US20050054001A1 - Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof - Google Patents
Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof Download PDFInfo
- Publication number
- US20050054001A1 US20050054001A1 US10/492,668 US49266804A US2005054001A1 US 20050054001 A1 US20050054001 A1 US 20050054001A1 US 49266804 A US49266804 A US 49266804A US 2005054001 A1 US2005054001 A1 US 2005054001A1
- Authority
- US
- United States
- Prior art keywords
- functional
- heavy chain
- chain antibody
- domain
- single domain
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/02—Nasal agents, e.g. decongestants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/06—Antiasthmatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/08—Antiallergic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/005—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies constructed by phage libraries
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
- C07K16/241—Tumor Necrosis Factors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3007—Carcino-embryonic Antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/22—Immunoglobulins specific features characterized by taxonomic origin from camelids, e.g. camel, llama or dromedary
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/20—Fusion polypeptide containing a tag with affinity for a non-protein ligand
- C07K2319/22—Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a Strep-tag
Definitions
- the present invention relates to functional heavy chain antibodies, fragments thereof and a library thereof. It also relates to methods for producing functional heavy chain antibodies, fragments thereof and a library thereof. It further relates to uses of functional heavy chain antibodies, fragments thereof and a library thereof.
- the IgG isotype is the most abundant immunoglobulin found in sera. In all mammals, it is composed of two identical heavy (H) chains and two identical light (L) chains. Immunoglobulins harbouring this structure are therefore designated four-chain immunoglobulins.
- the H-chain of a 4-chain immunoglobulin contains 4 domains and a hinge region in between the second and third domain.
- the L-chain has two domains.
- the N-terminal domains of both the L- and H-chain are more variable in sequence than the remaining domains and are known as V-domains (VL and VH respectively). Three loops within the VH and three loops within the VL juxtapose in the paired VH-VL domains and constitute the antigen-binding site.
- the loops are hypervariable in sequence and named CDR for Complementarity Determining Region.
- CDR Complementarity Determining Region.
- a description of the general structure of a 4-chain Immunoglobulin is provided in “Immunology” Roitt I. et al., Ed. MEDSI/Mc GRAWHILL.
- a pathological disorder in humans is characterised by the presence of antibodies in the serum that do not contain L-chains. Moreover, these antibodies lack important parts of their VH and CH1 as well, although the missing VH and CH1 regions can vary widely among different HCAb (Heavy Chain Antibody).
- the deletions in the H-chain are due to deletions of the rearranged H-chain involving part of the VH and the CH1 domain. These antibodies no longer recognise antigen since the VL is absent and large parts of the VH is absent too.
- the HCAb can be secreted from the B-cells because the chaperone proteins (such as BIP) that associate with the CH1 retain the H chain in the endoplasmic reticulum until BIP is replaced by the L-chain.
- the BIP In absence of the CH1 polypeptide domain, the BIP can no longer retain the truncated H-chain in the endoplasmic reticulum, and the L-chain cannot bind either resulting in the fact that the H-chains are immediately secreted as homodimers.
- HCAbs have a sequence that deviates at a few sites from normal VH sequences. Said functional HCAb occur as a homodimeric molecules.
- the CH1 is however encoded in the germline of all ⁇ -genes in dromedaries (and llama) and is removed from the mRNA coding for the functional HCAbs by a splicing of the 3′ end of the V-exon with the 5′ end of the hinge exon.
- the CH1 is part of the intron and is no longer recognized as an exon because of a single point mutation of the consensus splicing signal sequence.
- Llama and dromedary carry the same point mutation at the former CH1 exon and this finding indicates that these ⁇ -genes emerged before the llama and camels diverged from each other.
- the different splicing activity of the mRNA is not an alternative splicing as all mRNA is spliced according to this scheme. Hence these ⁇ -genes will always lead to a H-chain with its CH1 removed. Other ⁇ -genes are used to produce the common H-chain with a CH1 domain.
- VHH for Variable domain of the H-chain of a normal, i.e. immunologically-active HCAb
- VHH Variable domain of the H-chain of a normal, i.e. immunologically-active HCAb
- VH i.e. V-domain of H-chain of conventional four-chain antibody
- VH protein domain of the variable heavy polypeptide chain
- VHH VHH
- VHH and VH genes are imprinted in the dromedary genome.
- the VH and VHH genes are most likely residing in the same locus. It was noticed that the VH and VHH germline genes use the same D and J genes with the H-chain of conventional 4-chain antibodies.
- PCR around 50 VH and around 40 VHH germline genes were identified in dromedary. Each PCR fragment contains a leader signal exon and a V-exon, that ends where the CDR3 should start.
- the CDR3 and FR4 are provided by the recombined D - J segments.
- VHH germline segment harbours codons for Val37, Gly44, Leu45 and Trp47, and the VHH germline minigenes possess the Phe37 (11 ⁇ ) Tyr37 (30 ⁇ ) or in one single case Val37; Glu44 or Gln44 (8 ⁇ ); Arg45 (37 ⁇ ) or Cys45 (5 ⁇ ) and Gly47 (6 ⁇ ) or Leu47 (24 ⁇ ) or Trp47 (8 ⁇ ) or Phe47 (3 ⁇ ).
- these VHH germline-genes contain always (except 1) a Cys codon at position 45 or at the CDR1 region (codon 30,32 or 33).
- VHH germline segments were grouped in subfamilies. Some subfamilies had several members while others are much scarcer in the genome. However, it should be noted that the frequency of occurrence of these VHH germline genes in expressed HCAb is not at all related to their frequency of occurrence in the genome.
- the Cys at position 45 or around the CDR1 is normally maintained in the rearranged VHH-D-J segments, and these rearrangements products have also acquired an extra Cys in the CDR3.
- VHH-D-J rearrangements that were unable to generate an extra Cys in their CDR3 will apparently knock out the Cys45 or Cys in the CDR1 region probably by somatic hypermutation or by B-cell receptor editing.
- B cell receptor editing is a mechanism by which an upstream unrearranged V-segment is recombined into an existing V-D-J recombination product, that was most likely not functional, or recognizing a self antigen.
- the VHH domains carry also longer CDR3 than that of the VH domains (average length 17-18 versus 9). Three possibilities can be envisaged to generate a longer CDR3.
- the VHH may uses two or more D minigenes, however, this is unlikely in view of the necessity to recombine two minigenes with a different recombination signal sequence (the 12-23 spacer rule).
- a more active terminal deoxynucleotidyl transferase during the D-J or V-D-J recombination might add several non-template encoded nucleotides.
- Trp103 is encoded by the J gene and as the J gene is used in common in the VH-D-J and VHH-D-J recombination, it is logical to expect Trp at position 103 in VHH's as well. Since the VH-VL association is mediated by hydrophobic interactions, it is also clear that the substitution of the large aromatic and hydrophobic Trp 103 residue by the charged and hydrophilic Arg will prevent the association with a VL, and that of the surrogate light chain as well.
- WO92/01787 claims a single chain variable domain, being a synthetic variable immunoglobulin heavy chain domain, in which one or more of the amino acid residues at position 37, 39, 45, 47, 91, 93 or 103 is altered, whereby the tryptophan at position 103 is changed into glutamate, tyrosine or threonine.
- a substitution of tryptophan at 103 alone by arginine, glycine lysine, proline or serine would be sufficient to obtain a functional heavy chain antibody, neither that this mutation could compensate for the absence of a charged amino acid or a cysteine at position 45, nor that said mutation may result in an increased solubility of a single domain heavy chain antibody fragment.
- One embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof comprising, an amino acid which is neither a charged amino acid nor a C at position 45, and comprising an amino acid at position 103 independently chosen from the group consisting of R, G, K, S, Q, L, and P, and optionally an amino acid at position 108 independently chosen from the group consisting of Q, L and R, said positions determined according to the Kabat numbering.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof comprising an amino acid which is neither a charged amino acid nor a C at position 45 and SEQ ID NO: 13 (RGQGTQ) according to FIG. 6 , said positions determined according to the Kabat numbering.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof comprising an amino acid which is neither a charged amino acid nor a C at position 45 and SEQ ID NO: 14 (RGKGTQ) according to FIG. 6 , said positions determined according to the Kabat numbering.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof comprising SEQ ID NO: 15 (VXXXXXXGLXW) according to FIG. 6 , wherein X is any amino acid, said positions determined according to the Kabat numbering.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof comprising an amino acid which is neither a charged amino acid nor a C at position 45 and SEQ ID NO: 16 (LGQGTQVTVSS) according to FIG. 6 , said positions determined according to the Kabat numbering.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof comprising an amino acid which is neither a charged amino acid nor a C at position 45 and SEQ ID NO: 17 (QGQGTGVTVSS) according to FIG. 6 , said positions determined according to the Kabat numbering.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof comprising an amino acid which is neither a charged amino acid nor a C at position 45 and SEQ ID NO: 18 (PGQGTQVTVSS) according to FIG. 6 , said positions determined according to the Kabat numbering.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof comprising an amino acid which is neither a charged amino acid nor a C at position 45 and SEQ ID NO: 19 (SSQGTQVTVSS) according to FIG. 6 , said positions determined according to the Kabat numbering.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising any one of SEQ ID NOS: 1 to 10 according to FIG. 6 .
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising any one of SEQ ID NOS: 1, 3, 5, 7 or 9 according to FIG. 6 .
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising any one of SEQ ID NOS: 2, 4, 6, 8 or 10 according to FIG. 6 .
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising any one of SEQ ID NOS: 1, 2, 3, 4 or 5 according to FIG. 6 .
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising any one of SEQ ID NOS: 6, 7, 8, 9 or 10 according to FIG. 6 .
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising any one of SEQ ID NOS: 5, 6, 7, 8 or 9 according to FIG. 6 .
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising any one of SEQ ID NOS: 1, 3, 7, 9 or 10 according to FIG. 6 .
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising any one of SEQ ID NOS: 2, 5, 8, 9 or 10 according to FIG. 6 .
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising any one of SEQ ID NOS: 3, 4, 5, 6 or 7 according to FIG. 6 .
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising any one of SEQ ID NOS: 4, 6, 7, 8 or 9 according to FIG. 6 .
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising any one of SEQ ID NOS: 20 to 79 according to FIG. 6 .
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 1.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 2.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 3.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 4.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 5.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 6.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 7.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 8.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 9.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 10.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 20.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 21.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 22.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 23.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 24.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 25.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 26.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 27.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 28.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 29.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 30.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 31.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 32.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 33.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 34.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 35.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 36.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 37.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 38.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 39.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 40.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 41.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 42.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 43.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 44.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 45.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 46.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 47.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 48.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 49.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 50.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 51.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 52.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 53.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 54.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 55.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 56.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 57.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 58.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 59.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 60.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 61.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 62.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 63.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 64.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 65.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 66.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 67.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 68.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 69.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 70.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 71.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 72.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 73.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 74.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 75.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 76.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 77.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 78.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 79.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, according to any of the macromolecules above wherein said macromolecule is derived from camel.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, according to any of the macromolecules above wherein said macromolecule is derived from human.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, according to any of the macromolecules above wherein said macromolecule is derived from mouse.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, according to any of the macromolecules above wherein said macromolecule is derived from rabbit.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, according to any of the macromolecules above wherein said macromolecule is derived from goat.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, according to any of the macromolecules above wherein said macromolecule is derived from kangaroo.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, according to any of the macromolecules above wherein said macromolecule is derived from sheep.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, according to any of the macromolecules above wherein said macromolecule is derived from any vertebrate species other than camel, human and mouse.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof according to any of the macromolecules above, as an artificial mutant.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, according to any of according to any of the macromolecules above, as a peptide homologue of said functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof.
- homologue is an amino acid sequence which is at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 98.5%, 99%, 99.5% identical to the amino acid sequences of the present invention.
- polypeptide with an amino acid sequence having at least, for example, 95% “identity” to a reference amino acid sequence of the present invention it is intended at the amino acid sequence of the polypeptide is identical to the reference sequence, except that it may have up to 5% of its amino acids deleted or substituted compared with the reference sequence, or, except that the sequence may have amino acid insertions up to 5% of the total number of amino acids in the reference sequence.
- Another embodiment of the invention is a polypeptide comprising a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, as described above.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, as described above wherein one or more amino acids are derivatized.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above wherein said macromolecules are dimers.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above wherein said macromolecules are trimers.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above wherein said macromolecules are multimeric.
- Another embodiment of the invention is a method to functionalize a heavy chain antibody, a single domain heavy chain antibody, a VH domain, or a fragment thereof by replacing the amino acid at position 103 with an amino acid independently chosen from the group consisting of R, G, K, S and P, and optionally replacing the amino acid at position 108 with an amino acid independently chosen from the group consisting of L, Q and R, said positions determined by the Kabat numbering.
- Another embodiment of the invention is a method to functionalize a heavy chain antibody, a single domain heavy chain antibody, a VH domain, or a fragment thereof by replacing the amino acid at position 103 with R, said position determined according to the Kabat numbering.
- Another embodiment of the invention is a method to humanize and functionalize a heavy chain antibody, a single domain heavy chain antibody, a VH domain, or a fragment thereof, said method comprising replacing the amino acid at position 45 with L, and optionally replacing the amino acid at position 37 with V and/or the amino acid at position 44 with G and/or the amino acid at position 47 with W, and replacing of amino acid at position 103 with R, said position determined according to the Kabat numbering
- Another embodiment of the invention is a method to humanize and functionalize a heavy chain antibody, a single domain heavy chain antibody, a VH domain, or a fragment thereof, said method comprising replacing the amino acid at position 45 with L, replacing the amino acid at position 103 with an amino acid independently chosen from the group consisting of R, G, K, S and P, and optionally replacing the amino acid at position 37 with V and/or the amino acid at position 44 with G and/or the amino acid at position 47 with W, and optionally replacing the amino acid at position 108 with an amino acid independently chosen from the group consisting of L, Q and R, said positions determined by the Kabat numbering.
- Another embodiment of the invention is a method according to the above methods, wherein said heavy chain antibody, single domain heavy chain antibody, VH domain, or fragment thereof is derived from human or mouse.
- Another embodiment of the invention is a method according to the above methods, wherein said heavy chain antibody, single domain heavy chain antibody, VH domain, or fragment thereof is derived from human.
- Another embodiment of the invention is a method according to the above methods, wherein said heavy chain antibody, single domain heavy chain antibody, VH domain, or fragment thereof is derived from mouse.
- Another embodiment of the invention is a method according to the above methods, wherein said heavy chain antibody, single domain heavy chain antibody, VH domain, or fragment thereof is derived from rabbit.
- Another embodiment of the invention is a method according to the above methods, wherein said heavy chain antibody, single domain heavy chain antibody, VH domain, or fragment thereof is derived from goat.
- Another embodiment of the invention is a method according to the above methods, wherein said heavy chain antibody, single domain heavy chain antibody, VH domain, or fragment thereof is derived from sheep.
- Another embodiment of the invention is a method according to the above methods, wherein said heavy chain antibody, single domain heavy chain antibody, VH domain, or fragment thereof is derived from rat.
- Another embodiment of the invention is a method according to the above methods, wherein said heavy chain antibody, single domain heavy chain antibody, VH domain, or fragment thereof is derived from any vertebrate species other than human and mouse.
- Another embodiment of the invention is a method to humanize a functional camelid heavy chain antibody, a functional camelid single domain heavy chain, a functional camelid VHH domain or a functional fragment thereof, said method comprising replacing the amino acid at position 45 with L, and optionally replacing the amino acid at position 37 with V and/or the amino acid at position 44 with G and/or the amino acid at position 47 with W, said positions determined by the Kabat numbering.
- Another embodiment of the invention is a method to camelize a functional heavy chain antibody, a functional single domain heavy chain, a functional VH domain or a functional fragment thereof, said method comprising replacing the amino acid at position 45 with an amino acid independently chosen from the group consisting of L, V and P, replacing the amino acid at position 103 with an amino acid independently chosen from the group consisting of R, G, K, S and P, and replacing the amino acid at position 37 with F, the amino acid at position 44 with G, the amino acid at position 47 with W, and amino acid at position 103 with R, and optionally replacing the amino acid at position 108 with an amino acid independently chosen from the group consisting of L, Q and R, said positions determined by the Kabat numbering.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, obtainable by the methods above.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, obtained by the methods above.
- Another embodiment of the invention is a functional humanized camelid heavy chain antibody, a functional humanized camelid single domain heavy chain, a functional humanized VH domain or a functional fragment thereof, obtainable by the methods above.
- Another embodiment of the invention is a functional humanized camelid heavy chain antibody, a functional humanized camelid single domain heavy chain, a functional humanized VH domain or a functional humanized fragment thereof, obtained by the method above.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody; a functional VH domain, or a functional fragment thereof, according to above 4 paragraphs, as an artificial mutant.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, according to above 5 paragraphs, as a peptide homologue of said functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof.
- Another embodiment of the invention is a polypeptide comprising a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof according to according to above 6 paragraphs.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, according to the above 7 paragraphs which recite said macromolecules, or a polypeptide according the above paragraph wherein one or more amino acids is derivatized.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof obtained by the methods as defined above wherein said macromolecules are dimers.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof obtainable by the methods as defined above wherein said macromolecules are dimers.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof obtained by the methods as defined above wherein said macromolecules are trimers.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof obtainable by the methods as defined above wherein said macromolecules are trimers.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof obtained by the methods as defined above wherein said macromolecules are multimeric.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof obtainable by the methods as defined above wherein said macromolecules are multimeric.
- Another embodiment of the invention is a library, comprising one or more functional heavy chain antibodies, functional single domain antibodies, functional VH domains, or functional fragments thereof as defined above.
- Another embodiment of the invention is a method to make a library, comprising at least one functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or a functional fragment thereof, comprising the steps:
- Another embodiment of the invention is a method according to the above, whereby said restriction enzyme cut is situated within the last two codons of the CDR3 coding region.
- Another embodiment of the invention is a method according to the above, whereby said restriction enzyme creates a GA 3′ sticky end by cutting before the first nucleotide of the codon coding for amino acid position 101 and after the second nucleotide of codon coding for amino acid position 101 on the complementary strand, said positions determined according to the Kabat numbering.
- Another embodiment of the invention is a method according to the above, whereby said restriction enzyme cut is situated within the last codon of the CDR3 coding region.
- Another embodiment of the invention is a method according to the above, whereby said restriction enzyme is creating a CA-3′ sticky end by cutting before the second nucleotide of codon coding for amino acid position 102 and after the third nucleotide of codon 102 on the complementary strand, said position determined according to the Kabat numbering.
- Another embodiment of the invention is a method according to the above, whereby said restriction enzyme is chosen from the group consisting of Bpml, Eco57I , Bsgl, Smu I, Fau I, Bse RI, and Bfi I.
- Another embodiment of the invention is a method to make a library comprising at least one functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof, comprising a step of amplification of nucleic acid strands encoding a repertoire of immune or non-immune VHH antibodies, using a framework 1 specific primer as forward primer, and a back primer which anneals to said nucleic acid strands such that its 3′-terminal three nucleotides are positioned over the codon of the nucleic acid strands which encode amino acid position 103, the reverse-complement of said 3′-terminal three nucleotides encoding R103, K103, Q103, F103, P103, G103 or S103, said position determined according to the Kabat numbering.
- Another embodiment of the invention is a method to make a library comprising at least one functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof, comprising a step of amplification of nucleic acid encoding a repertoire of immune or non-immune VHH antibodies or fragments thereof, using a framework 1 specific primer, as forward primer, and using one or more of SEQ ID NOs: 80 to 88 according to FIG. 6 as back primers.
- Another embodiment of the invention is a library, comprising at least one functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof, obtainable by the method according to any of claims as defined above.
- Another embodiment of the invention is a library, comprising at least one functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof, obtained by the method as defined above.
- Another embodiment of the invention is a library as defined above wherein the methods use a single domain heavy chain library from human or mouse.
- Another embodiment of the invention is a library as defined above wherein the methods use a single domain heavy chain library from camel.
- Another embodiment of the invention is a library as defined above wherein the methods use a single domain heavy chain library from sheep.
- Another embodiment of the invention is a library as defined above wherein the methods use a single domain heavy chain library from human.
- Another embodiment of the invention is a library as defined above wherein the methods use a single domain heavy chain library from mouse.
- Another embodiment of the invention is a library as defined above wherein the methods use a single domain heavy chain library from rat.
- Another embodiment of the invention is a library as defined above wherein the methods use a single domain heavy chain library from goat.
- Another embodiment of the invention is a library as defined above wherein the methods use a single domain heavy chain library from any vertebrate species other than camel, human or mouse.
- Another embodiment of the invention is a heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, obtained by the method as defined above for use in immunoassays.
- Another embodiment of the invention is a recombinant DNA construct useful for the expression of a polypeptide in a cell containing the construct, the construct comprising control sequences which regulate transcription and translation of the said antibody in the cell and a coding sequence regulated by the control sequences, wherein the coding sequence comprises a DNA sequence of at least 21 bp in reading frame in that the DNA sequence encodes a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above.
- Another embodiment of the invention is a recombinant DNA construct useful for the expression of a polypeptide in a cell containing the construct, the construct comprising control sequences which regulate transcription and translation of the said antibody in the cell and a coding sequence regulated by the control sequences, wherein the coding sequence comprises a DNA sequence of at least 42 bp in reading frame in that the DNA sequence encodes a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above.
- Another embodiment of the invention is a recombinant DNA construct useful for the expression of a polypeptide in a cell containing the construct, the construct comprising control sequences which regulate transcription and translation of the said antibody in the cell and a coding sequence regulated by the control sequences, wherein the coding sequence comprises a DNA sequence of at least 63 bp in reading frame in that the DNA sequence encodes a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above.
- Another embodiment of the invention is a recombinant DNA construct useful for the expression of a polypeptide in a cell containing the construct, the construct comprising control sequences which regulate transcription and translation of the said antibody in the cell and a coding sequence regulated by the control sequences, wherein the coding sequence comprises a DNA sequence of at least 83 bp in reading frame in that the DNA sequence encodes a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above.
- Another embodiment of the invention is a recombinant DNA construct useful for the expression of a polypeptide in a cell containing the construct, the construct comprising control sequences which regulate transcription and translation of the said antibody in the cell and a coding sequence regulated by the control sequences, wherein the coding sequence comprises a DNA sequence of at least 150 bp in reading frame in that the DNA sequence encodes a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above.
- Another embodiment of the invention is a recombinant DNA construct useful for the expression of a polypeptide in a cell containing the construct, the construct comprising control sequences which regulate transcription and translation of the said antibody in the cell and a coding sequence regulated by the control sequences, wherein the coding sequence comprises a DNA sequence of at least 240 bp in reading frame in that the DNA sequence encodes a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above.
- Another embodiment of the invention is a recombinant DNA construct useful for the expression of a polypeptide in a cell containing the construct, the construct comprising control sequences which regulate transcription and translation of the said antibody in the cell and a coding sequence regulated by the control sequences,
- Another embodiment of the invention is a nucleic acid comprising a DNA sequence encoding a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above.
- Another embodiment of the invention is a nucleic acid having a nucleotide sequence which is at least 65% identical to the sequence as defined above.
- Another embodiment of the invention is a vector comprising a nucleic acid sequence as defined above.
- Another embodiment of the invention is a host cell comprising an integrated or episomal copy of a nucleic acid molecule as defined above, or a vector as defined above.
- Another embodiment of the invention is the host cell of as used above, wherein said host cell is a yeast, bacterial, insect, fungal, plant or mammalian cell.
- Another embodiment of the invention is a method for producing a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above, comprising:
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above, or nucleic acid as defined above for the preparation of a medicament.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above, or nucleic acid as defined above for the preparation of a medicament for the treatment of a disease related to asthma, rhinoconjunctivitis, allergic disorders, acute allograft rejection, Crohn's disease and ulcerative colitis.
- Another embodiment of the invention is a pharmaceutical composition
- a pharmaceutical composition comprising a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above, or nucleic acid as defined above, optionally in combination with a suitable excipient.
- Another embodiment of the invention is the use of a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above, or nucleic acid as defined above in the diagnosis of a disease related to asthma, rhinoconjunctivitis, allergic disorders, acute allograft rejection, Crohn's disease and ulcerative colitis.
- Another embodiment of the invention is the use of a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above for the purification of a protein.
- Another embodiment of the invention is the use of a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above for the purification of a protein.
- kits for the diagnosis of a pathological condition or a susceptibility to a pathological condition in a subject comprising a nucleic acid as defined above, a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above.
- Another embodiment of the invention is a drug screening assay for screening test compounds which interact with a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above, comprising:
- Another embodiment of the invention is the product or compound identifiable by the assay as defined above.
- nucleic acid comprising the sequence SEQ ID NO: 80 according to FIG. 6 .
- nucleic acid comprising the sequence SEQ ID NO: 81 according to FIG. 6 .
- nucleic acid comprising the sequence SEQ ID NO: 82 according to FIG. 6 .
- nucleic acid comprising the sequence SEQ ID NO: 83 according to FIG. 6 .
- nucleic acid comprising the sequence SEQ ID NO: 84 according to FIG. 6 .
- nucleic acid comprising the sequence SEQ ID NO: 85 according to FIG. 6 .
- nucleic acid comprising the sequence SEQ ID NO: 86 according to FIG. 6 .
- nucleic acid comprising the sequence SEQ ID NO: 87 according to FIG. 6 .
- nucleic acid comprising the sequence SEQ ID NO: 88 according to FIG. 6 .
- Another embodiment of the invention is a nucleic acid having a nucleotide sequence which is at least 65% identical to the sequence as defined above.
- Another embodiment of the invention is the use of a nucleic acid as defined above in a method to produce one or more functional heavy chain antibodies, functional single domain heavy chain antibodies, functional VH domains, or functional fragments thereof.
- the antibodies of the above embodiments are functional and as such exhibit improved properties, for example, expression levels, stability, affinity and solubility over antibodies in which the characterising features absent. It is known in the art that the production of antibodies, for example by bacterial overexpression techniques, in phage display libraries, for screening libraries, is difficult due to the properties of the antibody or fragments thereof.
- a heavy chain, carrying a mutation at position 103, possibly combined with a mutation at position 108 behaves as a functional heavy chain antibody (HCAb), even if it does not carry the VHH hallmark amino acids at positions 37, 44, 45 and 47.
- HCAb functional heavy chain antibody
- the inventors have found that a mutation wherein the amino acid residue corresponding to position 103 (Kabat numbering) is mutated to an amino acid selected among arginine, glycine, proline, serine, leucine, glutamine or lysine can compensate for the loss of the critical hallmark amino acid at position 45, whereby the charged amino acid or the cysteine at position 45, may be changed in any other amino acid, but preferably into a leucine.
- heavy chains having said amino acids at positions at 45 and 103 were considered by the person skilled in the art as part of a classical 4-chain antibody complex (Harmsen et al. 2000) and not as a functional heavy chain antibody. Moreover, for some antibodies having residues which characterise one aspect of the present invention, the presence of a light chain has been described (Anker et al., 1990; Chukwuocha at al., 1999), clearly demonstrating that these antibodies were not functional heavy chain antibodies.
- an amino acid at position 103 selected among arginine, glycine, proline, serine or lysine increases the solubility of the heavy chain, while it may disrupt the possibility to interact with a light chain. Therefore, such a heavy chain molecule behaves like a functional heavy chain antibody, even without the hallmark amino acid for the functional HCAb at position 45.
- the invention relates to a functional HCAb, comprising an amino acid, which is neither a charged amino acid nor a cysteine at position 45, and comprising an amino acid chosen from the group consisting of arginine (R), glycine (G), lysine (K), serine (S) and proline (P) at position 103, possibly combined with glutamine (0) at position 108 according to the Kabat numbering.
- the amino acid at position 45 is a L.
- the amino acid at position 103 is an R.
- the amino acid at position 103 is an R and the amino acid at position 108 is a Q.
- the functional HCAb or fragment thereof according to the invention is an artificial mutant.
- An artificial mutant as used here, means that the change is introduced intentionally and differs from the sequence found in the natural situation.
- Said artificial mutant may be derived from a variable domain (designated VH) of a heavy polypeptide chain of an immunoglobulin wherein the amino acid residue corresponding to position 103 (Kabat numbering) is mutated to an amino acid selected from the group consisting of R, G, K, S and P, possibly in combination with a mutation wherein the amino acid residue corresponding to position 108 (Kabat numbering) is mutated to Q.
- said artificial mutant is derived from a variable domain (designated VH) of a heavy polypeptide chain of an immunoglobulin wherein the amino acid residue corresponding to position 103 (Kabat numbering) is mutated to arginine.
- said artificial mutant is derived from a variable domain (designated VH) of a heavy polypeptide chain of an immunoglobulin wherein the amino acid residue corresponding to position 103 (Kabat numbering) is mutated to arginine and the amino acid residue corresponding to position 108 (Kabat numbering) is mutated to glutamine.
- said artificial mutant may be derived from a variable domain (designated VHH) of a heavy polypeptide chain of a heavy chain antibody wherein the hallmark amino acid residue at position 45 is mutated to a Leucine, possibly in combination with a mutation of one or more of the other hallmark amino acids at position 37, 44 and 47 to Val37, Gly44 and Trp47.
- VHH variable domain
- One embodiment is an artificial mutant wherein all hallmark amino acids at position 37, 44, 45 and 47 are mutated to Val37, Gly44, Leu45 and Trp47.
- An artificial mutant according to the invention comprises a polypeptide sequence derived from the VH domain and encompasses within this polypeptide sequence RGQGTQ (SEQ ID No 13) or alternatively sequence RGKGTQ (SEQ ID No 14).
- Another artificial mutant according to the invention comprises a polypeptide sequence derived from the VHH domain and encompasses within this polypeptide sequence VXXXXXGLXW (SEQ ID No 15), whereby X can be any amino acid.
- Another artificial mutant according to the invention comprises a polypeptide sequence derived from the VH domain and encompasses within this polypeptide sequence RGQGTQ (SEQ ID No 13), wherein R of said sequence is at position 103 according to the Kabat numbering.
- Another artificial mutant according to the invention comprises a polypeptide sequence derived from the VH domain and encompasses within this polypeptide sequence RGKGTQ (SEQ ID No 14), wherein R of said sequence is at position 103 according to the Kabat numbering.
- Another artificial mutant according to the invention comprises a polypeptide sequence derived from the VHH domain and encompasses within this polypeptide sequence VXXXXXGLXW (SEQ ID No 15), wherein V of said sequence is at position 37 according to the Kabat numbering, whereby X can be any amino acid.
- Another artificial mutant according to the invention comprises a polypeptide sequence derived from the VH domain and encompasses within this polypeptide sequence LGQGTQVTVSS (SEQ ID No 16), wherein L of said sequence is at position 103 according to the Kabat numbering.
- Another artificial mutant according to the invention comprises a polypeptide sequence derived from the VH domain and encompasses within this polypeptide sequence QGQGTGVTVSS (SEQ ID No 17), wherein L of said sequence is at position 103 according to the Kabat numbering.
- Another artificial mutant according to the invention comprises a polypeptide sequence derived from the VH domain and encompasses within this polypeptide sequence PGQGTQVTVSS (SEQ ID No 18), wherein L of said sequence is at position 103 according to the Kabat numbering.
