987-12-31 1995-06-27 Tanox Biosystems, Inc. Chimeric anti-human IgE-monoclonal antibody which binds to secreted IgE and membrane-bound IgE expressed by IgE-expressing B cells but notto IgE bound to FC receptors on basophils
DE122006000007I2 (en) 1987-12-31 2008-03-27 Tanox Inc BEARING B-LYMPHOCYTES.
US5252467A (en) 1987-12-31 1993-10-12 Tanox Biosystems, Inc. Method of making antibodies to antigenic epitopes of IGE present on B cells but not basophil cell surface or secreted, soluble IGE
US5091313A (en) 1988-08-05 1992-02-25 Tanox Biosystems, Inc. Antigenic epitopes of IgE present on B cell but not basophil surface
US5231026A (en) 1987-12-31 1993-07-27 Tanox Biosystems, Inc. DNA encoding murine-human chimeric antibodies specific for antigenic epitopes of IgE present on the extracellular segment of the membrane domain of membrane-bound IgE
US5422258A (en) 1987-12-31 1995-06-06 Tanox Biosystems, Inc. Methods for producing high affinity anti-human IgE-monoclonal antibodies which binds to IgE on IgEabearing B cells but not basophils
US4992478A (en) 1988-04-04 1991-02-12 Warner-Lambert Company Antiinflammatory skin moisturizing composition and method of preparing same
JPH01268645A (en) 1988-04-18 1989-10-26 Teijin Ltd Agent for suppressing schwartzman reaction
US4938949A (en) 1988-09-12 1990-07-03 University Of New York Treatment of damaged bone marrow and dosage units therefor
EP0366043B1 (en) 1988-10-24 1994-03-30 Otsuka Pharmaceutical Co., Ltd. Monoclonal antibody
US5051264A (en) * 1988-11-02 1991-09-24 Collaborative Research, Inc. Potentiation of the thrombolytic effect of prourokinase type plasminogen activators by streptokinase
ES2052027T5 (en) 1988-11-11 2005-04-16 Medical Research Council IMMUNOGLOBULINE VARIABLE DOMAIN SEQUENCE CLONING.
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
GB8905400D0 (en) * 1989-03-09 1989-04-19 Jonker Margreet Medicaments
US5766883A (en) 1989-04-29 1998-06-16 Delta Biotechnology Limited Polypeptides
US5399346A (en) 1989-06-14 1995-03-21 The United States Of America As Represented By The Department Of Health And Human Services Gene therapy
US5032666A (en) * 1989-06-19 1991-07-16 Becton, Dickinson And Company Amine rich fluorinated polyurethaneureas and their use in a method to immobilize an antithrombogenic agent on a device surface
SE509359C2 (en) 1989-08-01 1999-01-18 Cemu Bioteknik Ab Use of stabilized protein or peptide conjugates for the preparation of a drug
US6267964B1 (en) 1989-08-01 2001-07-31 Affibody Technology Sweden Ab Stabilized protein or peptide conjugates able to bond albumin having extended biological half-lives
US6498237B2 (en) 1989-08-07 2002-12-24 Peptech Limited Tumor necrosis factor antibodies
US5644034A (en) * 1989-08-07 1997-07-01 Peptide Technology Ltd. Tumour necrosis factor binding ligands
JP3443119B2 (en) * 1989-08-07 2003-09-02 ペプテック リミテッド Tumor necrosis factor binding ligand
GB8921123D0 (en) * 1989-09-19 1989-11-08 Millar Ann B Treatment of ards
US5196193A (en) * 1989-10-31 1993-03-23 Ophidian Pharmaceuticals, Inc. Antivenoms and methods for making antivenoms
US5859205A (en) 1989-12-21 1999-01-12 Celltech Limited Humanised antibodies
GB8928874D0 (en) 1989-12-21 1990-02-28 Celltech Ltd Humanised antibodies
GB9012995D0 (en) 1990-06-11 1990-08-01 Celltech Ltd Multivalent antigen-binding proteins
GB9016299D0 (en) 1990-07-25 1990-09-12 Brien Caroline J O Binding substances
JP2988635B2 (en) 1990-09-18 1999-12-13 塩野義製薬株式会社 Monoclonal antibody against human IgE
US5612034A (en) 1990-10-03 1997-03-18 Redcell, Inc. Super-globuling for in vivo extended lifetimes
US5843440A (en) * 1990-10-03 1998-12-01 Redcell Canada, Inc. Cellular and serum protein anchors for modulating pharmacokinetics
WO1992005801A1 (en) * 1990-10-04 1992-04-16 University Of Virginia Alumni Patents Foundation Primate erythrocyte bound monoclonal antibody heteropolymers
US5656272A (en) 1991-03-18 1997-08-12 New York University Medical Center Methods of treating TNF-α-mediated Crohn's disease using chimeric anti-TNF antibodies
DE69230998T2 (en) 1991-03-21 2000-12-21 Masimo Corp., Laguna Hills LOW-NOISE OPTICAL CONVERTER
WO1994004679A1 (en) 1991-06-14 1994-03-03 Genentech, Inc. Method for making humanized antibodies
ES2109362T3 (en) 1991-06-21 1998-01-16 Univ Cincinnati ADMINISTRABLE PROTEINS ORALLY AND METHOD TO MAKE THEM.
DK0602126T3 (en) 1991-08-14 2003-06-16 Genentech Inc Immunoglobulin variants for specific FC epsilon receptors
DE69232859T2 (en) * 1991-09-13 2003-04-10 Chiron Corp. (N.D.Ges.D. Staates Delaware), Emeryville COMPOSITION OF SEVERAL IMMUNE REACTIVE HEPATITIS C VIRUS POLYPEPTIDES
DE4293170T1 (en) * 1991-10-01 1993-11-18 Otsuka Pharma Co Ltd Antithrombotic resin, antithrombotic tube, antithrombotic film and antithrombotic coating
DE69233528T2 (en) 1991-11-25 2006-03-16 Enzon, Inc. Process for the preparation of multivalent antigen-binding proteins
JP4157160B2 (en) 1991-12-13 2008-09-24 ゾーマ テクノロジー リミテッド Methods for the preparation of modified antibody variable regions
US5869619A (en) 1991-12-13 1999-02-09 Xoma Corporation Modified antibody variable domains
EP0584421A1 (en) 1992-08-21 1994-03-02 Cécile Casterman Immunoglobulins devoid of light chains
PT1621554E (en) 1992-08-21 2009-07-13 Univ Bruxelles IMMUNOGLOBTAINES OF LIGHT CHAINS
US6765087B1 (en) * 1992-08-21 2004-07-20 Vrije Universiteit Brussel Immunoglobulins devoid of light chains
ES2121907T3 (en) 1992-08-28 1998-12-16 Bayer Ag USE OF ANTI-TNF MONOCLONAL ANTIBODIES FOR THE TREATMENT OF BACTERIAL MENINGITIS.
PT589840E (en) 1992-09-24 2004-08-31 Tanox Biosystems Inc MONOCLONAL ANTIBODIES REFORMULATED AGAINST AN IMMUNOGLOBULIN ISOTIPE
US6066718A (en) * 1992-09-25 2000-05-23 Novartis Corporation Reshaped monoclonal antibodies against an immunoglobulin isotype
WO1994008619A1 (en) 1992-10-08 1994-04-28 The Kennedy Institute Of Rheumatology Treatment of autoimmune and inflammatory disorders
GB9221657D0 (en) 1992-10-15 1992-11-25 Scotgen Ltd Recombinant bispecific antibodies
AU5669694A (en) * 1992-11-20 1994-06-22 Schering Corporation Antagonists of human gamma interferon
JP3720353B2 (en) 1992-12-04 2005-11-24 メディカル リサーチ カウンシル Multivalent and multispecific binding proteins, their production and use
DE69327229T2 (en) 1992-12-11 2000-03-30 The Dow Chemical Co., Midland Multivalent single chain antibodies
DE69322289T2 (en) 1992-12-29 1999-05-20 Genentech, Inc., South San Francisco, Calif. TREATMENT OF INFLAMMABLE INTESTINAL DISEASES WITH INTERFERON GAMMA INHIBITORS
MX9401351A (en) 1993-02-22 1994-08-31 Alza Corp COMPOSITIONS FOR ORAL SUPPLY FOR ACTIVE AGENTS.
US5888511A (en) 1993-02-26 1999-03-30 Advanced Biotherapy Concepts, Inc. Treatment of autoimmune diseases, including AIDS
EP0614984B2 (en) 1993-03-05 2010-11-03 Bayer HealthCare LLC Anti-TNF alpha human monoclonal antibodies
US6838254B1 (en) * 1993-04-29 2005-01-04 Conopco, Inc. Production of antibodies or (functionalized) fragments thereof derived from heavy chain immunoglobulins of camelidae
EP0698097B1 (en) 1993-04-29 2001-08-16 Unilever N.V. Production of antibodies or (functionalized) fragments thereof derived from heavy chain immunoglobulins of camelidae
GB9311454D0 (en) 1993-06-03 1993-07-21 Agricultural & Food Res Pharmaceutical compositions
DK104093D0 (en) * 1993-09-17 1993-09-17 Osteometer A S PROCEDURE FOR DETERMINING COLLAGEN FRAGMENTS IN BODY LIQUIDS, TEST KITS AND MEANS FOR EXERCISING THE PROCEDURE AND USING THE PROCEDURE FOR DIAGNOSTICING THE DISEASES OF TABLET METAL
WO1995017673A1 (en) 1993-12-21 1995-06-29 Ocutech, Inc. Ocular diagnostics and therapies
JP3825798B2 (en) * 1994-01-18 2006-09-27 ジェネンテク,インコーポレイテッド Method for treating parasitic infections using IgE antagonists
US5747148A (en) 1994-09-12 1998-05-05 Minnesota Mining And Manufacturing Company Ink jet printing sheet
US5670132A (en) * 1994-09-20 1997-09-23 Immunomedics, Inc. Modified radioantibody fragments for reduced renal uptake
US6544513B2 (en) * 1994-09-26 2003-04-08 The State Of New South Wales C/- Nsw Department Of Agriculture Method of controlling moth and other insect pests
WO1996017078A1 (en) 1994-11-30 1996-06-06 Ajinomoto Co., Inc. Antithrombotic agent and anti-von willebrand factor monoclonal antibodies
US5877155A (en) * 1995-03-17 1999-03-02 The Research Foundation Of State University Of New York Mimotopes and anti-mimotopes of human platelet glycoprotein Ib/IX
US6096871A (en) 1995-04-14 2000-08-01 Genentech, Inc. Polypeptides altered to contain an epitope from the Fc region of an IgG molecule for increased half-life
US6165463A (en) 1997-10-16 2000-12-26 Inhale Therapeutic Systems, Inc. Dispersible antibody compositions and methods for their preparation and use
EP0739981A1 (en) 1995-04-25 1996-10-30 Vrije Universiteit Brussel Variable fragments of immunoglobulins - use for therapeutic or veterinary purposes
WO1996034096A1 (en) 1995-04-28 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6410690B1 (en) * 1995-06-07 2002-06-25 Medarex, Inc. Therapeutic compounds comprised of anti-Fc receptor antibodies
JPH11507535A (en) * 1995-06-07 1999-07-06 イムクローン システムズ インコーポレイテッド Antibodies and antibody fragments that suppress tumor growth
US5637038A (en) 1995-07-10 1997-06-10 Davis; James F. Apparatus and method for skinning poultry
ZA966075B (en) 1995-07-27 1998-01-19 Genentech Inc Protein formulation.