- Another artificial mutant according to the invention comprises a polypeptide sequence derived from the VH domain and encompasses within this polypeptide sequence SSQGTQVTVSS (SEQ ID No 19), wherein L of said sequence is at position 103 according to the Kabat numbering.
- Said SEQ ID Nos: 13 to 19 are those cited in FIG. 6 .
- the artificial mutant according to the invention is derived from a VH domain, or a VHH domain, meaning that in accordance with the present invention it can be isolated from said domain by introducing said mutations, or it can be synthesized, including chemically synthesized or expressed especially by recombinant techniques, including in host cells, starting from the knowledge of the polypeptide sequence of said VH domains or VHH domains and the position of the mutations to be introduced. More generally, it can be prepared by any method made available for the preparation of polypeptide chains.
- the polypeptide chain derived from the VH gene and having the features as defined here above may be obtained by methods involving site-directed mutagenesis or PCR (using primers carrying said the mutation), starting from a conventional VH-D-J gene, especially one obtained from a library.
- a relevant method is that described by Hemsley et al. (1989).
- the present invention thus provides the possibility to generate soluble mutant single domain antibody fragments that originate from a VH-D-J gene.
- the method of Hemsley requires that the sequence of the gene to be mutated is known, at least in the region where the mutation has to be introduced. As a position to be mutated, residue 103, is adjacent to a variable region, the method of Hemsley et al. (1989) is not suitable for the introduction of a mutation in VHs with unknown variable regions, and an adapted method has to be applied in this case.
- the polypeptide chain derived from the VHH and having the features as defined here above may be obtained by methods involving site-directed mutagenesis or PCR (using primers carrying said the mutation), starting from a HCAb VHH, especially one obtained from a library.
- these mutations are situated in a conserved framework region, the method of Hemsley et al. (1989) can be applied.
- the present invention provides the possibility to humanize single domain antibody fragments that originate from a VHH-D-J gene. Humanization may comprise the replacement of one or more of the VHH hallmark amino acids at position 37, 44, 45 and 47 into the conserved human residues Val37, Gly44, Leu 45 and Trp47.
- the sequence of the adjacent variable region should be known, as discussed above.
- the invention relates further to a method to solubilize single domain heavy chain fragment derived from conventional 4-chain immunoglobulins.
- a hydrophilic amino acid residue especially of a residue selected among arginine, glycine, proline, serine or lysine renders the resulting polypeptide derived from the VH more soluble with respect to the same polypeptide having a tryptophan residue at position 103. This effect may even be enhanced by replacing the amino acid at position 108 by a glutamine.
- Another aspect of the invention is a method to “humanize” a camelid heavy chain antibody, said method comprising at least the replacement of the camelid hallmark amino acid at position 45, possibly combined with a replacement of one or more of the other hallmark amino acids at position 37, 44 and 47.
- Humanizing means that one or more of the camelid hallmark amino acids in the HCAb are replaced by their human counterpart as found in the human consensus sequence, without that said heavy chain antibody is losing its typical character, i.e. the humanization does not significantly affect the antigen binding capacity of the resulting HCAb or fragment thereof.
- Another aspect of the invention is a functional single domain heavy chain antibody fragment, obtainable by the method according to the invention. Still another aspect of the invention is a functional single domain heavy chain antibody fragment, obtained by the method according to the invention. Still another aspect of the invention is a functional humanized single domain heavy chain antibody fragment, obtainable by the method according to the invention. Still another aspect of the invention is a functional humanized single domain heavy chain antibody fragment, obtained by the method according to the invention.
- Another aspect of the invention is a library, comprising one or more functional single domain heavy chain antibody fragments according to the invention.
- said library comprises at least 100, or at least 1000, or at least 10 000, or at least 100 000, or at least 1 000 000 functional single domain heavy chain antibody fragments.
- Such a library has the advantage that it is composed of soluble molecules, contrary to a possible library of classical VH molecules, which would be insoluble and non-functional (Nutall et al., 2000).
- the problem may be solved by denaturation, followed by refolding and resolubilization, this procedure is not possible in case of the creation of a complex library, especially not when said creation is followed by the selection of domains with varying antigen binding specificities. Indeed, generation of insoluble and therefore “sticky” scaffold protein during selection procedures can lead to false positives through non-specific binding to antigen by hydrophobic patches on the displayed domain.
- Several attempts have been made to overcome this aggregation problem (Pessi et al, 1993; Quiocho, 1993; Dimasi et al., 1997), but till now, the attempts of producing single domain VH libraries with acceptable solubility characteristics have not been successful. Therefore, the soluble single domain heavy chain antibody fragment according to the invention allow for the first time the efficient construction of a library comprising functional single chain antibody fragments.
- a VHH backbone may be used as starting material, this has several drawbacks, as not only the camelid hallmark amino acids have to be mutated, but the compensating mutation at position 103 has to be introduced. For this reason, it is preferable to construct the library starting from a human VH mRNA library. From such a library, potent antigen binders may be retrieved. Contrary to the VHH situation, starting from a VH backbone, only the mutation at position 103 has to be introduced.
- the 3′-end primer used to amplify the VH by RT-PCR needs to be mutagenic for the codon 103, and the primer should extend for at least 4-5 nucleotides towards its 3′-end to anneal perfectly to the template.
- this region is part of the CDR3
- such a primer will contain too much degeneracies so that no DNA amplification will be achieved.
- making a functional single domain heavy chain library, according to the invention is far from obvious.
- Another aspect of the invention is a method to make a library, comprising at least one functional single chain library, according to the invention, comprising
- One embodiment comprises said method whereby the method is carried out on a pool of coding sequences, such as a pool of mRNA as well as on one isolated coding sequence.
- Another embodiment comprises said method whereby the method is carried out on one isolated coding sequence, and a synthetic library is generated by randomizing one or more codons of one or more of the CDR loops.
- a library may be generated by grafting camelid CDR loops on the mutated framework, comprising the 103R mutation.
- the restriction enzyme cut is situated within the last codon or within the last two codons of the CDR3 coding region.
- One embodiment comprises said method, whereby said enzyme is creating a blunt end at the CDR3—framework 4 junction.
- Another embodiment comprises said method, whereby said enzyme creates a CA 3′ sticky end by cutting before the second nucleotide of codon 102 and after the second nucleotide of codon 102, according to the Kabat numbering. Indeed, in most VH and VHH's, there is a conserved tyrosine (Y) at position 102. This amino acid is most frequently encoded by TAC.
- Another embodiment comprises said method, whereby said enzyme creates a GA 3′ sticky end by cutting before the first nucleotide of codon 101 and after the second nucleotide of codon 101, according to the Kabat numbering. Indeed, in most human VH, there is a conserved aspartic acid (D) at position 101, a charged amino acid that is important for the CDR3 loop structure. This amino acid is encoded by either GAC or GAT.
- Another embodiment comprises said method, whereby the restriction site is Bfil, introduced in such a way that the enzyme cuts at the CDR3 junction in the upper strand, and between the first and the second nucleotide of CDR3, adjacent to the framework 4 in the lower strand.
- the CDR3 and framework 4 regions may be restored by ligation with a double stranded primer consisting of the framework 4 coding region for the upper strand, and the complementary strand thereof, with either a TG 3′ overhang, or a TG-3′ overhang and an extra codon such as GTG, or TAC before the Trp103 codon.
- said library comprises at least 100, in another embodiment at least 1000, in another embodiment at least 10 000, in another embodiment at least 100 000, in another embodiment at least 1 000 000 functional single domain heavy chain antibody fragments.
- another aspect of the invention is a library obtained by specific amplification and cloning of the new class of functional heavy chain antibodies described in this invention, and which have more homology to human antibodies than the class of VHH with the hydrophilic residues in FR2.
- specific primers for amplification were designed, that anneal preferentially to genes encoding VHH with Arginine, Lysine, Glutamine, Phenylalanine, Proline, Glycine, Tryptophan or Serine as residue 103.
- the 3′ site of the primer ends exactly at the first nucleotide of the codon coding for residue 103, which in the new class of VHH is different from the Tryptophan 103 containing VHH fragments.
- primer 1 (R103): 5′-GAG TCA TTC TCG ACT TGC GGC CGC TGA GGA GAC GGT GAC CTG GGT CCC CTG GCC (A/T/C/G)CG-3′ primer 2 (R103): 5′-GAG TCA TTC TCG ACT TGC GGC CGC TGA GGA GAC GGT GAC CTG GGT CCC CTG GCC (C/T)CT-3′ primer 3 (K103): 5′-GAG TCA TTC TCG ACT TGC GGC CGC GCT GGA GAC GGT GAC CTG GGT CCC CTG GCC (T/C)TT-3′ primer 4 (Q103): 5′-GAG TCA TTC TCG ACT TGC GGC CGC TGA GGA GAC GGT GAC CTG GGT CCC CTG GC(C/G) (C/T)TG-3′ primer 5 (L103): 5′-GAG TCA TTC TCG ACT TGC GGC TGA GGA G
- Specific amplification was carried out using a Framework 1 specific primer, that is 5′ linked to a Sfil site, as forward primer, and a pool of primers 1-10 as back primers for the amplification of functional soluble single domain heavy chain antibody fragments according to the invention.
- the resulting material was cut with Sfil and Notl or BstEll and the resulting fragment is cloned into pHen4.
- Still another aspect of the invention is the use of a functional heavy chain antibody according to the invention or a functional soluble single domain heavy chain antibody fragment according to the invention for the preparation of a medicament.
- Still another aspect of the invention is a pharmaceutical composition, comprising a functional heavy chain antibody, according to the invention, or comprising a functional soluble single domain heavy chain antibody fragment, according to the invention, optionally in combination with a suitable excipient.
- antibodies may be used in the treatment of several diseases, such as, as a non-limiting example, asthma and rhinoconjunctivitis (Botger et al, 2002), allergic disorders (Babu et al, 2001), acute allograft rejection (Sollinger et al, 2001), Crohn's disease (Hommes et al, 2002) and ulcerative colitis (Gordon et al, 2002).
- the functional soluble single domain heavy chain antibody fragment may have a significant advantage due to their small size and their solubility.
- Another aspect of the invention is the use of a functional heavy chain antibody according to the invention or a functional soluble single domain heavy chain antibody fragment according to the invention in diagnosis. Diagnostic methods, using antibodies are known to the person skilled in the art and included, as a non-limiting example ELISA and RIA methods.
- the antibodies according to the invention do have several additional advantages in these assays, due to their stability and the fact that they can be fixed on a solid support without significant loss of activity. The latter characteristic makes them specially suitable for coating of surfaces, as may be desirable in several immunological detection techniques, including their use in microarrays.
- Still another aspect of the invention is the use of a functional heavy chain antibody according to the invention or a functional soluble single domain heavy chain antibody fragment according to the invention in the purification of proteins and other molecules.
- Purification methods such as, as a non-limiting example, immunochromatography are known to the person skilled in the art.
- the antibodies according to the invention do have several additional advantages in such purification methods, due to their stability, that may guarantee a long lifetime of the purification carrier, and due to the fact that they can be fixed on a solid support without significant loss of activity.
- Derivatized as used herein in reference to a polypeptidic macromolecule means comprising derivatized amino acids.
- derivatized amino acids For example, homo-phenylalanine, citrulline, and noreleucine are considered derivatized amino acids for the purposes of the invention.
- Derivatized amino acids also include imino acid residues such as proline and hydroxyproline.
- any amino acid representing a component of the variant proteins of the present invention, replaced by the same amino acid but of the opposite chirality is considered derivatized.
- any amino acid naturally occurring in the L-configuration (which may also be referred to as the R or S, depending upon the structure of the chemical entity) may be replaced with an amino acid of the same chemical structural type, but of the opposite chirality, generally referred to as the D-amino acid but which can additionally be referred to as the R— or the S—, depending upon its composition and chemical configuration.
- Such derivatives have the property of greatly increased stability, and therefore are advantageous in the formulation of compounds which may have longer in vivo half lives, when administered by oral, intravenous, intramuscular, intraperitoneal, topical, rectal, intraocular, or other routes.
- the derivatized amino acids are in the (S) or L-configuration or the (S) or D-configuration.
- Derivatized amino acids may be used, for example, to prevent or retard in vivo degradations.
- Proteins including non-naturally occurring amino acids may be synthesized or in some cases, made recombinantly; see van Hest et al., FEBS Lett 428:(1-2) 68-70 May. 221998 and Tang et al., Abstr. Pap Am. Chem. S218:U138-U138 Part 2 Aug. 22, 1999, both of which are expressly incorporated by reference herein.
- Aromatic amino acids may be replaced with D- or L-naphylalanine, DM or L-Phenylglycine, D- or L-2-thieneylalanine, D- or L-1-, 2-, 3- or 4-pyreneylalanine, D- or L-3-thieneylalanine, D- or L-(2-pyridinyl)-alanine, D- or L-(3-pyridinyl)-alanine, D- or L-(2-pyrazinyl)-alanine, D- or L-(4-isopropyl)-phenylglycine, D-(trifluoromethyl)-phenylglycine, D-(trifluoromethyl)-phenylalanine, D-p-fluorophenylalanine, D- or L-p-biphenylphenylalanine, D- or L-p-methoxybiphenylphenylalanine, D- or L-2-indole(alkyl
- Acidic amino acids can be regarded as derivatized when they are substituted with non-carboxylate amino acids while maintaining a negative charge, and derivatives or analogs thereof, such as the non-limiting examples of (phosphono)alanine, glycine, leucine, isoleucine, threonine, or serine; or sulfated (e.g., —SO3H) threonine, serine, or tyrosine.
- (phosphono)alanine glycine, leucine, isoleucine, threonine, or serine
- sulfated e.g., —SO3H
- alkyl refers to a branched or unbranched saturated hydrocarbon group of 1 to 24 carbon atoms, such as methyl, ethyl, n-propyl, isoptopyl, n-butyl, isobutyl, t-butyl, octyl, decyl, tetradecyl, hexadecyl, eicosyl, tetracisyl and the like.
- Alkyl includes heteroalkyl, with atoms of nitrogen, oxygen and sulfur.
- Preferred alkyl groups herein contain 1 to 12 carbon atoms.
- Basic amino acids may be substituted with alkyl groups at any position of the naturally occurring amino acids lysine, arginine, ornithine, citrulline, or (guanidino)-acetic acid, or other (guanidino)alkyl-acetic acids, where “alkyl” is define as above.
- Nitrile derivatives e.g., containing the CN-moiety in place of COOH
- methionine sulfoxide may be substituted for methionine.
- any amide linkage in any of the variant polypeptides can be replaced by a ketomethylene moiety.
- Such derivatives are expected to have the property of increased stability to degradation by enzymes, and therefore possess advantages for the formulation of compounds which may have increased in vivo half lives, as administered by oral, intravenous, intramuscular, intraperitoneal, topical, rectal, intraocular, or other routes.
- Additional amino acid modifications of amino acids of variant polypeptides of to the present invention may include the following: Cysteinyl residues may be reacted with alpha-haloacetates (and corresponding amine), such as 2-chloroacetic acid or chloroacetamide, to give carboxymethyl or carboxyamidomethyl derivatives.
- Cysteinyl residues may also be derivatized by reaction with compounds such as bromotrifluoroacetone, alpha-bromo-beta-(5-imidozoyl)propionic acid, chloroacetyl phosphate, N-alkylmaleimides, 3-nitro-2-pyridyl disulfide, methyl 2-pyridyl disulfide, P-chloromercuribenzoate, 2-chloromercuri-4-nitrophenol, or chloro-7-nitrobenzo-2-oxa-1,3-diazole.
- compounds such as bromotrifluoroacetone, alpha-bromo-beta-(5-imidozoyl)propionic acid, chloroacetyl phosphate, N-alkylmaleimides, 3-nitro-2-pyridyl disulfide, methyl 2-pyridyl disulfide, P-chloromercuribenzoate, 2-chloromercuri-4-nitrophenol, or chlor
- Histidyl residues may be derivatized by reaction with compounds such as diethylprocarbonate e.g., at pH 5.5 to 7.0 because this agent is relatively specific for the histidyl side chain, and para-bromophenacyl bromide may also be used, e.g., where the reaction is preferably performed in 0.1 M sodium cacodylate at pH 6.0.
- compounds such as diethylprocarbonate e.g., at pH 5.5 to 7.0 because this agent is relatively specific for the histidyl side chain, and para-bromophenacyl bromide may also be used, e.g., where the reaction is preferably performed in 0.1 M sodium cacodylate at pH 6.0.
- Lysinyl and amino terminal residues may be reacted with compounds such as succinic or other carboxylic acid anhydrides. Derivatization with these agents is expected to have the effect of reversing the charge of the lysinyl residues.
- Suitable reagents for derivatizing alpha-amino-containing residues include compounds such as imidoesters e.g., as methyl picolinimidate; pyridoxal phosphate; pyridoxal; chloroborohydride; trinitrobenzenesulfonic acid; O-methylisourea; 2,4 pentanedione; and transaminase-catalyzed reaction with glyoxylate.
- Arginyl residues may be modified by reaction with one or several conventional reagents, among them phenylglyoxal, 2,3-butanedione, 1,2-cyclohexanedione, and ninhydrin according to known method steps.
- arginine residues requires that the reaction be performed in alkaline conditions because of the high pKa of the guanidine functional group. Furthermore, these reagents may react with the groups of lysine as well as the arginine epsilon-amino group.
- the specific modification of tyrosyl residues per se is well-known, such as for introducing spectral labels into tyrosyl residues by reaction with aromatic diazonium compounds or tetranitromethane.
- N-acetylimidizol and tetranitromethane may be used to form O-acetyl tyrosyl species and 3-nitro derivatives, respectively.
- Carboxyl side groups (aspartyl or glutamyl) may be selectively modified by reaction with carbodiimides (R′—N—C—N—R′) such as 1-cyclohexyl-3-(2-morpholinyl-(4-ethyl) carbodiimide or 1-ethyl-3-(4-azonia-4,4-dimethylpentyl)carbodiimide.
- aspartyl and glutamyl residues may be converted to asparaginyl and glutaminyl residues by reaction with ammonium ions.
- Glutaminyl and asparaginyl residues may be frequently deamidated to the corresponding glutamyl and aspartyl residues. Alternatively, these residues may be deamidated under mildly acidic conditions. Either form of these residues falls within the scope of the present invention.
- “Functional” in reference to a heavy chain antibody, a single domain heavy chain antibody, a VH domain or fragments thereof means that the same retains a significant binding (dissociation constant in the micromolar range) to its epitope, compared with its binding in vivo, and that it shows no or limited aggregation (soluble and non-aggregated above 1 mg/ml), so allowing the use of the antibody as a binder.
- “Functionalized” in reference to a heavy chain antibody, a single domain heavy chain antibody, or fragments thereof means to render said heavy chain antibody, a single domain heavy chain antibody, or fragments thereof functional.
- fragments thereof as used herein, is meant a portion corresponding to more than 95% of the sequence, more than 90% of the sequence of, more than 85% of the sequence of, more than 80% of the sequence of, more than 75% of the sequence of, more than 70% of the sequence of, more than 65% of the sequence of, more than 60% of the sequence of, more than 55% of the sequence of, or more than 50% of the sequence of.
- Coding sequence is a nucleotide sequence, which is transcribed into mRNA and/or translated into a polypeptide when placed under the control of appropriate regulatory sequences. The boundaries of the complete coding sequence are determined by a translation start codon at the 5′-terminus and a translation stop codon at the 3′-terminus. However, coding sequence as used here is not limited to the complete coding sequence, but includes fragments thereof; such fragments are also indicated as coding region.
- a coding sequence can include, but is not limited to mRNA, cDNA, recombinant nucleotide sequences or genomic DNA, while introns may be present as well under certain circumstances.
- “Human hallmark amino acids” as used herein in reference to the humanization of non-human antibodies are Val37, Gly44, Leu45, Trp47, positions determined according to the Kabat numbering.
- Nucleotide sequence “DNA sequence” “nucleic acid molecule(s)” or “nucleic acid” as used herein refers to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides. This term refers only to the primary structure of the molecule. Thus, this term includes double- and single-stranded DNA, and RNA. It also includes known types of modifications, for example, methylation, “caps” substitution of one or more of the naturally occurring nucleotides with an analog.
- “Upper strand” of a DNA sequence is the strand that comprise the DNA version of the codons as they occur in the mRNA, lower strand is the strand with the anticodons, that is used as template to synthesize the mRNA.
- VH domain as used herein means the variable domain of H-chain of a conventional four-chain antibody.
- VHH domain as used herein means variable domain of the H-chain of a conventional, (i.e. immunologically functional) HCAb.
- FIGS. 1-1 and 1 - 2 Nucleotide and translated amino acid sequences of wild type anti-b-lactamase VHH TEM04 (A) and anti-carcinoembryonic antigen VHH CEA71 (B).
- FIG. 2 Western blot analysis of R103W mutant and wild type VHH from (A) anti- ⁇ -lactamase VHH TEM04 and (B) anti-carcinoembryonic antigen VHH CEA71. From each clone three cultures were induced and used for analysis. As positive control the anti-lysozyme VHH cAblys3 was used.
- FIG. 3 Coomassie stained 15% SDS PAGE of IMAC purified R103W mutant and wild type VHH.
- the slower migrating product in the two lanes on the left is ⁇ -lactamase, which was complexed to the VHH.
- FIG. 4 Antigen binding determined by ELISA of VHH CEA71 wild type (WT) and R103W mutant.
- FIG. 5 Examination of the solubility characteristics of VHH CEA72 (wild type and R103W mutant) by determining the concentration of ammonium sulfate at which the fragment started to precipitate. The amount of VHH in the supernatant was measured (A) by protein content with OD280, or (B) by antigen binding in ELISA.
- FIGS. 6-1 , 6 - 2 , 6 - 3 SEQ ID NOS: 1 to 10 and 20 to 79: sequences of heavy chain antibody, single domain antibody, a VH domain, or a fragment thereof, wherein amino acids at positions indicated are substituted by amino acids indicated, said positions determined according to the Kabat numbering.
- VH domains are isolated from scFv libraries.
- VH domains usually originate from a cloning artifact for example by the cloning of VH instead of VH-VL, or they may originate from a gene recombination within the clone, due for example to instability of the linker sequences, resulting in the deletion of the VL gene fragment.
- These molecules are normally difficult to work with because of their low expression yields in, for example, bacterial and other expression systems and their low solubility.
- the inventors show that these VH molecules may be better expressed and show a higher solubility by introducing a mutation changing the Trp on position 103 into Arg.
- VH domain has specific interest since this domain, in principle, provides specificity and is the largest contributor to affinity. Single domains have further advantages due to their smaller size. Although it has been repeatedly shown that VH domains retain sufficient activity to interact with antigen, VH domains are known to be sticky and insoluble. The present invention shows that these problems can be remedied by the Trp103Arg substitution.
- the gene fragment encoding the anti- ⁇ -lactamase VHH TEM04 was mutagenized by PCR using the FR4 specific primer A4short-TEM04 (5′-GGA GAC GGT GAC CTG GGT CCC CTG GCC CCA TAC GAC-3′), thereby changing the wild type residue Arg on position 103 to Trp103.
- the anti-carcinoembryonic antigen (CEA) VHH CEA71 was mutated with primer A4short-CEAVH (5′-GGA GAC GGT GAC CTG GGT CCC CTG GCC CCA GGG GC-3′).
- the E. coli production vector pHEN6 was used for expression of the wild type and mutated VHH fragments.
- pHEN6 is derived from pHEN1 (Hoogenboom et al. (1991)), pHEN6 encoding the hexahistidine tag sequence for purification of VHH and lacking the phage M13 gene3.
- the PCR-products and vector were digested with Ncol-BstEll and loaded on a 1% agarose gel. Fragments and vector were purified from gel with Jetsorb, ligated, transformed into WK6 competent cells and plated onto LB agar plates containing 100 ⁇ g/ml ampicillin and 2% glucose. Mutation of R to W on position 103 was confirmed by sequencing ( FIG. 1 ).
- the proteins were blotted on nitrocellulose and blocked overnight in PBS containing 1% casein.
- the hexahistidine-tagged VHH was detected with mouse anti-Histidine monoclonal antibody (Serotec, diluted 1:1000 in PBS) and after 4 washes with PBS-0.5% tween-20 incubated with anti-mouse alkaline phosphatase conjugate (Sigma, diluted 1:1000) using NBT and BCIP as chromogenic substrates. It can be concluded that the VHH TEM04 mutant is expressed at much lower levels than its wild type derivative, while for VHH CEA71 no differences were observed ( FIG. 2 ).
- Periplasmic extracts were made from all cultures by resuspending the cells in 4 ml TES (0.2 M Tris-HCI, 0.5 mM EDTA, 0.5 M sucrose; pH 8.0). The suspension was incubated for 30 minutes on ice. Subsequently 6 ml 0.25 ⁇ TES was added and the incubation on ice was continued for 20 minutes. Periplasts were removed by centrifugation for 20 minutes at 10,000 rpm and 4° C. in SS34-rotor (Sorval). VHH was purified by IMAC using Ni—NTA (QIAGEN).
- the purified VHH were analyzed on a coomassie stained PAGE ( FIG. 3 ), which revealed that ⁇ -lactamase was co-purified as a complex with VHH TEM04, both for the wild type and the mutant form.
- An ELISA was performed to compare the antigen binding characteristics of the wild type and the mutant VHH CEA71.
- a microtiter plate (Maxisorp, NUNC) was coated overnight at 4° C. with CEA (Scrips) at a concentration of 1 ⁇ g/ml (in PBS), and blocked for two hours at room temperature (RT) with 300 ⁇ l 1% casein in PBS. The plates were washed three times with PBS-tween. Dilution series (10 ⁇ g/ml to 4.57 ng/ml, dilution factor three) of all purified samples were incubated in triplicate (100 ⁇ l/well) for 2 hours at RT.
- the solubility characteristics were examined by determination of the concentration of ammonium sulfate, at which the VHH starts to precipitate. Therefore a saturated stock solution of ammonium sulfate was prepared by dissolving an excess of salt in a limited volume of water. After equilibration for 2 hours at RT, the solid particles were removed by centrifugation at 4300 rpm for 10 minutes and the supernatant (100% ammonium sulfate solution) was used to make dilutions of 0-80%. 60 ⁇ l sample was added to 300 ⁇ l ammonium sulphate solution and mixed for 18 hours at 4° C. This mixture was centrifuged for 10 minutes at 13000 rpm in an Eppendorf centrifuge. The amount of soluble VHH in the supernatant was determined in ELISA deduced from the degree of antigen binding ( FIG. 5A ) and on the other hand by measuring the protein concentration with OD280 ( FIG. 5B ).
- Dromedaries and llamas were immunized intramuscularly with a cocktail of antigens using Freund's complete adjuvant (first injection) and Freund's incomplete adjuvant (subsequent injections). Dromedaries were immunized with CEA (Carcino Embryonic Antigen), ovalbumine (OVA), PSA (Prostate Specific Antigen), Variant Surface Glycoprotein trypanosome (VSG), ⁇ -lactamase, carbonic anhydrase, Cutinase, Potyvirus and Lysozyme.
- CEA Carcino Embryonic Antigen
- OVA ovalbumine
- PSA Prostate Specific Antigen
- VSG Variant Surface Glycoprotein trypanosome
- Llamas were immunized with Poly A Binding Protein Type 2 (PABP2), Linoic Acid BSA-conjugate, a humanized mouse mAb to CD40 (Hu-anti-CD40), human serum albumin (HSA), Salmonella typhimurium , Rotavirus. Following 6 injections with a one-week interval, a blood sample of 100 ml was collected. PBL cells were separated on a Ficoll-Paque Plus gradient (Amersham Biosciences).
- the gene fragments were reamplified using an equimolar mixture of upstream primers SM017 (5′-CCAGCCGG CCATGG CTGATGTGCAGCTGGTGGAGTCTGG-3′, and SM018 (5′-CCAGCCGG CCATGG CTCAGGTGCAGCTGGTGGAGTCTGG-3′) in combination with Call002 in a nested PCR.
- upstream primers SM017 (5′-CCAGCCGG CCATGG CTGATGTGCAGCTGGTGGAGTCTGG-3′
- SM018 5′-CCAGCCGG CCATGG CTCAGGTGCAGCTGGTGGAGTCTGG-3′
- the A4short primer (5′-CATGCCATGACTCGC GGCCCAGCCGGCC ATGGC-3′) was used on one hand to introduce a Sfil site and on the other hand the primers as described before were used to introduce the key residues on position 103 and a Notl site: primer 1 (R103), primer 2 (R103), primer 3 (K103), primer 4 (Q103), primer 5 (L103), primer 6 (F103) primer 7 (G103), primer 8 (S103), primer 9 (P103), primer 10 (Y103).
- PCR products were cloned using the Sfil/Notl restriction enzymes into the phagemid vector pHEN4 (a derivative of pHEN1 (Hoogenboom et al., 1991) with a HA-tag downstream the cloning sites of the heavy chain antibody fragment).
- pHEN4 a derivative of pHEN1 (Hoogenboom et al., 1991) with a HA-tag downstream the cloning sites of the heavy chain antibody fragment.
- the repertoire was expressed on phage following infection with M13K07 helper phages. Specific binders were selected using the principle of phage display and panning (Ghahroudi et al., 1997).
- CEA1 and CEA72 Single domain heavy chain antibodies specific for CEA (CEA1 and CEA72), PSA (N3-A, N8-B, C9-B, C11-B, C12-A, C1-B, C24-A, N13-A, N15-B), HSA (ALB1, ALB2, ALB3, ALB4, ALB5), Hu anti-CD40 (CD40-1, CD40-2, CD40-3, CD40-4, CD40-5, CD40-6, CD40-7), OVA (B13, 1DBOVA11, 1DBOVA23, 1DBOVA43, A2-19, A4-17, B368, R24), VSG (cAbAn04), ⁇ -lactamase (cAbBLA01, cAbTEM04), carbonic anhydrase (1 D2CA30), PABP2 (C4PABP2, E3 PABP2, F6 PABP2), Salmonella typhimurium (MPOD6 salmon), Rotavirus (1-F6 RTV), Linoic Acid (
- Kd's were determined on BIAcore are given in the table below.
- Expression level (mg/l culture, Name of Antigen recognized Kd purified binder by antibody (nM) material) Host N3-A Prostate specific — 0.25 Dromedary antigen N8-B Prostate specific 1.6 6.2 Dromedary antigen C9-B Prostate specific 3.9 2.1 Dromedary antigen C11-B Prostate specific 2.6 6.1 Dromedary antigen C12-A Prostate specific 2.6 1.2 Dromedary antigen C1-B Prostate specific 0.8 0.75 Dromedary antigen C24-A Prostate specific — 5.0 Dromedary antigen N13-A Prostate specific — 0.25 Dromedary antigen N15-B Prostate specific — 0.65 Dromedary antigen CEA1 Carcino Embryonic Dromedary Antigen CEA72 Carcino Embryonic 8.4 Dromedary Antigen B13 ovalbumin ⁇ 13 Dromedary 1DBOVA11 oval
- a specific binder for the CEA tumor antigen, with high homology to the human germline gene DP-47 was therefore an ideal candidate to further humanize and evaluate the influence of mutagenesis on binding affinity in ELISA and BIAcore.