US6267958B1 (en) 1995-07-27 2001-07-31 Genentech, Inc. Protein formulation
US20040197326A1 (en) * 1995-07-27 2004-10-07 Genentech, Inc. Method for treatment of allergic asthma
GB9518323D0 (en) 1995-09-07 1995-11-08 Steidler Lothar Materials and methods relating to the attachment and display of substances on cell surfaces
ATE194291T1 (en) * 1995-09-18 2000-07-15 Intracel Corp NEUTRALIZING MONOCLONAL ANTIBODIES AGAINST RESPIRATORY SYNZYTIAL VIRUS
US7368111B2 (en) * 1995-10-06 2008-05-06 Cambridge Antibody Technology Limited Human antibodies specific for TGFβ2
HU230048B1 (en) 1996-02-09 2015-06-29 Abbvie Biotechnology Ltd Use of human tnf-alpha binding antibodies
WO1997038102A1 (en) 1996-04-04 1997-10-16 Unilever Plc Multivalent and multispecific antigen-binding protein
JP2000515002A (en) 1996-06-27 2000-11-14 フラームス・インテルウニフェルジテール・インスティテュート・フォール・ビオテヒノロジー・ヴェーゼットウェー Recognition molecules that specifically interact with the active site or cleft of the target molecule
US6361938B1 (en) 1996-11-08 2002-03-26 Elan Corporation, Plc Peptides which enhance transport across tissues and methods of identifying and using the same
IT1289608B1 (en) 1997-02-05 1998-10-15 Angelini Ricerche Spa COMPOSITION FOR THERAPEUTIC OR DIAGNOSTIC USE ADMINISTRABLE VIA INTRANASAL, SUBLINGUAL OR VAGINAL
US5942602A (en) * 1997-02-13 1999-08-24 Schering Aktiengessellschaft Growth factor receptor antibodies
AUPO561697A0 (en) 1997-03-13 1997-04-10 Crc For Cardiac Technology Haemocompatible surfaces
BR9809932A (en) 1997-06-05 2000-08-01 Lilly Co Eli Methods for treating thrombotic disorders
DE29712318U1 (en) 1997-07-07 1997-10-02 Arnold, Günter, 24977 Langballig Paring knife
WO1999009055A2 (en) * 1997-08-18 1999-02-25 Innogenetics N.V. Interferon-gamma-binding molecules for treating septic shock, cachexia, immune diseases and skin disorders
US20020076404A1 (en) * 1998-01-29 2002-06-20 Chang Tse Wen Treating atopic dermatitis with IgE antagonists
ATE535154T1 (en) 1998-03-12 2011-12-15 Vhsquared Ltd PRODUCTS THAT CONTAIN INACTIVATED YEAST OR MOLD THAT HAVE ACTIVE ANTIBODIES ON THEIR EXTERNAL SURFACE
EP0954978B1 (en) 1998-03-12 2011-11-30 VHsquared Limited New products comprising inactivated yeasts or moulds provided with active antibodies
US6504013B1 (en) * 2000-02-01 2003-01-07 Idexx Laboratories, Inc. Canine allergy therapeutic recombinant chimeric anti-IgE monoclonal antibody
CA2328725A1 (en) 1998-04-15 1999-10-21 Brigham & Women's Hospital, Inc. T cell inhibitory receptor compositions and uses thereof
WO1999064069A1 (en) * 1998-06-10 1999-12-16 Ophidian Pharmaceuticals, Inc. Antibodies to cytokines in the prevention and treatment of inflammatory bowel disease
DE69905291T3 (en) 1998-07-06 2009-06-25 Perkinelmer Cellular Sciences Belgium Sprl Bioluminescence assay for agonists or antagonists of a calcium-compound receptor
US6228360B1 (en) 1998-08-19 2001-05-08 Ajinomoto Co., Inc. Antithrombotic agent and humanized anti-von Willebrand factor monoclonal antibody
US6149934A (en) * 1999-04-23 2000-11-21 Kimberly-Clark Worldwide, Inc. Absorbent article having a lotionized bodyside liner
ATE259829T1 (en) 1998-10-20 2004-03-15 Vlaams Interuniv Inst Biotech USE OF A CYTOKINE-PRODUCING LACTOCOCCUS STRAIN FOR THE TREATMENT OF COLITIS
JP2002529373A (en) * 1998-10-23 2002-09-10 ザ ブリガム アンド ウィメンズ ホスピタル,インコーポレイテッド Conformation-specific anti-von Willebrand factor antibody
EP1002861A1 (en) 1998-10-26 2000-05-24 Unilever Plc Antigen-binding proteins comprising a linker which confers restricted conformational flexibility
GB9824632D0 (en) 1998-11-10 1999-01-06 Celltech Therapeutics Ltd Biological compounds
IL127127A0 (en) 1998-11-18 1999-09-22 Peptor Ltd Small functional units of antibody heavy chain variable regions
DE19852800C1 (en) 1998-11-16 2000-04-13 Univ Albert Ludwigs Freiburg Production of antibodies to a polypeptide encoded by a known DNA sequence comprises binding of antibodies produced by DNA vaccination to immobilized recombinantly expressed polypeptide
EP1135415B1 (en) 1998-12-01 2010-08-11 Facet Biotech Corporation Humanized antibodies to gamma-interferon
ATE330631T1 (en) 1999-01-05 2006-07-15 Univ Southern Australia ANTIBODIES FRAGMENTS FOR THE LOCAL TREATMENT OF EYE DISEASES
CN1252264C (en) 1999-04-22 2006-04-19 荷兰联合利华有限公司 Inhibition of viral infection using monovalent antigen-binding proteins
US7622259B1 (en) 1999-07-05 2009-11-24 K.U. Leuven Research & Development Detection of von-Willebrand factor (vWF) activity
GB9918788D0 (en) 1999-08-10 1999-10-13 Leuven K U Res & Dev Antithrombotic effect of platelet glycoprotein 1b blocking monoclonal Fab fragments