- cDNA templates were made starting from blood samples from 20 non-immunized human donors (or from other species containing antigen binding molecules with an Ig-fold).
- the peripheral blood lymphocytes (PBL) were isolated on Ficoll-Paque gradients (Amersham Biosciences).
- Total RNA was prepared individually from the 20 samples of PBL's as described in example 4.
- First strand cDNA was also individually synthesized from total RNA with random hexamers as primers (as in example 4).
- Mutagenesis was carried out using a Framework 1 specific primer that is 5′ linked to a Sfil site, as backward primer, and the mutagenic primer: 3′ - ACC CGA GGA GCC TGG GAC CAG TGG CAG - 5′ or 3′ - ACC CCG GTG AGG AGG GTC CAG TGG CAG - 5′
- the DNA obtained was cut with BseRI and ligated to the double stranded primer: 5′- pC GTC AGG GGC CAA GGA ACC CAG GTC ACC GTC TCC TCA -3′ 3′- CTG CAG TCC CCG GTC CCC TGG GTC CAG TGG CAG AGG AGT -5′
- This primer restores the CDR3 and Framework 4 coding regions.
- the resulting DNA was amplified using the same forward primer as above, and using 3′- C TGG GTC CAG TGG CAG AGG AGT CGCCGGCG -5′ as backward primer. This primer created a Notl site at the end of the VH coding sequence.
- the resulting material was cut with Sfil and Notl and the resulting fragment cloned in pHEN4 to yield a phage display library.
- the library was selected with a panel of antigens, such as Human Serum Albumin and human IgG1, thereby obtaining large numbers of antigen specific antibody fragments. Sequence analysis revealed the introduced residue on position 103. The produced and His6-tagged VHH fragments showed good solubility characteristics, good specificity (not reactive against irrelevant antigens) and high affinities (range of 2 to 50 nM).
- a mouse was immunized with a set of antigens (CEA and PSA) and after four weeks the spleen was removed, homogenized in guanidinium thiocyanate buffer with a Polytron homogenizer, debris removed by low speed centrifugation and total RNA extracted using the method described before.
- the mouse VH encoding gene segments were amplified thereby introducing the variant residues on position 103. Upon selection high affinity VH fragments were selected with good characteristics with respect to solubility.
- binders for tumor necrosis factor alpha from a phage library was carried out as described in Example 4. After panning the library, 48 individual clones were selected and tested in a phage ELISA on immobilized TNF and BSA.
- the clones for which the signal on TNF was superior to the one obtained on BSA were selected for further characterization.
- sequencing the selected clones we were able to eliminate identical clones and to demonstrate that W103 was no longer encoded in the selected fragments.
- the gene segments encoding the selected antibody fragment were recloned in the pHEN6 expression vector as described in example 3, which allowed us to produce the recombinant antibody fragment as soluble periplasmic proteins.
- the recombinant antibody fragments were purified to homogeneity from the periplasmic fraction by IMAC on Ni—NTA agarose and subsequent gel-fitration chromatography on Superdex-75. The purity was determined by SDS-PAGE.
- Anti-TNF specific fragments were tested in L929 murine fibrosarcoma cells following the protocol as described by Ameloot et al. (2001). L929 cells were seeded in 96-wells mirotiter plates at 30,000 cells per wells. The next day, purified recombinant antibody fragments were added to some wells, whereas only PBS was added to control wells. In this experiment the final concentration of antibody fragment was 1 micromolar.
- Two different formats of antibodies arrays were tested, i.e. on nitrocellulose filters and glass slides.
- 2 ⁇ l of the purified antibody fragments at concentration of 1 mg/ml in PBS were spotted with a micropipette on a nitrocellulose sheet. After drying, the sheet was blocked with 1% BSA in PBS.
- the presence of functional immobilized antibody fragment on the nitrocellulose sheet was demonstrated with biotinylated TNF.
- the presence of bound TNF was demonstrated with streptavidin-alkaline phosphatase conjugate and NBT-BCIP reagent.
- the appearance of dark spots on those positions where the TNF-specific fragments were applied proved that these antibody fragments retain functionality when passively coated on a solid support. This approach can be used for random screening and selection of antigen-specific fragments.
- the anti-TNF antibody fragments were covalently immobilized.
- Purified antibody fragments were diluted to a concentration of 200 ⁇ g/ml in PBS containing 20% glycerol.
- the samples where transferred to wells of a 384 well microtiter plate. Subsequently an automated contact printer was used to deliver 5 nanoliter of the antibody solutions to a commercially available glass slide (Telechem-Superaldehyde).
- the glass slide was incubated for 1 hour in a humid chamber, to allow the reaction between the reactive aldehydes present on the glass slide and the lysine groups present on the antibody fragment surface to proceed.
- the slide was subsequently blocked with 1% BSA/PBS, subsequently incubated with Cy3-modified TNF (fluorescent label Cy3-Amersham Biosciences) at 1 ⁇ g/ml and finally washed with PBS to remove unbound labeled TNF. After scanning the fluorescence intensity present on the surface of the slide, we observed an enhanced signal at those positions where the TNF specific antibody fragments were applied.
- Cy3-modified TNF fluorescent label Cy3-Amersham Biosciences
- Purified antibody fragments at a concentration of at least 1 mg/ml were dialyzed against 0.1 M sodium bicarbonate and subsequently mixed with 1 ml gel suspension (CNBr-activated Sepharose) following the protocol as described by the manufacturer (Amersham Biosciences).
- the functionality of the immobilized anti-TNF antibody resin was tested as described below. To 1 ml of human plasma 10 ⁇ g of purified TNF was added. We then added 100 ⁇ l of the affinity resin. After of overnight incubation of this suspension, the resin was washed extensively with PBS. The pelleted beads were subsequently resuspended in 100 ⁇ l of a solution containing 1% SDS solution and boiled for 10 minutes. After centrifugation 20 ⁇ l of the supernatant was loaded on SDS-PAGE. A band of the expected molecular weight was enriched in the analyzed sample.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Public Health (AREA)
- Pulmonology (AREA)
- Cell Biology (AREA)
- Virology (AREA)
- Oncology (AREA)
- Otolaryngology (AREA)
- Transplantation (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Investigating Or Analysing Biological Materials (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Abstract
The present invention relates to functional heavy chain antibodies, functional single domain heavy chain antibodies, functional VH domains, or functional fragments thereof comprising an amino acid which is neither a charged amino acid nor a C at position 45, and comprising an amino acid at position 103 independently chosen from the group consisting of R, G, K, S, Q, L, and P, and optionally an amino acid at position 108 independently chosen from the group consisting of Q, L and R, said positions determined according to the Kabat numbering.
Description
- The present invention relates to functional heavy chain antibodies, fragments thereof and a library thereof. It also relates to methods for producing functional heavy chain antibodies, fragments thereof and a library thereof. It further relates to uses of functional heavy chain antibodies, fragments thereof and a library thereof.
- The IgG isotype is the most abundant immunoglobulin found in sera. In all mammals, it is composed of two identical heavy (H) chains and two identical light (L) chains. Immunoglobulins harbouring this structure are therefore designated four-chain immunoglobulins. The H-chain of a 4-chain immunoglobulin contains 4 domains and a hinge region in between the second and third domain. The L-chain has two domains. The N-terminal domains of both the L- and H-chain are more variable in sequence than the remaining domains and are known as V-domains (VL and VH respectively). Three loops within the VH and three loops within the VL juxtapose in the paired VH-VL domains and constitute the antigen-binding site. The loops are hypervariable in sequence and named CDR for Complementarity Determining Region. A description of the general structure of a 4-chain Immunoglobulin is provided in “Immunology” Roitt I. et al., Ed. MEDSI/Mc GRAWHILL.
- Much of the antigen binding diversity and the success of antibodies to generate a tight antigen binder against virtually all possible foreign substances, comes from the random pairing of one out of thousands of possible VHs with one out of thousands possible VLs. The second domain of the L-chain, having a more conserved sequence and denoted CL, is associated with the second domain of the H-chain (CH1) that has also a conserved sequence.
- A pathological disorder in humans, known as heavy chain disease, is characterised by the presence of antibodies in the serum that do not contain L-chains. Moreover, these antibodies lack important parts of their VH and CH1 as well, although the missing VH and CH1 regions can vary widely among different HCAb (Heavy Chain Antibody). The deletions in the H-chain are due to deletions of the rearranged H-chain involving part of the VH and the CH1 domain. These antibodies no longer recognise antigen since the VL is absent and large parts of the VH is absent too. The HCAb can be secreted from the B-cells because the chaperone proteins (such as BIP) that associate with the CH1 retain the H chain in the endoplasmic reticulum until BIP is replaced by the L-chain. In absence of the CH1 polypeptide domain, the BIP can no longer retain the truncated H-chain in the endoplasmic reticulum, and the L-chain cannot bind either resulting in the fact that the H-chains are immediately secreted as homodimers.
- Similar non-functional HCAbs were also reported to emerge in mouse monoclonal cell lines.
- In sera of Camelidae (camels, dromedaries and llamas) we found the presence of the 4-chain immunoglobins and, in addition, of large amounts of functional HCAbs. These functional HCAbs have been described in European Patent Application No 0656946 and in various publications including Hamers-Casterman et al. (1993), Vu et al. (1997) and Muyldermans et al. (2001). They are distinct from the human/mouse HCAbs present as a result of the pathological stage, in several respects. Firstly, they are functional in antigen binding. In this respect the HCAbs found in Camelidae are functional normal immunoglobulins. Secondly, in Camelidae, the entire CH1 domain is missing, and the V domain is intact but HCAbs have a sequence that deviates at a few sites from normal VH sequences. Said functional HCAb occur as a homodimeric molecules.
- The CH1 is however encoded in the germline of all γ-genes in dromedaries (and llama) and is removed from the mRNA coding for the functional HCAbs by a splicing of the 3′ end of the V-exon with the 5′ end of the hinge exon. Thus, the CH1 is part of the intron and is no longer recognized as an exon because of a single point mutation of the consensus splicing signal sequence. Llama and dromedary carry the same point mutation at the former CH1 exon and this finding indicates that these γ-genes emerged before the llama and camels diverged from each other. The different splicing activity of the mRNA is not an alternative splicing as all mRNA is spliced according to this scheme. Hence these γ-genes will always lead to a H-chain with its CH1 removed. Other γ-genes are used to produce the common H-chain with a CH1 domain.
- The V-domain of the H-chain of functional HCAb (referred to as VHH, for Variable domain of the H-chain of a normal, i.e. immunologically-active HCAb) is expected to acquire adaptations versus the VH (i.e. V-domain of H-chain of conventional four-chain antibody) in the regions that are no longer contacting the VL (or the CH1) domain and in those participating in antigen binding (i.e. the paratope).
- For instance, Clothia et al. (1985) have indicated in the above-referenced publication that crystallographic data revealed that conserved Val 37, Gly 44, Leu 45 and
Trp 47 are clustered in space in a conventional 4-chain IgG and make important hydrophobic contacts with the VL. They added that the VHamino acids Gin 39, Tyr 91,Trp 103 and Glu 105 are also recognized as important for VL association. Desmyter et al. (1996) further observed that the surface of the VHH domain which is present in camelidae and which corresponds to the VH side of conventional IgG which interacts with a VL is significantly reshaped in the camelid VHHs. In the present invention, the numbering of the amino acid residues is given by reference to the Kabat numbering (Kabat E, 1991) which is used in accordance with the Kabat database available at http://www.bioinf.org.uk/abs. - The most frequently occurring amino acid residues at twelve VH locations known to interact with VL have been determined for 332 vertebrate VH segments. It is mentioned that for the purpose of the present invention, the protein domain of the variable heavy polypeptide chain is referred as “VH” and the corresponding DNA is designated VH-D-J as it is assembled from a VH germline, a diversity D minigene and a J minigene. In fact the CDR3 and FR4 are not encoded by the VH, but they are provided by D and J minigene that are recombined with the VH or (VHH) germline.
- For comparison, the amino acid consensus has been deduced for 42 dromedary germline VHH sequences at the corresponding locations. The preferred amino acid residues at four positions (39, 43, 60 and 91, Kabat numbering) is invariable in VH and VHH. In contrast, at four other sites (33, 35, 50 and 58) neither VH nor VHH sequences reveal a pronounced amino acid preference. At the latter VH sites, the possible contact with the VL is dependent on the actual angle between VH and VL domains, and this explains the observed amino acid degeneracy. The only crucial differences between VH and VHH proteins in this
area concern position - From the results published by Nguyen et al. (2000), it is apparent that VHH and VH genes are imprinted in the dromedary genome. The VH and VHH genes are most likely residing in the same locus. It was noticed that the VH and VHH germline genes use the same D and J genes with the H-chain of conventional 4-chain antibodies. By PCR, around 50 VH and around 40 VHH germline genes were identified in dromedary. Each PCR fragment contains a leader signal exon and a V-exon, that ends where the CDR3 should start. The CDR3 and FR4 are provided by the recombined D-J segments. The VH germline segment harbours codons for Val37, Gly44, Leu45 and Trp47, and the VHH germline minigenes possess the Phe37 (11×) Tyr37 (30×) or in one single case Val37; Glu44 or Gln44 (8×); Arg45 (37×) or Cys45 (5×) and Gly47 (6×) or Leu47 (24×) or Trp47 (8×) or Phe47 (3×). In addition, these VHH germline-genes contain always (except 1) a Cys codon at
position 45 or at the CDR1 region (codon position 45 or around the CDR1 is normally maintained in the rearranged VHH-D-J segments, and these rearrangements products have also acquired an extra Cys in the CDR3. Likewise, VHH-D-J rearrangements that were unable to generate an extra Cys in their CDR3 will apparently knock out the Cys45 or Cys in the CDR1 region probably by somatic hypermutation or by B-cell receptor editing. B cell receptor editing is a mechanism by which an upstream unrearranged V-segment is recombined into an existing V-D-J recombination product, that was most likely not functional, or recognizing a self antigen. - For dromedary, the VHH domains carry also longer CDR3 than that of the VH domains (average length 17-18 versus 9). Three possibilities can be envisaged to generate a longer CDR3. The VHH may uses two or more D minigenes, however, this is unlikely in view of the necessity to recombine two minigenes with a different recombination signal sequence (the 12-23 spacer rule). Alternatively, a more active terminal deoxynucleotidyl transferase during the D-J or V-D-J recombination might add several non-template encoded nucleotides. Finally, it can not be excluded that the length difference is only due to selection in which the fraction of VHH domains with long CDR3 or the VH domains with short CDR3 is much more likely to become functional to interact with antigen. A combination of the two latter explanations might also be relevant.
- It has been proposed repeatedly that the presence of the VHH hallmarks at
positions position 45 was considered crucial as the substitution of Leu45 of a human VH domain by Arg45 rendered the isolated domain more soluble. This camelised human VH adopts a properly folded immunoglobulin structure (Riechman, 1996). Rearrangement of the former VL interface in the solution structure of a camelised, single domain VH antibody). - However, work of Chothia et al. (1985) revealed that amino acids of VH at
position amino acids Position 103 is occupied by a conserved Trp that is well buried in the VH-VL complex and provides the largest contact surface area with the VL after Leu45 and Trp47 (FIG. 2 in Chothia et al.). As this Trp103 is encoded by the J gene and as the J gene is used in common in the VH-D-J and VHH-D-J recombination, it is logical to expect Trp atposition 103 in VHH's as well. Since the VH-VL association is mediated by hydrophobic interactions, it is also clear that the substitution of the large aromatic andhydrophobic Trp 103 residue by the charged and hydrophilic Arg will prevent the association with a VL, and that of the surrogate light chain as well. WO92/01787 claims a single chain variable domain, being a synthetic variable immunoglobulin heavy chain domain, in which one or more of the amino acid residues atposition position 103 is changed into glutamate, tyrosine or threonine. However, there is no indication that a substitution of tryptophan at 103 alone by arginine, glycine lysine, proline or serine would be sufficient to obtain a functional heavy chain antibody, neither that this mutation could compensate for the absence of a charged amino acid or a cysteine atposition 45, nor that said mutation may result in an increased solubility of a single domain heavy chain antibody fragment. - It is known in the art that the production of antibodies, for example by bacterial overexpression techniques, by phage display libraries, is technically difficult due to the antibody or fragments thereof being poorly expressed, insoluble, mis-folded. It is also known that the screening of antibody libraries is restricted to those which are soluble, so excluding a large fraction of antibodies with potentially active antigen binding regions. Thus binders which might be therapeutically useful would be precluded from screening. There is a need by researchers involved in discovering new therapeutic agents for a method for producing functional antibodies and fragments thereof. There is a need by researchers involved in discovering new therapeutic agents for antibody libraries comprising functional antibodies. There is a need by researchers involved in discovering new therapeutic agents for methods to functionalism antibodies.
- One embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof comprising, an amino acid which is neither a charged amino acid nor a C at
position 45, and comprising an amino acid atposition 103 independently chosen from the group consisting of R, G, K, S, Q, L, and P, and optionally an amino acid atposition 108 independently chosen from the group consisting of Q, L and R, said positions determined according to the Kabat numbering. - Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof comprising an amino acid which is neither a charged amino acid nor a C at
position 45 and SEQ ID NO: 13 (RGQGTQ) according toFIG. 6 , said positions determined according to the Kabat numbering. - Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof comprising an amino acid which is neither a charged amino acid nor a C at
position 45 and SEQ ID NO: 14 (RGKGTQ) according toFIG. 6 , said positions determined according to the Kabat numbering. - Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof comprising SEQ ID NO: 15 (VXXXXXXGLXW) according to
FIG. 6 , wherein X is any amino acid, said positions determined according to the Kabat numbering. - Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof comprising an amino acid which is neither a charged amino acid nor a C at
position 45 and SEQ ID NO: 16 (LGQGTQVTVSS) according toFIG. 6 , said positions determined according to the Kabat numbering. - Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof comprising an amino acid which is neither a charged amino acid nor a C at
position 45 and SEQ ID NO: 17 (QGQGTGVTVSS) according toFIG. 6 , said positions determined according to the Kabat numbering. - Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof comprising an amino acid which is neither a charged amino acid nor a C at
position 45 and SEQ ID NO: 18 (PGQGTQVTVSS) according toFIG. 6 , said positions determined according to the Kabat numbering. - Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof comprising an amino acid which is neither a charged amino acid nor a C at
position 45 and SEQ ID NO: 19 (SSQGTQVTVSS) according toFIG. 6 , said positions determined according to the Kabat numbering. - Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising any one of SEQ ID NOS: 1 to 10 according to
FIG. 6 . - Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising any one of SEQ ID NOS: 1, 3, 5, 7 or 9 according to
FIG. 6 . - Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising any one of SEQ ID NOS: 2, 4, 6, 8 or 10 according to
FIG. 6 . - Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising any one of SEQ ID NOS: 1, 2, 3, 4 or 5 according to
FIG. 6 . - Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising any one of SEQ ID NOS: 6, 7, 8, 9 or 10 according to
FIG. 6 . - Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising any one of SEQ ID NOS: 5, 6, 7, 8 or 9 according to
FIG. 6 . - Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising any one of SEQ ID NOS: 1, 3, 7, 9 or 10 according to
FIG. 6 . - Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising any one of SEQ ID NOS: 2, 5, 8, 9 or 10 according to
FIG. 6 . - Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising any one of SEQ ID NOS: 3, 4, 5, 6 or 7 according to
FIG. 6 . - Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising any one of SEQ ID NOS: 4, 6, 7, 8 or 9 according to
FIG. 6 . - Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising any one of SEQ ID NOS: 20 to 79 according to
FIG. 6 . - Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 1.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 2.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 3.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 4.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 5.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 6.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 7.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 8.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 9.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 10.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 20.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 21.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 22.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 23.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 24.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 25.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 26.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 27.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 28.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 29.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 30.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 31.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 32.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 33.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 34.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 35.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 36.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 37.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 38.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 39.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 40.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 41.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 42.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 43.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 44.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 45.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 46.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 47.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 48.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 49.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 50.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 51.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 52.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 53.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 54.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 55.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 56.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 57.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 58.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 59.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 60.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 61.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 62.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 63.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 64.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 65.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 66.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 67.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 68.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 69.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 70.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 71.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 72.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 73.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 74.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 75.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 76.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 77.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 78.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising SEQ ID NO: 79.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, according to any of the macromolecules above wherein said macromolecule is derived from camel.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, according to any of the macromolecules above wherein said macromolecule is derived from human.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, according to any of the macromolecules above wherein said macromolecule is derived from mouse.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, according to any of the macromolecules above wherein said macromolecule is derived from rabbit.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, according to any of the macromolecules above wherein said macromolecule is derived from goat.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, according to any of the macromolecules above wherein said macromolecule is derived from kangaroo.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, according to any of the macromolecules above wherein said macromolecule is derived from sheep.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, according to any of the macromolecules above wherein said macromolecule is derived from any vertebrate species other than camel, human and mouse.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof according to any of the macromolecules above, as an artificial mutant.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, according to any of according to any of the macromolecules above, as a peptide homologue of said functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof.
- By “homologue” as meant herein is an amino acid sequence which is at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 98.5%, 99%, 99.5% identical to the amino acid sequences of the present invention. By a polypeptide with an amino acid sequence having at least, for example, 95% “identity” to a reference amino acid sequence of the present invention, it is intended at the amino acid sequence of the polypeptide is identical to the reference sequence, except that it may have up to 5% of its amino acids deleted or substituted compared with the reference sequence, or, except that the sequence may have amino acid insertions up to 5% of the total number of amino acids in the reference sequence. As a practical matter, whether any particular peptide is at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 98.5%, 99%, 99.5% identical to the amino acid sequences of the present invention can be determined using known algorithms.
- Another embodiment of the invention is a polypeptide comprising a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, as described above.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, as described above wherein one or more amino acids are derivatized.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above wherein said macromolecules are dimers.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above wherein said macromolecules are trimers.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above wherein said macromolecules are multimeric.
- Another embodiment of the invention is a method to functionalize a heavy chain antibody, a single domain heavy chain antibody, a VH domain, or a fragment thereof by replacing the amino acid at
position 103 with an amino acid independently chosen from the group consisting of R, G, K, S and P, and optionally replacing the amino acid atposition 108 with an amino acid independently chosen from the group consisting of L, Q and R, said positions determined by the Kabat numbering. - Another embodiment of the invention is a method to functionalize a heavy chain antibody, a single domain heavy chain antibody, a VH domain, or a fragment thereof by replacing the amino acid at
position 103 with R, said position determined according to the Kabat numbering. - Another embodiment of the invention is a method to humanize and functionalize a heavy chain antibody, a single domain heavy chain antibody, a VH domain, or a fragment thereof, said method comprising replacing the amino acid at
position 45 with L, and optionally replacing the amino acid atposition 37 with V and/or the amino acid atposition 44 with G and/or the amino acid atposition 47 with W, and replacing of amino acid atposition 103 with R, said position determined according to the Kabat numbering - Another embodiment of the invention is a method to humanize and functionalize a heavy chain antibody, a single domain heavy chain antibody, a VH domain, or a fragment thereof, said method comprising replacing the amino acid at
position 45 with L, replacing the amino acid atposition 103 with an amino acid independently chosen from the group consisting of R, G, K, S and P, and optionally replacing the amino acid atposition 37 with V and/or the amino acid atposition 44 with G and/or the amino acid atposition 47 with W, and optionally replacing the amino acid atposition 108 with an amino acid independently chosen from the group consisting of L, Q and R, said positions determined by the Kabat numbering. - Another embodiment of the invention is a method according to the above methods, wherein said heavy chain antibody, single domain heavy chain antibody, VH domain, or fragment thereof is derived from human or mouse.
- Another embodiment of the invention is a method according to the above methods, wherein said heavy chain antibody, single domain heavy chain antibody, VH domain, or fragment thereof is derived from human.
- Another embodiment of the invention is a method according to the above methods, wherein said heavy chain antibody, single domain heavy chain antibody, VH domain, or fragment thereof is derived from mouse.
- Another embodiment of the invention is a method according to the above methods, wherein said heavy chain antibody, single domain heavy chain antibody, VH domain, or fragment thereof is derived from rabbit.
- Another embodiment of the invention is a method according to the above methods, wherein said heavy chain antibody, single domain heavy chain antibody, VH domain, or fragment thereof is derived from goat.
- Another embodiment of the invention is a method according to the above methods, wherein said heavy chain antibody, single domain heavy chain antibody, VH domain, or fragment thereof is derived from sheep.
- Another embodiment of the invention is a method according to the above methods, wherein said heavy chain antibody, single domain heavy chain antibody, VH domain, or fragment thereof is derived from rat.
- Another embodiment of the invention is a method according to the above methods, wherein said heavy chain antibody, single domain heavy chain antibody, VH domain, or fragment thereof is derived from any vertebrate species other than human and mouse.
- Another embodiment of the invention is a method to humanize a functional camelid heavy chain antibody, a functional camelid single domain heavy chain, a functional camelid VHH domain or a functional fragment thereof, said method comprising replacing the amino acid at
position 45 with L, and optionally replacing the amino acid atposition 37 with V and/or the amino acid atposition 44 with G and/or the amino acid atposition 47 with W, said positions determined by the Kabat numbering. - Another embodiment of the invention is a method to camelize a functional heavy chain antibody, a functional single domain heavy chain, a functional VH domain or a functional fragment thereof, said method comprising replacing the amino acid at
position 45 with an amino acid independently chosen from the group consisting of L, V and P, replacing the amino acid atposition 103 with an amino acid independently chosen from the group consisting of R, G, K, S and P, and replacing the amino acid atposition 37 with F, the amino acid atposition 44 with G, the amino acid atposition 47 with W, and amino acid atposition 103 with R, and optionally replacing the amino acid atposition 108 with an amino acid independently chosen from the group consisting of L, Q and R, said positions determined by the Kabat numbering. - Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, obtainable by the methods above.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, obtained by the methods above.
- Another embodiment of the invention is a functional humanized camelid heavy chain antibody, a functional humanized camelid single domain heavy chain, a functional humanized VH domain or a functional fragment thereof, obtainable by the methods above.
- Another embodiment of the invention is a functional humanized camelid heavy chain antibody, a functional humanized camelid single domain heavy chain, a functional humanized VH domain or a functional humanized fragment thereof, obtained by the method above.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody; a functional VH domain, or a functional fragment thereof, according to above 4 paragraphs, as an artificial mutant.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, according to above 5 paragraphs, as a peptide homologue of said functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof.
- Another embodiment of the invention is a polypeptide comprising a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof according to according to above 6 paragraphs.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, according to the above 7 paragraphs which recite said macromolecules, or a polypeptide according the above paragraph wherein one or more amino acids is derivatized.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof obtained by the methods as defined above wherein said macromolecules are dimers.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof obtainable by the methods as defined above wherein said macromolecules are dimers.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof obtained by the methods as defined above wherein said macromolecules are trimers.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof obtainable by the methods as defined above wherein said macromolecules are trimers.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof obtained by the methods as defined above wherein said macromolecules are multimeric.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof obtainable by the methods as defined above wherein said macromolecules are multimeric.
- Another embodiment of the invention is a library, comprising one or more functional heavy chain antibodies, functional single domain antibodies, functional VH domains, or functional fragments thereof as defined above.
- Another embodiment of the invention is a method to make a library, comprising at least one functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or a functional fragment thereof, comprising the steps:
-
- introducing a restriction enzyme recognition site in the coding region of the
framework 4 region of a VH chain, whereby the cutting site of said restriction enzyme recognition site is situated in the CDR3 region, - cutting the nucleic acid molecule comprising said coding sequence with said restriction enzyme,
- ligating a double stranded primer to the VH encoding nucleic acid molecule; restoring the CDR3 and so introducing an R amino acid at
position 103, said position determined by the Kabat numbering, and - amplifying the ligated fragments.
- introducing a restriction enzyme recognition site in the coding region of the
- Another embodiment of the invention is a method according to the above, whereby said restriction enzyme cut is situated within the last two codons of the CDR3 coding region.
- Another embodiment of the invention is a method according to the above, whereby said restriction enzyme creates a
GA 3′ sticky end by cutting before the first nucleotide of the codon coding for amino acid position 101 and after the second nucleotide of codon coding for amino acid position 101 on the complementary strand, said positions determined according to the Kabat numbering. - Another embodiment of the invention is a method according to the above, whereby said restriction enzyme cut is situated within the last codon of the CDR3 coding region.
- Another embodiment of the invention is a method according to the above, whereby said restriction enzyme is creating a CA-3′ sticky end by cutting before the second nucleotide of codon coding for amino acid position 102 and after the third nucleotide of codon 102 on the complementary strand, said position determined according to the Kabat numbering.
- Another embodiment of the invention is a method according to the above, whereby said restriction enzyme is chosen from the group consisting of Bpml, Eco57I , Bsgl, Smu I, Fau I, Bse RI, and Bfi I.
- Another embodiment of the invention is a method to make a library comprising at least one functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof, comprising a step of amplification of nucleic acid strands encoding a repertoire of immune or non-immune VHH antibodies, using a
framework 1 specific primer as forward primer, and a back primer which anneals to said nucleic acid strands such that its 3′-terminal three nucleotides are positioned over the codon of the nucleic acid strands which encodeamino acid position 103, the reverse-complement of said 3′-terminal three nucleotides encoding R103, K103, Q103, F103, P103, G103 or S103, said position determined according to the Kabat numbering. - Another embodiment of the invention is a method to make a library comprising at least one functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof, comprising a step of amplification of nucleic acid encoding a repertoire of immune or non-immune VHH antibodies or fragments thereof, using a
framework 1 specific primer, as forward primer, and using one or more of SEQ ID NOs: 80 to 88 according toFIG. 6 as back primers. - Another embodiment of the invention is a library, comprising at least one functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof, obtainable by the method according to any of claims as defined above.
- Another embodiment of the invention is a library, comprising at least one functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof, obtained by the method as defined above.
- Another embodiment of the invention is a library as defined above wherein the methods use a single domain heavy chain library from human or mouse.
- Another embodiment of the invention is a library as defined above wherein the methods use a single domain heavy chain library from camel.
- Another embodiment of the invention is a library as defined above wherein the methods use a single domain heavy chain library from sheep.
- Another embodiment of the invention is a library as defined above wherein the methods use a single domain heavy chain library from human.
- Another embodiment of the invention is a library as defined above wherein the methods use a single domain heavy chain library from mouse.
- Another embodiment of the invention is a library as defined above wherein the methods use a single domain heavy chain library from rat.
- Another embodiment of the invention is a library as defined above wherein the methods use a single domain heavy chain library from goat.
- Another embodiment of the invention is a library as defined above wherein the methods use a single domain heavy chain library from any vertebrate species other than camel, human or mouse.
- Another embodiment of the invention is a heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, obtained by the method as defined above for use in immunoassays.