US6436401B1 (en) * 1999-09-14 2002-08-20 Milkhaus Laboratory, Inc. Methods for alleviating symptoms associated with diabetes and diabetic neuropathy comprising administration of low levels of antibodies
EP1212100B1 (en) 1999-09-16 2005-04-06 Unilever Plc Delivery system for antidandruff agent
EP1118669A3 (en) 1999-12-17 2001-08-29 Unilever Plc Production of camelid antibodies in plants
US7608681B2 (en) 1999-12-24 2009-10-27 Genentech, Inc. Methods and compositions for prolonging elimination half-times of bioactive compounds
PL356836A1 (en) 2000-02-10 2004-07-12 Abbott Laboratories Antibodies that bind human interleukin-18 and methods of making and using
EP1134231B1 (en) 2000-03-14 2009-04-15 Unilever N.V. Antibody heavy chain variable domains against human dietary lipases, and their uses
EP1284752A4 (en) * 2000-04-26 2004-08-18 Elusys Therapeutics Inc Bispecific molecules and uses thereof
JP2001318093A (en) * 2000-05-09 2001-11-16 Keio Gijuku Anti-inflammatory agent containing a platelet GPIbα function inhibitor as an active ingredient
AU2001264747A1 (en) 2000-05-22 2001-12-03 Idec Pharmaceuticals Corporation Identification of unique binding interactions between certain antibodies and thehuman b7.1 and b7.2 co-stimulatory antigens
US7943129B2 (en) * 2000-05-26 2011-05-17 National Research Council Of Canada Single-domain brain-targeting antibody fragments derived from llama antibodies
US6849259B2 (en) * 2000-06-16 2005-02-01 Symphogen A/S Polyclonal antibody composition for treating allergy
US6902734B2 (en) * 2000-08-07 2005-06-07 Centocor, Inc. Anti-IL-12 antibodies and compositions thereof
UA81743C2 (en) 2000-08-07 2008-02-11 Центокор, Инк. HUMAN MONOCLONAL ANTIBODY WHICH SPECIFICALLY BINDS TUMOR NECROSIS FACTOR ALFA (TNFα), PHARMACEUTICAL MIXTURE CONTAINING THEREOF, AND METHOD FOR TREATING ARTHRITIS
MY128992A (en) 2000-08-25 2007-03-30 Merck Patent Gmbh Saratin for inhibiting platelet adhesion to collagen
US6887472B2 (en) * 2000-08-30 2005-05-03 Pfizer Inc. Anti-IgE vaccines
JP2004508036A (en) 2000-09-08 2004-03-18 マイクロメット アーゲー Antibodies and / or chemokine constructs and their use in immune disorders
CA2422881A1 (en) * 2000-10-13 2002-04-18 Uab Research Foundation Human anti-epidermal growth factor receptor single-chain antibodies
AU2002236572A1 (en) * 2000-11-03 2002-05-21 Board Of Regents, The University Of Texas System Methods for detecting the efficacy of anticancer treatments
US6545097B2 (en) * 2000-12-12 2003-04-08 Scimed Life Systems, Inc. Drug delivery compositions and medical devices containing block copolymer
ATE513854T1 (en) 2000-12-13 2011-07-15 Bac Ip B V PROTEIN GRID OF VARIABLE DOMAIN OF THE CAMEL IMMUNOGLOBULIN HEAVY CHAIN
GB0031448D0 (en) * 2000-12-22 2001-02-07 Leuven K U Res & Dev Inhibition of the vWF-collagen interaction by anti-human vWF monoclonal antibody (82D6A3) results in abolition of in vivo arterial platelet thrombus formation
US7754208B2 (en) 2001-01-17 2010-07-13 Trubion Pharmaceuticals, Inc. Binding domain-immunoglobulin fusion proteins
US6632470B2 (en) * 2001-01-31 2003-10-14 Percardia Methods for surface modification
CA2442074C (en) * 2001-03-28 2014-07-22 Heska Corporation Methods of detecting early renal disease in animals
US20050019324A1 (en) * 2001-03-29 2005-01-27 Wreschner Daniel H. Peptides and antibodies to muc 1 proteins
US8178098B2 (en) * 2001-04-03 2012-05-15 National Jewish Health Method to inhibit airway hyperresponsiveness using aerosolized T cell receptor antibodies
WO2002081649A2 (en) * 2001-04-06 2002-10-17 The Trustees Of The University Of Pennsylvania ErbB INTERFACE PEPTIDOMIMETICS AND METHODS OF USE THEREOF
US7589180B2 (en) * 2001-05-11 2009-09-15 Abbott Laboratories Inc. Specific binding proteins and uses thereof
AU2002319402B2 (en) * 2001-06-28 2008-09-11 Domantis Limited Dual-specific ligand and its use
US7084257B2 (en) * 2001-10-05 2006-08-01 Amgen Inc. Fully human antibody Fab fragments with human interferon-gamma neutralizing activity
JP4323317B2 (en) 2001-12-21 2009-09-02 フラームス・インテルウニフェルシタイル・インステイチュート・フォール・ビオテヒノロヒー・ヴェーゼットウェー(ヴェーイーベー・ヴェーゼットウェー) Methods for cloning variable region sequences
US20040063912A1 (en) 2002-03-15 2004-04-01 The Brigham And Women's Hospital, Inc. Central airway administration for systemic delivery of therapeutics
WO2003077834A2 (en) 2002-03-15 2003-09-25 The Brigham And Women's Hospital, Inc. Central airway administration for systemic delivery of therapeutics
EP1600459A3 (en) 2002-06-28 2005-12-07 Domantis Limited Ligand
US20050136056A1 (en) 2002-07-29 2005-06-23 Shunsuke Kageyama Pharmaceutical composition for the treatment of thrombocytopenia
CA2494310A1 (en) * 2002-08-01 2004-02-12 Immunomedics, Inc. Alpha-fetoprotein immu31 antibodies and fusion proteins and methods of use thereof
AU2003251238A1 (en) 2002-08-07 2004-02-25 Umc Utrecht Holding B.V. Modulation of platelet adhesion based on the surface exposed beta-switch loop of platelet glycoprotein ib-alpha
US20100003253A1 (en) * 2002-11-08 2010-01-07 Ablynx N.V. Single domain antibodies directed against epidermal growth factor receptor and uses therefor
EP1558647B1 (en) 2002-11-08 2015-06-10 Ablynx N.V. Single domain antibodies directed against tumour necrosis factor-alpha and uses therefor
EP2284192A3 (en) * 2002-11-08 2011-07-20 Ablynx N.V. Camelidae antibodies for sublingual administration
US9320792B2 (en) * 2002-11-08 2016-04-26 Ablynx N.V. Pulmonary administration of immunoglobulin single variable domains and constructs thereof
SI1639011T1 (en) 2003-06-30 2009-04-30 Domantis Ltd Pegylated single domain antibodies (dAb)
PT1687338E (en) * 2003-11-07 2011-01-20 Ablynx Nv Camelidae single domain antibodies vhh directed against epidermal growth factor receptor and uses thereof
WO2005090407A1 (en) * 2004-03-19 2005-09-29 Imclone Systems Incorporated Human anti-epidermal growth factor receptor antibody
US7566701B2 (en) 2004-09-07 2009-07-28 Archemix Corp. Aptamers to von Willebrand Factor and their use as thrombotic disease therapeutics
AP2007004019A0 (en) 2004-11-25 2007-06-30 Unilever Plc Heavy chain and single domain antibodies
CA2588892A1 (en) 2004-12-02 2006-06-08 Dormantis Limited Anti-il-1r1 single domain antibodies and therapeutic uses
CA2593328C (en) 2005-01-14 2018-02-06 Ablynx N.V. Methods and assays for distinguishing between different forms of diseases and disorders characterized by thrombocytopenia and/or by spontaneous interaction between von willebrand factor (vwf) and platelets
AU2006249144B2 (en) 2005-05-18 2011-11-17 Ablynx Nv Improved NanobodiesTM against Tumor Necrosis Factor-alpha
MX2007014564A (en) 2005-05-20 2008-02-07 Ablynx Nv VHH ANTIBODIES OF SINGLE DOMAIN AGAINST VON WILLEBRAND FACTOR.
DE102005023617A1 (en) 2005-05-21 2006-11-23 Aspre Ag Method for mixing colors in a display
EP1754955B1 (en) 2005-08-19 2015-05-06 Aisin Aw Co., Ltd. Navigation method and corresponding system for determining a travel related time
CA2632424A1 (en) 2005-12-06 2007-06-14 Domantis Limited Bispecific ligands with binding specificity to cell surface targets and methods of use therefor
WO2008049881A2 (en) 2006-10-25 2008-05-02 Umc Utrecht Holding Bv Polypeptides and pharmaceutical compositions comprising the same for the prevention and treatment of complications associated with infectious diseases
TW200938222A (en) 2007-12-13 2009-09-16 Glaxo Group Ltd Compositions for pulmonary delivery
CA2718081A1 (en) 2008-03-21 2009-09-24 Ablynx Nv Von willebrand factor specific binders and methods of use therefor
CN102089325A (en) 2008-04-17 2011-06-08 埃博灵克斯股份有限公司 Peptides capable of binding to serum proteins and compounds, constructs and polypeptides comprising the same
US20120321640A1 (en) 2009-12-01 2012-12-20 Ablynx N.V. Von willebrand factor specific binding agents and uses thereof

Patent Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5976532A (en) * 1988-05-18 1999-11-02 Centocor, Inc. Method of antithrombotic therapy using anti-GPIIb/IIIa antibodies or fragments thereof, including c7E3
US20020165387A1 (en) * 1996-10-31 2002-11-07 Kerr Anderson W. H. High affinity humanized anti-CEA monoclonal antibodies
US20020054878A1 (en) * 1997-07-02 2002-05-09 Genentech, Inc. Anti-IgE antibodies
US20030092892A1 (en) * 1997-10-27 2003-05-15 Frenken Leon Gerardus Multivalent antigen-binding proteins
US6759518B1 (en) * 1998-04-09 2004-07-06 Vectron Therapeutics Ag Single-chain multiple antigen-binding molecule, its preparation and use
US6419934B1 (en) * 1999-02-24 2002-07-16 Edward L. Tobinick TNF modulators for treating neurological disorders associated with viral infection
US20020001587A1 (en) * 2000-03-16 2002-01-03 Sharon Erickson Methods of treatment using anti-ErbB antibody-maytansinoid conjugates
US20070031424A1 (en) * 2001-10-24 2007-02-08 Vlaams Interuniversitair Instituut Voor Biotechnogie Vzw Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof
US20060034845A1 (en) * 2002-11-08 2006-02-16 Karen Silence Single domain antibodies directed against tumor necrosis factor alpha and uses therefor
US20060034833A1 (en) * 2002-11-08 2006-02-16 Els Beirnaert Single domain antibodies directed against interferron-gamma and uses therefor