- Another embodiment of the invention is a recombinant DNA construct useful for the expression of a polypeptide in a cell containing the construct, the construct comprising control sequences which regulate transcription and translation of the said antibody in the cell and a coding sequence regulated by the control sequences, wherein the coding sequence comprises a DNA sequence of at least 21 bp in reading frame in that the DNA sequence encodes a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above.
- Another embodiment of the invention is a recombinant DNA construct useful for the expression of a polypeptide in a cell containing the construct, the construct comprising control sequences which regulate transcription and translation of the said antibody in the cell and a coding sequence regulated by the control sequences, wherein the coding sequence comprises a DNA sequence of at least 42 bp in reading frame in that the DNA sequence encodes a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above.
- Another embodiment of the invention is a recombinant DNA construct useful for the expression of a polypeptide in a cell containing the construct, the construct comprising control sequences which regulate transcription and translation of the said antibody in the cell and a coding sequence regulated by the control sequences, wherein the coding sequence comprises a DNA sequence of at least 63 bp in reading frame in that the DNA sequence encodes a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above.
- Another embodiment of the invention is a recombinant DNA construct useful for the expression of a polypeptide in a cell containing the construct, the construct comprising control sequences which regulate transcription and translation of the said antibody in the cell and a coding sequence regulated by the control sequences, wherein the coding sequence comprises a DNA sequence of at least 83 bp in reading frame in that the DNA sequence encodes a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above.
- Another embodiment of the invention is a recombinant DNA construct useful for the expression of a polypeptide in a cell containing the construct, the construct comprising control sequences which regulate transcription and translation of the said antibody in the cell and a coding sequence regulated by the control sequences, wherein the coding sequence comprises a DNA sequence of at least 150 bp in reading frame in that the DNA sequence encodes a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above.
- Another embodiment of the invention is a recombinant DNA construct useful for the expression of a polypeptide in a cell containing the construct, the construct comprising control sequences which regulate transcription and translation of the said antibody in the cell and a coding sequence regulated by the control sequences, wherein the coding sequence comprises a DNA sequence of at least 240 bp in reading frame in that the DNA sequence encodes a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above.
- Another embodiment of the invention is a recombinant DNA construct useful for the expression of a polypeptide in a cell containing the construct, the construct comprising control sequences which regulate transcription and translation of the said antibody in the cell and a coding sequence regulated by the control sequences,
-
- wherein the coding sequence comprises a DNA sequence of at least 300 bp in reading frame in that the DNA sequence encodes a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above.
- Another embodiment of the invention is a nucleic acid comprising a DNA sequence encoding a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above.
- Another embodiment of the invention is a nucleic acid having a nucleotide sequence which is at least 65% identical to the sequence as defined above.
- Another embodiment of the invention is a vector comprising a nucleic acid sequence as defined above.
- Another embodiment of the invention is a host cell comprising an integrated or episomal copy of a nucleic acid molecule as defined above, or a vector as defined above.
- Another embodiment of the invention is the host cell of as used above, wherein said host cell is a yeast, bacterial, insect, fungal, plant or mammalian cell.
- Another embodiment of the invention is a method for producing a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above, comprising:
-
- (a) culturing host cells comprising a nucleic acid as defined above, under conditions allowing the expression of the polypeptide, and,
- (b) recovering the produced polypeptide from the culture.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above, or nucleic acid as defined above for the preparation of a medicament.
- Another embodiment of the invention is a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above, or nucleic acid as defined above for the preparation of a medicament for the treatment of a disease related to asthma, rhinoconjunctivitis, allergic disorders, acute allograft rejection, Crohn's disease and ulcerative colitis.
- Another embodiment of the invention is a pharmaceutical composition comprising a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above, or nucleic acid as defined above, optionally in combination with a suitable excipient.
- Another embodiment of the invention is the use of a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above, or nucleic acid as defined above in the diagnosis of a disease related to asthma, rhinoconjunctivitis, allergic disorders, acute allograft rejection, Crohn's disease and ulcerative colitis.
- Another embodiment of the invention is the use of a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above for the purification of a protein.
- Another embodiment of the invention is the use of a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above for the purification of a protein.
- Another embodiment of the invention is a kit for the diagnosis of a pathological condition or a susceptibility to a pathological condition in a subject comprising a nucleic acid as defined above, a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above.
- Another embodiment of the invention is a method for diagnosing a pathological condition or a susceptibility to a pathological condition in a subject comprising the steps of:
-
- (a) determining the presence or absence of a mutation in the nucleic acid as defined above, including mutations in the genomic and regulatory sequences of said nucleic acid, in a biological sample, and
- (b) diagnosing a pathological condition or a susceptibility to a pathological condition based on the presence or absence of said mutation.
- Another embodiment of the invention is a method for diagnosing a pathological condition or a susceptibility to a pathological condition in a subject comprising the steps of:
-
- (a) determining the presence or amount of the nucleic acid as defined above or expression of a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment as defined above or a polypeptide as defined above in a biological sample, and,
- (b) diagnosing a pathological condition or a susceptibility to a pathological condition based on the presence or amount of said nucleic acid or expression of said functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, functional fragment thereof or polypeptide.
- Another embodiment of the invention is a drug screening assay for screening test compounds which interact with a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above, comprising:
-
- (a) combining a functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof as defined above or a polypeptide as defined above with a test compound, under conditions which allow for interaction of the test compound to said functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, functional fragment thereof or polypeptide, to form a complex, and,
- (b) detecting the formation of a complex, in which the ability of the test compound to interact with the said functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof, is indicated by the presence of the test compound in the complex.
- Another embodiment of the invention is the product or compound identifiable by the assay as defined above.
- Another embodiment of the invention is nucleic acid comprising the sequence SEQ ID NO: 80 according to
FIG. 6 . - Another embodiment of the invention is nucleic acid comprising the sequence SEQ ID NO: 81 according to
FIG. 6 . - Another embodiment of the invention is nucleic acid comprising the sequence SEQ ID NO: 82 according to
FIG. 6 . - Another embodiment of the invention is nucleic acid comprising the sequence SEQ ID NO: 83 according to
FIG. 6 . - Another embodiment of the invention is nucleic acid comprising the sequence SEQ ID NO: 84 according to
FIG. 6 . - Another embodiment of the invention is nucleic acid comprising the sequence SEQ ID NO: 85 according to
FIG. 6 . - Another embodiment of the invention is nucleic acid comprising the sequence SEQ ID NO: 86 according to
FIG. 6 . - Another embodiment of the invention is nucleic acid comprising the sequence SEQ ID NO: 87 according to
FIG. 6 . - Another embodiment of the invention is nucleic acid comprising the sequence SEQ ID NO: 88 according to
FIG. 6 . - Another embodiment of the invention is a nucleic acid having a nucleotide sequence which is at least 65% identical to the sequence as defined above.
- Another embodiment of the invention is the use of a nucleic acid as defined above in a method to produce one or more functional heavy chain antibodies, functional single domain heavy chain antibodies, functional VH domains, or functional fragments thereof.
- The antibodies of the above embodiments are functional and as such exhibit improved properties, for example, expression levels, stability, affinity and solubility over antibodies in which the characterising features absent. It is known in the art that the production of antibodies, for example by bacterial overexpression techniques, in phage display libraries, for screening libraries, is difficult due to the properties of the antibody or fragments thereof.
- Surprisingly, the inventors have found that a heavy chain, carrying a mutation at
position 103, possibly combined with a mutation atposition 108 behaves as a functional heavy chain antibody (HCAb), even if it does not carry the VHH hallmark amino acids atpositions position 45, whereby the charged amino acid or the cysteine atposition 45, may be changed in any other amino acid, but preferably into a leucine. Prior to an aspect of the present invention, heavy chains having said amino acids at positions at 45 and 103 were considered by the person skilled in the art as part of a classical 4-chain antibody complex (Harmsen et al. 2000) and not as a functional heavy chain antibody. Moreover, for some antibodies having residues which characterise one aspect of the present invention, the presence of a light chain has been described (Anker et al., 1990; Chukwuocha at al., 1999), clearly demonstrating that these antibodies were not functional heavy chain antibodies. - Surprisingly, the inventors were able to show that an amino acid at
position 103 selected among arginine, glycine, proline, serine or lysine increases the solubility of the heavy chain, while it may disrupt the possibility to interact with a light chain. Therefore, such a heavy chain molecule behaves like a functional heavy chain antibody, even without the hallmark amino acid for the functional HCAb atposition 45. - The invention relates to a functional HCAb, comprising an amino acid, which is neither a charged amino acid nor a cysteine at
position 45, and comprising an amino acid chosen from the group consisting of arginine (R), glycine (G), lysine (K), serine (S) and proline (P) atposition 103, possibly combined with glutamine (0) atposition 108 according to the Kabat numbering. In one embodiment of the invention, the amino acid atposition 45 is a L. In another embodiment, the amino acid atposition 103 is an R. In another embodiment, the amino acid atposition 103 is an R and the amino acid atposition 108 is a Q. - In one embodiment of the invention embodiment, the functional HCAb or fragment thereof according to the invention is an artificial mutant. An artificial mutant, as used here, means that the change is introduced intentionally and differs from the sequence found in the natural situation. Said artificial mutant may be derived from a variable domain (designated VH) of a heavy polypeptide chain of an immunoglobulin wherein the amino acid residue corresponding to position 103 (Kabat numbering) is mutated to an amino acid selected from the group consisting of R, G, K, S and P, possibly in combination with a mutation wherein the amino acid residue corresponding to position 108 (Kabat numbering) is mutated to Q. In another embodiment, said artificial mutant is derived from a variable domain (designated VH) of a heavy polypeptide chain of an immunoglobulin wherein the amino acid residue corresponding to position 103 (Kabat numbering) is mutated to arginine. In another embodiment, said artificial mutant is derived from a variable domain (designated VH) of a heavy polypeptide chain of an immunoglobulin wherein the amino acid residue corresponding to position 103 (Kabat numbering) is mutated to arginine and the amino acid residue corresponding to position 108 (Kabat numbering) is mutated to glutamine.
- Alternatively, said artificial mutant may be derived from a variable domain (designated VHH) of a heavy polypeptide chain of a heavy chain antibody wherein the hallmark amino acid residue at
position 45 is mutated to a Leucine, possibly in combination with a mutation of one or more of the other hallmark amino acids atposition position - An artificial mutant according to the invention comprises a polypeptide sequence derived from the VH domain and encompasses within this polypeptide sequence RGQGTQ (SEQ ID No 13) or alternatively sequence RGKGTQ (SEQ ID No 14).
- Another artificial mutant according to the invention comprises a polypeptide sequence derived from the VHH domain and encompasses within this polypeptide sequence VXXXXXXGLXW (SEQ ID No 15), whereby X can be any amino acid.
- Another artificial mutant according to the invention comprises a polypeptide sequence derived from the VH domain and encompasses within this polypeptide sequence RGQGTQ (SEQ ID No 13), wherein R of said sequence is at
position 103 according to the Kabat numbering. Another artificial mutant according to the invention comprises a polypeptide sequence derived from the VH domain and encompasses within this polypeptide sequence RGKGTQ (SEQ ID No 14), wherein R of said sequence is atposition 103 according to the Kabat numbering. - Another artificial mutant according to the invention comprises a polypeptide sequence derived from the VHH domain and encompasses within this polypeptide sequence VXXXXXXGLXW (SEQ ID No 15), wherein V of said sequence is at
position 37 according to the Kabat numbering, whereby X can be any amino acid. - Another artificial mutant according to the invention comprises a polypeptide sequence derived from the VH domain and encompasses within this polypeptide sequence LGQGTQVTVSS (SEQ ID No 16), wherein L of said sequence is at
position 103 according to the Kabat numbering. - Another artificial mutant according to the invention comprises a polypeptide sequence derived from the VH domain and encompasses within this polypeptide sequence QGQGTGVTVSS (SEQ ID No 17), wherein L of said sequence is at
position 103 according to the Kabat numbering. - Another artificial mutant according to the invention comprises a polypeptide sequence derived from the VH domain and encompasses within this polypeptide sequence PGQGTQVTVSS (SEQ ID No 18), wherein L of said sequence is at
position 103 according to the Kabat numbering. - Another artificial mutant according to the invention comprises a polypeptide sequence derived from the VH domain and encompasses within this polypeptide sequence SSQGTQVTVSS (SEQ ID No 19), wherein L of said sequence is at
position 103 according to the Kabat numbering. - Said SEQ ID Nos: 13 to 19 are those cited in
FIG. 6 . - The artificial mutant according to the invention is derived from a VH domain, or a VHH domain, meaning that in accordance with the present invention it can be isolated from said domain by introducing said mutations, or it can be synthesized, including chemically synthesized or expressed especially by recombinant techniques, including in host cells, starting from the knowledge of the polypeptide sequence of said VH domains or VHH domains and the position of the mutations to be introduced. More generally, it can be prepared by any method made available for the preparation of polypeptide chains.
- The polypeptide chain derived from the VH gene and having the features as defined here above may be obtained by methods involving site-directed mutagenesis or PCR (using primers carrying said the mutation), starting from a conventional VH-D-J gene, especially one obtained from a library. A relevant method is that described by Hemsley et al. (1989). The present invention thus provides the possibility to generate soluble mutant single domain antibody fragments that originate from a VH-D-J gene. The method of Hemsley, however, requires that the sequence of the gene to be mutated is known, at least in the region where the mutation has to be introduced. As a position to be mutated,
residue 103, is adjacent to a variable region, the method of Hemsley et al. (1989) is not suitable for the introduction of a mutation in VHs with unknown variable regions, and an adapted method has to be applied in this case. - Alternatively, the polypeptide chain derived from the VHH and having the features as defined here above may be obtained by methods involving site-directed mutagenesis or PCR (using primers carrying said the mutation), starting from a HCAb VHH, especially one obtained from a library. As these mutations are situated in a conserved framework region, the method of Hemsley et al. (1989) can be applied. In that case, the present invention provides the possibility to humanize single domain antibody fragments that originate from a VHH-D-J gene. Humanization may comprise the replacement of one or more of the VHH hallmark amino acids at
position Leu 45 and Trp47. However, to introduce the compensating mutation atposition 103, the sequence of the adjacent variable region should be known, as discussed above. - The invention relates further to a method to solubilize single domain heavy chain fragment derived from conventional 4-chain immunoglobulins. Indeed, the inventors have shown that the presence at
position 103 of a hydrophilic amino acid residue, especially of a residue selected among arginine, glycine, proline, serine or lysine renders the resulting polypeptide derived from the VH more soluble with respect to the same polypeptide having a tryptophan residue atposition 103. This effect may even be enhanced by replacing the amino acid atposition 108 by a glutamine. - Another aspect of the invention is a method to “humanize” a camelid heavy chain antibody, said method comprising at least the replacement of the camelid hallmark amino acid at
position 45, possibly combined with a replacement of one or more of the other hallmark amino acids atposition - Another aspect of the invention is a functional single domain heavy chain antibody fragment, obtainable by the method according to the invention. Still another aspect of the invention is a functional single domain heavy chain antibody fragment, obtained by the method according to the invention. Still another aspect of the invention is a functional humanized single domain heavy chain antibody fragment, obtainable by the method according to the invention. Still another aspect of the invention is a functional humanized single domain heavy chain antibody fragment, obtained by the method according to the invention.
- Another aspect of the invention is a library, comprising one or more functional single domain heavy chain antibody fragments according to the invention. In one embodiment of the present invention, said library comprises at least 100, or at least 1000, or at least 10 000, or at least 100 000, or at least 1 000 000 functional single domain heavy chain antibody fragments. Such a library has the advantage that it is composed of soluble molecules, contrary to a possible library of classical VH molecules, which would be insoluble and non-functional (Nutall et al., 2000). Whereas for one single VH, the problem may be solved by denaturation, followed by refolding and resolubilization, this procedure is not possible in case of the creation of a complex library, especially not when said creation is followed by the selection of domains with varying antigen binding specificities. Indeed, generation of insoluble and therefore “sticky” scaffold protein during selection procedures can lead to false positives through non-specific binding to antigen by hydrophobic patches on the displayed domain. Several attempts have been made to overcome this aggregation problem (Pessi et al, 1993; Quiocho, 1993; Dimasi et al., 1997), but till now, the attempts of producing single domain VH libraries with acceptable solubility characteristics have not been successful. Therefore, the soluble single domain heavy chain antibody fragment according to the invention allow for the first time the efficient construction of a library comprising functional single chain antibody fragments.
- As the functional single domain heavy chain antibodies according to the invention do normally not occur in nature, such a library cannot be made by direct amplification of the messenger RNA, but has to be made by the use of mutagenic primers. Although in principle, a VHH backbone may be used as starting material, this has several drawbacks, as not only the camelid hallmark amino acids have to be mutated, but the compensating mutation at
position 103 has to be introduced. For this reason, it is preferable to construct the library starting from a human VH mRNA library. From such a library, potent antigen binders may be retrieved. Contrary to the VHH situation, starting from a VH backbone, only the mutation atposition 103 has to be introduced. - The problem to make such library is that the 3′-end primer used to amplify the VH by RT-PCR needs to be mutagenic for the
codon 103, and the primer should extend for at least 4-5 nucleotides towards its 3′-end to anneal perfectly to the template. However, since this region is part of the CDR3, such a primer will contain too much degeneracies so that no DNA amplification will be achieved. As a consequence, making a functional single domain heavy chain library, according to the invention is far from obvious. - Therefore another aspect of the invention is a method to make a library, comprising at least one functional single chain library, according to the invention, comprising
-
- introducing a restriction enzyme recognition site in the coding region of the
framework 4 region of a VH or VHH chain, whereby the cutting site of said restriction enzyme recognition site is situated in the CDR3 region - cutting the nucleic acid molecule comprising said coding sequence with said restriction enzyme
- ligating a double stranded primer to the remaining V encoding nucleic acid molecules, restoring the CDR3 and
framework 4 codons and introducing the 103 mutation in theframework 4 - amplifying the ligated fragments.
- introducing a restriction enzyme recognition site in the coding region of the
- One embodiment comprises said method whereby the method is carried out on a pool of coding sequences, such as a pool of mRNA as well as on one isolated coding sequence. Another embodiment comprises said method whereby the method is carried out on one isolated coding sequence, and a synthetic library is generated by randomizing one or more codons of one or more of the CDR loops. Alternatively, a library may be generated by grafting camelid CDR loops on the mutated framework, comprising the 103R mutation.
- In another embodiment, the restriction enzyme cut is situated within the last codon or within the last two codons of the CDR3 coding region. One embodiment comprises said method, whereby said enzyme is creating a blunt end at the CDR3—
framework 4 junction. Another embodiment comprises said method, whereby said enzyme creates aCA 3′ sticky end by cutting before the second nucleotide of codon 102 and after the second nucleotide of codon 102, according to the Kabat numbering. Indeed, in most VH and VHH's, there is a conserved tyrosine (Y) at position 102. This amino acid is most frequently encoded by TAC. Another embodiment comprises said method, whereby said enzyme creates aGA 3′ sticky end by cutting before the first nucleotide of codon 101 and after the second nucleotide of codon 101, according to the Kabat numbering. Indeed, in most human VH, there is a conserved aspartic acid (D) at position 101, a charged amino acid that is important for the CDR3 loop structure. This amino acid is encoded by either GAC or GAT. By creating -
- a
GA 3′ sticky end, the conserved codon may be restored by the ligation to the double stranded primer. In that case, the codon 102 may be either randomized or fixed, by ligation of the primer. One embodiment comprises said method above, whereby said restriction site is Bpm I. Another embodiment comprises said method, whereby said restriction site is Eco57 I. Another embodiment comprises said method, whereby said restriction site is Bsg I. An embodiment comprises said method, whereby said restriction site is Fau I. Another embodiment comprises said method, whereby said restriction site is Smu I. Another embodiment comprises said method, whereby said restriction site is Bse RI.
- a
- Another embodiment comprises said method, whereby the restriction site is Bfil, introduced in such a way that the enzyme cuts at the CDR3 junction in the upper strand, and between the first and the second nucleotide of CDR3, adjacent to the
framework 4 in the lower strand. In the latter case, the CDR3 andframework 4 regions may be restored by ligation with a double stranded primer consisting of theframework 4 coding region for the upper strand, and the complementary strand thereof, with either aTG 3′ overhang, or a TG-3′ overhang and an extra codon such as GTG, or TAC before the Trp103 codon. - Still another aspect of the inventions is a library obtainable by the invention, comprising one or more functional single domain heavy chain antibody fragments. Still another aspect of the invention is a library, obtained by the invention, comprising one or more functional single domain heavy chain antibody fragments.
- In one embodiment, said library comprises at least 100, in another embodiment at least 1000, in another embodiment at least 10 000, in another embodiment at least 100 000, in another embodiment at least 1 000 000 functional single domain heavy chain antibody fragments.
- Surprisingly, we have found that a significant fraction of the camelid antibodies comprises functional heavy chain antibodies according to the invention, contrary to what is assumed by the person skilled in the art. This significant fraction represent a new class of functional heavy chain antibodies. It would not be obvious, therefore, to a skilled artisan that a functional heavy chain antibody and/or a functional soluble single domain heavy chain antibody fragment can be isolated directly from a mRNA preparation from camelids, and this material can be used as starting material for the preparation of a functional soluble single domain heavy chain antibody fragment library according to the invention. As a consequence, another aspect of the invention is a library obtained by specific amplification and cloning of the new class of functional heavy chain antibodies described in this invention, and which have more homology to human antibodies than the class of VHH with the hydrophilic residues in FR2. In order to obtain this new class of VHH from a repertoire of immune or non-immune antibodies, specific primers for amplification were designed, that anneal preferentially to genes encoding VHH with Arginine, Lysine, Glutamine, Phenylalanine, Proline, Glycine, Tryptophan or Serine as
residue 103. To accomplish specific annealing the 3′ site of the primer ends exactly at the first nucleotide of the codon coding forresidue 103, which in the new class of VHH is different from theTryptophan 103 containing VHH fragments. - The following primers were designed:
primer 1 (R103): 5′-GAG TCA TTC TCG ACT TGC GGC CGC TGA GGA GAC GGT GAC CTG GGT CCC CTG GCC (A/T/C/G)CG-3′ primer 2 (R103): 5′-GAG TCA TTC TCG ACT TGC GGC CGC TGA GGA GAC GGT GAC CTG GGT CCC CTG GCC (C/T)CT-3′ primer 3 (K103): 5′-GAG TCA TTC TCG ACT TGC GGC CGC GCT GGA GAC GGT GAC CTG GGT CCC CTG GCC (T/C)TT-3′ primer 4 (Q103): 5′-GAG TCA TTC TCG ACT TGC GGC CGC TGA GGA GAC GGT GAC CTG GGT CCC CTG GC(C/G) (C/T)TG-3′ primer 5 (L103): 5′-GAG TCA TTC TCG ACT TGC GGC CGC TGA GGA GAC GGT GAC CTG GGT CCC CTG GCC (A/G/C/T)AG-3′ primer 6 (F103): 5′-GAG TCA TTC TCG ACT TGC GGC CGC TGA GGA GAC GGT GAC CTG GGT CCC CTG GCC (A/G)AA-3′ primer 7 (G103): 5′-GAG TCA TTC TCG ACT TGC GGC CGC TGA GGA GAC GGT GAC CTG GGT CCC CCC CGG (A/G/C/T)CC-3′ primer 8 (S103): 5′-GAG TCA TTC TCG ACT TGC GGC CGC TGA GGA GAC GGT GAC CTG GGT CCC CTG (A/G/C/T)GA (A/G/C/T)GA-3′ primer 9 (P103): 5′-GAG TCA TTC TCG ACT TGC GGC CGC TGA GGA GAC GGT GAC CTG GGT CCC CTG CTG (A/G/C/T)GG-3′ primer 10 (Y103): 5′-GAG TCA TTC TCG ACT TGC GGC CGC TGA GGA GAC GGT GAC CTG GGT CCC CTG GCC (A/G)TA-3′ - Specific amplification was carried out using a
Framework 1 specific primer, that is 5′ linked to a Sfil site, as forward primer, and a pool of primers 1-10 as back primers for the amplification of functional soluble single domain heavy chain antibody fragments according to the invention. The resulting material was cut with Sfil and Notl or BstEll and the resulting fragment is cloned into pHen4. - Still another aspect of the invention is the use of a functional heavy chain antibody according to the invention or a functional soluble single domain heavy chain antibody fragment according to the invention for the preparation of a medicament. Still another aspect of the invention is a pharmaceutical composition, comprising a functional heavy chain antibody, according to the invention, or comprising a functional soluble single domain heavy chain antibody fragment, according to the invention, optionally in combination with a suitable excipient. Indeed, antibodies may be used in the treatment of several diseases, such as, as a non-limiting example, asthma and rhinoconjunctivitis (Botger et al, 2002), allergic disorders (Babu et al, 2001), acute allograft rejection (Sollinger et al, 2001), Crohn's disease (Hommes et al, 2002) and ulcerative colitis (Gordon et al, 2002). The functional soluble single domain heavy chain antibody fragment may have a significant advantage due to their small size and their solubility.
- Another aspect of the invention is the use of a functional heavy chain antibody according to the invention or a functional soluble single domain heavy chain antibody fragment according to the invention in diagnosis. Diagnostic methods, using antibodies are known to the person skilled in the art and included, as a non-limiting example ELISA and RIA methods. The antibodies according to the invention do have several additional advantages in these assays, due to their stability and the fact that they can be fixed on a solid support without significant loss of activity. The latter characteristic makes them specially suitable for coating of surfaces, as may be desirable in several immunological detection techniques, including their use in microarrays.
- Still another aspect of the invention is the use of a functional heavy chain antibody according to the invention or a functional soluble single domain heavy chain antibody fragment according to the invention in the purification of proteins and other molecules. Purification methods such as, as a non-limiting example, immunochromatography are known to the person skilled in the art. The antibodies according to the invention do have several additional advantages in such purification methods, due to their stability, that may guarantee a long lifetime of the purification carrier, and due to the fact that they can be fixed on a solid support without significant loss of activity.
- The following definitions are set forth to illustrate and define the meaning and scope of various terms used to describe the invention herein.
- “Derivatized” as used herein in reference to a polypeptidic macromolecule means comprising derivatized amino acids. For example, homo-phenylalanine, citrulline, and noreleucine are considered derivatized amino acids for the purposes of the invention. Derivatized amino acids also include imino acid residues such as proline and hydroxyproline. In addition, any amino acid representing a component of the variant proteins of the present invention, replaced by the same amino acid but of the opposite chirality, is considered derivatized. Thus, any amino acid naturally occurring in the L-configuration (which may also be referred to as the R or S, depending upon the structure of the chemical entity) may be replaced with an amino acid of the same chemical structural type, but of the opposite chirality, generally referred to as the D-amino acid but which can additionally be referred to as the R— or the S—, depending upon its composition and chemical configuration. Such derivatives have the property of greatly increased stability, and therefore are advantageous in the formulation of compounds which may have longer in vivo half lives, when administered by oral, intravenous, intramuscular, intraperitoneal, topical, rectal, intraocular, or other routes.
- In the preferred embodiment, the derivatized amino acids are in the (S) or L-configuration or the (S) or D-configuration. Derivatized amino acids may be used, for example, to prevent or retard in vivo degradations. Proteins including non-naturally occurring amino acids may be synthesized or in some cases, made recombinantly; see van Hest et al., FEBS Lett 428:(1-2) 68-70 May. 221998 and Tang et al., Abstr. Pap Am. Chem. S218:U138-
U138 Part 2 Aug. 22, 1999, both of which are expressly incorporated by reference herein. - Aromatic amino acids may be replaced with D- or L-naphylalanine, DM or L-Phenylglycine, D- or L-2-thieneylalanine, D- or L-1-, 2-, 3- or 4-pyreneylalanine, D- or L-3-thieneylalanine, D- or L-(2-pyridinyl)-alanine, D- or L-(3-pyridinyl)-alanine, D- or L-(2-pyrazinyl)-alanine, D- or L-(4-isopropyl)-phenylglycine, D-(trifluoromethyl)-phenylglycine, D-(trifluoromethyl)-phenylalanine, D-p-fluorophenylalanine, D- or L-p-biphenylphenylalanine, D- or L-p-methoxybiphenylphenylalanine, D- or L-2-indole(alkyl)alanines, and D- or L-alkylainines where alkyl may be substituted or unsubstituted methyl, ethyl, propyl, hexyl, butyl, pentyl, isopropyl, iso-butyl, sec-isotyl, iso-pentyl, non-acidic amino acids, of C1-C20.
- Acidic amino acids can be regarded as derivatized when they are substituted with non-carboxylate amino acids while maintaining a negative charge, and derivatives or analogs thereof, such as the non-limiting examples of (phosphono)alanine, glycine, leucine, isoleucine, threonine, or serine; or sulfated (e.g., —SO3H) threonine, serine, or tyrosine.
- Other substitutions may include unnatural hyroxylated amino acids. Other derivatives may made by combining “alkyl” with any natural amino acid. The term “alkyl” as used herein refers to a branched or unbranched saturated hydrocarbon group of 1 to 24 carbon atoms, such as methyl, ethyl, n-propyl, isoptopyl, n-butyl, isobutyl, t-butyl, octyl, decyl, tetradecyl, hexadecyl, eicosyl, tetracisyl and the like. Alkyl includes heteroalkyl, with atoms of nitrogen, oxygen and sulfur. Preferred alkyl groups herein contain 1 to 12 carbon atoms. Basic amino acids may be substituted with alkyl groups at any position of the naturally occurring amino acids lysine, arginine, ornithine, citrulline, or (guanidino)-acetic acid, or other (guanidino)alkyl-acetic acids, where “alkyl” is define as above. Nitrile derivatives (e.g., containing the CN-moiety in place of COOH) may also be substituted for asparagine or glutamine, and methionine sulfoxide may be substituted for methionine. Methods of preparation of such peptide derivatives are well known to one skilled in the art.
- In addition, any amide linkage in any of the variant polypeptides can be replaced by a ketomethylene moiety. Such derivatives are expected to have the property of increased stability to degradation by enzymes, and therefore possess advantages for the formulation of compounds which may have increased in vivo half lives, as administered by oral, intravenous, intramuscular, intraperitoneal, topical, rectal, intraocular, or other routes.
- Additional amino acid modifications of amino acids of variant polypeptides of to the present invention may include the following: Cysteinyl residues may be reacted with alpha-haloacetates (and corresponding amine), such as 2-chloroacetic acid or chloroacetamide, to give carboxymethyl or carboxyamidomethyl derivatives.
- Cysteinyl residues may also be derivatized by reaction with compounds such as bromotrifluoroacetone, alpha-bromo-beta-(5-imidozoyl)propionic acid, chloroacetyl phosphate, N-alkylmaleimides, 3-nitro-2-pyridyl disulfide, methyl 2-pyridyl disulfide, P-chloromercuribenzoate, 2-chloromercuri-4-nitrophenol, or chloro-7-nitrobenzo-2-oxa-1,3-diazole.
- Histidyl residues may be derivatized by reaction with compounds such as diethylprocarbonate e.g., at pH 5.5 to 7.0 because this agent is relatively specific for the histidyl side chain, and para-bromophenacyl bromide may also be used, e.g., where the reaction is preferably performed in 0.1 M sodium cacodylate at pH 6.0.