Cited By (77)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10041102B2 (en) 2002-10-08 2018-08-07 Pfenex Inc. Expression of mammalian proteins in Pseudomonas fluorescens
US9453251B2 (en) 2002-10-08 2016-09-27 Pfenex Inc. Expression of mammalian proteins in Pseudomonas fluorescens
US9458487B2 (en) 2002-10-08 2016-10-04 Pfenex, Inc. Expression of mammalian proteins in pseudomonas fluorescens
US9725522B2 (en) 2002-11-08 2017-08-08 Ablynx N.V. Pulmonary administration of immunoglobulin single variable domains and constructs thereof
US20110178277A1 (en) * 2002-11-08 2011-07-21 Ablynx N.V. Stabilized single domain antibodies
US9243065B2 (en) 2002-11-08 2016-01-26 Ablynx N.V. Polypeptide constructs including VHH directed against EGFR for intracellular delivery
US20090022721A1 (en) * 2002-11-08 2009-01-22 Ablynx N.V. Single domain antibodies directed against tumour necrosis factor-alpha and uses therefor
US9320792B2 (en) 2002-11-08 2016-04-26 Ablynx N.V. Pulmonary administration of immunoglobulin single variable domains and constructs thereof
US20090238829A1 (en) * 2002-11-08 2009-09-24 Ablynx N.V. Stabilized single domain antibodies
US20090324512A1 (en) * 2002-11-08 2009-12-31 Ablynx N.V. Polypeptide constructs for nasal administration
US20100003253A1 (en) * 2002-11-08 2010-01-07 Ablynx N.V. Single domain antibodies directed against epidermal growth factor receptor and uses therefor
US20100003249A1 (en) * 2002-11-08 2010-01-07 Ablynx N.V. Polypeptide constructs for topical administration
US20100003248A1 (en) * 2002-11-08 2010-01-07 Ablynx N.V Polypeptide constructs for rectal and/or vaginal administration
US20100021459A1 (en) * 2002-11-08 2010-01-28 Ablynx N.V. Polypeptide constructs for intracellular delivery
US20100040613A1 (en) * 2002-11-08 2010-02-18 Ablynx N.V. Polypeptide constructs for sublingual administration
US20070178082A1 (en) * 2002-11-08 2007-08-02 Ablynx N.V. Stabilized single domain antibodies
US9371381B2 (en) 2002-11-08 2016-06-21 Ablynx, N.V. Single domain antibodies directed against tumor necrosis factor-alpha and uses therefor
US20070237769A1 (en) * 2002-11-08 2007-10-11 Ablynx N.V. Single domain antibodies directed against tumour necrosis factor-alpha and uses therefor
US20060034845A1 (en) * 2002-11-08 2006-02-16 Karen Silence Single domain antibodies directed against tumor necrosis factor alpha and uses therefor
US20110184151A1 (en) * 2002-11-08 2011-07-28 Ablynx N.V. Single domain antibodies directed against epidermal growth factor receptor and uses therefor
US20110184145A1 (en) * 2002-11-08 2011-07-28 Ablynx N.V. Method of administering therapeutic polypeptides, and polypeptides therefor
US20110123529A1 (en) * 2002-11-08 2011-05-26 Ablynx N.V. Single domain antibodies directed against epidermal growth factor receptor and uses therefor
US20110027281A1 (en) * 2002-11-08 2011-02-03 Ablynx N.V. Single domain antibodies directed against tumor necrosis factor-alpha and uses therefor
US20060034833A1 (en) * 2002-11-08 2006-02-16 Els Beirnaert Single domain antibodies directed against interferron-gamma and uses therefor
US20110184150A1 (en) * 2002-11-08 2011-07-28 Ablynx N.V. Single domain antibodies directed against tumor necrosis factor-alpha and uses therefor
US20060228355A1 (en) * 2003-11-07 2006-10-12 Toon Laeremans Camelidae single domain antibodies vhh directed against epidermal growth factor receptor and uses therefor
US9109229B2 (en) 2004-07-26 2015-08-18 Pfenex Inc. Process for improved protein expression by strain engineering
US8603824B2 (en) 2004-07-26 2013-12-10 Pfenex, Inc. Process for improved protein expression by strain engineering
US20080267949A1 (en) * 2006-12-05 2008-10-30 Ablynx N.V. Peptides capable of binding to serum proteins
US9580719B2 (en) 2007-04-27 2017-02-28 Pfenex, Inc. Method for rapidly screening microbial hosts to identify certain strains with improved yield and/or quality in the expression of heterologous proteins
US10689640B2 (en) 2007-04-27 2020-06-23 Pfenex Inc. Method for rapidly screening microbial hosts to identify certain strains with improved yield and/or quality in the expression of heterologous proteins
EP3192808A1 (en) 2007-11-27 2017-07-19 The University Of British Columbia 14-3-3 antagonists for the prevention and treatment of arthritis
EP3192807A1 (en) 2007-11-27 2017-07-19 The University Of British Columbia 14-3-3 eta antibodies and uses thereof for the diagnosis and treatment of arthritis
US20100260853A1 (en) * 2007-12-13 2010-10-14 Amrik Basran Compositions for pulmonary delivery
WO2009074634A3 (en) * 2007-12-13 2010-09-23 Glaxo Group Limited Polypeptides, antibody variable domains & antagonists