- Lysinyl and amino terminal residues may be reacted with compounds such as succinic or other carboxylic acid anhydrides. Derivatization with these agents is expected to have the effect of reversing the charge of the lysinyl residues.
- Other suitable reagents for derivatizing alpha-amino-containing residues include compounds such as imidoesters e.g., as methyl picolinimidate; pyridoxal phosphate; pyridoxal; chloroborohydride; trinitrobenzenesulfonic acid; O-methylisourea; 2,4 pentanedione; and transaminase-catalyzed reaction with glyoxylate. Arginyl residues may be modified by reaction with one or several conventional reagents, among them phenylglyoxal, 2,3-butanedione, 1,2-cyclohexanedione, and ninhydrin according to known method steps. Derivatization of arginine residues requires that the reaction be performed in alkaline conditions because of the high pKa of the guanidine functional group. Furthermore, these reagents may react with the groups of lysine as well as the arginine epsilon-amino group. The specific modification of tyrosyl residues per se is well-known, such as for introducing spectral labels into tyrosyl residues by reaction with aromatic diazonium compounds or tetranitromethane.
- N-acetylimidizol and tetranitromethane may be used to form O-acetyl tyrosyl species and 3-nitro derivatives, respectively. Carboxyl side groups (aspartyl or glutamyl) may be selectively modified by reaction with carbodiimides (R′—N—C—N—R′) such as 1-cyclohexyl-3-(2-morpholinyl-(4-ethyl) carbodiimide or 1-ethyl-3-(4-azonia-4,4-dimethylpentyl)carbodiimide. Furthermore aspartyl and glutamyl residues may be converted to asparaginyl and glutaminyl residues by reaction with ammonium ions. Glutaminyl and asparaginyl residues may be frequently deamidated to the corresponding glutamyl and aspartyl residues. Alternatively, these residues may be deamidated under mildly acidic conditions. Either form of these residues falls within the scope of the present invention.
- “Functional” in reference to a heavy chain antibody, a single domain heavy chain antibody, a VH domain or fragments thereof means that the same retains a significant binding (dissociation constant in the micromolar range) to its epitope, compared with its binding in vivo, and that it shows no or limited aggregation (soluble and non-aggregated above 1 mg/ml), so allowing the use of the antibody as a binder.
- “Functionalized” in reference to a heavy chain antibody, a single domain heavy chain antibody, or fragments thereof means to render said heavy chain antibody, a single domain heavy chain antibody, or fragments thereof functional.
- By “fragments thereof” as used herein, is meant a portion corresponding to more than 95% of the sequence, more than 90% of the sequence of, more than 85% of the sequence of, more than 80% of the sequence of, more than 75% of the sequence of, more than 70% of the sequence of, more than 65% of the sequence of, more than 60% of the sequence of, more than 55% of the sequence of, or more than 50% of the sequence of.
- “Coding sequence” is a nucleotide sequence, which is transcribed into mRNA and/or translated into a polypeptide when placed under the control of appropriate regulatory sequences. The boundaries of the complete coding sequence are determined by a translation start codon at the 5′-terminus and a translation stop codon at the 3′-terminus. However, coding sequence as used here is not limited to the complete coding sequence, but includes fragments thereof; such fragments are also indicated as coding region. A coding sequence can include, but is not limited to mRNA, cDNA, recombinant nucleotide sequences or genomic DNA, while introns may be present as well under certain circumstances.
- “Human hallmark amino acids” as used herein in reference to the humanization of non-human antibodies are Val37, Gly44, Leu45, Trp47, positions determined according to the Kabat numbering.
- “Nucleotide sequence” “DNA sequence” “nucleic acid molecule(s)” or “nucleic acid” as used herein refers to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides. This term refers only to the primary structure of the molecule. Thus, this term includes double- and single-stranded DNA, and RNA. It also includes known types of modifications, for example, methylation, “caps” substitution of one or more of the naturally occurring nucleotides with an analog.
- “Upper strand” of a DNA sequence is the strand that comprise the DNA version of the codons as they occur in the mRNA, lower strand is the strand with the anticodons, that is used as template to synthesize the mRNA.
- “VH domain” as used herein means the variable domain of H-chain of a conventional four-chain antibody.
- “VHH domain” as used herein means variable domain of the H-chain of a conventional, (i.e. immunologically functional) HCAb.
-
FIGS. 1-1 and 1-2: Nucleotide and translated amino acid sequences of wild type anti-b-lactamase VHH TEM04 (A) and anti-carcinoembryonic antigen VHH CEA71 (B). -
FIG. 2 : Western blot analysis of R103W mutant and wild type VHH from (A) anti-β-lactamase VHH TEM04 and (B) anti-carcinoembryonic antigen VHH CEA71. From each clone three cultures were induced and used for analysis. As positive control the anti-lysozyme VHH cAblys3 was used. -
FIG. 3 : Coomassie stained 15% SDS PAGE of IMAC purified R103W mutant and wild type VHH. The slower migrating product in the two lanes on the left is β-lactamase, which was complexed to the VHH. -
FIG. 4 : Antigen binding determined by ELISA of VHH CEA71 wild type (WT) and R103W mutant. -
FIG. 5 : Examination of the solubility characteristics of VHH CEA72 (wild type and R103W mutant) by determining the concentration of ammonium sulfate at which the fragment started to precipitate. The amount of VHH in the supernatant was measured (A) by protein content with OD280, or (B) by antigen binding in ELISA. -
FIGS. 6-1 , 6-2, 6-3: SEQ ID NOS: 1 to 10 and 20 to 79: sequences of heavy chain antibody, single domain antibody, a VH domain, or a fragment thereof, wherein amino acids at positions indicated are substituted by amino acids indicated, said positions determined according to the Kabat numbering. - Classically, a recombinant VH domain is isolated from scFv libraries. Such VH domains usually originate from a cloning artifact for example by the cloning of VH instead of VH-VL, or they may originate from a gene recombination within the clone, due for example to instability of the linker sequences, resulting in the deletion of the VL gene fragment. These molecules are normally difficult to work with because of their low expression yields in, for example, bacterial and other expression systems and their low solubility. The inventors show that these VH molecules may be better expressed and show a higher solubility by introducing a mutation changing the Trp on
position 103 into Arg. This is a much easier and more straightforward mutation than Val37Phe, Gly44Glu, Leu45Arg and Trp47Gly or part of it as originally carried out by Davies and Riechmann (1994). It has the additional advantage that it could be performed on all VH sequences, not only of human origin, but of all other species having antibodies with an Ig-fold. - In cases where a minimal size of the antigen binding fragment is envisaged, it might be an advantage to design a single domain from an existing scFv. The VH domain has specific interest since this domain, in principle, provides specificity and is the largest contributor to affinity. Single domains have further advantages due to their smaller size. Although it has been repeatedly shown that VH domains retain sufficient activity to interact with antigen, VH domains are known to be sticky and insoluble. The present invention shows that these problems can be remedied by the Trp103Arg substitution.
- 3.1 Production and Purification of Wild Type and Mutant VHH.
- The gene fragment encoding the anti-β-lactamase VHH TEM04 was mutagenized by PCR using the FR4 specific primer A4short-TEM04 (5′-GGA GAC GGT GAC CTG GGT CCC CTG GCC CCA TAC GAC-3′), thereby changing the wild type residue Arg on
position 103 to Trp103. Using a similar approach, the anti-carcinoembryonic antigen (CEA) VHH CEA71, was mutated with primer A4short-CEAVH (5′-GGA GAC GGT GAC CTG GGT CCC CTG GCC CCA GGG GC-3′). - The E. coli production vector pHEN6 was used for expression of the wild type and mutated VHH fragments. pHEN6 is derived from pHEN1 (Hoogenboom et al. (1991)), pHEN6 encoding the hexahistidine tag sequence for purification of VHH and lacking the phage M13 gene3. The PCR-products and vector were digested with Ncol-BstEll and loaded on a 1% agarose gel. Fragments and vector were purified from gel with Jetsorb, ligated, transformed into WK6 competent cells and plated onto LB agar plates containing 100 μg/ml ampicillin and 2% glucose. Mutation of R to W on
position 103 was confirmed by sequencing (FIG. 1 ). - For each construct pre-cultures were started in triplicate in 10 ml of LB-medium containing 100 μg/ml ampicillin and 2% glucose. 330 ml cultures (in TB-medium with 100 μg/ml ampicillin) were inoculated with 3 ml of preculture and grown at 370° C. Cultures were induced at OD600 nm=0.4 with 1 mM IPTG and grown overnight at 28° C. No significant differences were observed in cell densities after induction between the wild type and mutant (VHH TEM04: OD600(wt)=1.05±0.25; OD600(mut)=1.25±0.05 ; VHH CEA71: OD600(wt)=1.48±0.28; OD600(mut)=1.30±0.20), suggesting that no toxic products were expressed.
- The cells were boiled in reducing sample buffer and loaded on 15% PAGE, normalized for the number of cells (OD600nm=0.1). The proteins were blotted on nitrocellulose and blocked overnight in PBS containing 1% casein. The hexahistidine-tagged VHH was detected with mouse anti-Histidine monoclonal antibody (Serotec, diluted 1:1000 in PBS) and after 4 washes with PBS-0.5% tween-20 incubated with anti-mouse alkaline phosphatase conjugate (Sigma, diluted 1:1000) using NBT and BCIP as chromogenic substrates. It can be concluded that the VHH TEM04 mutant is expressed at much lower levels than its wild type derivative, while for VHH CEA71 no differences were observed (
FIG. 2 ). - Periplasmic extracts were made from all cultures by resuspending the cells in 4 ml TES (0.2 M Tris-HCI, 0.5 mM EDTA, 0.5 M sucrose; pH 8.0). The suspension was incubated for 30 minutes on ice. Subsequently 6 ml 0.25×TES was added and the incubation on ice was continued for 20 minutes. Periplasts were removed by centrifugation for 20 minutes at 10,000 rpm and 4° C. in SS34-rotor (Sorval). VHH was purified by IMAC using Ni—NTA (QIAGEN). The yields were determined by measuring the OD280 nm using the calculated molar extinction coefficients (VHH TEM04 E(R103)=2.168 and E(W103)=2.582; VHH CEA71 E(R103)=1.444 and E(W103)=1.865) (Table 1). As was observed by Western blot analysis the yield of mutant antibody for VHH TEM04 was much lower than for its wild type, while for VHH CEA71 no difference was found. The purified VHH were analyzed on a coomassie stained PAGE (
FIG. 3 ), which revealed that β-lactamase was co-purified as a complex with VHH TEM04, both for the wild type and the mutant form.TABLE 1 Production yields of wild type (R on position 203) and mutant (W) VHH expressed per liter of culture. Yield (mg/l) VHH R (wild type) W (mutant) TEM04 14 ± 5 2.3 ± 0.7 CEA71 33 ± 4 32 ± 2
3.2 Antigen Binding Characteristics of VHH CEA71 Variants. - An ELISA was performed to compare the antigen binding characteristics of the wild type and the mutant VHH CEA71. A microtiter plate (Maxisorp, NUNC) was coated overnight at 4° C. with CEA (Scrips) at a concentration of 1 μg/ml (in PBS), and blocked for two hours at room temperature (RT) with 300
μl 1% casein in PBS. The plates were washed three times with PBS-tween. Dilution series (10 μg/ml to 4.57 ng/ml, dilution factor three) of all purified samples were incubated in triplicate (100 μl/well) for 2 hours at RT. Plates were washed six times with PBS-tween, after which binding of VHH was detected by incubation with mouse anti-Histidine mAB (Serotec; 1:1000 diluted; 100 μl/well) for 1 hour at RT followed by anti-mouse-alkaline phosphatase conjugate (Sigma, 1:2000 diluted), also for 1 hour at RT. Staining was performed with the substrate PNPP (p-nitrophenyl-phosphate, 2 mg/ml in 1M diethanolamine, 1 mM Mg2SO4, pH9.8) and the signals were measured after 30 minutes at 405 nm. The CEA wild type VHH still binds at approximately tenfold lower concentrations than the mutant form (FIG. 4 ). This means that either 90% of the mutant protein is not correctly folded (thus inactive) or that the affinity of the mutated VHH is tenfold lower. - For VHH TEM04 no ELISA was performed, but on the coomassie stained gel (
FIG. 3 ) the co-purified β-lactamase seems to have a similar intensity as the VHH, suggesting that the R103W mutant is produced completely in an active form. It therefore can be assumed that the introduction of Tryptophan onposition 103 decreases the affinity. - 3.3 Solubility of VHH CEA71 Wild Type and R103W Mutant.
- The solubility characteristics were examined by determination of the concentration of ammonium sulfate, at which the VHH starts to precipitate. Therefore a saturated stock solution of ammonium sulfate was prepared by dissolving an excess of salt in a limited volume of water. After equilibration for 2 hours at RT, the solid particles were removed by centrifugation at 4300 rpm for 10 minutes and the supernatant (100% ammonium sulfate solution) was used to make dilutions of 0-80%. 60 μl sample was added to 300 μl ammonium sulphate solution and mixed for 18 hours at 4° C. This mixture was centrifuged for 10 minutes at 13000 rpm in an Eppendorf centrifuge. The amount of soluble VHH in the supernatant was determined in ELISA deduced from the degree of antigen binding (
FIG. 5A ) and on the other hand by measuring the protein concentration with OD280 (FIG. 5B ). - From both types of measurements it can be concluded that the wild type anti-CEA VHH CEA71 started to precipitate at an ammonium sulfate concentration of 65%, while the mutant form shows signs of precipitation at 58%. This experiment clearly demonstrates that the introduction of Tryptophan on
position 103 in the context of the wild type sequence of VHH CEA71, which has Arginine on this position, decreases its solubility. - Dromedaries and llamas were immunized intramuscularly with a cocktail of antigens using Freund's complete adjuvant (first injection) and Freund's incomplete adjuvant (subsequent injections). Dromedaries were immunized with CEA (Carcino Embryonic Antigen), ovalbumine (OVA), PSA (Prostate Specific Antigen), Variant Surface Glycoprotein trypanosome (VSG), β-lactamase, carbonic anhydrase, Cutinase, Potyvirus and Lysozyme. Llamas were immunized with Poly A Binding Protein Type 2 (PABP2), Linoic Acid BSA-conjugate, a humanized mouse mAb to CD40 (Hu-anti-CD40), human serum albumin (HSA), Salmonella typhimurium, Rotavirus. Following 6 injections with a one-week interval, a blood sample of 100 ml was collected. PBL cells were separated on a Ficoll-Paque Plus gradient (Amersham Biosciences). Total RNA was isolated from these cells using an acid guanidinium thiocyanate extraction (Chomczynski and Sacchi, 1987) and cDNA was prepared using M-MLV RT (Gibco BRL) and random oligonucleotide primers (Amersham Biosciences). With the primers Call001 (5′-GTCCTGGCTGCTCTTCTACAAG-3′) and Call002 (5′-GGTACGTGCTGTTGAACTGTTCC-3′), annealing to the leader sequence and the CH2 exon of all camelid immunoglobulins respectively, the gene fragments coding for the variable domain were amplified by PCR. To introduce a Ncol restriction site, the gene fragments were reamplified using an equimolar mixture of upstream primers SM017 (5′-CCAGCCGGCCATGGCTGATGTGCAGCTGGTGGAGTCTGG-3′, and SM018 (5′-CCAGCCGGCCATGGCTCAGGTGCAGCTGGTGGAGTCTGG-3′) in combination with Call002 in a nested PCR. In the final amplification the A4short primer (5′-CATGCCATGACTCGCGGCCCAGCCGGCCATGGC-3′) was used on one hand to introduce a Sfil site and on the other hand the primers as described before were used to introduce the key residues on
position 103 and a Notl site: primer 1 (R103), primer 2 (R103), primer 3 (K103), primer 4 (Q103), primer 5 (L103), primer 6 (F103) primer 7 (G103), primer 8 (S103), primer 9 (P103), primer 10 (Y103). The PCR products were cloned using the Sfil/Notl restriction enzymes into the phagemid vector pHEN4 (a derivative of pHEN1 (Hoogenboom et al., 1991) with a HA-tag downstream the cloning sites of the heavy chain antibody fragment). The repertoire was expressed on phage following infection with M13K07 helper phages. Specific binders were selected using the principle of phage display and panning (Ghahroudi et al., 1997). - Single domain heavy chain antibodies specific for CEA (CEA1 and CEA72), PSA (N3-A, N8-B, C9-B, C11-B, C12-A, C1-B, C24-A, N13-A, N15-B), HSA (ALB1, ALB2, ALB3, ALB4, ALB5), Hu anti-CD40 (CD40-1, CD40-2, CD40-3, CD40-4, CD40-5, CD40-6, CD40-7), OVA (B13, 1DBOVA11, 1DBOVA23, 1DBOVA43, A2-19, A4-17, B368, R24), VSG (cAbAn04), β-lactamase (cAbBLA01, cAbTEM04), carbonic anhydrase (1 D2CA30), PABP2 (C4PABP2, E3 PABP2, F6 PABP2), Salmonella typhimurium (MPOD6 salmon), Rotavirus (1-F6 RTV), Linoic Acid (LA-1), Cutinase (CutIII19, A4cut9, CACU13, CABCUT4, CU16), Potyvirus (48dpvy, 348DPVY, 1648DPVY,1048DPVY23, PVYIA15, PVYIA2, PVYIA1, PVY17) and Lysozyme (1D2L28) were isolated and evaluated for expression, binding in ELISA and affinities. The sequences are listed below; amino acid position 103, as determined by the Kabat numbering is indicated in bold,
N3-A DVQLQESGGSLVQPGGSLRLSCAASGFTFSAYYMIWVRQAPGKGLEWVSGISANGRDTLYEDSVEGRFAISRDNA KNTLYLQMNSLRSEDTALYYCVIGALITGRRGQGTQVTVSS NB-B DVQLQESGGGLVQPGGSLRLSCAASGFLFSDTYMTWARQAPGKGLEWLGGISKDGSGTLYEDSVEGRFTISRDNA KNTLYLQMNSLKSEDTALYYCSTGALLPTRPQGQGTQVTVSS C9-B DVQLQESGGGLVQPGGSLRLSCAASGFTFSNHYMTWVRQAPGKGLEWVSVISNDGRYTDYADSVKGRFTISRDNA KNTLYLQMNSLKTEDTALYTCVRGYYLTNLPAGDRGQGTQVTVSS C11-B DVQLQESGGGLVQPGGSLRLSCAASGFIFSNTYMTWVRQAPGKGLEWVSGISADGRDTLYADSVEGRFAISRDNA KNTLYLQMNSLRSEDTALYYCVTGALMTGRRGQGTQVTVSS C12-A DVQLQESGGGLVRPGGSLRLSCAASGFLFSGTYMTWARQAPGKGLEWLCGINKDGSGTLYADSVEGRFTCSRDNA KNTLYLQMNSLKSEDTALYYCSTGALLPTRPQGQGTQVTVSS C1-B DVQLQESGGGLVQPGGSLRLSCAASGFTFSTSYMTWARQAPGKGLEWVSGINRDGNNPLYADSVEGRFTVSRDNA KNTLYLQMNSLKSEDTALYYCVAGALVAGARGQGTQVTVSS C24-A DVQLQESGGGLVQPGGSLRLSCAASGFAFTPSYMSWVRQAPGKGLEWVSVISNDGRYTDYADSVKGRFTISRDNA KNKTLYLQMNSLKTEDTALYTCVRGYYLTNLPAGDRGQGTQVTVSS N13-A DVQLQESGGGSVQPGGSLRLSCAASGFTFKDASMNWVRQAPGKGLEWVSAINGGGTVTDYADPMEGRFTISRDNA KNTLYLQMNSLNFEDTALYYCATGWLFRANNYRGQGTQVTVSS N15-B DVQLQESGGGSVQAGGSLRLACAATAYTYDSNVLGWFRQAPGKEHEGVAVIYTGTRTTYYADSVKGRFTISQDNA KNTVYLQMNSLKPGDTAMYFCAANVRLGGVWSFDYRGQGTQVTVSS ALB-1 QVQLQESGGGLVQPGGSLRLSCAASGFAFSSFPMTWVRQAPGKGLEWVSGILEGGGSPAYADSVKGRFTISRDDA KNTLYLQMNSLKPEDTAVYYCAKGYVYAREGARSQGTQVTVSS ALB-2 QVQLQESGGGLVQPGGSLRLTCTASGFAFSNFGMSWVRQPPGKGLEWVSAISADSSTKNYADSVKGRFTISRDNT KKMLYLEMNSLKPEDTAVYHCVIGRGSASSQGTQVTVSS ALB-3 QVQLQESGGGLVQPGNSLRLSCAASGFAFGNFGMSWVRQAPGKEPEWVSSIDSIGSDTLYADFVKGRFTISRDNA KSTLYLQMNSLKPEDTAVYYCTIGGSLSRSSQGTQVTVSS ALB-4 QVQLQESGGGLVQPGNSLRLSCAASGFSFRSFGMSWVRQAPGKGPEWVSSINSSGDDTRYTDSVKGRFTISRDNA KSTLYLQMNSLKPEDTAVYYCTIGSSISRSSQGTQVTVSS ALB-5 QVQLQESGGGLVQPGGSLRLTCTASGFAFSSFGMSWVRQPPGKGLEWVSAISADSSTKNYADSVKGRFTISRDND KKMLYLEMNKLKPEDTAVYHCVIGRGSPSSQGTQVTVSS CEA1 QVQLVESGGGLVQPGGSLRLSCAASGFTFSKYDMSWVRQAPGKGLEWVSRISSGGGSTYYADSVKGRFTISRDNA KNTLYLQMNSLKPEDTAVYYCATPTYSSDYRGLPPGQGTQVTVSS CEA72 QVQLVESGGGLVQPGGSLRLSCAASEFTFSSSYMSWVRQAPGKGLEWVSGINTDGSFTRYADSVKGRFTISRDNA KNTLYLQMNSLKSEDTALYYCAVGGGLGYGPRGQGTQVTVSS B13 QVQLQASGGGLVQPGGSLRLSCAASGFDFMNVYMTWVRQAPGKGVEWVSGISVSGSITHYSESVKGRFTISRDNA KNMLYLQMNSLKSEDTARYYCARGGYNRYYGALGQGTLVTVSS 1DBOVA11 QVQLVESGGGSVQ?GESLRLSCVASGFTFDV?YMNWVRQAPGKGLEWVSGISASGY?TTYA??VKGRFTISRDNA KNTLYLQMNSL??TRGQGTQVTVSS 1DBOVA23 QVQLVESGGGSVQAGGSLIISCAASGFDFSNNYMTWVRQAPGKGVEWVSGISVSGSITHYTDSVKGRFTISRDNA KNTLYLQMNSLRSEDTARYYCGTGGYGRYYGTLGQGTQVTVSS 1DBOVA43 QVQLVESGGGLVQPGGSLRLSCVGSGFTFSSYYISWVRQAPGKGLEWVSGISGSGATTSYTDSVKGRFTISRDNA KNTVYLQLNSLETEDSAMYYCRLGYGTPPGGVWPSQRQGTQVTVSS A2-19 QVQLQASGGGLVQPGGSLKLSCVVSGFLFSNYAFSWVRQAPGKGLEWVSTIGTSSGYTNYAPSVKGRFITSRDNA KNTVYLQLNSLKTEDTAMYYCRRPGTDERGQGTQVTVSS A4-17 QVQLQASGGGLVQPGGSLRLSCAASGFDFSNVYMTWVRQAPGKGVEWVSGISVSGSITHYSDSVKDRFTISRDNA KNTLYLQMNSLKSEDTARYYCARGGYNTYSGALGQGTQVTVSS B368 VQLVESGGGSVQAGGSLILSCTASGLPYKSYCMGWFRQAAGKEPEGVATINSGTGSKFYTDSVKGRFTISLDNDN NRVYLEMSSLKPEDTATYYCAAGQRHSCGYVLKNTDGWTHRAQGTQVTVSS R24 SAQVQLQASGGGLVQPGGSLKLSCVVSGFLFSNYAFSWVRQAPGKGLEWVSTIGTSSGYTNYAPSVKGRFTISRD NAKNTVYLQLNSLKTEDTAMYYCRRPGTDERGQGTQVTVSS cAbAn04 QVQLVESGGGSVEAGGSLRLSCVVSGYSVSIGCMAWFRQAPGSGREGVAGISRGGSMTDYTASVKGRFTISRDND QRTVTLQMNSLKPEDTAVYYCARDGPEIATMIGGSRGRGTQVTVSS cAbBLA01 QLQLVESGGGSVQSGGSLRLSCKVSGYIGSTNCMGWFRQAPGKEREGVASLFTGSGNTYYGDSVKGRFTISEDNA KNTVSLQMNSLKPEDTAMYYCASSSNVGSDESCGRKNTRQFVYTYQGQGTQVTVSS cAbTEM04 QVQLVESGGGLVQAGGSLRLSCAASGFTFSSAWMTWVRQAPGKGLEWVTSIATDGSTDYADSVKGRFTISRDNAK NTLYLQLNSLNTEDTAVYYCAKDRWGYVVRGQGTQVTVSS 1D2CA30 QVQLVESGGGSVQAGGSLRLSCAASGYTVSTYCMGWFRQAPGKEREGVATILGGSTYYGDSVKGRFTISQDNAKN TVYLQMNSLKPEDTAIYYCAGSTVASTGWCSRLRPYDYHYRGQGTQVTVSS C4 PABP2 QVQLQESGGGLVQPGGSLRLSCAASGFTFSRSWMYWVRQAPGKGLEWVSSITPGGSEPFYVDSVKGRFTISRDNA KNTLYLQMNSLKSEDTAVYFCAKDSKNGPRGQGTQVTVSS E3 PABP2 QVQLQESGGGLVQPGGSLRLSCAASGFTFSRSWMYWVRQAPGKGLEWVSSITPGGTEAFYADSVKGRFTISRDNA KNTLYLQMNSLKSEDTALYFCAKDSKNGPRGQGTQVTVSS F6 PABP2 QVQLQESGGGLVQPGGSLRLSCATSGFIFSDYWMYWVRQAPGKGLEWVSSITPGASTTLYADSVKGRFTISRDNA KNTLYLQMNSLKSEDTAVYYCAKGSKIGPRGQGTQVTVSS LA-1 QVQLQDDSGGGLVQPGGSLKLSCAASGFTFSNYEMSWVRQAPGKGLEWVSSINNGGDITYYANSVKGRFTISRDN TKNTLYLQMNSLKSEDTAVYYCKVPNRRLRGPGTQVTVSS CD40-1 QVQLVESGGGLVQPGGSLRLSCAASGFAFSRYSMYWVRQAPGKGLEWVSEIYPDGNGWYTSSVKGRFTISRDNDK NMLYLQMNSLKPDDTAVYYCALSRSGQGRGQGTRVTVSS CD40-2 EVQLVESGGGLVQAGGSLELSCSFGGRAFDRYFMAWFRQAPGKGLEWVSRIYSGGSTSYADSVKGRFTISRDNAK NTLYLQMNNLKPEDTAVYYCDIAGRRGQGIQVTVSS CD40-3 EVQLVESGGGLVQAGDSLRLSCAASGRTFNTVDMGWFRQAPGKEREFVAHISWRGGSTYYADSVKGRFTISRDNA KNTLYLQMNNLKPEDTAVYYCDIAGRRGQGTQVTVSS CD40-4 QVQLVESGGGLVQPGGSLRLSCAASGFAFSRYSMYWVRQAPGKGLEWVSEIYPDGNGWYTSSVKGRFTISRDNDK NMLYLQMNSLKPDDTAVYYCALSRSGQGRGQGTRVTVSS CD40-5 EVQLVESGGGLVQAGGSLELSCSFGGRAFDRYFMAWFRQAPGKGLEWVSRIYSGGSTSYADSVKGRFTISRDNAK NTLYLQMNNLKPEDTAVYYCDIAGRRGQGIQVTVVS CD40-6 EVQLVESGGGLVQAGDSLRLSCAASGRTFNTVDMGWFRQAPGKEREFVAHISWRGGSTYYADSVKGRFTISRDNA KNTLYLQMNNLKPEDTAVYYCDIAGRRGQGTQVTVSS CD40-7 AVQLEESGGDSVQAGGSLRLSCAASGFTFSRYSMYWVRQPPGKGLEWVSEIYPDGNGWYTSSVKGRFTISRDNDK NMLYLQMNSLKPDDTAVYYCALSRSGQGRGQGTRVTVSS MPOD6 Salmon QVQLQESGGGLVQPGGSLRLSCAASGFTFNDYFMNWVRQAPGKGLEWVSGIYSDGSKTYYGDSVKGRFTISRDNA KNTLYLQMNSLKSEDSAVYYCTRGTGWSSTPYTYRGQGTQVTVSS 1-F6 RTV QVQLQEVRGRLVQLGGSLRLSCAASGFTFKYYAMSWVRQAPGKGLEWVSYINDNGGYTDYSDSVKGRFTISRDNA KNTLYLHMNRLKPEDTAVYFCAKWDTDAVSSSRYKTHNGDIRGPGTQVTVSS CUTIII19 QVQLVESGGGLVQAGESLTLSCTASGGSFNNWHMGWFRQAPGTEREFVAAIRRAYGSTFYADSVKGRFTI ARDNAKNTVYLQMSSLKPEDSAVYYCAAKRAFRVGGDFEYYGQGTQVTVSS A4cut9 QVQLQASGGGLVQPGGSLRLSCAASGFTFSTYYMNWVRQAPGKGLEWVPGINKDGSVSHYADSVKGRFTISRDNA KNTLYLRMNSLKSEDTALYYCATIAGFRVGGGPGGTQVTVSS CACU13 DVQLVESGGGLVQPGGSLRLSCAASGFRFDSVAMTWVRQTPGKGLEWVSSISWDGTTTSYAASVKGRFTISRDNA KNTLYLQLDSLKTEDTAMYYCTKTGVDYRDSRDRGRGTQVTVSS CABCUT4 QVQLVESGGGLVQPGGSLRLSCAASGFRFDSVAMTWVRQAPGKGLEWVSSISWDGTTTSYAASVKGRFTISRDNA KNTLYLQLDSLNTEDTAMYYCTKTGVDYRDSRSRGQGTQVTVSS Cu16 QVQLVESGGGSVQAGGSLKLTCELSGFNGRSNCMGWFRQVLGKDREGVAAINHPEGSEFYDDSVKGRFKITRDGL KDADSLQMNNLKPEDTATYYCALRPYDCYSGAWSPADFYYRGARGTQVTVSS 48dpvy3 QVQLQASGGGSVEAGGSLRLSCAASGDTAKLNCMAWFRQAPGKERERVASLSTRLTTTSYTDSVKGRFTISQDTA TNTVYLEMNSLQPEDTAVYYCQLSRGGTNYRGQGTLVTVSS 48DPVY16 QVQLQASGGGSVQAGGSLRLSCAASGYTYSSNCMGWFRQALGKEREGVAAIYTGGGSTYYADSVKGRFTISQDNA KNTVLYQMNSLKPEDTAMYYCAASLLPLVAGIGVWDAFDYRGQGTQVTVSS 48DPVY10 QVQLQASGGGSVQAGGSLRLSCVASQYEYSNNYIAWFRQAPGKEREGVAAIYTGGVTRASPYYADPVKGRFSISK DNAKNTVYLQMNDLKPEDSGTYICASSIHGLGNPLRSEFSYYGQGTLVTVSS 48DPVY23 QVQLQASGGGSVEAGGSLRLSCAASGDTAKLNCMAWFRQAPGKERERVALLSTRLTTTSYTDSVKGRFTISQDTA TNTVYLEMNSLQPEDTAIYYCAARWAGRSCLVSVYDYYGQGTLVTVSS PVYIA15 QVQLVESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSGIKSGGGRTYYADSVKGRFTISRDNA KNTLTLQLNSLKTEDTAMYYCAKGARYDSDYDVTWLDSYSGQGTQVTVSS PVYIA2 DVQLVESGGGSVQAGGSLRLSCTASGLRLNTYHMSWVRQAPGKGLEWVSTIYIGGTTTSHANSVSGRFTISRDDA KNTLYLQMNNLKPEDTAVYFCATGSVNAYGVKGQGTQVTVSS PVYIA1 QVQLVESGGGSVQAGGSLTLSCTVSGYDFNRCSMNWYRENPGKEREFVAGIDSDGTTTYADSVKGRFTISHDNTR NTLYLQMNSLKSEDTALYYCRLGGLRTWPQYGYRGQGTQVTVSS PVY17 QVQLVESGGGLVQPGGSLRLSCTASGLRLNTYHMSWVRQAPGKGLEWVSTIYIGGTTTSHANSVSGRFTI SRDDAKNTLYLQMNNLKPEDTAVYFCATGSVNAYGVKGQGTLVTVSSAA 1D2L28 QVQLVESGGGLVQPGGSLRLSCAASGFAFSIYRMSWVRQAPGQGLEWVSSIDSGGGITYYADSVKGRFTI SRDNAKNTLYLQLNSLKTEDTAMYYCARGHYLYDDIFTGAKGQGTQVTVSSGR - For each construct 10 ml pre-cultures were started in TB containing 100 μg/ml ampicillin and 2% glucose. For each pre-culture, 4×330 ml culture was started at 37° C. in TB containing 100 μg/ml ampicillin with 3 ml of the overnight culture. Cultures were induced with 1 mM IPTG at OD600 nm=0.4 and grown overnight at 28° C.
- Periplasmic extract was prepared for all overnight cultures. The overnight cultures were centrifuged for 10 minutes at 10,000 rpm at 40° C. The supernatant was removed and the pellet was re-suspended in 16 ml TES (0.2 M Tris-HCI, pH=8.0, 0.5 mM EDTA and 0.5 M sucrose). This mixture was incubated for 30 minutes on ice. 24 ml 0.25×TES was added, incubated on ice for 20 minutes and centrifuged for 20 minutes at 10,000 rpm. The supernatant was purified on Ni-NTA (QIAGEN), and dialyzed overnight against PBS. OD280 was measured and the yield (in mg) of purified material per liter of culture was determined. Kd's were determined on BIAcore are given in the table below.
Expression level (mg/l culture, Name of Antigen recognized Kd purified binder by antibody (nM) material) Host N3-A Prostate specific — 0.25 Dromedary antigen N8-B Prostate specific 1.6 6.2 Dromedary antigen C9-B Prostate specific 3.9 2.1 Dromedary antigen C11-B Prostate specific 2.6 6.1 Dromedary antigen C12-A Prostate specific 2.6 1.2 Dromedary antigen C1-B Prostate specific 0.8 0.75 Dromedary antigen C24-A Prostate specific — 5.0 Dromedary antigen N13-A Prostate specific — 0.25 Dromedary antigen N15-B Prostate specific — 0.65 Dromedary antigen CEA1 Carcino Embryonic Dromedary Antigen CEA72 Carcino Embryonic 8.4 Dromedary Antigen B13 ovalbumin <13 Dromedary 1DBOVA11 ovalbumin Dromedary 1DBOVA23 ovalbumin Dromedary 1DBOVA43 ovalbumin Dromedary A2-19 ovalbumin Dromedary A4-17 ovalbumin Dromedary B368 ovalbumin Dromedary R24 ovalbumin Dromedary cAbAn04 Variant surface Dromedary glycoprotein trypanosome cAbBLA01 β-lactamase <1 0.4 Dromedary cAbTEM04 TEM1 Dromedary 1D2CA30 Carbonic anhydrase Dromedary A4Cut9 Cutinase Dromedary CACU13 Cutinase Dromedary CABCUT4 Cutinase Dromedary CU16 Cutinase Dromedary 48dpvy Potyvirus Dromedary 348DPVY Potyvirus Dromedary 1648DPVY Potyvirus Dromedary 1048DPVY23 Potyvirus Dromedary PVYIA15 Potyvirus Dromedary PVYIA2 Potyvirus Dromedary PVYIA1 Potyvirus Dromedary PVY17 Potyvirus Dromedary 1D2L28 Lysozyme Dromedary LA-1 Linoic acid Llama C4 PABP2 Poly A Binding Llama Protein Type 2 E3 PABP2 Poly A Binding Llama Protein Type 2 F6 PABP2 Poly A Binding Llama Protein Type 2 CD40-1 humanised mouse 2 8 Llama mAb to CD40 CD40-2 humanised mouse Llama mAb to CD40 CD40-3 humanised mouse Llama mAb to CD40 CD40-4 humanised mouse Llama mAb to CD40 CD40-5 humanised mouse Llama mAb to CD40 CD40-6 humanised mouse Llama mAb to CD40 CD40-7 humanised mouse Llama mAb to CD40 MPOD6 Salmonella Llama salmon Typhimurium 1-F6 RTV Rotavirus Llama CutIII19 Cutinase Llama ALB-1 Human serum 15 Llama albumin ALB-2 Human serum 15 Llama albumin ALB-3 Human serum 15 Llama albumin ALB-4 Human serum 15 Llama albumin ALB-5 Human serum 15 Llama albumin - Alignment of the CEA1 binder and a human VH3 germline (DP-47) revealed a high degree of homology (two amino acid changes in FR1 on
position position DP-47 EVQLLESGGGLVQPGGSLRLSCAASGFTFS SYAMS WVRQAPGKGLEWVSAISGSGGSTYY CEA1 QVQLVESGGGLVQPGGSLRLSCAASGFTFS KYDMS WVRQAPGKGLEWVSRISSGGGSTYY DP-47 ADSVKG RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK ---------------------- CEA1 ADSVKG RFTISRDNAKNTLYLQNNSLKPEDTAVYYCAT PTYSSDYRGLPPGQGTQVTVSS - A specific binder for the CEA tumor antigen, with high homology to the human germline gene DP-47 was therefore an ideal candidate to further humanize and evaluate the influence of mutagenesis on binding affinity in ELISA and BIAcore.
- Mutagenesis of the residues in FR1 had no significant influence on specificity, binding affinity and expression level. Mutagenesis of most of the FR3 residues did not result in loss of specificity, affinity and expression levels. The most humanized and best performing CEA1 mutant was chosen for immunogenicity studies. Baboons were immunized intravenously, intramuscularly and subcutaneously with a weekly dose of 1 mg/kg body weight. Blood samples were taken and humoral response was evaluated in ELISA. No significant antibody response was raised against the CEA1 mutant.
- cDNA templates were made starting from blood samples from 20 non-immunized human donors (or from other species containing antigen binding molecules with an Ig-fold). The peripheral blood lymphocytes (PBL) were isolated on Ficoll-Paque gradients (Amersham Biosciences). Total RNA was prepared individually from the 20 samples of PBL's as described in example 4. First strand cDNA was also individually synthesized from total RNA with random hexamers as primers (as in example 4).
- Mutagenesis was carried out using a
Framework 1 specific primer that is 5′ linked to a Sfil site, as backward primer, and the mutagenic primer:3′ - ACC CGA GGA GCC TGG GAC CAG TGG CAG - 5′ or 3′ - ACC CCG GTG AGG AGG GTC CAG TGG CAG - 5′ - as forward primer. The DNA obtained was cut with BseRI and ligated to the double stranded primer:
5′- pC GTC AGG GGC CAA GGA ACC CAG GTC ACC GTC TCC TCA -3′ 3′- CTG CAG TCC CCG GTC CCC TGG GTC CAG TGG CAG AGG AGT -5′ - for the PCR product obtained with the first mutagenic primer, or
5′- pAGG GGC CAA GGA ACC CAG GTC ACC GTC TCC TCA - 3′ 3′- GT TCC CCG GTC CCC TGG GTC CAG TGG CAG AGG AGT -5′
for the PCR product obtained with the second mutagenic primer. - This primer restores the CDR3 and
Framework 4 coding regions. The resulting DNA was amplified using the same forward primer as above, and using3′- C TGG GTC CAG TGG CAG AGG AGT CGCCGGCG -5′
as backward primer. This primer created a Notl site at the end of the VH coding sequence. The resulting material was cut with Sfil and Notl and the resulting fragment cloned in pHEN4 to yield a phage display library. - The library was selected with a panel of antigens, such as Human Serum Albumin and human IgG1, thereby obtaining large numbers of antigen specific antibody fragments. Sequence analysis revealed the introduced residue on
position 103. The produced and His6-tagged VHH fragments showed good solubility characteristics, good specificity (not reactive against irrelevant antigens) and high affinities (range of 2 to 50 nM). - A mouse was immunized with a set of antigens (CEA and PSA) and after four weeks the spleen was removed, homogenized in guanidinium thiocyanate buffer with a Polytron homogenizer, debris removed by low speed centrifugation and total RNA extracted using the method described before. As was described above the mouse VH encoding gene segments were amplified thereby introducing the variant residues on
position 103. Upon selection high affinity VH fragments were selected with good characteristics with respect to solubility. - Selection of binders for tumor necrosis factor alpha (TNF) from a phage library was carried out as described in Example 4. After panning the library, 48 individual clones were selected and tested in a phage ELISA on immobilized TNF and BSA.
- The clones for which the signal on TNF was superior to the one obtained on BSA were selected for further characterization. By sequencing the selected clones, we were able to eliminate identical clones and to demonstrate that W103 was no longer encoded in the selected fragments.
- The gene segments encoding the selected antibody fragment were recloned in the pHEN6 expression vector as described in example 3, which allowed us to produce the recombinant antibody fragment as soluble periplasmic proteins. The recombinant antibody fragments were purified to homogeneity from the periplasmic fraction by IMAC on Ni—NTA agarose and subsequent gel-fitration chromatography on Superdex-75. The purity was determined by SDS-PAGE.
- 6. Applications of anti-TNF Antibody Fragments.
- 6. 1.1 Therapeutic Applications.
- Anti-TNF specific fragments were tested in L929 murine fibrosarcoma cells following the protocol as described by Ameloot et al. (2001). L929 cells were seeded in 96-wells mirotiter plates at 30,000 cells per wells. The next day, purified recombinant antibody fragments were added to some wells, whereas only PBS was added to control wells. In this experiment the final concentration of antibody fragment was 1 micromolar.
- Subsequently a lethal dose of TNF was added to those wells where antibody was added and also to part of the control wells. After 18 hours, the level of surviving cells was estimated by the calorimetric method. In this way we demonstrated that these antibody fragments have the ability to neutralize the cytotoxic effect of TNF and have therapeutic potential.
- 6.1.2 Diagnostic Application of anti-TNF VHH in ELISA.
- To individual wells of a microtiter plate, we added 100 μl of the antibody fragments at a concentration of 5 μg/ml in PBS. After incubation overnight at 4° C. the plate is blocked with 1% BSA in PBS. The presence of functional immobilized antibody fragment was demonstrated by the binding of biotinylated TNF at 1 μg/ml. The presence of bound biotinylated TNF was demonstrated with streptavidin-alkaline phosphatase conjugate and subsequent reaction with para-nitrophenyl-phosphate.
- 6.1.3 Application of anti-TNF VHH in Antibody Arrays.
- Two different formats of antibodies arrays were tested, i.e. on nitrocellulose filters and glass slides. For the
filter method 2 μl of the purified antibody fragments at concentration of 1 mg/ml in PBS were spotted with a micropipette on a nitrocellulose sheet. After drying, the sheet was blocked with 1% BSA in PBS. The presence of functional immobilized antibody fragment on the nitrocellulose sheet was demonstrated with biotinylated TNF. The presence of bound TNF was demonstrated with streptavidin-alkaline phosphatase conjugate and NBT-BCIP reagent. The appearance of dark spots on those positions where the TNF-specific fragments were applied proved that these antibody fragments retain functionality when passively coated on a solid support. This approach can be used for random screening and selection of antigen-specific fragments. - For the glass slide type of antibody array the anti-TNF antibody fragments were covalently immobilized. Purified antibody fragments were diluted to a concentration of 200 μg/ml in PBS containing 20% glycerol. The samples where transferred to wells of a 384 well microtiter plate. Subsequently an automated contact printer was used to deliver 5 nanoliter of the antibody solutions to a commercially available glass slide (Telechem-Superaldehyde).
- After application of the samples, the glass slide was incubated for 1 hour in a humid chamber, to allow the reaction between the reactive aldehydes present on the glass slide and the lysine groups present on the antibody fragment surface to proceed.
- The slide was subsequently blocked with 1% BSA/PBS, subsequently incubated with Cy3-modified TNF (fluorescent label Cy3-Amersham Biosciences) at 1 μg/ml and finally washed with PBS to remove unbound labeled TNF. After scanning the fluorescence intensity present on the surface of the slide, we observed an enhanced signal at those positions where the TNF specific antibody fragments were applied.
- This result demonstrated that these antibody fragments were covalently immobilized with retention of binding capacity.
- 6.1.4 Affinity Chromatography.
- Purified antibody fragments at a concentration of at least 1 mg/ml were dialyzed against 0.1 M sodium bicarbonate and subsequently mixed with 1 ml gel suspension (CNBr-activated Sepharose) following the protocol as described by the manufacturer (Amersham Biosciences).
- After incubation for 3 hr, 100 μl of a
1M Tris pH 8 solution was added. After extensive washing, in order to remove unbound protein, the affinity resin was resuspended in 1 ml PBS. - The functionality of the immobilized anti-TNF antibody resin was tested as described below. To 1 ml of
human plasma 10 μg of purified TNF was added. We then added 100 μl of the affinity resin. After of overnight incubation of this suspension, the resin was washed extensively with PBS. The pelleted beads were subsequently resuspended in 100 μl of a solution containing 1% SDS solution and boiled for 10 minutes. After centrifugation 20 μl of the supernatant was loaded on SDS-PAGE. A band of the expected molecular weight was enriched in the analyzed sample. - References
-
- Ameloot, P., Declercq, W., Fiers, W., Vandenabeele, P. and Brouckaert, P. (2001), J Biol Chem 276: 27098-27103.
- Anker, R., Zavala, F and Pollok, B. A. (1990). Eur J Immunol 20: 2757-2761.
- Babu, K. S., Arshad, S. H. and Holgate, S. T. (2001). Expert Opin Biol 1:1049-1058.
- Bodtger, U., Poulsend, L.K., Jacobi, H. H. and Mailing, H. J. (2002). Allergy 57: 297-305.
- Chomczynski, P. and Sacchi, N. (1987) Anal Biochem 162: 156-159.
- Chukwuocha, R., Hsiao, E. T., Shaw, P., Witztum, J. L. and Chen, P.P. (1999). J Immunol 163: 4604-4611.
- Chothia, Novotny, Bruccoleri Karplus, (1985), J. Mol. Biol. 186, 651-663.
- Desmyter et al, (1996), Nature structural biology, v3: 803-811
- Dimasi, N., Martin, F., Volpari, C., Brunetti, M., Biasiol, G., Altamura, S., Cortese, R., De Francesco, R., Steinkuhler, C. and Sollazzo, M. (1997). J Virol, 71: 7461-7469.
- Ghahroudi, M. A. Desmyter, A., Wyns, L., Hamers, R. and Muyldermans, S. (1997). FEBS Letters 414: 521-526.
- Gordon, F. H., Hamilton, M. I., Donoghue, S., Greenlees, C., Palmer, T., Rowley-Jones, D., Dhillon, A. P., Amlot, P. L. and Pounder, R.E. (2002). Aliment Pharmacol Ther 16: 699-705.
- Hamers-Casterman C., Atarhouch, T., Muyldermans, S., Robinson, G., Hamers, C.; Songa E. B., Bendaham, N. and Hamers, R. (1993). Nature, 363: 446-448.
- Hoogenboom H. R., Griffiths A. D., Johnson K. S., Chiswell D. J., Hudson P., and Winter, G. (1991). Nucleic Acid Res 19: 4133-4137.
- Harmsen, M. M., Ruuls, R. C., Nijman, I. J., Niewold, T. A., Frenken, L. G. J. and de Geus, B. (2000). Mol Immunol, 37: 579-590.
- Hommes, D. W., van de Heisteeg, B. H., van der Spek, M., Barteisman, J. F. and van Deventer, S. J. (2002). Inflamm Bowel Dis 8: 81-86.
- Kabat, E.; Wu, T., T.; Perry,H., M.; Gottesman,K., S.; Foeller, C. 1991, US Public Health Services, NIH, Bethesda, Md.
- Muyldermans, S., Cambillau, C. and Wyns, L. (2001). Trends Biochem Sci, 26: 230-235.
- Nguyen, V. K., Hamers, R., Wyns, L. and Muyldermans, S. (2000). EMBO J, 19: 921-930.
- Nuttall, S. D., Irving, R. A. and Hudson, P. J. (2000). Curr Pharm Biotechnol, 1: 253-263.
- Pessi, A., Bianchi, E., Crameri, A., Venturi, S., Tramonatno, A. and Solazzo, M. (1993). Nature, 362: 367-369.
- Quiocho, F. A. (1993). Nature, 362: 293-294.
- Riechman (1996), J.Mol.Biol. 259: 957-969.
- Sollinger, H., Kaplan, B., Pescovitz, M. D., Philosophe, B., Roza, A., Brayman, K. and Somberg, K. (2001). Transplantation 72: 1915-1919.
- Vu, K. B., Ghahroudi, M. A., Wyns, L. and Muyidermans, S. (1997). Mol Immunol, 34, 1121-1131.
Claims (33)
1-87. (canceled)
88. A functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising
an amino acid which is neither a charged amino acid nor a C at position 45, and
an amino acid at position 103 selected from the group consisting of R, G, K, S, Q, L, and P,
said positions determined according to the Kabat numbering.
89. The functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof of claim 88 , further comprising an amino acid at position 108 selected from the group consisting of Q, L and R.
90. The functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof of claim 88 , further comprising an amino acid sequence, starting at position 103, selected from the group consisting of RGQGTQ (SEQ ID NO: 13), RGKGTQ (SEQ ID NO: 14), LGQGTQVTVSS (SEQ ID NO: 16), QGQGTGVTVSS (SEQ ID NO:17), PGQGTQVTVSS (SEQ ID NO:18), and SSQGTQVTSS (SEQ ID NO:19):
91. The functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof of claim 88 , further comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:1, 2, 3, 4, 5, 6, 7, 8, 9, and 10.
92. The functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof of claim 88 , further comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, and 79.
93. A functional heavy chain antibody, a functional single domain heavy chain antibody, a functional VH domain, or a functional fragment thereof, comprising the amino acid sequence VXXXXXXGLXW, wherein the V of the amino acid sequence is at position 37 according to the Kabat numbering, whereby X is any amino acid.
94. The functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof of claim 88 , which is a functional heavy chain antibody.
95. The functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof of claim 88 , which is a functional single domain heavy chain antibody.
96. The functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof of claim 88 , which is a functional VH domain.
97. The functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof of claim 88 , which is a functional fragment thereof.
98. The functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof of claim 88 , which is an artificial mutant.
99. The functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof of claim 93 , which is an artificial mutant.
100. The artificial mutant of claim 98 , comprising at least one derivatized amino acid.
101. The artificial mutant of claim 98 , derived from a protein from a Camelidae.
102. The artificial mutant of claim 98 , derived from a protein from a human.
103. The artificial mutant of claim 98 , derived from a protein from a mouse.
104. The artificial mutant of claim 98 , derived from a protein from a vertebrate species other than a Camelidae, human or mouse.
105. A polypeptide comprising the functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof of claim 88 .
106. A method to functionalize a heavy chain antibody, a single domain heavy chain antibody, a VH domain, or a fragment thereof, the method comprising replacing the amino acid at position 103 with an amino acid independently chosen from the group consisting of R, G, K, S and P, said position determined by the Kabat numbering.
107. A functional heavy chain antibody, a single domain heavy chain antibody, a VH domain, or a fragment thereof, produced by the method of claim 106 .
108. A method to humanize and functionalize a heavy chain antibody, a single domain heavy chain antibody, a VH domain, or a fragment thereof, said method comprising replacing the amino acid at position 45 with L, and replacing the amino acid at position 103 with an amino acid selected from the group consisting of R, G; K, S and P, said positions determined by the Kabat numbering, wherein the resulting product is the functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof of claim 88 .
109. A library comprising more than one functional mutant of claim 98 .
110. A library comprising more than one functional mutant of claim 99 .
111. A nucleic acid comprising a DNA sequence encoding the functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof of claim 88 .
112. A nucleic acid comprising a DNA sequence encoding the functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof of claim 93 .
113. A host cell comprising the nucleic acid of claim 111 , wherein the host cell is capable of expressing the functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof.
114. A host cell comprising the nucleic acid of claim 112 , wherein the host cell is capable of expressing the functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof.
115. The functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof of claim 88 , in a pharmaceutically suitable excipient.
116. The functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof of claim 93 , in a pharmaceutically suitable excipient.
117. A method of treating a mammal, the method comprising administering to the mammal the functional heavy chain antibody, functional single domain heavy chain antibody, functional VH domain, or functional fragment thereof of claim 115 .
118. The method of claim 117 , wherein the mammal is a human with a disease selected from the group consisting of asthma, rhinoconjunctivitis, allergic disorders, acute allograft rejection, Crohn's disease and ulcerative colitis.
119. A nucleic acid comprising a sequence selected from the group consisting of SEQ ID NOs:80, 81, 82, 83, 84, 85, 86, 87, and 88.