CN102131827A (en) * 2007-12-13 2011-07-20 葛兰素集团有限公司 Compositions for pulmonary delivery of premedication
EP2080770A1 (en) * 2008-01-21 2009-07-22 MorphoSys AG Proteinaceous binding molecules comprising purification tags
EP2262530A4 (en) * 2008-03-03 2012-12-05 Dyax Corp Metalloproteinase 12 binding proteins
US9993552B2 (en) 2008-10-29 2018-06-12 Ablynx N.V. Formulations of single domain antigen binding molecules
US9393304B2 (en) 2008-10-29 2016-07-19 Ablynx N.V. Formulations of single domain antigen binding molecules
AU2013202856B2 (en) * 2008-10-29 2016-02-11 Ablynx N.V. Formulations of single domain antigen binding molecules
US11370835B2 (en) 2008-10-29 2022-06-28 Ablynx N.V. Methods for purification of single domain antigen binding molecules
US10118962B2 (en) * 2008-10-29 2018-11-06 Ablynx N.V. Methods for purification of single domain antigen binding molecules
US20100172894A1 (en) * 2008-10-29 2010-07-08 Wyeth Methods for purification of single domain antigen binding molecules
CN105646643A (en) * 2008-10-29 2016-06-08 阿布林克斯公司 Methods for purification of single domain antigen-binding molecules
US20110311515A1 (en) * 2009-01-14 2011-12-22 Ablynx N.V. Pulmonary administration of immunoglobulin single variable domains and constructs thereof
AU2010205627B2 (en) * 2009-01-14 2015-04-02 Ablynx Nv Pulmonary administration of immunoglobulin single variable domains and constructs thereof
US10005830B2 (en) 2009-03-05 2018-06-26 Ablynx N.V. Antigen binding dimer-complexes, methods of making/avoiding and uses thereof
US10919954B2 (en) 2009-03-05 2021-02-16 Ablynx N.V. Antigen binding dimer-complexes, methods of making/avoiding and uses thereof
US12492239B2 (en) 2009-03-05 2025-12-09 Ablynx N.V. Antigen binding dimer-complexes, methods of making/avoiding and uses thereof
US9265834B2 (en) 2009-03-05 2016-02-23 Ablynx N.V. Stable formulations of polypeptides and uses thereof
WO2010100135A1 (en) * 2009-03-05 2010-09-10 Ablynx N.V. Novel antigen binding dimer-complexes, methods of making/avoiding and uses thereof
EP3438126A1 (en) * 2009-09-03 2019-02-06 Ablynx N.V. Stable formulations of polypeptides and uses thereof
US9884117B2 (en) 2009-09-03 2018-02-06 Ablynx N.V. Stable formulations of polypeptides and uses thereof
WO2011049449A1 (en) * 2009-10-22 2011-04-28 University Of Twente Vhh for application in tissue repair, organ regeneration, organ replacement and tissue engineering
US10961303B2 (en) 2009-10-22 2021-03-30 Universiteit Twente VHH for application in tissue repair, organ regeneration, organ replacement and tissue engineering
US9340605B2 (en) 2009-10-22 2016-05-17 Universiteit Twente VHH for application in tissue repair, organ regeneration, organ replacement and tissue engineering
WO2012022814A1 (en) 2010-08-20 2012-02-23 Novartis Ag Antibodies for epidermal growth factor receptor 3 (her3)
WO2013084147A2 (en) 2011-12-05 2013-06-13 Novartis Ag Antibodies for epidermal growth factor receptor 3 (her3)
EP3590538A1 (en) 2011-12-05 2020-01-08 Novartis AG Antibodies for epidermal growth factor receptor 3 (her3)
WO2013084148A2 (en) 2011-12-05 2013-06-13 Novartis Ag Antibodies for epidermal growth factor receptor 3 (her3) directed to domain ii of her3
US20140363434A1 (en) * 2012-01-06 2014-12-11 Complix Nv Binding agents to intracellular target molecules
US12030930B2 (en) 2012-05-31 2024-07-09 United States Of America As Represented By The Secretary Of The Air Force Camelidae single-domain antibodies against Yersinia pestis and methods of use
US12030931B2 (en) 2012-05-31 2024-07-09 United States Of America As Represented By The Secretary Of The Air Force Camelidae single-domain antibodies against Yersinia pestis and methods of use
US12030932B2 (en) 2012-05-31 2024-07-09 United States Of America As Represented By The Secretary Of The Air Force Camelidae single-domain antibodies against Yersinia pestis and methods of use
US11987618B2 (en) 2012-05-31 2024-05-21 The Government Of The United States Of America As Represented By The Secretary Of The Air Force Camelidae single-domain antibodies against Yersinia pestis and methods of use
US11891433B2 (en) 2012-05-31 2024-02-06 United States Of America As Represented By The Secretary Of The Air Force Camelidae single-domain antibodies against Yersinia pestis and methods of use
EP3611189A1 (en) 2013-03-14 2020-02-19 Novartis AG Antibodies against notch 3
WO2014159239A2 (en) 2013-03-14 2014-10-02 Novartis Ag Antibodies against notch 3
WO2015090229A1 (en) 2013-12-20 2015-06-25 Novartis Ag Regulatable chimeric antigen receptor