Priority Applications (6)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US10/492,668 US20050054001A1 (en) | 2001-10-24 | 2002-07-12 | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
US11/474,521 US8097251B2 (en) | 2001-10-24 | 2006-06-23 | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
US12/498,835 US9156905B2 (en) | 2001-10-24 | 2009-07-07 | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
US13/078,438 US20110251373A1 (en) | 2001-10-24 | 2011-04-01 | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
US13/208,667 US20120172578A1 (en) | 2001-10-24 | 2011-08-12 | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
US14/807,951 US20160052999A1 (en) | 2001-10-24 | 2015-07-24 | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
Applications Claiming Priority (7)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US33505401P | 2001-10-24 | 2001-10-24 | |
EP01204037 | 2001-10-24 | ||
EP01204037.4 | 2001-10-24 | ||
JP2002004184A JP2005289809A (en) | 2001-10-24 | 2002-01-11 | Mutant heavy-chain antibody |
JP2002-004184 | 2002-02-20 | ||
US10/492,668 US20050054001A1 (en) | 2001-10-24 | 2002-07-12 | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
PCT/EP2002/007804 WO2003035694A2 (en) | 2001-10-24 | 2002-07-12 | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2002/007804 A-371-Of-International WO2003035694A2 (en) | 2001-10-24 | 2002-07-12 | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US11/474,521 Continuation US8097251B2 (en) | 2001-10-24 | 2006-06-23 | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
Publications (1)
Publication Number | Publication Date |
---|---|
US20050054001A1 true US20050054001A1 (en) | 2005-03-10 |
Family
ID=35323183
Family Applications (6)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US10/492,668 Abandoned US20050054001A1 (en) | 2001-10-24 | 2002-07-12 | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
US11/474,521 Expired - Fee Related US8097251B2 (en) | 2001-10-24 | 2006-06-23 | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
US12/498,835 Expired - Fee Related US9156905B2 (en) | 2001-10-24 | 2009-07-07 | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
US13/078,438 Abandoned US20110251373A1 (en) | 2001-10-24 | 2011-04-01 | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
US13/208,667 Abandoned US20120172578A1 (en) | 2001-10-24 | 2011-08-12 | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
US14/807,951 Abandoned US20160052999A1 (en) | 2001-10-24 | 2015-07-24 | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
Family Applications After (5)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US11/474,521 Expired - Fee Related US8097251B2 (en) | 2001-10-24 | 2006-06-23 | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
US12/498,835 Expired - Fee Related US9156905B2 (en) | 2001-10-24 | 2009-07-07 | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
US13/078,438 Abandoned US20110251373A1 (en) | 2001-10-24 | 2011-04-01 | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
US13/208,667 Abandoned US20120172578A1 (en) | 2001-10-24 | 2011-08-12 | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
US14/807,951 Abandoned US20160052999A1 (en) | 2001-10-24 | 2015-07-24 | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
Country Status (6)
Country | Link |
---|---|
US (6) | US20050054001A1 (en) |
EP (2) | EP1693384A3 (en) |
JP (2) | JP2005289809A (en) |
AU (1) | AU2002336927B2 (en) |
CA (1) | CA2464372C (en) |
WO (1) | WO2003035694A2 (en) |
Cited By (18)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20050048060A1 (en) * | 2002-01-03 | 2005-03-03 | Hilde Revets | Immunoconjugates |
US20060149041A1 (en) * | 2003-01-10 | 2006-07-06 | Ablynx N.V. | Therapeutic polypeptides, homologues thereof, fragments thereof and for use in modulating platelet-mediated aggregation |
US20070031424A1 (en) * | 2001-10-24 | 2007-02-08 | Vlaams Interuniversitair Instituut Voor Biotechnogie Vzw | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
US20070269422A1 (en) * | 2006-05-17 | 2007-11-22 | Ablynx N.V. | Serum albumin binding proteins with long half-lives |
US20100021459A1 (en) * | 2002-11-08 | 2010-01-28 | Ablynx N.V. | Polypeptide constructs for intracellular delivery |
US20100226920A1 (en) * | 2006-03-27 | 2010-09-09 | Ablynx N.V. | Medical delivery device for therapeutic proteins based on single domain antibodies |
US20100297111A1 (en) * | 2005-05-21 | 2010-11-25 | Els Anna Alice Beirnaert | Nanobodies against tumor necrosis factor-alpha |
US20100330084A1 (en) * | 2005-05-20 | 2010-12-30 | Ablynx N.V. | Single domain vhh antibodies against von willebrand factor |
US20110158996A1 (en) * | 2008-03-21 | 2011-06-30 | Ablynx N.V. | Von willebrand factor specific binders and methods of use therefor |
WO2011098518A2 (en) | 2010-02-11 | 2011-08-18 | Ablynx Nv | Delivery of immunoglobulin variable domains and constructs thereof |
WO2011161263A1 (en) | 2010-06-25 | 2011-12-29 | Ablynx Nv | Pharmaceutical compositions for cutaneous administration |
US8188223B2 (en) | 2005-05-18 | 2012-05-29 | Ablynx N.V. | Serum albumin binding proteins |
WO2012166906A1 (en) | 2011-05-31 | 2012-12-06 | Massachusetts Institute Of Technology | Cell-directed synthesis of multifunctional nanopatterns and nanomaterials |
EP2888367A4 (en) * | 2012-08-22 | 2016-04-20 | Mogam Biotech Res Inst | Screening and engineering method of super-stable immunoglobulin variable domains and their uses |
US9320792B2 (en) | 2002-11-08 | 2016-04-26 | Ablynx N.V. | Pulmonary administration of immunoglobulin single variable domains and constructs thereof |
US9371381B2 (en) | 2002-11-08 | 2016-06-21 | Ablynx, N.V. | Single domain antibodies directed against tumor necrosis factor-alpha and uses therefor |
US11891433B2 (en) | 2012-05-31 | 2024-02-06 | United States Of America As Represented By The Secretary Of The Air Force | Camelidae single-domain antibodies against Yersinia pestis and methods of use |
US12030930B2 (en) | 2021-01-05 | 2024-07-09 | United States Of America As Represented By The Secretary Of The Air Force | Camelidae single-domain antibodies against Yersinia pestis and methods of use |
Families Citing this family (262)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7842480B2 (en) * | 2001-05-18 | 2010-11-30 | Mayo Foundation For Medical Education And Research | Chimeric antigen-specific t cell-activating polypeptides |
US20060222656A1 (en) * | 2005-04-01 | 2006-10-05 | University Of Maryland, Baltimore | MAGE-A3/HPV 16 peptide vaccines for head and neck cancer |
US20050271663A1 (en) * | 2001-06-28 | 2005-12-08 | Domantis Limited | Compositions and methods for treating inflammatory disorders |
US20060002935A1 (en) * | 2002-06-28 | 2006-01-05 | Domantis Limited | Tumor Necrosis Factor Receptor 1 antagonists and methods of use therefor |
US9028822B2 (en) | 2002-06-28 | 2015-05-12 | Domantis Limited | Antagonists against TNFR1 and methods of use therefor |
EP2366718A3 (en) | 2002-06-28 | 2012-05-02 | Domantis Limited | Ligand |
US9321832B2 (en) | 2002-06-28 | 2016-04-26 | Domantis Limited | Ligand |
EP1558647B1 (en) * | 2002-11-08 | 2015-06-10 | Ablynx N.V. | Single domain antibodies directed against tumour necrosis factor-alpha and uses therefor |
US20060034833A1 (en) * | 2002-11-08 | 2006-02-16 | Els Beirnaert | Single domain antibodies directed against interferron-gamma and uses therefor |
US20060228355A1 (en) | 2003-11-07 | 2006-10-12 | Toon Laeremans | Camelidae single domain antibodies vhh directed against epidermal growth factor receptor and uses therefor |
US20100003253A1 (en) * | 2002-11-08 | 2010-01-07 | Ablynx N.V. | Single domain antibodies directed against epidermal growth factor receptor and uses therefor |
NZ576284A (en) * | 2003-01-10 | 2010-07-30 | Ablynx Nv | Therapeutic polypeptides, homologues thereof, fragments thereof and for use in modulating platelet-mediated aggregation |
CN1845938B (en) * | 2003-06-30 | 2010-05-26 | 杜门蒂斯有限公司 | Polypeptides |
US7235641B2 (en) | 2003-12-22 | 2007-06-26 | Micromet Ag | Bispecific antibodies |
EP2322554A1 (en) | 2004-06-30 | 2011-05-18 | Domantis Limited | Composition comprising an anti-TNF-alpha domain antibody for the treatment of rheumatoid arthritis |
GB2416768A (en) * | 2004-07-22 | 2006-02-08 | Univ Erasmus | Heavy chain immunoglobulin complexes |
MX2007000921A (en) * | 2004-07-22 | 2007-11-09 | Univ Erasmus Medical Ct | Binding molecules. |
US7563443B2 (en) | 2004-09-17 | 2009-07-21 | Domantis Limited | Monovalent anti-CD40L antibody polypeptides and compositions thereof |
CN101724071A (en) | 2004-10-08 | 2010-06-09 | 杜门蒂斯有限公司 | Single domain antibodies against TNFRl and methods of use therefor |
US8105592B2 (en) * | 2004-11-25 | 2012-01-31 | Vhsquared Limited | Heavy chain and single domain antibodies |
FR2879605B1 (en) * | 2004-12-16 | 2008-10-17 | Centre Nat Rech Scient Cnrse | PRODUCTION OF ANTIBODY FORMATS AND IMMUNOLOGICAL APPLICATIONS OF THESE FORMATS |
EP1790358A1 (en) * | 2005-11-23 | 2007-05-30 | Université de Reims Champagne-Ardennes | Protein constructs designed for targeting and lysis of cells |
US8703136B2 (en) | 2006-10-10 | 2014-04-22 | Regenesance B.V. | Complement inhibition for improved nerve regeneration |
GB0621513D0 (en) | 2006-10-30 | 2006-12-06 | Domantis Ltd | Novel polypeptides and uses thereof |
KR20090110295A (en) | 2006-11-22 | 2009-10-21 | 에드넥서스, 어 브리스톨-마이어스 스퀴브 알&디 컴파니 | Targeted therapeutics based on engineered proteins for tyrosine kinases receptors, including igf-ir |
AU2007336242B2 (en) | 2006-12-19 | 2012-08-30 | Ablynx N.V. | Amino acid sequences directed against GPCRs and polypeptides comprising the same for the treatment of GPCR-related diseases and disorders |
EP2102244A2 (en) | 2006-12-19 | 2009-09-23 | Ablynx N.V. | Amino acid sequences directed against a metalloproteinase from the adam family and polypeptides comprising the same for the treatment of adam-related diseases and disorders |
PL2308514T3 (en) | 2007-03-23 | 2013-11-29 | To Bbb Holding B V | Conjugates for targeted drug delivery across the blood-brain barrier |
BRPI0812398A2 (en) * | 2007-06-06 | 2019-09-24 | Domantis Ltd | anti-vegf immunoglobulin single variable domain, anti-vegf antagonist, protease resistant immunoglobulin simple variable domain, use of vegf antagonist, method for oral or drug delivery to a patient's gi tract or lung or lung tissue or a patient's eye, pulmonary dispensing device, oral formulation, double specific ligand, isolated or recombinant nucleic acid, vector, host cell, method for producing polypeptide, pharmaceutical composition, polypeptide, and fusion protein. |
CA2691940C (en) | 2007-07-03 | 2018-03-06 | Joost Alexander Kolkman | Methods for providing improved immunoglobulin sequences |
AU2008276787B2 (en) * | 2007-07-13 | 2013-06-06 | Bac Ip B.V. | Single-domain antigen-binding proteins that bind mammalian IgG |
CN104004088B (en) * | 2007-09-26 | 2017-11-07 | Ucb医药有限公司 | dual specificity antibody fusions |
US20110053865A1 (en) | 2007-11-27 | 2011-03-03 | Ablynx N.V. | Amino acid sequences directed against heterodimeric cytokines and/or their receptors and polypeptides comprising the same |
US20110091462A1 (en) | 2008-03-05 | 2011-04-21 | Ablynx N.V. | Novel antigen binding dimer-complexes, methods of making and uses thereof |
US9908943B2 (en) | 2008-04-03 | 2018-03-06 | Vib Vzw | Single domain antibodies capable of modulating BACE activity |
ES2447844T3 (en) | 2008-04-03 | 2014-03-13 | Vib Vzw | Individual domain antibodies capable of modulating BACE1 activity |
US8557965B2 (en) | 2008-04-07 | 2013-10-15 | Ablynx N.V. | Single variable domains against notch pathway members |
JP2011516603A (en) | 2008-04-17 | 2011-05-26 | アブリンクス エン.ヴェー. | Peptides capable of binding to serum proteins and compounds, constructs and polypeptides containing them |
RU2010151725A (en) | 2008-05-16 | 2012-06-27 | Аблинкс Нв (Be) | AMINO ACID SEQUENCES AIMED AGAINST CXCR4 AND OTHER GPCR, AND COMPOUNDS INCLUDING THEM |
WO2009147248A2 (en) | 2008-06-05 | 2009-12-10 | Ablynx N.V. | Amino acid sequences directed against envelope proteins of a virus and polypeptides comprising the same for the treatment of viral diseases |
US8444976B2 (en) | 2008-07-02 | 2013-05-21 | Argen-X B.V. | Antigen binding polypeptides |
SI2321352T1 (en) | 2008-07-18 | 2016-04-29 | Bristol-Myers Squibb Company | Compositions monovalent for cd28 binding and methods of use |
CA2731255C (en) * | 2008-07-21 | 2018-06-05 | David M. Goldenberg | Structural variants of antibodies for improved therapeutic characteristics |
MX2011004558A (en) | 2008-10-29 | 2011-06-01 | Wyeth Llc | Methods for purification of single domain antigen binding molecules. |
EP2362767B1 (en) | 2008-10-29 | 2017-12-06 | Ablynx N.V. | Formulations of single domain antigen binding molecules |
HUE042919T2 (en) | 2008-12-19 | 2019-07-29 | Ablynx Nv | Genetic immunization for producing immunoglobulins against cell-associated antigens such as p2x7, cxcr7 or cxcr4 |
WO2010100135A1 (en) | 2009-03-05 | 2010-09-10 | Ablynx N.V. | Novel antigen binding dimer-complexes, methods of making/avoiding and uses thereof |
GB0905023D0 (en) | 2009-03-24 | 2009-05-06 | Univ Erasmus Medical Ct | Binding molecules |
JP5501439B2 (en) | 2009-04-02 | 2014-05-21 | ロシュ グリクアート アクチェンゲゼルシャフト | Multispecific antibody comprising a full-length antibody and a single chain Fab fragment |
EP3828201A1 (en) | 2009-04-30 | 2021-06-02 | Ablynx N.V. | Method for the production of domain antibodies |
ES2804450T3 (en) | 2009-07-10 | 2021-02-08 | Ablynx Nv | Method for producing variable domains |
EP2473528B1 (en) | 2009-09-03 | 2014-12-03 | Ablynx N.V. | Stable formulations of polypeptides and uses thereof |
US20120302737A1 (en) | 2009-09-16 | 2012-11-29 | Genentech, Inc. | Coiled coil and/or tether containing protein complexes and uses thereof |
DK2491056T3 (en) | 2009-10-22 | 2021-10-25 | Univ Twente | VHH FOR USE IN TISSUE REPAIR, ORGAN REGENERATION, ORGAN REPLACEMENT AND TISSUE CONSTRUCTION |
US20120321640A1 (en) | 2009-12-01 | 2012-12-20 | Ablynx N.V. | Von willebrand factor specific binding agents and uses thereof |
CN102770456B (en) | 2009-12-04 | 2018-04-06 | 弗·哈夫曼-拉罗切有限公司 | Multi-specificity antibody, antibody analog, composition and method |
ES2595376T3 (en) | 2009-12-10 | 2016-12-29 | Regeneron Pharmaceuticals, Inc. | Mice that produce heavy chain antibodies |
ES2565208T3 (en) | 2009-12-11 | 2016-04-01 | F. Hoffmann-La Roche Ag | Anti-VEGF-C antibodies and methods of use thereof |
US8962807B2 (en) | 2009-12-14 | 2015-02-24 | Ablynx N.V. | Single variable domain antibodies against OX40L, constructs and therapeutic use |
DK2516465T3 (en) | 2009-12-23 | 2016-06-06 | Hoffmann La Roche | ANTI-BV8 ANTIBODIES AND APPLICATIONS THEREOF |
WO2011083141A2 (en) | 2010-01-08 | 2011-07-14 | Ablynx Nv | Method for generation of immunoglobulin sequences by using lipoprotein particles |
EP2531523A1 (en) | 2010-02-05 | 2012-12-12 | Ablynx N.V. | Peptides capable of binding to serum albumin and compounds, constructs and polypeptides comprising the same |
US9120855B2 (en) | 2010-02-10 | 2015-09-01 | Novartis Ag | Biologic compounds directed against death receptor 5 |
EP3501499B1 (en) | 2010-02-11 | 2022-09-07 | Ablynx NV | Methods and compositions for the preparation of aerosols |
TW201138821A (en) | 2010-03-26 | 2011-11-16 | Roche Glycart Ag | Bispecific antibodies |
US9556273B2 (en) | 2010-03-29 | 2017-01-31 | Vib Vzw | Anti-macrophage mannose receptor single variable domains for targeting and in vivo imaging of tumor-associated macrophages |
US9101674B2 (en) | 2010-03-29 | 2015-08-11 | Vib Vzw | Targeting and in vivo imaging of tumor-associated macrophages |
TWI586806B (en) | 2010-04-23 | 2017-06-11 | 建南德克公司 | Production of heteromultimeric proteins |
NZ603570A (en) | 2010-05-20 | 2014-12-24 | Ablynx Nv | Biological materials related to her3 |
GB201014715D0 (en) | 2010-09-06 | 2010-10-20 | Vib Vzw | Nanobodies stabilizing functional conformational states of GPCRS |
MX2013001267A (en) | 2010-08-13 | 2013-04-10 | Genentech Inc | Antibodies to il-1beta and il-18, for treatment of disease. |
CA2807278A1 (en) | 2010-08-24 | 2012-03-01 | F. Hoffmann - La Roche Ag | Bispecific antibodies comprising a disulfide stabilized - fv fragment |
US9380781B2 (en) | 2010-08-26 | 2016-07-05 | Agrosavfe N.V. | Compositions for seed treatment |
WO2012056000A1 (en) | 2010-10-29 | 2012-05-03 | Ablynx Nv | Method for the production of immunoglobulin single variable domains |
SG191153A1 (en) | 2010-12-23 | 2013-07-31 | Hoffmann La Roche | Polypeptide-polynucleotide-complex and its use in targeted effector moiety delivery |
US10689447B2 (en) | 2011-02-04 | 2020-06-23 | Genentech, Inc. | Fc variants and methods for their production |
AR085138A1 (en) | 2011-02-04 | 2013-09-11 | Genentech Inc | Fc VARIATIONS AND METHODS FOR PRODUCTION |
PT2691415T (en) | 2011-03-28 | 2018-10-19 | Ablynx Nv | Method for producing solid formulations comprising immunoglobulin single variable domains |
UA117218C2 (en) | 2011-05-05 | 2018-07-10 | Мерк Патент Гмбх | Amino acid sequences directed against il-17a, il-17f and/or il17-a/f and polypeptides comprising the same |
US9534039B2 (en) | 2011-05-09 | 2017-01-03 | Ablynx N.V. | Method for the production of immunoglobulin single variable domains |
CA2835340A1 (en) | 2011-05-27 | 2012-12-06 | Ablynx Nv | Inhibition of bone resorption with rankl binding peptides |
CN107857810A (en) | 2011-06-21 | 2018-03-30 | 非营利性组织佛兰芒综合大学生物技术研究所 | For GPCR:The binding structural domain of G-protein compound and the purposes from it |
CN104271598A (en) | 2011-06-23 | 2015-01-07 | 埃博灵克斯股份有限公司 | Immunoglobulin single variable domains directed against IgE |
WO2013041722A1 (en) | 2011-09-23 | 2013-03-28 | Ablynx Nv | Prolonged inhibition of interleukin-6 mediated signaling |
JP6216321B2 (en) | 2011-10-11 | 2017-10-18 | ジェネンテック, インコーポレイテッド | Improved construction of bispecific antibodies |
US20140301977A1 (en) | 2011-11-02 | 2014-10-09 | Genentech, Inc. | Overload and elute chromatography |
AU2012347972B2 (en) | 2011-12-05 | 2018-05-10 | X-Body, Inc. | PDGF receptor beta binding polypeptides |
EP2617732A1 (en) | 2012-01-19 | 2013-07-24 | Vib Vzw | Tools and methods for expression of membrane proteins |
CN104105711B (en) | 2012-02-10 | 2018-11-30 | 弗·哈夫曼-拉罗切有限公司 | Single-chain antibody and other heteromultimerics |
AU2013265665B2 (en) | 2012-05-24 | 2017-10-26 | Vib Vzw | Anti-macrophage mannose receptor single variable domains for targeting and in vivo imaging of tumor-associated macrophages |
CN104395339A (en) | 2012-06-27 | 2015-03-04 | 弗·哈夫曼-拉罗切有限公司 | Method for selection and production of tailor-made highly selective and multi-specific targeting entities containing at least two different binding entities and uses thereof |
CA2871882A1 (en) | 2012-06-27 | 2014-01-03 | F. Hoffmann-La Roche Ag | Method for making antibody fc-region conjugates comprising at least one binding entity that specifically binds to a target and uses thereof |
WO2014078729A1 (en) | 2012-11-15 | 2014-05-22 | Genentech, Inc. | IONIC STRENGTH-MEDIATED pH GRADIENT ION EXCHANGE CHROMATOGRAPHY |
WO2014087010A1 (en) | 2012-12-07 | 2014-06-12 | Ablynx N.V. | IMPROVED POLYPEPTIDES DIRECTED AGAINST IgE |
WO2014111550A1 (en) | 2013-01-17 | 2014-07-24 | Glaxosmithkline Intellectual Property Development Limited | Modified anti-serum albumin binding proteins |
CN112858672A (en) | 2013-01-30 | 2021-05-28 | 弗拉芒区生物技术研究所 | Novel chimeric polypeptides for screening and drug discovery purposes |
WO2014120916A1 (en) | 2013-02-01 | 2014-08-07 | Bristol-Myers Squibb Company | Pegylated domain antibodies monovalent for cd28 binding and methods of use |
ES2745772T3 (en) | 2013-02-05 | 2020-03-03 | Vib Vzw | Acetylcholine Muscarinic Receptor Binding Agents and Uses thereof |
WO2014141192A1 (en) | 2013-03-15 | 2014-09-18 | Erasmus University Medical Center | Generation of heavy chain-only antibodies |
US9617339B2 (en) | 2013-03-15 | 2017-04-11 | Vib Vzw | Method of imaging a cardiovascular disease with an anti-macrophage mannose receptor immunoglobulin single variable domain |
CN104109207B (en) * | 2013-04-17 | 2017-12-12 | 上海市肺科医院 | Nano antibody of the anti-Surfactant protein A of lung targeted characteristic and preparation method thereof |
PT2992100T (en) | 2013-04-29 | 2019-12-16 | Agrosavfe Nv | Agrochemical compositions comprising antibodies binding to sphingolipids |
NL1040254C2 (en) | 2013-05-17 | 2014-11-24 | Ablynx Nv | Stable formulations of immunoglobulin single variable domains and uses thereof. |
PL3019516T3 (en) | 2013-07-12 | 2019-04-30 | Hoffmann La Roche | Elucidation of ion exchange chromatography input optimization |
CA2922832A1 (en) | 2013-09-05 | 2015-03-12 | Genentech, Inc. | Method for chromatography reuse |
KR102373930B1 (en) | 2013-09-13 | 2022-03-11 | 제넨테크, 인크. | Methods and compositions comprising purified recombinant polypeptides |
JP6546178B2 (en) | 2013-09-13 | 2019-07-17 | ジェネンテック, インコーポレイテッド | Compositions and methods for detecting and quantifying host cell proteins and recombinant polypeptide products in cell lines |
EP2883883A1 (en) | 2013-12-16 | 2015-06-17 | Cardio3 Biosciences S.A. | Therapeutic targets and agents useful in treating ischemia reperfusion injury |
CA2936728C (en) | 2014-01-30 | 2023-06-20 | Vib Vzw | Opioid receptor binding agents and uses thereof |
KR20230164192A (en) | 2014-05-06 | 2023-12-01 | 제넨테크, 인크. | Production of heteromultimeric proteins using mammalian cells |
AU2015261536B2 (en) | 2014-05-16 | 2020-05-07 | Ablynx Nv | Improved immunoglobulin variable domains |
NL2013661B1 (en) | 2014-10-21 | 2016-10-05 | Ablynx Nv | KV1.3 Binding immunoglobulins. |
EP3194976B1 (en) | 2014-07-22 | 2020-04-01 | Vib Vzw | Methods to select agents that stabilize protein complexes |
WO2016016329A1 (en) | 2014-07-29 | 2016-02-04 | Vrije Universiteit Brussel | Radio-labelled antibody fragments for use in the prognosis, diagnosis of cancer as well as for the prediction of cancer therapy response |
CN106573983B (en) | 2014-07-29 | 2018-05-25 | 布鲁塞尔自由大学 | For the radiolabeled antibody fragment used in the prevention and/or treatment of cancer |
RU2609627C2 (en) * | 2014-09-26 | 2017-02-02 | Закрытое Акционерное Общество "Биокад" | High affinity and aggregationally stable antibodies based on vl variable domains and vhh derivative |
CA2966548A1 (en) | 2014-11-05 | 2016-05-12 | Agrosavfe Nv | Transgenic plant comprising a polynucleotide encoding a variable domain of heavy-chain antibody |
WO2016077369A1 (en) | 2014-11-10 | 2016-05-19 | Genentech, Inc. | Animal model for nephropathy and agents for treating the same |
ES2764111T3 (en) | 2014-12-03 | 2020-06-02 | Hoffmann La Roche | Multispecific antibodies |
AU2015366284B2 (en) | 2014-12-19 | 2021-07-22 | Ablynx N.V. | Cysteine linked nanobody dimers |
AU2016230018A1 (en) | 2015-03-06 | 2017-09-21 | Genentech, Inc. | Ultrapurified DsbA and DsbC and methods of making and using the same |
CN107709364A (en) | 2015-04-07 | 2018-02-16 | 豪夫迈·罗氏有限公司 | Antigen binding complex and application method with agonist activity |
JP7163028B2 (en) | 2015-05-13 | 2022-10-31 | アブリンクス エン.ヴェー. | T cell recruiting polypeptides based on CD3 reactivity |
AU2016259792B2 (en) | 2015-05-13 | 2019-07-25 | Ablynx N.V. | T cell recruiting polypeptides based on TCR alpha/beta reactivity |
ES2889906T3 (en) | 2015-05-21 | 2022-01-14 | Harpoon Therapeutics Inc | Trispecific binding proteins and medical uses |
SG10201911335TA (en) | 2015-05-28 | 2020-01-30 | Genentech Inc | Cell-based assay for detecting anti-cd3 homodimers |
US11298433B2 (en) | 2015-07-17 | 2022-04-12 | Vrije Universiteit Brussel | Radiolabelled antibody fragments for use in treating cancer |
CN105384825B (en) | 2015-08-11 | 2018-06-01 | 南京传奇生物科技有限公司 | A kind of bispecific chimeric antigen receptor and its application based on single domain antibody |
CN108473561B (en) | 2015-11-27 | 2022-12-16 | 埃博灵克斯股份有限公司 | Polypeptide inhibiting CD40L |
CN109073635A (en) | 2016-01-25 | 2018-12-21 | 豪夫迈·罗氏有限公司 | Method for measuring T cell dependence bispecific antibody |
EP3411397A1 (en) | 2016-02-05 | 2018-12-12 | Orionis Biosciences NV | Cd8 binding agents |
CA3016849A1 (en) | 2016-03-07 | 2017-09-14 | Vib Vzw | Cd20 binding single domain antibodies |
CA3017813C (en) | 2016-03-17 | 2021-12-07 | Oslo Universitetssykehus Hf | Fusion proteins targeting tumour associated macrophages for treating cancer |
WO2017182605A1 (en) | 2016-04-22 | 2017-10-26 | Université Libre de Bruxelles | A new biomarker expressed in pancreatic beta cells useful in imaging or targeting beta cells |
WO2017182603A1 (en) | 2016-04-22 | 2017-10-26 | Université Libre de Bruxelles | A new biomarker expressed in pancreatic beta cells useful in imaging or targeting beta cells |
US20190127447A1 (en) | 2016-05-02 | 2019-05-02 | Ablynx N.V. | Treatment of rsv infection |
US11753463B2 (en) | 2016-05-13 | 2023-09-12 | Orionis Biosciences BV | Therapeutic targeting of non-cellular structures |
KR20190007026A (en) | 2016-05-17 | 2019-01-21 | 제넨테크, 인크. | Substrate Gene Properties for Diagnosis and Use in Immunotherapy |
EA201892691A1 (en) | 2016-05-20 | 2019-04-30 | Харпун Терапьютикс, Инк. | SINGLE-DOMAIN PROTEIN, BINDING SERUM ALBUMIN |
CA3024683A1 (en) | 2016-05-20 | 2017-11-23 | Harpoon Therapeutics, Inc. | Single chain variable fragment cd3 binding proteins |
US11623958B2 (en) | 2016-05-20 | 2023-04-11 | Harpoon Therapeutics, Inc. | Single chain variable fragment CD3 binding proteins |
MX2018015173A (en) | 2016-06-17 | 2019-07-04 | Genentech Inc | Purification of multispecific antibodies. |
WO2018007442A1 (en) | 2016-07-06 | 2018-01-11 | Ablynx N.V. | Treatment of il-6r related diseases |
WO2018014260A1 (en) | 2016-07-20 | 2018-01-25 | Nanjing Legend Biotech Co., Ltd. | Multispecific antigen binding proteins and methods of use thereof |
US11046776B2 (en) | 2016-08-05 | 2021-06-29 | Genentech, Inc. | Multivalent and multiepitopic antibodies having agonistic activity and methods of use |
WO2018029182A1 (en) | 2016-08-08 | 2018-02-15 | Ablynx N.V. | Il-6r single variable domain antibodies for treatment of il-6r related diseases |
KR102617148B1 (en) | 2016-08-15 | 2023-12-26 | 제넨테크, 인크. | Chromatographic Method for Quantifying Nonionic Surfactants in Compositions Comprising Nonionic Surfactants and Polypeptides |
MX2019002256A (en) * | 2016-08-24 | 2019-10-09 | Teneobio Inc | Transgenic non-human animals producing modified heavy chain-only antibodies. |
WO2018050833A1 (en) | 2016-09-15 | 2018-03-22 | Ablynx Nv | Immunoglobulin single variable domains directed against macrophage migration inhibitory factor |
WO2018068201A1 (en) | 2016-10-11 | 2018-04-19 | Nanjing Legend Biotech Co., Ltd. | Single-domain antibodies and variants thereof against ctla-4 |
EP3541846A1 (en) | 2016-11-16 | 2019-09-25 | Ablynx NV | T cell recruiting polypeptides capable of binding cd123 and tcr alpha/beta |
EP3544997A4 (en) | 2016-11-23 | 2020-07-01 | Harpoon Therapeutics, Inc. | Prostate specific membrane antigen binding protein |
AU2017363302A1 (en) | 2016-11-23 | 2019-06-27 | Harpoon Therapeutics, Inc. | PSMA targeting trispecific proteins and methods of use |
WO2018099968A1 (en) | 2016-11-29 | 2018-06-07 | Ablynx N.V. | Treatment of infection by respiratory syncytial virus (rsv) |
KR20230061582A (en) | 2016-12-07 | 2023-05-08 | 아블린쓰 엔.브이. | Improved serum albumin binding immunoglobulin single variable domains |
KR20240013861A (en) | 2017-01-17 | 2024-01-30 | 아블린쓰 엔.브이. | Improved serum albumin binders |
AU2018209150A1 (en) | 2017-01-17 | 2019-07-25 | Ablynx Nv | Improved serum albumin binders |
US11384154B2 (en) | 2017-02-06 | 2022-07-12 | Orionis Biosciences BV | Targeted chimeric proteins and uses thereof |
EP3589725A1 (en) | 2017-02-28 | 2020-01-08 | Vib Vzw | Means and methods for oral protein delivery |
WO2018160754A2 (en) | 2017-02-28 | 2018-09-07 | Harpoon Therapeutics, Inc. | Inducible monovalent antigen binding protein |
CA3058290A1 (en) | 2017-04-18 | 2018-10-25 | Universite Libre De Bruxelles | Biomarkers and targets for proliferative diseases |
KR20200005635A (en) | 2017-05-11 | 2020-01-15 | 브이아이비 브이지더블유 | Glycosylation of Variable Immunoglobulin Domains |
CN110913908B (en) | 2017-05-12 | 2022-05-27 | 哈普恩治疗公司 | MSLN-targeting trispecific proteins and methods of use |
KR102376863B1 (en) | 2017-05-12 | 2022-03-21 | 하푼 테라퓨틱스, 인크. | mesothelin binding protein |
WO2018222587A1 (en) | 2017-05-30 | 2018-12-06 | The Regents Of The University Of California | NANOBODIES AGAINST CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE REGULATOR (CFTR) INHIBITORY FACTOR (Cif) |
MX2019014400A (en) | 2017-06-02 | 2020-02-10 | Merck Patent Gmbh | Adamts binding immunoglobulins. |
EP3630817A1 (en) | 2017-06-02 | 2020-04-08 | Merck Patent GmbH | Polypeptides binding adamts5, mmp13 and aggrecan |
EP3630818A1 (en) | 2017-06-02 | 2020-04-08 | Ablynx NV | Aggrecan binding immunoglobulins |
US20200190216A1 (en) | 2017-06-02 | 2020-06-18 | Merck Patent Gmbh | Mmp13 binding immunoglobulins |
WO2019000223A1 (en) | 2017-06-27 | 2019-01-03 | Nanjing Legend Biotech Co., Ltd. | Chimeric antibody immune effctor cell engagers and methods of use thereof |
JP7241731B2 (en) | 2017-07-19 | 2023-03-17 | フエー・イー・ベー・フエー・ゼツト・ウエー | serum albumin binder |
CR20200196A (en) | 2017-10-13 | 2020-06-05 | Harpoon Therapeutics Inc | Trispecific proteins and methods of use |
CN111465612A (en) | 2017-10-13 | 2020-07-28 | 哈普恩治疗公司 | B cell maturation antigen binding proteins |
CA3076791A1 (en) | 2017-10-31 | 2019-05-09 | Vib Vzw | Novel antigen-binding chimeric proteins and methods and uses thereof |
CA3082280A1 (en) | 2017-12-28 | 2019-07-04 | Nanjing Legend Biotech Co., Ltd. | Single-domain antibodies and variants thereof against tigit |
WO2019137541A1 (en) | 2018-01-15 | 2019-07-18 | Nanjing Legend Biotech Co., Ltd. | Single-domain antibodies and variants thereof against pd-1 |
EP3749295A4 (en) | 2018-02-05 | 2022-04-27 | Orionis Biosciences, Inc. | Fibroblast binding agents and use thereof |
WO2019155041A1 (en) | 2018-02-12 | 2019-08-15 | Vib Vzw | Gβγ COMPLEX ANTIBODIES AND USES THEREOF |