EP4420663A2 (en) 2013-12-20 2024-08-28 Novartis AG Regulatable chimeric antigen receptor
EP3811970A1 (en) 2014-03-15 2021-04-28 Novartis AG Regulatable chimeric antigen receptor
WO2016014553A1 (en) 2014-07-21 2016-01-28 Novartis Ag Sortase synthesized chimeric antigen receptors
EP4205749A1 (en) 2014-07-31 2023-07-05 Novartis AG Subset-optimized chimeric antigen receptor-containing cells
EP3660042A1 (en) 2014-07-31 2020-06-03 Novartis AG Subset-optimized chimeric antigen receptor-containing t-cells
US20250019464A1 (en) * 2023-07-13 2025-01-16 Phylaxis Bioscience, Llc IgE BINDING PROTEINS AND USES THEREOF
US12234297B2 (en) * 2023-07-13 2025-02-25 Phylaxis Bioscience, Llc IgE binding proteins and uses thereof

Also Published As

Publication number Publication date
RU2357974C2 (en) 2009-06-10
RU2012108416A (en) 2013-09-10
BRPI0406694B8 (en) 2021-05-25
JP2006524036A (en) 2006-10-26
CA2512545A1 (en) 2004-07-29
JP2006519763A (en) 2006-08-31
NO20053774L (en) 2005-08-31
US20070178082A1 (en) 2007-08-02
US20100021459A1 (en) 2010-01-28
CA2505326A1 (en) 2004-05-21
US9028816B2 (en) 2015-05-12
JP2006517789A (en) 2006-08-03
NO337265B1 (en) 2016-02-29
WO2004062551A2 (en) 2004-07-29
NZ540194A (en) 2008-07-31
KR20080113286A (en) 2008-12-29
EP1587838A2 (en) 2005-10-26
JP2006520584A (en) 2006-09-14
JP2011024581A (en) 2011-02-10
WO2004041865A3 (en) 2004-07-15
EP2316852A1 (en) 2011-05-04
ZA200504996B (en) 2008-02-27
WO2004041865A2 (en) 2004-05-21
US20100040613A1 (en) 2010-02-18
NZ540196A (en) 2008-09-26
US20190112363A1 (en) 2019-04-18
CA2512545C (en) 2015-06-30
EP2390270A1 (en) 2011-11-30
BRPI0406694B1 (en) 2017-03-07
CN101412759A (en) 2009-04-22
ES2655912T3 (en) 2018-02-22
EP2390268A1 (en) 2011-11-30
CA2505316C (en) 2014-08-05
ES2551682T3 (en) 2015-11-23
NZ540771A (en) 2009-05-31
ATE517922T1 (en) 2011-08-15
CA2505325A1 (en) 2004-05-21
CN102584997A (en) 2012-07-18
NZ540195A (en) 2009-01-31
US20110184145A1 (en) 2011-07-28
EP2284192A2 (en) 2011-02-16
US20090324512A1 (en) 2009-12-31
CN1735630A (en) 2006-02-15
HK1082745A1 (en) 2006-06-16
CA2505316A1 (en) 2004-05-21
CA2505325C (en) 2014-02-25
CN100439400C (en) 2008-12-03
EP2316852B1 (en) 2014-03-05
MXPA05004955A (en) 2005-11-17
ES2542330T3 (en) 2015-08-04
EP1900753A3 (en) 2008-04-09
EP2301967A2 (en) 2011-03-30
EP2336179A1 (en) 2011-06-22
AU2004204262A1 (en) 2004-07-29
ES2466716T3 (en) 2014-06-11
RU2005125430A (en) 2006-02-10
MXPA05006043A (en) 2006-01-30
US20100003248A1 (en) 2010-01-07
AU2004204262B2 (en) 2010-11-04
AU2010226938A1 (en) 2010-10-28
BRPI0406694A (en) 2005-12-20
EP1900753B1 (en) 2017-08-09
KR20050092029A (en) 2005-09-16
US20150299301A1 (en) 2015-10-22
EP2301967A3 (en) 2011-07-13
US10112989B2 (en) 2018-10-30
US11034755B2 (en) 2021-06-15
EP1587838B1 (en) 2015-04-15
WO2004041863A3 (en) 2004-07-15
NZ563471A (en) 2009-04-30
US9243065B2 (en) 2016-01-26
IL168357A (en) 2011-09-27
AU2010226938B2 (en) 2012-03-29
EP2390268B1 (en) 2017-11-01
DK2316852T3 (en) 2014-06-16
US20100003249A1 (en) 2010-01-07
EP2284192A3 (en) 2011-07-20
US20060149041A1 (en) 2006-07-06
WO2004041863A2 (en) 2004-05-21
WO2004062551A3 (en) 2004-09-02
PT2316852E (en) 2014-06-23
WO2004041862A2 (en) 2004-05-21
EP1900753A2 (en) 2008-03-19
EP3299393A1 (en) 2018-03-28
EP2258392A1 (en) 2010-12-08
RU2704232C2 (en) 2019-10-24
WO2004041862A3 (en) 2004-06-24

Similar Documents

Publication Publication Date Title
US9243065B2 (en) Polypeptide constructs including VHH directed against EGFR for intracellular delivery
AU2003283137B8 (en) Camelidae antibodies against immunoglobulin E and use thereof for the treatment of allergic disorders
US20110123529A1 (en) Single domain antibodies directed against epidermal growth factor receptor and uses therefor
US9725522B2 (en) Pulmonary administration of immunoglobulin single variable domains and constructs thereof
EP1687338B1 (en) Camelidae single domain antibodies vhh directed against epidermal growth factor receptor and uses thereof
US20090022721A1 (en) Single domain antibodies directed against tumour necrosis factor-alpha and uses therefor
US20060034833A1 (en) Single domain antibodies directed against interferron-gamma and uses therefor
CN114685667A (en) Mesothelin binding molecules and uses thereof
JP2011256169A (en) Method for administering therapeutic polypeptide and polypeptide therefor

Legal Events

Date Code Title Description
STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION

AS Assignment

Owner name: ABLYNX N.V., BELGIUM

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:SILENCE, KAREN;VAECK, MARK;VAN BERGEN EN HENEGOUWEN, PAUL M.P.;SIGNING DATES FROM 20100531 TO 20100804;REEL/FRAME:024936/0356