WO2019166622A1 (en) | 2018-03-01 | 2019-09-06 | Vrije Universiteit Brussel | Human pd-l1-binding immunoglobulins |
BR112020018908A2 (en) | 2018-03-23 | 2021-01-26 | Université Libre de Bruxelles | wnt signaling agonist molecules |
WO2019185723A1 (en) | 2018-03-27 | 2019-10-03 | Umc Utrecht Holding B.V. | Targeted thrombolysis for treatment of microvascular thrombosis |
CN111886254B (en) | 2018-03-30 | 2023-12-08 | 南京传奇生物科技有限公司 | Single domain antibodies against LAG-3 and uses thereof |
EP3805388A4 (en) | 2018-05-30 | 2021-08-18 | Cognano, Inc. | Method for obtaining antibody, method for identifying antibody, method for producing antibody, and antibody |
US10815311B2 (en) | 2018-09-25 | 2020-10-27 | Harpoon Therapeutics, Inc. | DLL3 binding proteins and methods of use |
JP2022528067A (en) | 2019-03-27 | 2022-06-08 | ユーエムシー ユトレヒト ホールディング ビー.ブイ. | Engineering engineered IgA antibody and usage |
JP2022528804A (en) | 2019-04-18 | 2022-06-15 | ジェネンテック, インコーポレイテッド | Antibody titer test |
AU2020266750A1 (en) | 2019-04-29 | 2021-11-25 | Confo Therapeutics N.V. | Screening methods and assays for use with transmembrane proteins, in particular with GPCRS |
US20220289837A1 (en) | 2019-04-30 | 2022-09-15 | Vib Vzw | Cystic Fibrosis Transmembrane Conductance Regulator Stabilizing Agents |
MX2021014007A (en) | 2019-05-14 | 2022-01-24 | Harpoon Therapeutics Inc | EpCAM BINDING PROTEINS AND METHODS OF USE. |
EP3976067A1 (en) | 2019-05-28 | 2022-04-06 | Vib Vzw | Cd8+ t-cells lacking plexins and their application in cancer treatment |
WO2020239945A1 (en) | 2019-05-28 | 2020-12-03 | Vib Vzw | Cancer treatment by targeting plexins in the immune compartment |
AR119264A1 (en) | 2019-06-05 | 2021-12-09 | Genentech Inc | METHOD FOR REUSE OF CHROMATOGRAPHY |
CN114466864A (en) | 2019-06-21 | 2022-05-10 | 索瑞索制药公司 | Polypeptides |
CN114514243A (en) | 2019-06-21 | 2022-05-17 | 索瑞索制药公司 | Polypeptides |
WO2021078786A1 (en) | 2019-10-21 | 2021-04-29 | Vib Vzw | Nanodisc-specific antigen-binding chimeric proteins |
CA3160506A1 (en) | 2019-11-11 | 2021-05-20 | Ibi-Ag Innovative Bio Insecticides Ltd. | Insect control nanobodies and uses thereof |
WO2021105438A1 (en) | 2019-11-27 | 2021-06-03 | Vib Vzw | Positive allosteric modulators of the calcium-sensing receptor |
GB201918279D0 (en) | 2019-12-12 | 2020-01-29 | Vib Vzw | Glycosylated single chain immunoglobulin domains |
CA3165429A1 (en) | 2019-12-20 | 2021-06-24 | Vib Vzw | Nanobody exchange chromatography |
WO2021140205A1 (en) | 2020-01-10 | 2021-07-15 | Confo Therapeutics N.V. | Methods for generating antibodies and antibody fragments and libraries comprising same |
WO2021156490A2 (en) | 2020-02-06 | 2021-08-12 | Vib Vzw | Corona virus binders |
MX2022010175A (en) | 2020-02-21 | 2022-09-12 | Harpoon Therapeutics Inc | Flt3 binding proteins and methods of use. |
WO2021170540A1 (en) | 2020-02-25 | 2021-09-02 | Vib Vzw | Leucine-rich repeat kinase 2 allosteric modulators |
US20230102101A1 (en) * | 2020-03-05 | 2023-03-30 | Merck Sharp & Dohme Llc | Human-like heavy chain antibody variable domain (vhh) display libraries |
WO2021198396A1 (en) | 2020-03-31 | 2021-10-07 | Biotalys NV | Anti-fungal polypeptides |
WO2021213435A1 (en) | 2020-04-22 | 2021-10-28 | 迈威(上海)生物科技股份有限公司 | Single variable domain antibody targeting human programmed death ligand 1 (pd-l1) and derivative thereof |
WO2021229104A1 (en) | 2020-05-15 | 2021-11-18 | Université de Liège | Anti-cd38 single-domain antibodies in disease monitoring and treatment |
KR20230025005A (en) | 2020-06-17 | 2023-02-21 | 얀센 바이오테크 인코포레이티드 | Materials and methods for producing pluripotent stem cells |
WO2022003156A1 (en) | 2020-07-02 | 2022-01-06 | Oncurious Nv | Ccr8 non-blocking binders |
IL300173A (en) | 2020-07-31 | 2023-03-01 | Biotalys NV | Expression host |
JP2023542079A (en) | 2020-09-21 | 2023-10-05 | ジェネンテック, インコーポレイテッド | Purification of multispecific antibodies |
WO2022063947A1 (en) | 2020-09-24 | 2022-03-31 | Vib Vzw | Combination of p2y6 inhibitors and immune checkpoint inhibitors |
WO2022063957A1 (en) | 2020-09-24 | 2022-03-31 | Vib Vzw | Biomarker for anti-tumor therapy |
CA3195687A1 (en) | 2020-09-25 | 2022-03-31 | Ablynx Nv | Polypeptides comprising immunoglobulin single variable domains targeting il-13 and ox40l |
US11926667B2 (en) | 2020-10-13 | 2024-03-12 | Janssen Biotech, Inc. | Bioengineered T cell mediated immunity, materials and other methods for modulating cluster of differentiation IV and/or VIII |
JP2024508207A (en) | 2020-12-02 | 2024-02-26 | ブイアイビー ブイゼットダブリュ | LTBR agonists in combination therapy against cancer |
WO2022117569A1 (en) | 2020-12-02 | 2022-06-09 | Oncurious Nv | A ccr8 antagonist antibody in combination with a lymphotoxin beta receptor agonist antibody in therapy against cancer |
KR20230123497A (en) | 2020-12-18 | 2023-08-23 | 아블린쓰 엔.브이. | Polypeptide comprising an immunoglobulin single variable domain targeting IL-6 and TNF-α |
GB202020502D0 (en) | 2020-12-23 | 2021-02-03 | Vib Vzw | Antibody composistion for treatment of corona virus infection |
WO2022136647A1 (en) | 2020-12-24 | 2022-06-30 | Oncurious Nv | Human ccr8 binders |
WO2022136649A1 (en) | 2020-12-24 | 2022-06-30 | Oncurious Nv | Non-blocking human ccr8 binders |
EP4267621A1 (en) | 2020-12-24 | 2023-11-01 | Vib Vzw | Murine cross-reactive human ccr8 binders |
WO2022157373A1 (en) | 2021-01-25 | 2022-07-28 | Vrije Universiteit Brussel | Compositions and kits for in vivo imaging of cardiac sarcoidosis |
WO2022156908A1 (en) | 2021-01-25 | 2022-07-28 | Vrije Universiteit Brussel | Method for preparing a lyophilized composition |
WO2022156907A1 (en) | 2021-01-25 | 2022-07-28 | Vrije Universiteit Brussel | Method and kit for labeling a biomolecule with one or more detectable labels, including a radiolabel |
CN117794566A (en) | 2021-02-05 | 2024-03-29 | Vib研究所 | Sha Bei viral binding agents |
US20240101647A1 (en) | 2021-02-05 | 2024-03-28 | Vib Vzw | Sarbecovirus binders |
US20240130999A1 (en) | 2021-02-17 | 2024-04-25 | Vib Vzw | Inhibition of SLC4A4 in the Treatment of Cancer |
KR20220118962A (en) | 2021-02-19 | 2022-08-26 | (주)샤페론 | Single domain antibodies against PD-L1 and use thereof |
EP4296282A1 (en) | 2021-02-19 | 2023-12-27 | SHAPERON Inc. | Single domain antibody against cd47 and use thereof |
KR20220118963A (en) | 2021-02-19 | 2022-08-26 | (주)샤페론 | Bispecific single domain antibodies against PD-L1 and CD47 and use thereof |
CA3211270A1 (en) | 2021-02-19 | 2022-08-25 | Vib Vzw | Cation-independent mannose-6-phosphate receptor binders |
IL305301A (en) | 2021-02-19 | 2023-10-01 | Us Health | SINGLE DOMAIN ANTIBODIES THAT NEUTRALIZE SARS-CoV-2 |
WO2022199804A1 (en) | 2021-03-24 | 2022-09-29 | Vib Vzw | Nek6 inhibition to treat als and ftd |
WO2022242892A1 (en) | 2021-05-17 | 2022-11-24 | Université de Liège | Anti-cd38 single-domain antibodies in disease monitoring and treatment |
WO2022269473A1 (en) | 2021-06-23 | 2022-12-29 | Janssen Biotech, Inc. | Materials and methods for hinge regions in functional exogenous receptors |
WO2022268993A1 (en) | 2021-06-23 | 2022-12-29 | Vib Vzw | Means and methods for selection of specific binders |
EP4365199A1 (en) | 2021-06-29 | 2024-05-08 | Shandong Simcere Biopharmaceutical Co., Ltd. | Cd16 antibody and use thereof |
EP4377352A2 (en) | 2021-07-30 | 2024-06-05 | Vib Vzw | Cation-independent mannose-6-phosphate receptor binders for targeted protein degradation |
CN117751143A (en) | 2021-07-30 | 2024-03-22 | 山东先声生物制药有限公司 | anti-PVRIG/anti-TIGIT bispecific antibodies and uses |
WO2023057508A1 (en) | 2021-10-05 | 2023-04-13 | Vrije Universiteit Brussel | Fluorescently labeled immunoglobulin single variable domai ns |
WO2023057601A1 (en) | 2021-10-06 | 2023-04-13 | Biotalys NV | Anti-fungal polypeptides |
WO2023098846A1 (en) | 2021-12-03 | 2023-06-08 | 江苏先声药业有限公司 | Anti-bcma nanobody and use thereof |
CU20210101A7 (en) | 2021-12-15 | 2023-07-12 | Ct Ingenieria Genetica Biotecnologia | POLYPEPTIDES THAT BIND PROANGIOGENIC GROWTH FACTORS |
WO2023111266A1 (en) | 2021-12-17 | 2023-06-22 | Ablynx Nv | POLYPEPTIDES COMPRISING IMMUNOGLOBULIN SINGLE VARIABLE DOMAINS TARGETING TCRαβ, CD33 AND CD123 |
WO2023135198A1 (en) | 2022-01-12 | 2023-07-20 | Vib Vzw | Human ntcp binders for therapeutic use and liver-specific targeted delivery |
WO2023148291A1 (en) | 2022-02-02 | 2023-08-10 | Biotalys NV | Methods for genome editing |
WO2023150735A2 (en) * | 2022-02-04 | 2023-08-10 | The Board Of Trustees Of The Leland Stanford Junior University | Surrogate cytokine polypeptides |
WO2023148397A1 (en) | 2022-02-07 | 2023-08-10 | Vib Vzw | Engineered stabilizing aglycosylated fc-regions |
US20230364020A1 (en) | 2022-04-01 | 2023-11-16 | Genentech, Inc. | Hydroxypropyl methyl cellulose derivatives to stabilize polypeptides |
WO2023198848A1 (en) | 2022-04-13 | 2023-10-19 | Vib Vzw | An ltbr agonist in combination therapy against cancer |
WO2023213751A1 (en) | 2022-05-02 | 2023-11-09 | Umc Utrecht Holding B.V | Single domain antibodies for the detection of plasmin-cleaved vwf |
WO2023222825A1 (en) | 2022-05-18 | 2023-11-23 | Vib Vzw | Sarbecovirus spike s2 subunit binders |
WO2024008755A1 (en) | 2022-07-04 | 2024-01-11 | Vib Vzw | Blood-cerebrospinal fluid barrier crossing antibodies |
WO2024018426A1 (en) | 2022-07-22 | 2024-01-25 | Janssen Biotech, Inc. | Enhanced transfer of genetic instructions to effector immune cells |
US20240132624A1 (en) | 2022-07-27 | 2024-04-25 | Ablynx N.V. | Polypeptides binding to a specific epitope of the neonatal fc receptor |
WO2024068744A1 (en) | 2022-09-27 | 2024-04-04 | Vib Vzw | Antivirals against human parainfluenza virus |
EP4349374A1 (en) | 2022-10-05 | 2024-04-10 | Vrije Universiteit Brussel | Anti-urokinase plasminogen activator receptor immunoglobulin single variable domains |
WO2024083843A1 (en) | 2022-10-18 | 2024-04-25 | Confo Therapeutics N.V. | Amino acid sequences directed against the melanocortin 4 receptor and polypeptides comprising the same for the treatment of mc4r-related diseases and disorders |
WO2024105091A1 (en) | 2022-11-15 | 2024-05-23 | Imec Vzw | Method and system for droplet manipulation |
WO2024108178A1 (en) | 2022-11-18 | 2024-05-23 | Genentech, Inc. | Signal amplification and multiplexing using mass tags for ia-lc-ms/ms based assays |
WO2024126805A1 (en) | 2022-12-15 | 2024-06-20 | Aarhus Universitet | Synthetic activation of multimeric transmembrane receptors |
Citations (18)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5530101A (en) * | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
US20020001587A1 (en) * | 2000-03-16 | 2002-01-03 | Sharon Erickson | Methods of treatment using anti-ErbB antibody-maytansinoid conjugates |
US20020165387A1 (en) * | 1996-10-31 | 2002-11-07 | Kerr Anderson W. H. | High affinity humanized anti-CEA monoclonal antibodies |
US20030129659A1 (en) * | 2001-12-03 | 2003-07-10 | Whelihan E. Fayelle | Library screening |
US6670453B2 (en) * | 1997-10-27 | 2003-12-30 | Unilever Patent Holdings B.V. | Multivalent antigen-binding proteins |
US20040071705A1 (en) * | 2002-06-21 | 2004-04-15 | Dyax Corporation | Serum protein-associated target-specific ligands and identification method therefor |
US20060034845A1 (en) * | 2002-11-08 | 2006-02-16 | Karen Silence | Single domain antibodies directed against tumor necrosis factor alpha and uses therefor |
US20060106203A1 (en) * | 2002-06-28 | 2006-05-18 | Domantis Limited | Ligand |
US7084257B2 (en) * | 2001-10-05 | 2006-08-01 | Amgen Inc. | Fully human antibody Fab fragments with human interferon-gamma neutralizing activity |
US20060228355A1 (en) * | 2003-11-07 | 2006-10-12 | Toon Laeremans | Camelidae single domain antibodies vhh directed against epidermal growth factor receptor and uses therefor |
US20070031424A1 (en) * | 2001-10-24 | 2007-02-08 | Vlaams Interuniversitair Instituut Voor Biotechnogie Vzw | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
US20070178082A1 (en) * | 2002-11-08 | 2007-08-02 | Ablynx N.V. | Stabilized single domain antibodies |
US20070269422A1 (en) * | 2006-05-17 | 2007-11-22 | Ablynx N.V. | Serum albumin binding proteins with long half-lives |
US20070268422A1 (en) * | 2006-05-18 | 2007-11-22 | Lg.Philips Lcd Co., Ltd. | Array substrate for liquid crystal display device and method of fabricating the same |
US20080008713A1 (en) * | 2002-06-28 | 2008-01-10 | Domantis Limited | Single domain antibodies against tnfr1 and methods of use therefor |
US7368111B2 (en) * | 1995-10-06 | 2008-05-06 | Cambridge Antibody Technology Limited | Human antibodies specific for TGFβ2 |
US20090028880A1 (en) * | 2005-05-18 | 2009-01-29 | Ablynx Nv | Serum albumin binding proteins |
US20100297111A1 (en) * | 2005-05-21 | 2010-11-25 | Els Anna Alice Beirnaert | Nanobodies against tumor necrosis factor-alpha |
Family Cites Families (38)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
DE321017C (en) * | 1917-05-15 | 1920-05-11 | Aloysius Petrus Van Leuven | |
SE307996B (en) | 1965-11-30 | 1969-01-27 | Asea Ab | |
JPS62175426A (en) | 1986-01-27 | 1987-08-01 | Kazufumi Shimizu | Antibody and spraying agent containing said substance as active component |
GB9016299D0 (en) * | 1990-07-25 | 1990-09-12 | Brien Caroline J O | Binding substances |
JP3356800B2 (en) | 1992-07-31 | 2002-12-16 | 株式会社川本製作所 | Control method of automatic water supply device |
DE69330523T4 (en) | 1992-08-21 | 2012-08-23 | Vrije Universiteit Brussel | IMMUNOGLOBULINE WITHOUT LIGHT CHAINS |
EP0584421A1 (en) | 1992-08-21 | 1994-03-02 | Cécile Casterman | Immunoglobulins devoid of light chains |
JP3720353B2 (en) * | 1992-12-04 | 2005-11-24 | メディカル リサーチ カウンシル | Multivalent and multispecific binding proteins, their production and use |
US6838254B1 (en) * | 1993-04-29 | 2005-01-04 | Conopco, Inc. | Production of antibodies or (functionalized) fragments thereof derived from heavy chain immunoglobulins of camelidae |
EP0698097B1 (en) | 1993-04-29 | 2001-08-16 | Unilever N.V. | Production of antibodies or (functionalized) fragments thereof derived from heavy chain immunoglobulins of camelidae |
AU7477394A (en) * | 1993-07-30 | 1995-03-27 | University Of Medicine And Dentistry Of New Jersey | Efficient gene transfer into primary lymphocytes |
US6262238B1 (en) * | 1997-01-14 | 2001-07-17 | Roche Diagnostic, Gmbh | Process for modifying the stability of antibodies |
GB9722131D0 (en) | 1997-10-20 | 1997-12-17 | Medical Res Council | Method |
WO1999037681A2 (en) | 1998-01-26 | 1999-07-29 | Unilever Plc | Method for producing antibody fragments |
JP2003525016A (en) * | 1998-02-19 | 2003-08-26 | エクサイト セラピーズ, インコーポレイテッド | Compositions and methods for modulating lymphocyte activation |
EP1105535A1 (en) | 1998-08-13 | 2001-06-13 | U.S. Genomics | Optically characterizing polymers |
CA2375033A1 (en) * | 1999-05-27 | 2000-12-07 | Max-Delbruck-Centrum Fur Molekulare Medizin | Vaccines against conformation-dependent antigens and against antigens that are not or are not only proteins or peptides |
PT1233987E (en) * | 1999-11-29 | 2009-12-28 | Bac Ip B V | Immobilized single domain antigen-binding molecules |
CA2921260A1 (en) * | 1999-12-24 | 2001-06-28 | Genentech, Inc. | Methods and compositions for prolonging elimination half-times of bioactive compounds |
US7229619B1 (en) * | 2000-11-28 | 2007-06-12 | Medimmune, Inc. | Methods of administering/dosing anti-RSV antibodies for prophylaxis and treatment |
AU2001268855A1 (en) | 2000-05-26 | 2001-12-03 | National Research Council Of Canada | Single-domain antigen-binding antibody fragments derived from llama antibodies |
AU2002229639A1 (en) * | 2000-12-13 | 2002-06-24 | De Haard, Johannes Joseph Wilhelmus | Camelidae antibody arrays |
AU2002319402B2 (en) * | 2001-06-28 | 2008-09-11 | Domantis Limited | Dual-specific ligand and its use |
US20050271663A1 (en) * | 2001-06-28 | 2005-12-08 | Domantis Limited | Compositions and methods for treating inflammatory disorders |
US20100081792A1 (en) * | 2001-06-28 | 2010-04-01 | Smithkline Beecham Corporation | Ligand |
US7365167B2 (en) * | 2001-11-26 | 2008-04-29 | Cell Matrix, Inc. | Humanized collagen antibodies and related methods |
US7393648B2 (en) * | 2001-12-03 | 2008-07-01 | Alexion Pharmaceuticals, Inc. | Hybrid antibodies |
AU2002351896A1 (en) | 2001-12-11 | 2003-06-23 | Ablynx N.V. | Method for displaying loops from immunoglobulin domains in different contexts |
US20060002935A1 (en) | 2002-06-28 | 2006-01-05 | Domantis Limited | Tumor Necrosis Factor Receptor 1 antagonists and methods of use therefor |
CA2505316C (en) | 2002-11-08 | 2014-08-05 | Ablynx N.V. | Single domain antibodies directed against tumour necrosis factor-alpha and uses therefor |
CN1845938B (en) * | 2003-06-30 | 2010-05-26 | 杜门蒂斯有限公司 | Polypeptides |
US7432238B2 (en) | 2004-04-16 | 2008-10-07 | Stc.Unm | Human Kunitz-type inhibitor with enhanced antifibrinolytic activity |
GB0521621D0 (en) | 2005-10-24 | 2005-11-30 | Domantis Ltd | Tumor necrosis factor receptor 1 antagonists for treating respiratory diseases |
EP2769990A3 (en) * | 2004-12-02 | 2015-02-25 | Domantis Limited | Bispecific domain antibodies targeting serum albumin and GLP-1 or PYY |
GB0724331D0 (en) | 2007-12-13 | 2008-01-23 | Domantis Ltd | Compositions for pulmonary delivery |
MX2009013137A (en) | 2007-06-06 | 2010-04-30 | Domantis Ltd | Methods for selecting protease resistant polypeptides. |
BRPI0812398A2 (en) | 2007-06-06 | 2019-09-24 | Domantis Ltd | anti-vegf immunoglobulin single variable domain, anti-vegf antagonist, protease resistant immunoglobulin simple variable domain, use of vegf antagonist, method for oral or drug delivery to a patient's gi tract or lung or lung tissue or a patient's eye, pulmonary dispensing device, oral formulation, double specific ligand, isolated or recombinant nucleic acid, vector, host cell, method for producing polypeptide, pharmaceutical composition, polypeptide, and fusion protein. |
US20110053865A1 (en) | 2007-11-27 | 2011-03-03 | Ablynx N.V. | Amino acid sequences directed against heterodimeric cytokines and/or their receptors and polypeptides comprising the same |
-
2002
- 2002-01-11 JP JP2002004184A patent/JP2005289809A/en active Pending
- 2002-07-12 EP EP06006277A patent/EP1693384A3/en not_active Withdrawn
- 2002-07-12 EP EP02772097A patent/EP1438338A2/en not_active Ceased
- 2002-07-12 CA CA2464372A patent/CA2464372C/en not_active Expired - Lifetime
- 2002-07-12 US US10/492,668 patent/US20050054001A1/en not_active Abandoned
- 2002-07-12 WO PCT/EP2002/007804 patent/WO2003035694A2/en active Application Filing
- 2002-07-12 AU AU2002336927A patent/AU2002336927B2/en not_active Expired
- 2002-07-12 JP JP2003538207A patent/JP2005520494A/en active Pending
-
2006
- 2006-06-23 US US11/474,521 patent/US8097251B2/en not_active Expired - Fee Related
-
2009
- 2009-07-07 US US12/498,835 patent/US9156905B2/en not_active Expired - Fee Related
-
2011
- 2011-04-01 US US13/078,438 patent/US20110251373A1/en not_active Abandoned
- 2011-08-12 US US13/208,667 patent/US20120172578A1/en not_active Abandoned
-
2015
- 2015-07-24 US US14/807,951 patent/US20160052999A1/en not_active Abandoned
Patent Citations (22)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5530101A (en) * | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
US7368111B2 (en) * | 1995-10-06 | 2008-05-06 | Cambridge Antibody Technology Limited | Human antibodies specific for TGFβ2 |
US20020165387A1 (en) * | 1996-10-31 | 2002-11-07 | Kerr Anderson W. H. | High affinity humanized anti-CEA monoclonal antibodies |
US6670453B2 (en) * | 1997-10-27 | 2003-12-30 | Unilever Patent Holdings B.V. | Multivalent antigen-binding proteins |
US20020001587A1 (en) * | 2000-03-16 | 2002-01-03 | Sharon Erickson | Methods of treatment using anti-ErbB antibody-maytansinoid conjugates |
US7084257B2 (en) * | 2001-10-05 | 2006-08-01 | Amgen Inc. | Fully human antibody Fab fragments with human interferon-gamma neutralizing activity |
US20070031424A1 (en) * | 2001-10-24 | 2007-02-08 | Vlaams Interuniversitair Instituut Voor Biotechnogie Vzw | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
US20100047241A1 (en) * | 2001-10-24 | 2010-02-25 | Vlaams Interuniversitair Instituut Voor Biotechnologies Vzw | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
US20030129659A1 (en) * | 2001-12-03 | 2003-07-10 | Whelihan E. Fayelle | Library screening |
US20040071705A1 (en) * | 2002-06-21 | 2004-04-15 | Dyax Corporation | Serum protein-associated target-specific ligands and identification method therefor |
US20080008713A1 (en) * | 2002-06-28 | 2008-01-10 | Domantis Limited | Single domain antibodies against tnfr1 and methods of use therefor |
US20060106203A1 (en) * | 2002-06-28 | 2006-05-18 | Domantis Limited | Ligand |
US20070077249A1 (en) * | 2002-11-08 | 2007-04-05 | Ablynx N.V. | Single domain antibodies directed against tumour necrosis factor-alpha and uses therefor |
US20070178082A1 (en) * | 2002-11-08 | 2007-08-02 | Ablynx N.V. | Stabilized single domain antibodies |
US20070237769A1 (en) * | 2002-11-08 | 2007-10-11 | Ablynx N.V. | Single domain antibodies directed against tumour necrosis factor-alpha and uses therefor |
US20090022721A1 (en) * | 2002-11-08 | 2009-01-22 | Ablynx N.V. | Single domain antibodies directed against tumour necrosis factor-alpha and uses therefor |
US20060034845A1 (en) * | 2002-11-08 | 2006-02-16 | Karen Silence | Single domain antibodies directed against tumor necrosis factor alpha and uses therefor |
US20060228355A1 (en) * | 2003-11-07 | 2006-10-12 | Toon Laeremans | Camelidae single domain antibodies vhh directed against epidermal growth factor receptor and uses therefor |
US20090028880A1 (en) * | 2005-05-18 | 2009-01-29 | Ablynx Nv | Serum albumin binding proteins |
US20100297111A1 (en) * | 2005-05-21 | 2010-11-25 | Els Anna Alice Beirnaert | Nanobodies against tumor necrosis factor-alpha |
US20070269422A1 (en) * | 2006-05-17 | 2007-11-22 | Ablynx N.V. | Serum albumin binding proteins with long half-lives |
US20070268422A1 (en) * | 2006-05-18 | 2007-11-22 | Lg.Philips Lcd Co., Ltd. | Array substrate for liquid crystal display device and method of fabricating the same |
Cited By (35)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20070031424A1 (en) * | 2001-10-24 | 2007-02-08 | Vlaams Interuniversitair Instituut Voor Biotechnogie Vzw | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
US9156905B2 (en) * | 2001-10-24 | 2015-10-13 | Vib Vzw | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
US20100047241A1 (en) * | 2001-10-24 | 2010-02-25 | Vlaams Interuniversitair Instituut Voor Biotechnologies Vzw | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
US8097251B2 (en) | 2001-10-24 | 2012-01-17 | Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof |
US20050048060A1 (en) * | 2002-01-03 | 2005-03-03 | Hilde Revets | Immunoconjugates |
US20070031430A1 (en) * | 2002-01-03 | 2007-02-08 | Vlaams Interuniversitair Instituut | Immunoconjugates |
US9320792B2 (en) | 2002-11-08 | 2016-04-26 | Ablynx N.V. | Pulmonary administration of immunoglobulin single variable domains and constructs thereof |
US20100021459A1 (en) * | 2002-11-08 | 2010-01-28 | Ablynx N.V. | Polypeptide constructs for intracellular delivery |
US9243065B2 (en) * | 2002-11-08 | 2016-01-26 | Ablynx N.V. | Polypeptide constructs including VHH directed against EGFR for intracellular delivery |
US9725522B2 (en) | 2002-11-08 | 2017-08-08 | Ablynx N.V. | Pulmonary administration of immunoglobulin single variable domains and constructs thereof |
US9371381B2 (en) | 2002-11-08 | 2016-06-21 | Ablynx, N.V. | Single domain antibodies directed against tumor necrosis factor-alpha and uses therefor |
US10112989B2 (en) | 2003-01-10 | 2018-10-30 | Ablynx, N.V. | Polypeptides and polypeptide constructs comprising single domain antibodies directed against von Willebrand factor |
US9028816B2 (en) | 2003-01-10 | 2015-05-12 | Ablynx N.V. | Polypeptides and polypeptide constructs comprising single domain antibodies directed against von Willebrand factor |
US11034755B2 (en) | 2003-01-10 | 2021-06-15 | Ablynx N.V. | Polypeptides and polypeptide constructs comprising single domain antibodies directed against von willebrand factor |
US20060149041A1 (en) * | 2003-01-10 | 2006-07-06 | Ablynx N.V. | Therapeutic polypeptides, homologues thereof, fragments thereof and for use in modulating platelet-mediated aggregation |
US8188223B2 (en) | 2005-05-18 | 2012-05-29 | Ablynx N.V. | Serum albumin binding proteins |
US11472871B2 (en) | 2005-05-18 | 2022-10-18 | Ablynx N.V. | Nanobodies against tumor necrosis factor-alpha |
US9067991B2 (en) | 2005-05-18 | 2015-06-30 | Ablynx N.V. | Nanobodies against tumor necrosis factor-alpha |
US8372398B2 (en) * | 2005-05-20 | 2013-02-12 | Ablynx N.V. | Single domain VHH antibodies against Von Willebrand Factor |
US20100330084A1 (en) * | 2005-05-20 | 2010-12-30 | Ablynx N.V. | Single domain vhh antibodies against von willebrand factor |
US20100297111A1 (en) * | 2005-05-21 | 2010-11-25 | Els Anna Alice Beirnaert | Nanobodies against tumor necrosis factor-alpha |
US8703131B2 (en) | 2005-05-21 | 2014-04-22 | Ablynx N.V. | Nanobodies against tumor necrosis factor-alpha |
US20100226920A1 (en) * | 2006-03-27 | 2010-09-09 | Ablynx N.V. | Medical delivery device for therapeutic proteins based on single domain antibodies |
US20070269422A1 (en) * | 2006-05-17 | 2007-11-22 | Ablynx N.V. | Serum albumin binding proteins with long half-lives |
US20110158996A1 (en) * | 2008-03-21 | 2011-06-30 | Ablynx N.V. | Von willebrand factor specific binders and methods of use therefor |
WO2011098518A2 (en) | 2010-02-11 | 2011-08-18 | Ablynx Nv | Delivery of immunoglobulin variable domains and constructs thereof |
WO2011161263A1 (en) | 2010-06-25 | 2011-12-29 | Ablynx Nv | Pharmaceutical compositions for cutaneous administration |
WO2012166906A1 (en) | 2011-05-31 | 2012-12-06 | Massachusetts Institute Of Technology | Cell-directed synthesis of multifunctional nanopatterns and nanomaterials |
US11891433B2 (en) | 2012-05-31 | 2024-02-06 | United States Of America As Represented By The Secretary Of The Air Force | Camelidae single-domain antibodies against Yersinia pestis and methods of use |
US11987618B2 (en) | 2012-05-31 | 2024-05-21 | The Government Of The United States Of America As Represented By The Secretary Of The Air Force | Camelidae single-domain antibodies against Yersinia pestis and methods of use |
US10078085B2 (en) | 2012-08-22 | 2018-09-18 | Mogam Biothechnology Institute | Screening and engineering method of super-stable immunoglobulin variable domains and their uses |
EP2888367A4 (en) * | 2012-08-22 | 2016-04-20 | Mogam Biotech Res Inst | Screening and engineering method of super-stable immunoglobulin variable domains and their uses |
US12030930B2 (en) | 2021-01-05 | 2024-07-09 | United States Of America As Represented By The Secretary Of The Air Force | Camelidae single-domain antibodies against Yersinia pestis and methods of use |
US12030931B2 (en) | 2021-01-05 | 2024-07-09 | United States Of America As Represented By The Secretary Of The Air Force | Camelidae single-domain antibodies against Yersinia pestis and methods of use |
US12030932B2 (en) | 2021-01-05 | 2024-07-09 | United States Of America As Represented By The Secretary Of The Air Force | Camelidae single-domain antibodies against Yersinia pestis and methods of use |
Also Published As
Publication number | Publication date |
---|---|
US20160052999A1 (en) | 2016-02-25 |
US20100047241A1 (en) | 2010-02-25 |
WO2003035694A3 (en) | 2003-10-02 |
US9156905B2 (en) | 2015-10-13 |
US8097251B2 (en) | 2012-01-17 |
CA2464372C (en) | 2013-09-03 |
JP2005289809A (en) | 2005-10-20 |
EP1438338A2 (en) | 2004-07-21 |
CA2464372A1 (en) | 2003-05-01 |
US20110251373A1 (en) | 2011-10-13 |
JP2005520494A (en) | 2005-07-14 |
EP1693384A2 (en) | 2006-08-23 |
WO2003035694A2 (en) | 2003-05-01 |
US20120172578A1 (en) | 2012-07-05 |
US20070031424A1 (en) | 2007-02-08 |
EP1693384A3 (en) | 2006-11-08 |
AU2002336927B2 (en) | 2007-05-17 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US9156905B2 (en) | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof | |
AU2002336927A1 (en) | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof | |
Riechmann et al. | Single domain antibodies: comparison of camel VH and camelised human VH domains | |
Muyldermans et al. | Unique single‐domain antigen binding fragments derived from naturally occurring camel heavy‐chain antibodies | |
EP2390268B1 (en) | Single domain antibodies directed against tumour necrosis factor-alpha and uses therefor | |
US9371381B2 (en) | Single domain antibodies directed against tumor necrosis factor-alpha and uses therefor | |
Nguyen et al. | Functional heavy-chain antibodies in Camelidae | |
Davies et al. | Single antibody domains as small recognition units: design and in vitro antigen selection of camelized, human VH domains with improved protein stability | |
Nuttall et al. | Immunoglobulin VH Domains and Beyond Design and Selection of Single-Domain Binding and Targeting Reagents | |
Alvarez-Rueda et al. | Generation of llama single-domain antibodies against methotrexate, a prototypical hapten | |
EP1558646A2 (en) | Single domain antibodies directed against interferon- gamma and uses thereof | |
Saerens et al. | Parallel selection of multiple anti-infectome Nanobodies without access to purified antigens | |
US20060034833A1 (en) | Single domain antibodies directed against interferron-gamma and uses therefor | |
WO2001030393A2 (en) | Methods for reducing the effects of cancers that express a33 antigen using a33 antigen specific immunoglobulin products | |
AU2006201330B2 (en) | Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof | |
Olsen et al. | Minimal structural elements of an inhibitory anti-ATF1/CREB single-chain antibody fragment (scFv41. 4) | |
Serge et al. | Advantages of Single-Domain Antigen-Binding Fragments Derived from Functional Camel Heavy-Chain Antibodied: Camel Single-domain Antibodies |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: VLAAMS INTERUNIVERSITAIR VOOR BIOTECHNOLOGIE VZW, Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:MUYLDERMANS, SERGE;REEL/FRAME:015214/0202 Effective date: 20040614 |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |