US20030194784A1 - DNA encoding methymycin and pikromycin - Google Patents

DNA encoding methymycin and pikromycin Download PDF

Info

Publication number
US20030194784A1
US20030194784A1 US10/271,889 US27188902A US2003194784A1 US 20030194784 A1 US20030194784 A1 US 20030194784A1 US 27188902 A US27188902 A US 27188902A US 2003194784 A1 US2003194784 A1 US 2003194784A1
Authority
US
United States
Prior art keywords
dna
seq
synthase
gene
nucleic acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US10/271,889
Inventor
David Sherman
Hung-Wen Liu
Yongquan Xue
Lishan Zhao
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Minnesota System
Original Assignee
Individual
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from US09/836,821 external-priority patent/US20030087405A1/en
Application filed by Individual filed Critical Individual
Priority to US10/271,889 priority Critical patent/US20030194784A1/en
Assigned to REGENTS OF THE UNIVERSITY OF MINNESOTA reassignment REGENTS OF THE UNIVERSITY OF MINNESOTA ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: XUE, YONGQUAN, LIU, HUNG-WEN, SHERMAN, DAVID H., ZHAO, LISHAN
Publication of US20030194784A1 publication Critical patent/US20030194784A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P7/00Preparation of oxygen-containing organic compounds
    • C12P7/40Preparation of oxygen-containing organic compounds containing a carboxyl group including Peroxycarboxylic acids
    • C12P7/42Hydroxy-carboxylic acids
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/52Genes encoding for enzymes or proenzymes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P19/00Preparation of compounds containing saccharide radicals
    • C12P19/44Preparation of O-glycosides, e.g. glucosides
    • C12P19/60Preparation of O-glycosides, e.g. glucosides having an oxygen of the saccharide radical directly bound to a non-saccharide heterocyclic ring or a condensed ring system containing a non-saccharide heterocyclic ring, e.g. coumermycin, novobiocin
    • C12P19/62Preparation of O-glycosides, e.g. glucosides having an oxygen of the saccharide radical directly bound to a non-saccharide heterocyclic ring or a condensed ring system containing a non-saccharide heterocyclic ring, e.g. coumermycin, novobiocin the hetero ring having eight or more ring members and only oxygen as ring hetero atoms, e.g. erythromycin, spiramycin, nystatin

Definitions

  • PHAs Polyhydroxyalkanoates
  • the first identified member of the PHAs thermoplastics was polyhydroxybutyrate (PHB), the polymeric ester of D( ⁇ )-3-hydroxybutyrate.
  • PHB polyhydroxybutyrate
  • the biosynthetic pathway of PHB in the gram negative bacterium Alcaligenes eutrophus is depicted in FIG. 1.
  • PHAs related to PHB differ in the structure of the pendant arm, R (FIG. 2). For example, R ⁇ CH 3 in PHB, while R ⁇ CH 2 CH 3 in polyhydroxyvalerate, and R ⁇ (CH 2 ) 4 CH 3 in polyhydroxyoctanoate.
  • PHB represents the archetypical form of a biodegradable thermoplastic
  • its physical properties preclude significant use of the homopolymer form.
  • Pure PHB is highly crystalline and, thus, very brittle.
  • unique physical properties resulting form the structural characteristics of the R groups in a PHA copolymer may result in a polymer with more desirable characteristics. These characteristics include altered crystallinity, UV weathering resistance, glass to rubber transition temperature (T g ), melting temperature of the crystalline phase, rigidity and durability (Holmes et al., EPO 00052 459; Anderson et al., Microbiol. Rev ., 54, 450 (1990)).
  • these polyesters behave as thermoplastics, with melting temperatures of 50-180° C., which can be processed by conventional extension and molding equipment.
  • PKS polyketide synthase
  • PHAs are biodegradable polymers that have the versatility to replace petrochemical-based thermoplastics, it is desirable that new, more economical methods be provided for the production of defined PHAs. Thus, what is needed are methods to produce recombinant PHA monomer synthases for the generation of PHA polymers.
  • the present invention provides a method of preparing a polyhydroxyalkanoate synthase.
  • the method comprises introducing an expression cassette into a non-plant eukaryotic cell.
  • the expression cassette comprises a DNA molecule encoding a polyhydroxyalkanoate synthase, e.g., a polyhydroxybutyrate synthase, operably linked to a promoter functional in the non-plant eukaryotic cell.
  • the DNA molecule may be obtained from a bacterium such as Alcaligenes eutrophus .
  • the DNA molecule encoding the polyhydroxyalkanoate synthase is then expressed in the cell.
  • another embodiment of the invention provides a purified recombinant polyhydroxybutyrate synthase isolated from a host cell which expresses the synthase.
  • Another embodiment of the invention is a method of preparing a polyhydroxyalkanoate polymer.
  • the method comprises introducing a first expression cassette and a second expression cassette into a eukaryotic cell.
  • the first expression cassette comprises a DNA segment encoding a fatty acid synthase in which the dehydrase activity has been inactivated that is operably linked to a promoter functional in the eukaryotic cell, e.g., an insect cell.
  • the inactivation preferably is via a mutation in the catalytic site of the dehydrase.
  • the second expression cassette comprises a DNA segment encoding a polyhydroxyalkanoate synthase operably linked to a promoter functional in the eukaryotic cell.
  • the expression cassettes may be on the same or separate molecules.
  • the DNA segments in the expression cassettes are expressed in the cell so as to yield a polyhydroxyalkanoate polymer.
  • Another embodiment of the invention is a baculovirus expression cassette comprising a nucleic acid molecule encoding a polyhydroxyalkanoate synthase operably linked to a promoter functional in an insect cell.
  • the nucleic acid molecule is obtained from a bacterium, e.g., Alcaligenes eutrophus.
  • the present invention also provides an expression cassette comprising a nucleic acid molecule encoding a polyhydroxyalkanoate monomer synthase operably linked to a promoter functional in a host cell.
  • the nucleic acid molecule comprises a plurality of DNA segments.
  • the nucleic acid molecule comprises at least a first and a second DNA segment.
  • No more than one DNA segment is derived from the eryA gene cluster of Saccharopolyspora erythraea .
  • the first DNA segment encodes a first module and the second DNA segment encodes a second module, wherein the DNA segments together encode a polyhydroxyalkanoate monomer synthase.
  • the source of at least one DNA segment is preferably bacterial DNA.
  • the first DNA segment encodes the first module form the vep gene cluster and the second DNA segment encodes module 7 from the tyl P gene cluster.
  • the nucleic acid molecule may optionally further comprise a third DNA segment encoding a polyhydroxyalkanoate synthase.
  • a second nucleic acid molecule encoding a polyhydroxyalkanoate synthase may be introduced into the host cell.
  • the DNA molecule comprises a plurality of DNA segments.
  • the DNA molecule comprises at least a first and a second DNA segment.
  • the first DNA segment encodes a first module and the second DNA segment encodes a second module.
  • No more than one DNA segment is derived from the eryA gene cluster of Saccharopolyspora erythraea .
  • no more than one module is derived from the gene cluster from Streptomyces hygroscopicus that encodes rapamycin or the gene cluster that encodes spiramycin. Together the DNA segments encode a recombinant polyhydroxyalkanoate monomer synthase.
  • a preferred embodiment of the invention employs a first DNA segment derived from the vep gene cluster of Streptomyces. Another preferred embodiment of the invention employs a second DNA segment derived from the tyl gene cluster of Streptomyces.
  • a further preferred embodiment of the isolated DNA molecule of the invention includes a DNA segment encoding a polyhydroxyalkanoate synthase.
  • Yet another preferred embodiment is an isolated DNA molecule of the invention wherein the second DNA segment comprises a DNA encoding a thioesterase which is located at the 3′ end of the second DNA segment. More preferably, the second DNA segment comprises a DNA encoding an acyl carrier protein which is located 5′ to the DNA encoding the thioesterase. Even more preferably, the second DNA segment comprises a DNA encoding a linker region, wherein the DNA encoding the linker region is located between the DNA encoding the acyl carrier protein and the DNA encoding the thioesterase.
  • Another embodiment of the isolated DNA molecule of the invention comprises a first DNA segment comprising DNA encoding two acyl transferases, wherein the DNA encoding the first acyl transferase is 5′ to the DNA encoding the second acyl transferase.
  • the second acyl transferase adds acyl groups to malonylCoA.
  • inventions of the isolated DNA molecule include a first DNA segment comprising a DNA encoding a dehydrase, a first DNA segment comprising a DNA encoding a dehydrase and an enoyl reductase, a second DNA segment comprising a DNA encoding an inactive dehydrase, or a first DNA segment comprising a DNA encoding an acyl transferase.
  • a preferred acyl transferase binds an acyl CoA substrate.
  • a further embodiment of the isolated DNA molecule includes a first DNA segment encoding a first module and a second DNA segment encoding a second module, wherein the DNA segments together encode a recombinant polyhydroxyalkanoate monomer synthase, and wherein no more than one DNA segment is derived from the eryA gene cluster of Saccharopolyspora erythraea . Also preferably, at least one DNA segment is derived from the vep gene cluster or the tyl gene cluster. In one preferred embodiment, the first DNA segment encodes the first module from the vep gene cluster and the second DNA segment encodes module 7 from the tyl gene cluster.
  • Yet another embodiment of the invention is a method of providing a polyhydroxyalkanoate monomer.
  • the method comprises introducing a DNA molecule into a host cell.
  • the DNA molecule comprises a DNA segment encoding a recombinant polyhydroxyalkanoate monomer synthase operably linked to a promoter functional in the host cell.
  • the DNA encoding the recombinant polyhydroxyalkanoate monomer synthase, which synthase comprises at least a first module and a second module, is expressed in the host cell so as to generate a polyhydroxyalkanoate monomer.
  • the first DNA segment encodes the first module from the vep gene cluster and the second DNA segment encodes module 7 from the tyl P gene cluster.
  • the DNA molecule further comprises a DNA segment encoding a polyhydroxyalkanoate synthase.
  • the method comprises introducing a first DNA molecule and a second DNA molecule into a host cell.
  • the first DNA molecule comprises a DNA segment encoding a recombinant polyhydroxyalkanoate monomer synthase.
  • the recombinant polyhydroxyalkanoate monomer synthase comprises a plurality of modules.
  • the monomer synthase comprises at least a first module and a second module.
  • the first DNA molecule is operably linked to a promoter functional in a host cell.
  • the second DNA molecule comprises a DNA segment encoding a polyhydroxyalkanoate synthase operably linked to a promoter functional in the host cell.
  • the DNAs encoding the recombinant polyhydroxyalkanoate monomer synthase and polyhydroxyalkanoate synthase are expressed in the host cell so as to generate a polyhydroxyalkanoate polymer.
  • the DNA molecule comprises a plurality of DNA segments. That is, the DNA molecule comprises at least a first and a second DNA segment.
  • the first DNA segment encodes a fatty acid synthase and the second DNA segment encodes a module of a polyketide synthase.
  • a preferred embodiment of the invention employs a second DNA segment encoding a module which comprises a ⁇ -ketoacyl synthase amino-terminal to an acyltransferase which is amino-terminal to a ketoreductase which is amino-terminal to an acyl carrier protein which is amino-terminal to a thioesterase.
  • Other preferred embodiments of the invention include a second DNA segment that is 3′ to the DNA encoding the fatty acid synthase, a first DNA segment encoding a fatty acid synthase and a second DNA segment encoding a module of a polyketide synthase, or a second DNA segment that is separated from the first DNA segment by a DNA encoding a linker region.
  • Preferred linker regions include the linker region from tyl ORF1 ACP 1 -KS 2 , tyl ORF1 ACP 2 -KS 3 , tyl ORF3 ACP 5 -KS 6 , eryA ORF1 ACP 1 -KS 1 , eryA ORF1 ACP 2 -KS 2 , eryA ORF2 ACP 3 -KS 4 , and eryA ORF2 ACP 5 -KS 6 .
  • the invention also provides a method of preparing a polyhydroxyalkanoate monomer.
  • the method comprises introducing a DNA molecule comprising a plurality of DNA segments into a host cell, e.g., an insect cell, a Streptomyces cell or a Pseudomonas cell.
  • the DNA molecule comprises at least a first and a second DNA segment.
  • the first DNA segment encodes a fatty acid synthase operably linked to a promoter functional in the host cell.
  • the fatty acid synthase is eukaryotic in origin.
  • the fatty acid synthase is prokaryotic in origin.
  • the second DNA segment encodes a polyketide synthase.
  • the second DNA segment encodes the tyl module F.
  • the second DNA segment is located 3′ to the first DNA segment.
  • the first DNA segment is linked to the second DNA segment so that the encoded protein is expressed as a fusion protein.
  • the DNA molecule is then expressed in the host cell so as to generate a polyhydroxyalkanoate monomer.
  • Another embodiment of the invention is an expression cassette comprising a DNA molecule comprising a DNA segment encoding a fatty acid synthase and a polyhydroxyalkanoate synthase.
  • the method comprises introducing an expression cassette into a host cell.
  • the expression cassette comprises a DNA molecule encoding a polyhydroxyalkanoate monomer synthase operably linked to a promoter functional in the host cell.
  • the monomer synthase comprises a plurality of modules.
  • the monomer synthase comprises at least a first and second module which together encode the monomer synthase.
  • the expression cassette further comprises a second DNA molecule encoding a polyhydroxyalkanoate synthase.
  • a further embodiment of the invention is an isolated and purified DNA molecule comprising a DNA segment which encodes a Streptomyces venezuelae polyketide synthase, e.g., a polyhydroxyalkanoate monomer synthase, a biologically active variant or subunit (fragment) thereof.
  • the DNA segment encodes a polypeptide having an amino acid sequence comprising SEQ ID NO:45.
  • the DNA segment comprises SEQ ID NO:44.
  • the DNA molecules of the invention are double stranded or single stranded.
  • a preferred embodiment of the invention is a DNA molecule that has at least about 70%, more preferably at least about 80%, and even more preferably at least about 90%, but less than 100%, contiguous sequence identity to the DNA segment comprising SEQ ID NO:44, e.g., a “variant” DNA molecule.
  • a variant DNA molecule of the invention can be prepared by methods well known to the art, including oligonucleotide-mediated mutagenesis. See Adelman et al., DNA , 2, 183 (1983) and Sambrook et al., Molecular Cloning: A Laboratory Manual (1989).
  • the invention also provides an isolated, purified polyhydroxyalkanoate monomer synthase, e.g., a polypeptide having an amino acid sequence comprising SEQ ID NO:45, a biologically active subunit, or a biologically active variant thereof.
  • a variant polypeptide having at least about 80%, more preferably at least about 90%, and even more preferably at least about 95%, but less than 100%, contiguous amino acid sequence identity to the polypeptide having an amino acid sequence comprising SEQ ID NO:45.
  • a preferred variant polypeptide, or a subunit of a polypeptide, of the invention includes a variant or subunit polypeptide having at least about 10%, more preferably at least about 50%, and even more preferably at least about 90%, the activity of the polypeptide having the amino acid sequence comprising SEQ ID NO:45.
  • a variant polypeptide of the invention has one or more conservative amino acid substitutions relative to the polypeptide having the amino acid sequence comprising SEQ ID NO:45.
  • conservative substitutions include aspartic-glutamic as acidic amino acids; lysine/arginine/histidine as basic amino acids; leucine/isoleucine, methionine/valine, alanine/valine as hydrophobic amino acids; serine/glycine/alanine/threonine as hydrophilic amino acids.
  • the biological activity of a polypeptide of the invention can be measured by methods well known to the art, including but not limited to, methods described hereinbelow.
  • the invention also provides an isolated and purified nucleic acid segment comprising a nucleic acid sequence comprising a sugar (desosamine) biosynthetic gene cluster, a biologically active variant or fragment thereof, wherein the nucleic acid sequence is not derived from the eryC gene cluster of Saccharopolyspora erythraea .
  • the desosamine biosynthetic gene cluster from Streptomycyes venezuelae was isolated, cloned and sequenced.
  • the isolated nucleic acid segment comprising the gene cluster preferably includes a nucleic acid sequence comprising SEQ ID NO:3, or a fragment or variant thereof.
  • the cluster was found to encode nine polypeptides including DesI (e.g., SEQ ID NO:51 encoded by SEQ ID NO:50), DesII (e.g., SEQ ID NO:53 encoded by SEQ ID NO:52), DesIII (e.g., SEQ ID NO:55 encoded by SEQ ID NO:54), DesIV (e.g., SEQ ID NO:14 encoded by SEQ ID NO:13), DesV (e.g., SEQ ID NO:16 encoded by SEQ ID NO:15), DesVI (e.g., SEQ ID NO:18 encoded by SEQ ID NO:17), DesVII (e.g., SEQ ID NO:20 encoded by SEQ ID NO:19), DesVIII (e.g., SEQ ID NO:22 encoded by SEQ ID NO:21), and DesR (e.g., SEQ ID NO:24 encoded by SEQ ID NO:23) (see FIG. 24). It is also preferred that the nucleic acid segment of the invention en
  • the invention also provides a variant polypeptide having at least about 80%, more preferably at least about 90%, and even more preferably at least about 95%, but less than 100%, contiguous amino acid sequence identity to the polypeptide having an amino acid sequence comprising SEQ ID NO:51, SEQ ID NO:53, SEQ ID NO:55, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:22, SEQ ID NO:24, or a fragment thereof.
  • a preferred variant polypeptide, or a subunit or fragment of a polypeptide, of the invention includes a variant or subunit polypeptide having at least about 1%, more preferably at least about 10%, and even more preferably at least about 50%, the activity of the polypeptide having the amino acid sequence comprising SEQ ID NO:51, SEQ ID NO:53, SEQ ID NO:55, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:22, or SEQ ID NO:24.
  • glycosyltransferase activity of a polypeptide of SEQ ID NO:20 can be compared to a variant of SEQ ID NO:20 having at least one amino acid substitution, insertion, or deletion relative to SEQ ID NO:20.
  • a variant nucleic acid sequence of the invention has at least about 80%, more preferably at least about 90%, and even more preferably at least about 95%, but less than 100%, contiguous nucleic acid sequence identity to a nucleic acid sequence comprising SEQ ID NO:46, SEQ ID NO:50, SEQ ID NO:52, SEQ ID NO:54, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:23, or a fragment thereof.
  • an expression cassette comprising a nucleic acid sequence comprising a desosamine biosynthetic gene cluster, a biologically active variant or fragment thereof operably linked to a promoter functional in a host cell, as well as host cells comprising an expression cassette of the invention.
  • the expression cassettes of the invention are useful to express individual genes within the cluster, e.g., the desR gene which encodes a glycosidase or the desVII gene which encodes a glycosyltransferase having relaxed substrate specificity for polyketides and deoxysugars, i.e., the glycosyltransferase processes sugar substrates other than TDP-desosamine.
  • the desVII gene can be employed in combinatorial biology approaches to synthesize a library of macrolide compounds having various polyketide and deoxysugar structures.
  • the expression of a glycosylase in a host cell which synthesizes a macrolide antibiotic may be useful in a method to reduce toxicity of, e.g., inactivate, the antibiotic.
  • a host cell which produces the antibiotic is transformed with an expression cassette encoding the glycosyltransferase.
  • the recombinant glycosyltransferase is expressed in an amount that reversibly inactivates the antibiotic.
  • the antibiotic preferably the isolated antibiotic which is recovered from the host cell, is contacted with an appropriate native or recombinant glycosidase.
  • the nucleic acid segment encoding desosamine in the expression cassette of the invention is not derived form the eryC gene cluster of Saccharopolyspora erythraea .
  • Preferred host cells are prokaryotic cells, although eukaryotic host cells are also envisioned. These host cells are useful to express desosamine, analogs or derivatives thereof.
  • an expression cassette or host cell comprising antisense sequences from at least a portion of the desosamine biosynthetic gene cluster.
  • Another embodiment of the invention is a recombinant host cell, e.g., a bacterial cell, in which a portion of a nucleic acid sequence encoding desosamine in the host chromosome is disrupted, e.g., deleted or interrupted (e.g., by an insertion) with heterologous sequences, or substituted with a variant nucleic acid sequence of the invention, preferably so as to result in a decrease or lack of desosamine synthesis, and/or so as to result in the synthesis of an analog or derivative of desosamine.
  • the nucleic acid sequence which is disrupted is not derived from the eryC gene cluster of Saccharopolyspora erythraea .
  • the recombinant host cell of the invention has at least one gene, i.e., desI, desII, desIII, desIV, desV, desVI, desVII, desVIII or desR, which is disrupted.
  • One embodiment of the invention includes a recombinant host cell in which the desVI gene, which encodes an N-methyltransferase, is disrupted, for example, by replacement with an antibiotic resistance gene.
  • such a host cell produces an aglycone having an N-acetylated aminodeoxy sugar, 10-deoxy-methylonide, a compound of formula (7), a compound of formula (8), or a combination thereof.
  • the deletion or disruption of the desVI gene may be useful in a method for preparing novel sugars.
  • Another preferred embodiment of the invention is a recombinant bacterial host cell in which the desR gene, which encodes a glycosidase such as ⁇ -glucosidase, is disrupted.
  • the host cell synthesizes C-2′ ⁇ -glucosylated macrolide antibiotics, for example, a compound of formula (13), a compound of formula (14), or a combination thereof. Therefore, the invention further provides a compound of formula (8), (9), (13) or (14).
  • each atom of the compounds of the invention having a chiral center may exist in and be isolated in optically active and racemic forms. Some compounds may exhibit polymorphism.
  • the present invention encompasses any racemic, optically active, polymorphic or stereoisomeric form, or mixtures thereof, of a compound of the invention, which possess the useful properties described herein, it being well known in the art how to prepare optically active forms (for example, by resolution of the racemic form by recrystallization techniques, by synthesis from optically active starting materials, by chiral synthesis, or by chromatographic separation using a chiral stationary phase) and how to determine activity using the standard tests described herein, or using other similar tests which are well known in the art.
  • nucleic acid segment comprising a nucleic acid sequence comprising a macrolide biosynthetic gene cluster (the “met/pik” or “pik” gene cluster) encoding methymycin, pikomycin, neomethymycin, narbomycin, or a combination thereof, or a biologically active variant or fragment thereof. It is preferred that the nucleic acid segment comprises SEQ ID NO:5, or a fragment or variant thereof.
  • the isolated and purified nucleic acid segment is from Streptomyces sp., such as Streptomyces venezuelae (e.g., ATCC 15439, MCRL 0306, SC 2366 or 3629), Streptomyces narbonensis, Streptomyces eurocidicus, Streptomyces zaomyceticus (MCRL 0405), Streptomyces flavochromogens , Streptomyces sp. AM400, and Streptomyces felleus , although isolated and purified nucleic acid from other organisms which produce methymycin, narbomycin, neomethymycin and/or pikomycin are also within the scope of the invention.
  • Streptomyces sp. such as Streptomyces venezuelae (e.g., ATCC 15439, MCRL 0306, SC 2366 or 3629), Streptomyces narbonensis, Streptomyces
  • the cloned genes can be introduced into an expression system and genetically manipulated so as to yield novel macrolide antibiotics, e.g., ketolides, as well as monomers for polyhydroxyalkanoate (PHA) biopolymers.
  • the nucleic acid sequence encodes PikR1 (e.g., SEQ ID NO:27 encoded by SEQ ID NO:26), PikR2 (e.g., SEQ ID NO:29 encoded by SEQ ID NO:28), PikAI (e.g., SEQ ID NO:31 encoded by SEQ ID NO:30), PikAII (e.g., SEQ ID NO:33 encoded by SEQ ID NO:32), PikAIII (e.g., SEQ ID NO:35 encoded by SEQ ID NO:34), PikAIV (e.g., SEQ ID NO:37 encoded by SEQ ID NO:36), PikB (which is the desosamine gene cluster described above), PikC (e.g., SEQ ID
  • the invention also provides a variant polypeptide having at least about 80%, more preferably at least about 90%, and even more preferably at least about 95%, but less than 100%, contiguous amino acid sequence identity to the polypeptide having an amino acid sequence comprising SEQ ID NO:27, SEQ ID NO:29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO:37, SEQ ID NO:39, SEQ ID NO:41, or a fragment thereof.
  • a preferred variant polypeptide, or a subunit of a polypeptide, of the invention includes a variant or subunit polypeptide having at least about 1%, more preferably at least about 10%, and even more preferably at least about 50%, the activity of the polypeptide having the amino acid sequence comprising SEQ ID NO:27, SEQ ID NO:29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO:37, SEQ ID NO:39, or SEQ ID NO:41.
  • the activities of polypeptides of the macrolide biosynthetic pathway of the invention are described below.
  • a variant nucleic acid sequence of the pik biosynthetic gene cluster of the invention has at least about 80%, more preferably at least about 90%, and even more preferably at least about 95%, but less than 100%, contiguous nucleic acid sequence identity to a nucleic acid sequence comprising SEQ ID NO:48, SEQ ID NO:26, SEQ ID NO:28, SEQ ID NO:30, SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:38, SEQ ID NO:40, or a fragment thereof.
  • the pikA gene encodes a polyketide synthase which synthesizes macrolactone 10-deoxymethonolide and narbolide
  • pikB encodes desosamine synthases which catalyze the formation and transfer of a deoxysugar moiety onto aglycones
  • the pikC gene encodes a P450 hydoxylase which catalyzes the conversion of YC-17 and narbomycin into methymycin, neomethymycin, and pikromycin
  • the pikR1, pikR2 (possibly one for a 12-membered ring and the other for a 14-membered ring) and desR genes which encode enzymes associated with bacterial self-protection.
  • the isolated nucleic acid molecule of the invention encodes four active macrolide antibiotics two of which have a 12-membered ring while the other two have a 14-membered ring.
  • the regulation of the synthesis of 12- or 14-membered rings may be the result of the sequences in the spacer region between modules 5 and 6, as discussed below.
  • the genetic mechanism underlying the alternative termination of polyketide synthesis may be useful to prepare novel antibiotics and PHA monomers.
  • the invention further provides isolated and purified nucleic acid segments, e.g., in the form of an expression cassette, for each of the individual genes in the macrolide biosynthetic gene cluster.
  • the invention provides an isolated and purified pikAV gene that encodes a thioesterase II.
  • the thioesterase is useful to enhance the structural diversity of antibiotics and in PHA production, as the thioesterase modulates chain release and cyclization.
  • a thioesterase II gene having acyl-ACP coenzyme A transferase activity e.g., a mutant pik TEII, bacterial, fungal or plant medium-chain-length thioesterase, an animal fatty acid thioesterase or a thioesterase from a polyketide synthase
  • a recombinant monomer synthase see FIG. 36
  • PHA synthase e.g., phaC1
  • a fusion of a portion of PKS gene cluster with a PHA synthase may result in the transfer of an acyl chain from the PHA to the polymerase.
  • pikC gene that encodes a hydroxylase which is active at two positions on a 12-membered ring or at one position on a 14-membered ring. Such a gene may be particularly useful to prepare novel compounds through bioconversion or biotransformation.
  • the invention also provides an expression cassette comprising a nucleic acid segment comprising a macrolide biosynthetic gene cluster encoding methymycin, pikomycin, neomethymycin, narbomycin, or a combination thereof, or a biologically active variant or fragment thereof, operably linked to a promoter functional in a host cell. Further provided is a host cell comprising the nucleic acid segment encoding methymycin, pikomycin, neomethymycin, narbomycin, or a combination thereof, or a biologically active variant or fragment thereof. Moreover, the invention provides isolated and purified polypeptides of the invention, preferably obtained from host cells having the nucleic acid molecules of the invention. In addition, expression cassettes and host cells comprising antisense sequences of at least a portion of the macrolide biosynthetic gene cluster of the invention are envisioned.
  • Yet another embodiment of the invention is a recombinant host cell, e.g., a bacterial cell, in which a portion of the macrolide biosynthetic gene cluster of the invention is disrupted or replaced with a heterologous sequence or a variant nucleic acid segment of the invention, preferably so as to result in a decrease or lack of methymycin, pikomycin, neomethymycin, narbomycin, or a combination thereof, and/or so as to result in the synthesis of novel macrolides.
  • a recombinant host cell e.g., a bacterial cell, in which a portion of the macrolide biosynthetic gene cluster of the invention is disrupted or replaced with a heterologous sequence or a variant nucleic acid segment of the invention, preferably so as to result in a decrease or lack of methymycin, pikomycin, neomethymycin, narbomycin, or a combination thereof, and/or so as
  • the invention provides a recombinant host cell in which a pikAI gene, a pikAII gene, a pikAIII gene (12-membered rings), a pikIV gene (14-membered rings), a pikB gene cluster, a pikAV gene, a pikC gene, a pikD gene, a pikR1 gene, a pikR2 gene, or a combination thereof, is disrupted or replaced.
  • a preferred embodiment of the invention is a host cell wherein the pikB (e.g., the desVI and desV genes), pikA1, pikAV or pikC gene, is disrupted.
  • nucleic acid segment comprising the macrolide biosynthetic gene cluster of the invention encodes a polyketide synthase
  • modules of that synthase are useful in methods to prepare recombinant polyhydroxyalkanoate monomer synthases and polymers in addition to macrolide antibiotics and derivatives thereof.
  • the invention provides an isolated and purified DNA molecule comprising a first DNA segment encoding a first module and a second DNA segment encoding a second module, wherein the DNA segments together encode a recombinant polyhydroxyalkanoate monomer synthase, and wherein at least one DNA segment is derived from the pikA gene cluster of Streptomyces venezuelae .
  • no more than one DNA segment is derived from the eryA gene cluster of Saccharopolyspora erythraea .
  • the 3′ most DNA segment of the isolated DNA molecule of the invention encodes a thioesterase II.
  • an expression cassette comprising a nucleic acid molecule encoding the polyhydroxyalkanoate monomer synthase operably linked to a promoter functional in a host cell.
  • Yet another embodiment of the invention is a method of providing a polyhydroxyalkanoate monomer.
  • the method comprises introducing into a host cell a DNA molecule comprising a DNA segment encoding a recombinant polyhydroxyalkanoate monomer synthase operably linked to a promoter functional in the host cell.
  • the recombinant polyhydroxyalkanoate monomer synthase comprises a first module and a second module, wherein at least one DNA segment is derived from the pikA gene cluster of Streptomyces venezuelae .
  • the DNA encoding the recombinant polyhydroxyalkanoate monomer synthase is then expressed in the host cell so as to generate a polyhydroxyalkanoate monomer.
  • a a second DNA molecule may be introduced into the host cell.
  • the second DNA molecule comprises a DNA segment encoding a polyhydroxyalkanoate synthase operably linked to a promoter functional in the host cell.
  • the two DNA molecules are expressed in the host cell so as to generate a polyhydroxyalkanoate polymer.
  • Another embodiment of the invention is an isolated and purified DNA molecule comprising a first DNA segment encoding a fatty acid synthase and a second DNA segment encoding a module from the pikA gene cluster of Streptomyces venezuelae .
  • a DNA molecule can be employed in a method of providing a polyhydroxyalkanoate monomer.
  • a DNA molecule comprising a first DNA segment encoding a fatty acid synthase and a second DNA segment encoding a polyketide synthase is introduced into a host cell.
  • the first DNA segment is 5′ to the second DNA segment and the first DNA segment is operably linked to a promoter functional in the host cell.
  • the first DNA segment is linked to the second DNA segment so that the linked DNA segments express a fusion protein.
  • the DNA molecule is expressed in the host cell so as to generate a polyhydroxyalkanoate monomer.
  • the method comprises introducing an expression cassette comprising a DNA molecule encoding a polyhydroxyalkanoate synthase operably linked to a promoter functional in a host cell.
  • the DNA molecule comprises a first DNA segment encoding a first module and a second DNA segment encoding a second module wherein the DNA segments together encode a polyhydroxyalkanoate monomer synthase.
  • At least one DNA segment is derived from the pikA gene cluster of Streptomyces venezuelae .
  • the DNA molecule is expressed in the host cell.
  • the DNA molecule further comprises a DNA segment encoding a polyhydroxyalkanoate synthase.
  • a second, separate DNA molecule encoding a polyhydroxyalkanoate synthase is introduced into the host cell.
  • a method for directing the biosynthesis of specific glycosylation-modified polyketides by genetic manipulation of a polyketide-producing microorganism comprises introducing into a polyketide-producing microorganism a DNA sequence encoding enzymes in desosamine biosynthesis, e.g., a DNA sequence comprising SEQ ID NO:46, a variant or fragment thereof, so as to yield a microorganism that produces specific glycosylation-modified polyketides.
  • an anti-sense DNA sequence of the invention may be employed.
  • the glycosylation-modified polyketides are isolated from the microorganism. It is preferred that the DNA sequence is modified so as to result in the inactivation of at least one enzymatic activity in sugar biosynthesis or in the attachment of the sugar to a polyketide.
  • modules encoded by the nucleic acid segments of the invention may be employed in the methods described hereinabove to prepare polyhydroxyalkanoates of varied chain length or having various side chain substitutions and/or to prepare glycosylated biopolymers.
  • the compounds produced by the recombinant host cells of the invention are useful as biopolymers, e.g., in packaging or biomedical applications, or to engineer PHA monomer synthases; pharmaceuticals such as chemotherapeutic agents, immunosuppressants, agents to treat asthma, chronic obstructive pulmonary disease as well as other diseases involving respiratory inflammation, cholesterol-lowering agents, or macrolide-based antibiotics which are active against a variety of organisms, e.g., bacteria, including multi-drug-resistant pneumococci and other respiratory pathogens, as well as viral and parasitic pathogens; or as crop protection agents (e.g., fungicides or insecticides) via expression of polyketides in plants.
  • Methods employing these compounds e.g., to treat a mammal, bird or fish in need of such therapy, such as a patient having a bacterial infection, are also envisioned.
  • a “linker region” is an amino acid sequence present in a multifunctional protein which is less well conserved in an amino acid sequence than an amino acid sequence with catalytic activity.
  • an “extender unit” catalytic or enzymatic domain is an acyl transferase in a module that catalyzes chain elongation by adding 2-4 carbon units to an acyl chain and is located carboxy-terminal to another acyl transferase.
  • an extender unit with methylmalonylCoA specificity adds acyl groups to a methylmalonylCoA molecule.
  • a “polyhydroxyalkanoate” or “PHA” polymer includes, but is not limited to, linked units of related, preferably heterologous, hydroxyalkanoates such as 3-hydroxybutyrate, 3-hydroxyvalerate, 3-hydroxycaproate, 3-hydroxyheptanoate, 3-hydroxyhexanoate, 3-hydroxyoctanoate, 3-hydroxyundecanoate, and 3-hydroxydodecanoate, and their 4-hydroxy and 5-hydroxy counterparts.
  • a “Type I polyketide synthase” is a single polypeptide with a single set of iteratively used active sites. This is in contrast to a Type II polyketide synthase which employs active sites on a series of polypeptides.
  • a “recombinant” nucleic acid or protein molecule is a molecule where the nucleic acid molecule which encodes the protein has been modified in vitro, so that its sequence is not naturally occurring, or corresponds to naturally occurring sequences that are not positioned as they would be positioned in a genome which has not been modified.
  • a “recombinant” host cell of the invention has a genome that has been manipulated in vitro so as to alter, e.g., decrease or disrupt, or, alternatively, increase, the function or activity of at least one gene in the macrolide or desosamine biosynthetic gene cluster of the invention.
  • a “multifunctional protein” is one where two or more enzymatic activities are present on a single polypeptide.
  • a “module” is one of a series of repeated units in a multifunctional protein, such as a Type I polyketide synthase or a fatty acid synthase.
  • a “premature termination product” is a product which is produced by a recombinant multifunctional protein which is different than the product produced by the non-recombinant multifunctional protein.
  • the product produced by the recombinant multifunctional protein has fewer acyl groups.
  • a DNA that is “derived from” a gene cluster is a DNA that has been isolated and purified in vitro from genomic DNA, or synthetically prepared on the basis of the sequence of genomic DNA.
  • the pik gene cluster includes sequences encoding a polyketide synthase (pikA), desosamine biosynthetic enzymes (pikB, also referred to as des), a cytochrome P450 (pikC), regulatory factors (pikD) and enzymes for cellular self-resistance (pikR).
  • pikA polyketide synthase
  • pikB desosamine biosynthetic enzymes
  • pikC cytochrome P450
  • pikD regulatory factors
  • enzymes for cellular self-resistance pikR
  • isolated and/or purified refer to in vitro isolation of a DNA or polypeptide molecule from its natural cellular environment, and from association with other components of the cell, such as nucleic acid or polypeptide, so that is can be sequenced, replicated and/or expressed.
  • the DNA may encode more than one recombinant Type I polyketide synthase and/or fatty acid synthase.
  • an isolated DNA molecule encoding a polyhydroxyalkanoate monomer synthase is RNA or DNA containing greater than 7, preferably 15, and more preferably 20 or more sequential nucleotide bases that encode a biologically active polypeptide, fragment, or variant thereof, that is complementary to the non-coding, or complementary to the coding strand, of a polyhydroxyalkanoate monomer synthase RNA, or hybridizes to the RNA or DNA encoding the polyhydroxyalkanoate monomer synthase and remains stably bound under stringent conditions, as defined by methods well known to the art, e.g., in Sambrook et al., supra.
  • an “antibiotic” as used herein is a substance produced by a microorganism which, either naturally or with limited chemical modification, will inhibit the growth of or kill another microorganism or eukaryotic cell.
  • An “antibiotic biosynthetic gene” is a nucleic acid, e.g., DNA, segment or sequence that encodes an enzymatic activity which is necessary for an enzymatic reaction in the process of converting primary metabolites into antibiotics.
  • An “antibiotic biosynthetic pathway” includes the entire set of antibiotic biosynthetic genes necessary for the process of converting primary metabolites into antibiotics. These genes can be isolated by methods well known to the art, e.g., see U.S. Pat. No. 4,935,340.
  • Antibiotic-producing organisms include any organism, including, but not limited to, Actinoplanes, Actinomadura, Bacillus, Cephalosporium, Micromonospora, Penicillium, Nocardia, and Streptomyces, which either produces an antibiotic or contains genes which, if expressed, would produce an antibiotic.
  • An antibiotic resistance-conferring gene is a DNA segment that encodes an enzymatic or other activity which confers resistance to an antibiotic.
  • sequence means a series of nucleic acid units that appears within genetic material. With regard to individual references in the literature, sequences may be disclosed that are actually arbitrary segments taken from the genetic material. By arbitrarily selecting segments of different lengths, starting at different positions within the identified DNA from which a segment is being designated, an extraordinarily large number of different segments may be defined that are nothing more than different size puzzle pieces selected from the same picture. Given a disclosure of a specific source of DNA, identification of conventional processing to provide the genome for a species DNA, and the identification of a genetic sequence of a related species that has been clearly identified and includes segments of similar or identical sequences, the entire DNA is included within the disclosure and each arbitrary sequence is disclosed.
  • polyketide refers to a large and diverse class of natural products, including but not limited to antibiotic, antifungal, anticancer, and anti-helminthic compounds.
  • Antibiotics include, but are not limited to anthracyclines and macrolides of different types (polyenes and avermectins as well as classical macrolides such as erythromycins). Macrolides are produced by, for example, S. erytheus, S. antibioticus, S. venezuelae, S. fradiae and S. narbonensis.
  • glycosylated polyketide refers to any polyketide that contains one or more sugar residues.
  • glycosylation-modified polyketide refers to a polyketide having a changed glycosylation pattern or configuration relative to that particular polyketide's unmodified or native state.
  • polyketide-producing microorganism includes any microorganism that can produce a polyketide naturally or after being suitably engineered (i.e., genetically).
  • actinomycetes that naturally produce polyketides include but are not limited to Micromonospora rosaria, Micromonospora megalomicea, Saccharopolyspora erythraea, Streptomyces antibioticus, , Streptomyces albereticuli, Streptomyces ambofaciens, Streptomyces avermitilis, Streptomyces fradiae, Streptomyces griseus, Streptomyces hydroscopicus, Streptomyces tsukulubaensis, Streptomyces mycarofasciens, Streptomyces platenesis , Streptomycesviolaceoniger, Streptomyces violaceoniger, Streptomyces thermotolerans, Streptomyces
  • polyketide-producing microorganisms that produce polyketides naturally include various Actinomadura, Dactylosporangium and Nocardia strains.
  • sugar biosynthesis genes refers to nucleic acid sequences from organisms such as Streptomyces venezuelae that encode sugar biosynthesis enzymes and is intended to include sequences of DNA from other polyketide-producing microorganisms which are identical or analogous to those obtained from Streptomyces venezuelae.
  • sugar biosynthesis enzymes refers to polypeptides which are involved in the biosynthesis and/or attachment of polyketide-associated sugars and their derivatives and intermediates.
  • polyketide-associated sugar refers to a sugar that is known to attach to polyketides or that can be attached to polyketides by the processes described herein.
  • sugar derivative refers to a sugar which is naturally associated with a polyketide but which is altered relative to the unmodified or native state, including but not limited to, N-3-a-desdimethyl D-desosamine.
  • sugar intermediate refers to an intermediate compound produced in a sugar biosynthesis pathway.
  • FIG. 1 The PHB biosynthetic pathway in A. eutrophus.
  • FIG. 2 Molecular structure of common bacterial PHAs. Most of the known PHAs are polymers of 3-hydroxy acids possessing the general formula shown. For example, R ⁇ CH 3 in PHB, T ⁇ CH 2 CH 3 in polyhydroxyvalerate (PHV), and R ⁇ (CH 2 ) 4 CH 3 in polyhydroxyoctanoate (PHO).
  • FIG. 3 Comparison of the natural and recombinant pathways for PHB synthesis.
  • the three enzymatic steps of PHB synthesis in bacteria involving 3-ketothiolase, acetoacetyl-CoA reductase, and PHB synthase are shown on the left.
  • the two enzymatic steps involved in PHB synthesis in the pathway in Sf21 cells containing a rat fatty acid synthase with an inactivated dehydrase domain (ratF AS206) are shown on the right.
  • FIG. 4 Schematic diagram of the molecular organization of the tyl polyketide synthase (PKS) gene cluster. Open arrows correspond to individual open reading frames (ORFs) and numbers above an ORF denote a multifunctional module or synthase unit (SU).
  • AT acyltransferase
  • ACP acyl carrier protein
  • KS ⁇ -ketoacyl synthase
  • KR ketoreductase
  • DH dehydrase
  • ER enoyl reductase
  • TE thioesterase
  • MM methylmalonylCoA
  • M malonyl CoA
  • EM ethylmalonyl CoA.
  • Module 7 in tyl is also known as Module F.
  • FIG. 5 Schematic diagram of the molecular organization of the met PKS gene cluster.
  • FIG. 6 Strategy for producing a recombinant PHA monomer synthase by domain replacement.
  • FIG. 7 (A) 10% SDS-PAGE gel showing samples from various stages of the purification of PHA synthase; lane 1, molecular weight markers; lane 2, total protein of uninfected insect cells; lane 3, total protein or insect cells expressing a rat FAS (200 kDa; Joshi et al., Biochem. J ., 296, 143 (1993)); lane 4, total protein of insect cells expressing PHA synthase; lane 5, soluble protein from sample in lane 4; lane 6, pooled hydroxylapatite (HA) fractions containing PHA synthase.
  • Bands designated with arrows are: a, intact PHB synthase with N-terminal alanine at residue 7 and serine at residue 10 (A7/S10); b, 44 kDa fragment of PHB synthase with N-terminal alanine at residue 181 and asparagine at residue 185 (A181/N185); c, PHB synthase fragment of approximately 30 kDa apparently blocked based on resistance to Edman degradation; d, 22 kDa fragment with N-terminal glycine at residue 187 (G187). Band d apparently does not react with rabbit-a-PHB synthase antibody (B, lane 6). The band of similar size in B, lane 4 was not further identified.
  • FIG. 8 N-terminal analysis of PHA synthase purified from insect cells.
  • (a) The expected N-terminal 25 amino acid sequence of A. eutrophus PHA synthase.
  • (b&c) The two N-terminal sequences determined for the A. eutrophus PHA synthase produced in insect cells. The bolded sequences are the actual N-termini determined.
  • FIG. 9 Spectrophotometric scans of substrate, 3-hydroxybutyrate CoA (HBCoA) and product, CoA.
  • the wavelength at which the direct spectrophotometric assays were carried out (232 nm) is denoted by the arrow; substrate, HBCoA ( ⁇ ) and product, CoA ( ⁇ ).
  • FIG. 10 Velocity of the hydrolysis of HBCoA as a function of substrate concentration. Assays were carried out in 40 or 200 ⁇ l assay volumes with enzyme concentration remaining constant at 0.95 mg/ml (3.8 ⁇ g/40 ⁇ l assay). Velocities were calculated from the linear portions of the assay curves subsequent to the characteristic lag period. The substrate concentration at half-optimal velocity, the apparent K m value, was estimated to be 2.5 mM from this data.
  • FIG. 11 Double reciprocal plot of velocity versus substrate concentration. The concave upward shape of this plot is similar to results obtained by Fukui et al. ( Arch. Microbiol ., 110, 149 (1976)) with granular PHA synthase from Z. ramigera.
  • FIG. 12 Velocity of the hydrolysis of HBCoA as a function of enzyme concentration. Assays were carried out in 40 ⁇ l assay volumes with the concentration HBCoA remaining constant at 8 ⁇ M.
  • FIG. 13 Specific activity of PHA synthase as a function of enzyme concentration.
  • FIG. 14 pH activity curve for soluble PHA synthase produced using the baculovirus system. Reactions were carried out in the presence of 200 mM P i . Buffers of pH ⁇ 10 were prepared with potassium phosphate, while buffers of pH>10 were prepared with the appropriate proportion of Na 3 PO 4 .
  • FIG. 15 Assays of the hydrolysis of HBCoA with varying amounts of PHA synthase. Assays were carried out in 40 ⁇ l assay volumes with the concentration of HBCoA remaining constant at 8 ⁇ M. Initial A 232 values, originally between 0.62 and 0.77, were normalized to 0.70. Enzyme amounts used in these assays were, from the uppermost curve, 0.38, 0.76, 1.14, 1.52, 1.90, 2.28, 2.66, 3.02, 3.42, 7.6, and 15.2 ⁇ g, respectively.
  • FIG. 17 Gas chromatographic evidence for PHB accumulation in Sf21 cells. Gas chromatograms from various samples are superimposed. PHB standard (Sigma) is chromatogram #7 showing a propylhydroxybutyrate elution time of 10.043 minutes (s, arrow). The gas chromatograms of extracts of the uninfected (#1); singly infected with ratFAS206 (#2, day 3); and singly infected with PHA synthase (#3, day 3) are shown at the bottom of the figure.
  • FIG. 18 Gas chromatography-mass spectrometry analysis of PHB. The characteristic fragmentation of propylhydroxybutyrate at m/z of 43, 60, 87, and 131 is shown.
  • FIG. 19 Map of the vep ( Streptomyces venezuelae polyene encoding) gene cluster.
  • FIG. 20 Plasmid map of pDHS502.
  • FIG. 21 Plasmid map of pDHS505.
  • FIG. 22 Cloning protocol for pDHS505.
  • FIG. 23 Nucleotide sequence (SEQ ID NO:45) and corresponding amino acid sequence (SEQ ID NO:22) of vep ORFI.
  • FIG. 24 Schematic diagram of the desosamine biosynthetic pathway and the enzymatic activity associated with each of the desosamine biosynthetic polypeptides.
  • FIG. 25 Schematic of the conversion of the inactive (diglycosylated) form of methymycin and pikromycin to the active form of methymycin and pikromycin.
  • FIG. 26 Schematic diagram of the desosamine biosynthetic pathway.
  • FIG. 27 Pathway for the synthesis of a compound of formula 7 and 8 in desVI mutants of Streptomyces.
  • FIG. 28 The methymycin/pikromycin biosynthetic gene cluster and the structure and biosynthesis of methymycin, neomethymycin, narbomycin, and pikromycin in S. venezuelae .
  • Each circle represents an enzymatic domain in PKS protein.
  • ACP acyl carrier protein
  • KS ⁇ -ketoacyl-ACP synthase
  • KS Q a KS-like domain
  • AT acyltransferase
  • KR ⁇ -ketoacyl ACP reductase
  • DH ⁇ -hydroxyl-thioester dehydratase
  • ER enoyl reductase
  • TEI thioesterase domain
  • TEII type II thioesterase.
  • Des represents all eight enzymes in desosamine synthesis and transfer which include DesI, DesII, DesIII, DesIV, DesV, DesVI, DesVIII, and DesVII.
  • FIG. 29 Organization of the pik cluster in S. venezuelae .
  • Each arrow represents an open reading frame (ORF).
  • ORF open reading frame
  • the direction of transcription and relative sizes of the ORFs deduced from nucleotide sequence are indicated.
  • the cluster is composed of four genetic loci: pikA, pikB (des), pikC, and pikR. Cosmid clones are denoted as overlapping lines.
  • FIG. 30 Conversion of YC-17 and narbomycin by PikC P450 hydroxylase.
  • FIG. 31 Nucleotide sequence (SEQ ID NO:48) and inferred amino acid sequence (SEQ ID NO:49) of the pik gene cluster.
  • FIG. 32 Nucleotide sequence (SEQ ID NO:46) and inferred amino acid sequence (SEQ ID NO:47) of the desosamine gene cluster.
  • FIG. 33 S. venezuelae AX916 construct useful to prepare a polyketide having a shorter chain length compared to wild-type pikA.
  • pik module 2 is fused to pik module 5, and module 3 and 4 are deleted, so as to encode a three module PKS which produces two macrolides, a triketide and a tetraketide.
  • FIG. 34 Recombinant PKS having a wild-type thioesterase II.
  • FIG. 35 pAX703 construct, an expression and complementation vector.
  • the PikTEII gene can be replaced with an EcoRI-NsiI fragment.
  • the phaC1 gene can be replaced with a PacI-DraI fragment.
  • FIG. 36 Strategy for C7 polymer production.
  • mTEII is a mutant pikTEII, an acyl-ACP CoA transferase
  • phaC1 is a PHA polymerase 1 from P. olivarus which may have racemase activity.
  • AX916, a PHA polymer is produced.
  • FIG. 37 Strategy for C5 polymer production.
  • a PHA polymerase gene phaC1 is directly fused to pik module 2, so as to result in a fusion that transfers an acyl chain from the PKS protein directly to the polymerase by the prosthetic group on the ACP domain of the PKS.
  • FIG. 38 Codons for specified amino acids.
  • FIG. 39 Exemplary and preferred amino acid substitutions.
  • the invention described herein can be used for the production of a diverse range of biodegradable PHA polymers through genetic redesign of DNA encoding a FAS or a PKS such as that found in Streptomyces spp. Type I PKS polypeptide to provide a recombinant PHA monomer synthase. Different PHA synthases can then be tested for their ability to polymerize the monomers produced by the recombinant PHA synthase into a biodegradable polymer.
  • the invention also provides a method by which various PHA synthases can be tested for their specificity with respect to different monomer substrates.
  • PHAs produced by PHA monomer synthases and PHA synthases include both medical and industrial applications.
  • Medical applications of PHAs include surgical pins, sutures, staples, swabs, wound dressings, blood vessel replacements, bone replacements and plates, stimulation of bone growth by piezoelectric properties, and biodegradable carrier for long-term dosage of pharmaceuticals.
  • Industrial applications of PHAs include disposable items such as baby diapers, packaging containers, bottles, wrappings, bags, and films, and biodegradable carriers for long-term dosage of herbicides, fungicides, insecticides, or fertilizers.
  • the biosynthesis of fatty acids de novo from malonyl-CoA is catalyzed by FAS.
  • the rat FAS is a homodimer with a subunit structure consisting of 2505 amino acid residues having a molecular weight of 272,340 Da. Each subunit consists of seven catalytic activities in separate physical domains (Amy et al., Proc. Natl. Acad. Sci. USA , 86, 3114 (1989)).
  • ketoacyl synthase KS
  • malonyl/acetyltransferase M/AT
  • ER enoyl reductase
  • KR ketoreductase
  • ACP acyl carrier protein
  • TE thioesterase
  • DH dehydrase
  • PKS eryA polyketide synthase
  • the three polypeptides that comprise this PKS are constructed from “modules” which resemble animal FAS, both in terms of their amino acid sequence and in the ordering of the constituent domains (Donadio et al., Gene , 111, 51 (1992); Benh et al., Eur. J. Biochem ., 204, 39 (1992)).
  • Streptomyces Narbonensis is LOCUS AF193252 437 bp DNA linear BCT 04 Apr. 2000 DEFINITION Streptomyces narbonensis polyketide synthase module 5 and polyketide synthase module 6 genes, partial cds. ACCESSION AF193252 VERSION AF193252.1 GI:7406991 KEYWORDS . SOURCE Streptomyces narbonensis .
  • REFERENCE 1 bases 1 to 437) AUTHORS Xue, Y., Wilson, D. and Sherman, D. H. TITLE Genetic architecture of the polyketide syntheses for methymycin and pikromycin series macrolides JOURNAL Gene 245 (1), 203-211 (2000) MEDLINE 20179700 PUBMED 10713461 REFERENCE 2 (bases 1 to 437) AUTHORS Xue, Y., Wilson, D. and Sherman, D.
  • REFERENCE 1 (bases 1 to 327) AUTHORS Xue, Y., Wilson, D. and Sherman, D. H. TITLE Genetic architecture of the polyketide synthases for methymycin and pikromycin series macrolides JOURNAL Gene 245 (1), 203-211 (2000) MEDLINE 20179700 PUBMED 10713461 REFERENCE 2 (bases 1 to 327) AUTHORS Xue, Y., Wilson, D. and Sherman, D. H. TITLE Direct submission JOURNAL Submitted (11 Oct. 1999) Department of Microbiology, University of Minnesota, 420 Delaware Street SE. Room 1060, Minneapolis, MN 55455, USA FEATURES Location/Qualifiers source 1 . . .
  • One embodiment of the invention employs a FAS in which the DH is inactivated (FAS DH ⁇ ).
  • the FAS DH ⁇ employed in this embodiment of the invention is preferably a eukaryotic FAS DH ⁇ and, more preferably, a mammalian FAS DH ⁇ .
  • the most preferred embodiment of the invention is a FAS where the active site in the DH has been inactivated by mutation. For example, Joshi et al. ( J. Biol. Chem ., 268, 22508 (1993)) changed the His 878 residue in the rat FAS to an alanine residue by site-directed mutagenesis. In vitro studies showed that a FAS with this change (ratFAS206) produced 3-hydroxybutyrylCoA as a premature termination product from acetyl-CoA, malonyl-CoA and NADPH.
  • a FAS DH ⁇ effectively replaces the ⁇ -ketothiolase and acetoacetyl-CoA reductase activities of the natural pathway by producing D( ⁇ )-3-hydroxybutyrate as a premature termination product, rather than the usual 16-carbon product, palmitic acid.
  • This premature termination product can then be incorporated into PHB by a PHB synthase (See Example 2).
  • Another embodiment of the invention employs a recombinant Streptomyces spp. PKS to produce a variety of ⁇ -hydroxyCoA esters that can serve as monomers for a PHA synthase.
  • a DNA encoding a Type I PKS is the eryA gene cluster, which governs the synthesis of erythromycin aglycone deoxyerythronolide B (DEB).
  • the gene cluster encodes six repeated units, termed modules or synthase units (SUs). Each module or SU, which comprises a series of putative FAS-like activities, is responsible for one of the six elongation cycles required for DEB formation.
  • SUs synthase units
  • Two other Type I PKS are encoded by the tyl (tylosin) (FIG. 4) and met (methymycin) (FIG. 5) gene clusters.
  • the macrolide multifunctional synthases encoded by tyl and met provide a greater degree of metabolic diversity than that found in the eryA gene cluster.
  • the PKSs encoded by the eryA gene cluster only catalyze chain elongation with methylmalonylCoA, as opposed to tyl and met PKSs, which catalyze chain elongation with malonylCoA, methylmalonylCoA and ethylmalonylCoA.
  • the tyl PKS includes two malonylCoA extender units and one ethylmalonylCoA extender unit, and the met PKS includes one malonylCoA extender unit.
  • a preferred embodiment of the invention includes, but is not limited to, replacing catalytic activities encoded in met PKS open reading frame 1 (ORF1) to provide a DNA encoding a protein that possesses the required keto group processing capacity and short-chain acylCoA ester starter and extender unit specificity necessary to provide a saturated ⁇ -hydroxyhexanoylCoA or unsaturated B-hydroxyhexenoylCoA monomer.
  • Linker regions amino acid sequences of related modules, preferably those encoded by more than one gene cluster, are compared. Linker regions are amino acid sequences which are less well conserved than amino acid sequences with catalytic activity. Witkowski et al., Eur. J. Biochem ., 198, 571 (1991).
  • a DNA encoding a module F containing KS, MT, KR, ACP, and TE catalytic activities, is introduced at the 3′ end of a DNA encoding a first module (FIG. 6).
  • Module F introduces the final (R)-3-hydroxyl acyl group at the final step of PHA monomer synthesis, as a result of the presence of a TE domain.
  • DNA encoding a module F is not present in the eryA PKS gene cluster (Donadio et al., supra, 1991).
  • a DNA encoding a recombinant monomer synthase is inserted into an expression vector.
  • the expression vector employed varies depending on the host cell to be transformed with the expression vector. That is, vectors are employed with transcription, translation and/or post-translational signals, such as targeting signals, necessary for efficient expression of the genes in various host cells into which the vectors are introduced. Such vectors are constructed and transformed into host cells by methods well known in the art. See Sambrook et al., Molecular Cloning: A Laboratory Manual , Cold Spring Harbor (1989).
  • Preferred host cells for the vectors of the invention include insect, bacterial, and plant cells.
  • Preferred insect cells include Spodoptera frugiperda cells such as Sf2 1, and Trichoplusia ni cells.
  • Preferred bacterial cells include Escherichia coli , Streptomyces and Pseudomonas.
  • Preferred plant cells include monocot and dicot cells, such as maize, rice, wheat, tobacco, legumes, carrot, squash, canola, soybean, potato, and the like.
  • the appropriate subcellular compartment in which to locate the enzyme in eukaryotic cells must be considered when constructing eukaryotic expression vectors. Two factors are important: the site of production of the acetyl-CoA substrate, and the available space for storage of the PHA polymer. To direct the enzyme to a particular subcellular location, targeting sequences may be added to the sequences encoding the recombinant molecules.
  • the baculovirus system is particularly amenable to the introduction of DNA encoding a recombinant FAS or a PKS monomer synthase because an increasing variety of transfer plasmids are becoming available which can accommodate a large insert, and the virus can be propagated to high titers.
  • insect cells are adapted readily to suspension culture, facilitating relatively large-scale recombinant protein production.
  • recombinant proteins tend to be produced exclusively as soluble proteins in insect cells, thus, obviating the need for refolding, a task that might be particularly daunting in the case of a large multifunctional protein.
  • the Sf21/baculovirus system has routinely expressed milligram quantities of catalytically active recombinant fatty acid synthase.
  • the baculovirus/insect cell system provides the ability to construct and analyze different synthase proteins for the ability to polymerize monomers into unique biodegradable polymers.
  • a further embodiment of the invention is the introduction of at least one DNA encoding a PHA synthase and a DNA encoding a PHA monomer synthase into a host cell.
  • Such synthases include, but are not limited to, A. eutrophus 3-hydroxy, 4-hydroxy, and 5-hydroxy alkanoate synthases, Rhodococcus ruber C 3 -C 5 hydroxyalkanoate synthases, Pseudomonas oleororans C 6 -C 14 hydroxyalkanoate synthases, P. putida C 6 -C 14 hydroxyalkanoate synthases, P. aeruginosa C 5 -C 10 hydroxyalkanoate synthases, P.
  • eutrophus PHB synthase utilizes only C4 and C5 compounds as substrates, it appears to be a good prototype synthase for initial studies since it is known to be capable of producing copolymers of 3-hydroxybutyrate and 4-hydroxybutyrate (Kunioka et al., Macromolecules , 22, 694 (1989)) as well as copolymers of 3-hydroxyvalerate, 3-hydroxybutyrate, and 5-hydroxyvalerate (Doi et al., Macromolecules , 19, 2860 (1986)).
  • Other synthases especially those of Pseudomonas aeruginosa (Timm et al., Eur. J.
  • Rhodococcus ruber Pieris et al., FEMS Microbiol. Lett ., 96, 73 (1992)
  • Synthase specificity may be alterable through molecular biological methods.
  • a DNA encoding a FAS and a PHA synthase can be introduced into a single expression vector, obviating the need to introduce the genes into a host cell individually.
  • a further embodiment of the invention is the generation of a DNA encoding a recombinant multifunctional protein, which comprises a FAS, of either eukaryotic or prokaryotic origin, and a PKS module F.
  • Module F will carry out the final chain extension to include two additional carbons and the reduction of the ⁇ -keto group, which results in a (R)-3-hydroxy acyl CoA moiety.
  • DNA encoding the FAS TE is replaced with a DNA encoding a linker region which is normally found in the ACP-KS interdomain region of bimodular ORFs.
  • DNA encoding a module F is then inserted 3′ to the DNA encoding the linker region.
  • Different linker regions such as those described below which vary in length and amino acid composition, can be tested to determine which linker most efficiently mediates or allows the required transfer of the nascent saturated fatty acid intermediate to module F for the final chain elongation and keto reduction steps.
  • the resulting DNA encoding the protein can then be tested for expression of long-chain ⁇ -hydroxy fatty acids in insect cells, such as Sf21 cells, or Streptomyces, or Pseudomonas.
  • the expected 3-hydroxy C-18 fatty acid can serve as a potential substrate for PHA synthases which are able to accept long-chain alkyl groups.
  • a preferred embodiment of the invention is a FAS that has a chain length specificity between 4-22 carbons.
  • linker regions that can be employed in this embodiment of the invention include, but are not limited to, the ACP-KS linker regions encoded by the tyl ORFI (ACP 1 -KS 2 ; ACP 2 -KS 3 ), and ORF3 (ACP 5 -KS 6 ), and eryA ORFI (ACP 1 -KS 1 ; ACP 2 -KS 2 ), ORF2 (ACP 3 -KS 4 ) and ORF3 (ACP 5 -KS 6 ).
  • This approach can also be used to produce shorter chain fatty acid groups by limiting the ability of the FAS unit to generate long-chain fatty acids. Mutagenesis of DNA encoding various FAS catalytic activities, starting with the KS, may result in the synthesis of short-chain (R)-3-hydroxy fatty acids.
  • PHA polymers are then recovered from the biomass. Large-scale solvent extraction can be used, but is expensive. An alternative method involving heat shock with subsequent enzymatic and detergent digestive processes is also available (Byron, Trends Biotechnical , 5, 246 (1987); Holmes, In: Developments in Crystalline Polymers , D. C. Bassett (ed.), pp. 1-65 (1988)). PHB and other PHAs are readily extracted from microorganisms by chlorinated hydrocarbons. Refluxing with chloroform has been extensively used; the resulting solution is filtered to remove debris and concentrated, and the polymer is precipitated with methanol or ethanol, leaving low-molecular-weight lipids in solution.
  • the present invention also contemplates nucleic acid sequences which hybridize under stringent hybridization conditions to the nucleic acid sequences set forth herein. Stringent hybridization conditions are well known in the art and define a degree of sequence identity greater than about 80 to about 90%.
  • nucleic acid sequences encoding variant polypeptides (FIG. 38), or nucleic acid sequences having conservative (silent) nucleotide substitutions (FIG. 37), are within the scope of the invention.
  • variant polypeptides encoded by the nucleic acid sequences of the invention are biologically active.
  • the present invention also contemplates naturally occurring allelic variations and mutations of the nucleic acid sequences described herein.
  • DNA and RNA molecules that can code for the same polypeptides as those encoded by the exemplified biosynthetic genes and fragments thereof.
  • the present invention contemplates those other DNA and RNA molecules which, on expression, encode the polypeptides of, for example, portions of SEQ ID NO:47 or SEQ ID NO:49. Having identified the amino acid residue sequence encoded by a sugar biosynthetic or macrolide biosynthetic gene, and with knowledge of all triplet codons for each particular amino acid residue, it is possible to describe all such encoding RNA and DNA sequences. DNA and RNA molecules other than those specifically disclosed herein and, which molecules are characterized simply by a change in a codon for a particular amino acid, are within the scope of this invention.
  • a TCT codon for serine exists at nucleotide positions 1735-1737.
  • serine can be encoded by a TCA codon (see, e.g., nucleotide positions 1738-1740) and a TCC codon (see, e.g., nucleotide positions 1874-1876).
  • TCA codon see, e.g., nucleotide positions 1738-1740
  • TCC codon see, e.g., nucleotide positions 1874-1876.
  • substitution of the latter codons for serine with the TCT codon for serine or vice versa does not substantially alter the DNA sequence of SEQ ID NO:49 and results in production of the same polypeptide.
  • substitutions of the recited codons with other equivalent codons can be made in a like manner without departing from the scope of the present invention.
  • a nucleic acid molecule, segment or sequence of the present invention can also be an RNA molecule, segment or sequence.
  • An RNA molecule contemplated by the present invention corresponds to, is complementary to or hybridizes under stringent conditions to any of the DNA sequences set forth herein.
  • Exemplary and preferred RNA molecules are mRNA molecules that encode sugar biosynthetic or macrolide biosynthetic enzymes of this invention.
  • Mutations can be made to the native nucleic acid sequences of the invention and such mutants used in place of the native sequence, so long as the mutants are able to function with other sequences to collectively catalyze the synthesis of an identifiable polyketide or macrolides.
  • Such mutations can be made to the native sequences using conventional techniques such as by preparing synthetic oligonucleotides including the mutations and inserting the mutated sequence into the gene using restriction endonuclease digestion. (See, e.g., Kunkel, T. A. Proc. Natl. Acad. Sci. USA (1985) 82:448; Geisselsoder et al.
  • the mutations can be effected using a mismatched primer (generally 10-20 nucleotides in length) which hybridizes to the native nucleotide sequence (generally cDNA corresponding to the RNA sequence), at a temperature below the melting temperature of the mismatched duplex.
  • the primer can be made specific by keeping primer length and base composition within relatively narrow limits and by keeping the mutant base centrally located. Zoller and Smith, Methods Enzymol ., (1983) 100:468.
  • Primer extension is effected using DNA polymerase, the product cloned and clones containing the mutated DNA, derived by segregation of the primer extended strand, selected.
  • Selection can be accomplished using the mutant primer as a hybridization probe.
  • the technique is also applicable for generating multiple point mutations. See, e.g., Dalbie-McFarland et al., Proc. Natl. Acad. Sci. USA (1982) 79:6409. PCR mutagenesis will also find use for effecting the desired mutations.
  • Random mutagenesis of the nucleotide sequence can be accomplished by several different techniques known in the art, such as by altering sequences within restriction endonuclease sites, inserting an oligonucleotide linker randomly into a plasmid, by irradiation with X-rays or ultraviolet light, by incorporating incorrect nucleotides during in vitro DNA synthesis, by error-prone PCR mutagenesis, by preparing synthetic mutants or by damaging plasmid DNA in vitro with chemicals.
  • Chemical mutagens include, for example, sodium bisulfite, nitrous acid, hydroxylamine, agents which damage or remove bases thereby preventing normal base-pairing such as hydrazine or formic acid, analogues of nucleotide precursors such as nitrosoguanidine, 5-bromouracil, 2-aminopurine, or acridine intercalating agents such as proflavine, acriflavine, quinacrine, and the like.
  • plasmid DNA or DNA fragments are treated with chemicals, transformed into E. coli and propagated as a pool or library of mutant plasmids.
  • the gene sequences can be inserted into one or more expression vectors, using methods known to those of skill in the art.
  • Expression vectors may include control sequences operably linked to the desired genes.
  • Suitable expression systems for use with the present invention include systems which function in eukaryotic and prokaryotic host cells. Prokaryotic systems are preferred, and in particular, systems compatible with Streptomyces spp. are of particular interest.
  • Control elements for use in such systems include promoters, optionally containing operator sequences, and ribosome binding sites. Particularly useful promoters include control sequences derived from the gene clusters of the invention.
  • bacterial promoters such as those derived from sugar metabolizing enzymes, such as galactose, lactose (lac) and maltose, will also find use in the expression cassettes encoding desosamine. Additional examples include promoter sequences derived from biosynthetic enzymes such as tryptophan (trp), the ⁇ -lactamase (bla) promoter system, bacteriophage lambda PL, and T5. In addition, synthetic promoters, such as the tac promoter (U.S. Pat. No. 4,551,433), which do not occur in nature, also function in bacterial host cells.
  • regulatory sequences may also be desirable which allow for regulation of expression of the genes relative to the growth of the host cell. Regulatory sequences are known to those of skill in the art, and examples include those which cause the expression of a gene to be turned on or off in response to a chemical or physical stimulus, including the presence of a regulatory compound. Other types of regulatory elements may also be present in the vector, for example, enhancer sequences.
  • Selectable markers can also be included in the recombinant expression vectors.
  • a variety of markers are known which are useful in selecting for transformed cell lines and generally comprise a gene whose expression confers a selectable phenotype on transformed cells when the cells are grown in an appropriate selective medium.
  • markers include, for example, genes which confer antibiotic resistance or sensitivity to the plasmid.
  • polyketides are naturally colored and this characteristic provides a built-in marker for selecting cells successfully transformed by the present constructs.
  • the various subunits of interest can be cloned into one or more recombinant vectors as individual cassettes, with separate control elements, or under the control of, e.g., a single promoter.
  • the subunits can include flanking restriction sites to allow for the easy deletion and insertion of other subunits so that hybrid PKSs can be generated.
  • the design of such unique restriction sites is known to those of skill in the art and can be accomplished using the techniques described above, such as site-directed mutagenesis and PCR.
  • the choice of vector depends on the pool of mutant sequences, i.e., donor or recipient, with which they are to be employed. Furthermore, the choice of vector determines the host cell to be employed in subsequent steps of the claimed method. Any transducible cloning vector can be used as a cloning vector for the donor pool of mutants. It is preferred, however, that phagemids, cosmids, or similar cloning vectors be used for cloning the donor pool of mutant encoding nucleotide sequences into the host cell.
  • Phagemids and cosmids are advantageous vectors due to the ability to insert and stably propagate therein larger fragments of DNA than in M13 phage and ? phage, respectively.
  • Phagemids which will find use in this method generally include hybrids between plasmids and filamentous phage cloning vehicles.
  • Cosmids which will find use in this method generally include ? phage-based vectors into which cos sites have been inserted.
  • Recipient pool cloning vectors can be any suitable plasmid.
  • the cloning vectors into which pools of mutants are inserted may be identical or may be constructed to harbor and express different genetic markers (see, e.g., Sambrook et al., supra). The utility of employing such vectors having different marker genes may be exploited to facilitate a determination of successful transduction.
  • the cloning vector employed may be a phagemid and the host cell may be E. coli .
  • the host cell which contains a phagemid
  • single-stranded phagemid DNA is produced, packaged and extruded from the cell in the form of a transducing phage in a manner similar to other phage vectors.
  • clonal amplification of mutant encoding nucleotide sequences carried by phagemids is accomplished by propagating the phagemids in a suitable host cell.
  • the cloned donor pool of mutants is infected with a helper phage to obtain a mixture of phage particles containing either the helper phage genome or phagemids mutant alleles of the wild-type encoding nucleotide sequence.
  • Infection, or transfection, of host cells with helper phage is generally accomplished by methods well known in the art (see., e.g., Sambrook et al., supra; and Russell et al. (1986) Gene 45:333-338).
  • the helper phage may be any phage which can be used in combination with the cloning phage to produce an infective transducing phage.
  • the helper phage will necessarily be a ? phage.
  • the cloning vector is a phagemid and the helper phage is a filamentous phage, and preferably phage M13.
  • the transducing phage can be separated from helper phage based on size difference (Barnes et al. (1983) Methods Enzymol . 101:98-122), or other similarly effective technique.
  • Recipient cells which may be employed in the method disclosed and claimed herein may be, for example, E. coli , or other bacterial expression systems which are not recombination deficient.
  • a recombination deficient cell is a cell in which recombinatorial events is greatly reduced, such as rec mutants of E. coli (see, Clark et al. (1965) Proc. Natl. Acad. Sci. USA 53:451-459).
  • transductants can now be selected for the desired expressed protein property or characteristic and, if necessary or desirable, amplified.
  • transductants may be selected by way of their expression of both donor and recipient plasmid markers.
  • the recombinants generated by the above-described methods can then be subjected to selection or screening by any appropriate method, for example, enzymatic or other biological activity.
  • the above cycle of amplification, infection, transduction, and recombination may be repeated any number of times using additional donor pools cloned on phagemids.
  • the phagemids into which each pool of mutants is cloned may be constructed to express a different marker gene.
  • Each cycle could increase the number of distinct mutants by up to a factor of 10 6 .
  • the probability of occurrence of an inter-allelic recombination event in any individual cell is f (a parameter that is actually a function of the distance between the recombining mutations)
  • the transduced culture from two pools of 10 6 allelic mutants will express up to 10 12 distinct mutants in a population of 10 12 /f cells.
  • eutrophus PHA synthase antibody was a religious gift from Dr. F. Srienc and S. Stoup (Biological Process Technology Institute, University of Minnesota). Sf21 cells and T. ni cells were kindly provided by Greg Franzen (R&D Systems, Minneapolis, Minn.) and Stephen Harsch (Department of Veterinary Pathobiology, University of Minnesota), respectively.
  • Plasmid pFAS206 and a recombinant baculoviral clone encoding FAS206 were generous gifts of A. Joshi and S. Smith.
  • Plasmid pAet41 Peoples et al., J. Biol. Chem ., 264, 15298 (1989)
  • the source of the A. eutrophus PHB synthase was obtained from A. Sinskey.
  • Baculovirus transfer vector, pBaePAK9, and linearized baculoviral DNA were obtained from Clontech Inc. (Palo Alto, Calif.).
  • T4 DNA ligase E. coli DH5a competent cells
  • molecular weight standards lipofectin reagent
  • Grace's insect cell medium fetal bovine serum (FBS)
  • antibiotic/antimycotic reagent obtained from GIBCO-BRL (Grand Island, N.Y.).
  • Tissue culture dishes were obtained from Coming Inc.
  • Spinner flasks were obtained from Bellco Glass Inc.
  • Seaplaque agarose GTG was obtained from FMC Bioproducts Inc.
  • R-( ⁇ )-3 HBCoA was prepared by the mixed anhydride method described by Haywood et al., FEMS Microbiol. Lett ., 57, 1 (1989). 60 mg (0.58 nmol) of R-( ⁇ )-3 hydroxybutyric acid was freeze dried and added to a solution of 72 mg of pyridine in 10 ml diethyl ether at 0° C. Ethylchloroformate (100 mg) was added, and the mixture was allowed to stand at 4° C. for 60 minutes. Insoluble pyridine hydrochloride was removed by centrifugation.
  • the resulting anhydride was added, dropwise with mixing, to a solution of 100 mg coenzyme-A (0.13 mmol) in 4 ml 0.2 M potassium bicarbonate, pH 8.0 at 0° C.
  • the reaction was monitored by the nitroprusside test of Stadtman, Meth. Enzymol ., 3, 931 (1957), to ensure sufficient anhydride was added to esterify all the coenzyme-A.
  • pBP-phbC Construction of pBP-phbC.
  • the phbC gene (approximately 1.8 kb) was excised from pAet4l (Peoples et al., J. Biol. Chem ., 264, 15293 (1989)) by digestion with BstBI and StuI, purified as described by Williams et al. ( Gene , 109, 445 (1991)), and ligated to pBacPAK9 digested with BstBI and StuI. This resulted in pBP-phbC, the baculovirus transfer vector used in formation of recombinant baculovirus particles carrying phbC.
  • pBP-phbC and linearized baculovirus DNA were used for cotransfection of Sf21 cells using the liposome-mediated method (Feigner et al., Proc. Natl. Acad. Sci. USA , 84, 7413 (1987)) utilizing Lipofectin (GIBCO-BRL). Four days later cotransfection supernatants were utilized for plaque purification. Recombinant viral clones were purified from plaque assay plates containing 1.5% Seaplaque GTG after 5-7 days at 28° C.
  • Recombinant viral clone stocks were then amplified in T25-flask cultures (4 ml, 3 ⁇ 10 6 /ml on day 0) for 4 days; infected cells were determined by their morphology and size and then screened by SDS/PAGE using 10% polyacrylamide gels (Laemmli, Nature , 227, 680 (1970)) for production of PHA synthase.
  • This mixture was homogenized with three series of 10 strokes each in two Thomas homogenizers while partially submerged in an ice bath and then sonicated for 2 minutes in a Branson Sonifier 250 at 30% cycle, 30% power while on ice. All subsequent procedures were carried out at 4° C.
  • the lysate was immediately centrifuged at 100000 ⁇ g in a Beckman 50.2Ti rotor for 80 minutes, and the resulting supernatant (10.5 ml, 47 mg) was immediately filtered through a 0.45 mm Uniflow filter (Schleicher and Schuell Inc., Keene, N.H.) to remove any remaining insoluble matter. Aliquots of the soluble fraction (1.5 ml, 7 mg) were loaded onto a 5 ml BioRad Econo-Pac HTP column that had been equilibrated with Buffer A (+protease inhibitor mix) attached to a BioRad Econo-system, and the column was washed with 30 ml Buffer A. All chromatographic steps were carried out at a flow rate of 0.8 ml/minute. PHA synthase was eluted form the HA column with a 32 ⁇ 32 ml linear gradient from 10 to 300 mM KPi.
  • Fraction collection tubes were prepared by addition of 30 ml of 100 mM EDTA to provide a metalloprotease inhibitor at 1 mM immediately after HA chromatography. PHA synthase was eluted in a broad peak between 110-180 mM KPi. Fractions (3 ml) containing significant PHA synthase activity were pooled and stored at 0° C. until the entire soluble fraction had been run through the chromatographic process. Pooled fractions then were concentrated at 4° C. by use of a Centriprep-30 concentrator (Amicon) to 3.8 mg/ml. Aliquots (0.5 ml) were either flash frozen and stored in liquid N 2 or glycerol was added to a final concentration of 50% and samples (1.9 mg/ml) were stored at ⁇ 20° C.
  • Membranes were then washed four times for 10 minutes with PBS-Tween followed by the addition of horseradish peroxidase-conjugated goat-anti-rabbit antibody (Boehringer-Mannheim) diluted 10,000 ⁇ in fresh blocking solution and incubated at 25° C. for 1 hour. Membranes were washed finally in three changes (10 minutes) of PBS, and the immobilized peroxidase label was detected using the chemiluminescent LumiGLO substrate kit (Kirkegaard and Perry, Gaithersburg, Md.) and X-ray film.
  • horseradish peroxidase-conjugated goat-anti-rabbit antibody Boehringer-Mannheim
  • Double-infection protocol Four 100 ml spinner flasks were each inoculated with 8 ⁇ 10 7 cells in 50 ml of fresh insect medium. To flask 1, an additional 20 ml of fresh insect medium was added (uninfected control); to flask 2, 10 ml BacPAK6::phbC viral stock (1 ⁇ 10 8 pfu/ml) and 10 ml fresh insect medium were added; to flask 3, 10 ml BacPAK6::FAS206 viral stock (1 ⁇ 10 8 pfu/ml) and 10 ml fresh insect medium were added; and to flask 4, 10 ml BacPAK6::phbC viral stock (1 ⁇ 10 8 pfu/ml) and 10 ml BacPAK6::FAS206 viral stock (1 ⁇ 10 8 pfu/ml) were added.
  • HBCoA was monitored spectrophotometrically. Assays were performed at 25° C. in a Hewlett Packard 8452A diode array spectrophotometer equipped with a water-jacketed cell holder. Two-piece Starna Spectrosil spectrophotometer cells with pathlengths of 0.1 and 0.01 cm were employed to avoid errors arising from the compression of the absorbance scale at higher values. Absorbance was monitored at 232 nm, and E 232 nm of 4.5 ⁇ 103 M ⁇ 1 cm ⁇ 1 was used in calculations. One unit (U) of enzyme is the amount required to hydrolyze 1 mmol of substrate minute ⁇ 1 .
  • Buffer (0.15 M KPi, pH 7.2) and substrate were equilibrated to 25° C. and then combined in an Eppendorf tube also at 25° C. Enzyme was added and mixed once in the pipet tip used to transfer the entire mixture to the spectrophotometer cell.
  • the two-piece cell was immediately assembled, placed in the spectrophotometer with the cell holder (type CH) adapted for the standard 10 mm pathlength cell holder of the spectrophotometer. Manipulations of sample, from mixing to initiation of monitoring, took only 10-15 seconds. Absorbance was continually monitored for up to 10 minutes. Calibration of reactions was against a solution of buffer and enzyme (no substrate) which led to absorbance values that represented substrate only.
  • PHB assay PHB was assayed from Sf21 cell samples according to the propanolysis method of Riis et al., J. Chromo ., 445, 285 (1988). Cell pellets were thawed on ice, resuspended in 1 ml cold ddH 2 O and transferred to 5 ml screwtop test tubes with teflon seals. Two ml of ddH 2 O were added, the cells were washed and centrifuged and then 3 ml of acetone were added and the cells washed and centrifuged. The samples were then desiccated by placing them in a 94° C. oven for 12 hours.
  • Ketoacyl synthase (KS) activity was assessed radiochemically by the condensation- 14 CO 2 exchange reaction (Smith et al., PNAS USA , 73, 1184 (1976)).
  • Transferase (AT) activity was assayed, using malonyl-CoA as donor and pantetheine as acceptor, by determining spectrophotometrically the free CoA released in a coupled ATP citrate-lyase-malate dehydrogenase reaction (see, Rangen et al., J. Biol. Chem ., 266, 19180 (1991).
  • Ketoreductase (KR) was assayed spectrophotometrically at 340 nm: assay systems contained 0.1 M potassium phosphate buffer (pH 7), 0.15 mM NADPH, enzyme and either 10 mM trans-1-decalone or 0.1 mM acetoacetyl-CoA substrate.
  • DH activity was assayed spectrophotometrically at 270 nm using S-DL- ⁇ -hydyroxybutyryl N-acetylcysteamine as substrate (Kumar et al., J. Biol. Chem ., 245, 4732 (1970)).
  • Enoyl reductase (ER) activity was assayed spectrophotometrically at 340 nm essentially as described by Strom et al. ( J. Biol. Chem ., 254, 8159 (1979)); the assay system contained 0.1 M potassium phosphate buffer (pH 7), 0.15 mM NADPH, 0.375 nM crotonoyl-CoA, 20 ⁇ M CoA and enzyme.
  • Thioesterase (TE) activity was assessed radiochemically by extracting and assaying the [ 14 C]palmitic acid formed from [1- 14 C]palmitoyl-CoA during a 3 minute incubation Smith, Meth. Enzymol ., 71 C, 181 (1981); the assay was in a final volume of 0.1 ml, 25 mM potassium phosphate buffer (pH 8), 20 ⁇ M [1- 14 C]palmitoyl-CoA (20 nCi) and enzyme.
  • Assay of overall fatty acid synthase activity was performed spectrophotometrically as described previously by Smith et al. ( Meth. Enzymol ., 35, 65 (1975)). All enzyme activities were assayed at 37° C. except the transferase, which was assayed at 20° C. Activity units indicate nmol of substrate consumed/minute. All assays were conducted, at a minimum, at two different protein concentrations with the appropriate enzyme and substrate blanks included.
  • PHA synthase from A. eutrophus can be overexpressed in E. coli , in the absence of 3-ketothiolase and acetoacetyl-CoA reductase (Gerngross et al., supra) and can be expressed in plants (See Poirier et al., Biotech , 1584 13, 142 (1995) for a review). Isolation of the soluble form of PHA synthase provides opportunities to examine the mechanistic details of the priming and initiation reactions.
  • the baculovirus system has been successful for the expression of a number of prokaryotic genes as soluble proteins, and insect cells, unlike bacterial expression systems, carry out a wide array of post-translational modifications, the baculovirus expression system appeared ideal for the expression of large quantities of soluble PHA synthase, a protein that must be modified by phosphopantetheine in order to be catalytically active (Gerngross et al., supra).
  • PHA synthase Purification of PHA synthase.
  • the purification procedure employed for PHA synthase is a modification of Gerngross et al. (supra) involving the elimination of the second liquid chromatographic step and inclusion of a protease-inhibitor cocktail in all buffers. All steps were carried out on ice or at 4° C. except where noted. Frozen cells were thawed on ice in 10 ml of Buffer A (10 mM KPi, pH 7.2, 05% glycerol, and 0.05% Hecameg) and then immediately homogenized prior to centrifugation and HA chromatography.
  • Buffer A 10 mM KPi, pH 7.2, 05% glycerol, and 0.05% Hecameg
  • N-terminal sequencing of the 64 kDa protein confirmed its identity as PHA synthase (FIG. 8). Two prominent N-termini, at amino acid residue 7 (alanine) and residue 10 (scrine) were obtained in a 3:2 ratio. This heterogeneous N-terminus presumably is the result of aminopeptidase activity.
  • Western analysis using a rabbit-anti-PHA synthase antibody corroborated the results of the sequencing and indicated the presence of at least three bands that resulted from proteolysis of PHA synthase (FIG. 7B, lanes 4-6). The antibody was specific for PHA synthase since neither T. ni nor baculoviral proteins showed reactivity (FIG. 7B, lanes 2 and 3).
  • N-terminal protein sequencing (FIG. 8) showed directly that the 44 kDa (band b) and 32 kDa (band d) proteins were derived from PHA synthase (fragments beginning at A181/N185 and at G387, respectively).
  • the 35-40 kDa (band c) protein gave low sequencing yields and may contain a blocked N-terminus. Inspection of FIG. 7B suggests that most degradation occurs following cell disruption since the total protein sample of this gel (lane 4) was prepared by boiling intact cells directly in SDS sample buffer while the HA sample (lane 6) went through the purification procedure described above.
  • Substrate (R-( ⁇ )3-HBCoA) substrate for these studies was prepared using the mixed anhydride method (Haywood et al., supra), and its concentration was determined by measuring A 260 .
  • the short pathlength cells (0.1 cm and 0.01 cm) allowed use of relatively high reaction concentrations while conserving substrate and enzyme.
  • Assay results showed an initial lag period of 60 seconds prior to the linear decrease in A 232 , and velocities were determined from the slope of these linear regions of the assay curves. The length of the lag period was variable and was inversely related to enzyme concentration.
  • FIGS. 10 and 11 show the V versus S and 1/V versus 1/S plots, respectively.
  • the double reciprocal plot was concave upward which is similar to results obtained from studies of the granular PHA synthase from Zooglea ramigera (Fukui et al., Arch. Microbiol ., 110, 149 (1976)) and suggests a complex reaction mechanism. Examinations of velocity and specific activity as a function of enzyme concentration are shown in FIGS. 12 and 13. These results confirm that specific activity of the synthase depends upon enzyme concentration.
  • the pH activity curve for A. eutrophus PHA synthase purified from T. ni cells is shown in FIG. 14. The curve shows a broad activity maximum centered around pH 8.5. This result agrees well with prior work on the A. eutrophus PHB synthase although it is significantly different than results obtained for the PHB synthase from Z. ramigera for which the optimum was determined to be pH 7.0.
  • PHA synthase purified from insect cells appears to be relatively stable. Examination of activity following storage, in liquid N 2 and at ⁇ 20° C. in the presence of 50% glycerol showed that approximately 50% of synthase activity remained after 7 weeks when stored in liquid N 2 and approximately 75% of synthase activity remained after 7 weeks when stored at ⁇ 20° C. in the presence of 50% glycerol.
  • PHA synthase produced in the baculovirus system was of sufficient potency to allow direct spectrophotometric analysis of the hydrolysis of the thioester bond of HBCoA at 232 nm. These assays revealed a lag period of approximately 60 seconds, the length of which was variable and inversely related to enzyme concentration. Such a lag period presumably reflects a slow step in the reaction, perhaps correlating to dimerization of the enzyme, the priming, and/or initiation steps in formation of PHB. Size exclusion chromatographic examination of the PHB synthase native MW indicated two forms of the synthase.
  • T. ni cells which had been infected with a baculovirus vector encoding rat FAS DH 0 and/or a baculovirus vector encoding PHA synthase were analyzed for the presence of granules. Infected cells were fixed in paraformaldehyde and incubated with anti-PHA synthase antibodies (Williams et al., Protein Exp. Purif ., 7, 203 (1996)). Granules were observed only in doubly infected cells (Williams et al., App. Environ. Micro ., 62, 2540 (1996)).
  • DNA sequence analysis of the vep ORFI showed that the order of catalytic domains is KS Q /AT/ACP/KS/AT/KR/ACP/KS/AT/DH/KR/ACP.
  • the complete DNA sequence, and corresponding amino acid sequence, of the vep ORFI is shown in FIG. 23 (SEQ ID NO:44 and SEQ ID NO:45, respectively).
  • the vep gene cluster contains 5 polyketide synthase modules, with a loading module at its 5′ end and an ending domain at its 3′ end.
  • Each of the sequenced modules includes a keto-ACP (KS), an acyltransferase (AT), a dehydratase (DH), a keto-reductase (KR), and an acyl carrier protein domain.
  • the six acyltransferase domains in the cluster are responsible for the incorporation of six acetyl-CoA moieties into the product.
  • the loading module contains a KS Q , an AT and an ACP domain.
  • KS Q refers to a domain that is homologous to a KS domain except that the active site cysteine (C) is replaced by glutamine (Q). There is no counterpart to the KS Q domain in the PKS clusters which have been previously characterized.
  • the ending domain is an enzyme which is responsible for the attachment of the nascent polyketide chain onto another molecule.
  • the amino acid sequence of ED resembles an enzyme, HetM, which is involved in Anabaena heterocyst formation.
  • HetM an enzyme which is involved in Anabaena heterocyst formation.
  • the homology between vep and HetM suggests that the polypeptide encoded by the vep gene cluster may synthesize a polyene-containing composition which is present in the spore coat or cell wall of its natural host, S. venezuelae.
  • DNA encoding a linker region separating a normal ACP-TE region in a PKS for example, the one found in met PKS ORF5 (FIG. 5)
  • the resulting vector can be introduced into a host cell and the TE activity, rate of release of the CoA product, and identity of the fatty acid chain determined.
  • the acyl chain that is most likely to be released is the CoA ester, specifically the 3-hydroxy-4-methyl heptenoylCoA ester, since the fully elongated chain is presumably released in this form prior to macrolide cyclization. If the CoA form of the acyl chain is not observed, then a gene encoding a CoA ligase will be cloned and co-expressed in the host cell to catalyze formation of the desired intermediate.
  • DNA encoding the extender unit AT in met module 1 is replaced to change the specificity from methylmalonylCoA to malonylCoA (FIGS. 4 - 6 ). This change eliminates methyl group branching in the ⁇ -hydroxy acyl chain. While comparison of known AT amino acid sequences shows high overall amino acid sequence conservation, distinct regions are readily apparent where significant deletions or insertions have occurred. For example, comparison of malonyl and methylmalonyl amino acid sequences reveals a 37 amino acid deletion in the central region of the malonyltransferase.
  • the met ORFI DNA encoding the 37 amino acid sequence of MMT will be deleted, and the resulting gene will be tested in a host cell for production of the desmethyl species, 3-hydroxyheptenoylCoA.
  • the DNA encoding the entire MMT can be replaced with a DNA encoding an intact MT to affect the desired chain construction.
  • DNA encoding DH/ER will be introduced into DNA encoding met ORFI module 1. This modification results in a multifunctional protein that generates a methylene group at C-3 of the acyl chain (FIG. 6).
  • the DNA encoding DH/ER will be PCR amplified from the available eryA or tyl PKS sequences, including the DNA encoding the required linker regions, employing a primer pair to conserved sequences 5′ and 3′ of the DNA encoding DH/ER.
  • the PCR fragment will then be cloned into the met ORFI.
  • the result is a DNA encoding a multifunctional protein (MT*DH/ER*TE*). This protein possesses the full complement of keto group processing steps and results in the production of heptenoylCoA.
  • the final domain replacement will involve the DNA encoding the starter unit acyltransferase in met module 1 (FIG. 5), to change the specificity from propionyl CoA to acetyl CoA. This shortens the (R)-3-hydroxy acyl chain from heptanoyl to hexanoyl.
  • the DNA encoding the catalytic domain will need to be generated based on a FAS or 6-methylsalicylic acid synthase model (Beck et al., Eur. J. Biochem ., 192, 487 (1990)) or by using site-directed mutagenesis to alter the specificity of the resident met PKS propionyltransferase sequence.
  • the DNA segment encoding the loading and the first module of the vep gene cluster was linked to the DNA segment encoding module 7 of the tyl gene cluster so as to yield a recombinant DNA molecule encoding a fusion polypeptide which has no amino acid differences relative to the corresponding amino acid sequence of the parent modules.
  • the fusion polypeptide catalyzes the synthesis of 3-hydroxyl-4-hexenoic acid.
  • the recombinant DNA molecule was introduced into SCP2, a Streptomyces vector, under the control of the act promoter (pDHS502, FIG. 20).
  • a polyhydroxyalkanoate polymerase gene, phaC1 from Pseudomonas oleavorans was then introduced downstream of the recombinant PKS cluster (pDHS505; FIGS. 22 and 23).
  • the DNA segment encoding the polyhydroxyalkanoate polymerase is linked to the DNA segment encoding the recombinant PKS synthase so as to yield a fusion polypeptide which synthesizes polyhydroxyhexenoate in Streptomyces.
  • Polyhydroxyhexenoate a biodegradable thermoplastic
  • Streptomyces or as a major product in any other organism.
  • unsaturated double bond in the side chain of polyhydroxyhexenoate may result in a polymer which has superior physical properties as a biodegradable thermoplastic over the known polyhydroxyalkanoates.
  • ORFs open reading frames downstream of the PKS genes
  • erythromycin biosynthetic machinery may rely on a general cellular pool of TDP-4-keto-6-deoxy-D-glucose for mycarose and desosamine formation. Depicted in FIG. 24 is a biosynthetic pathway for TDP-D-desosamine.
  • a disruption plasmid (pBL1005) derived from pKC1139 (containing an apramycin resistance marker) (Bierman et al., 1992) was constructed in which a 1.0 kb NcoI/XhoI fragment of the desR gene was deleted and replaced by the thiostrepton resistance (tsr) gene (1.1 kb) (Bibb et al., 1985) via blunt-end ligation.
  • This plasmid was used to transform E. coli S17-1, which serves as the donor strain to introduce the pBL1005 construct through conjugal transfer into the wild-type S.
  • the desired mutant was first grown at 29° C. in seed medium for 48 hours, and then inoculated and grown in vegetative medium for another 48 hours (Cane et al., 1993). After the fermentation broth was centrifuged at 10,000 g to remove cellular debris and mycelia, the supernatant was adjusted to pH 9.5 with concentrated KOH, and extracted with an equivolume of chloroform (four times). The organic layer was dried over sodium sulfate and evaporated to dryness.
  • amber oil-like crude products were first subjected to flash chromatography on silica gel using a gradient of 0-40% methanol in chloroform, followed by HPLC purification on a C 18 column eluted isocratically with 45% acetonitrile in 57 mM ammonium acetate (pH 6.7).
  • methymycin a compound of formula (1)
  • neomethymycin a compound of formula (2)
  • two new products were isolated.
  • the yield of a compound of formula (13) and a compound of formula (14) was each in the range of 5-10 mg/L of fermentation broth.
  • a compound of formula (1) and a compound of formula (2) remained to be the major products.
  • the translated desR gene has a leader sequence characteristic of secretory proteins (von Heijne, 1986; von Heijne, 1989).
  • DesR may be transported through the cell membrane and hydrolyze the modified antibiotics extracellularly to activate them (FIG. 25).
  • DesR the encoded protein
  • tsr thiostrepton resistance
  • two new products were isolated from the fermentation of the mutant strain. These two new compounds, which are biologically inactive, were found to be C-2′ ⁇ -glucosylated methymycin and neomethymycin. Since the translated desR gene has a leader sequence characteristic of secretory proteins, the DesR protein may be an extracellular ⁇ -glucosidase capable of removing the added glucose from the modified antibiotics to activate them.
  • the desR gene can be used as a probe to identify homologs in other antibiotic biosynthetic pathways. Deletion of the corresponding macrolide glycosidase gene in other antibiotic biosynthetic pathways may lead to the accumulation of the glycosylated products which may be used as prodrugs with reduced cytotoxicity. Glycosylation also holds promise as a tool to regulate and/or minimize the potential toxicity associated with new macrolide antibiotics produced by genetically engineered microorganisms.
  • macrolide glycosidases which can be used for the activation of newly formed antibiotics that have been deliberately deactivated by engineered glycosyltransferases, may be useful in the development of novel antibiotics using the combinatorial biosynthetic approach (Hopwood et al., 1990; Katz et al., 1993; Hutchinson et al., 1995; Carreras et al., 1997; Kramer et al., 1996; Khosla et al., 1996; Jacobsen et al., 1997; Marsden et al., 1998).
  • This class of clinically important drugs consists of two essential structural components: a polyketide aglycone and the appended deoxy sugars (Omura, 1984).
  • the aglycone is synthesized via sequential condensations of acyl thioesters catalyzed by a highly organized multi-enzyme complex, polyketide synthase (PKS) (Hopwood et al., 1990; Katz, 1993; Hutchinson et al., 1995; Carreras et al., 1997).
  • PKS polyketide synthase
  • neomethymycin (a compound of formula (2) in FIG. 24) and its co-metabolite, neomethymycin (a compound of formula (2) in FIG. 24)), of Streptomyces venezuelae present themselves as an attractive system to study the formation of deoxy sugars (Donin et al., 1953; Djerassi et al., 1956). First, they carry D-desosamine (a compound of formula (3)) a prototypical aminodeoxy sugar that also exists in erythromycin. Second, since desosamine is the only sugar attached to the macrolactone of formula (1) and (2), identification of the sugar biosynthetic genes within the methymycin/neomethymycin gene cluster should be possible with much more certainty.
  • the desVI gene which has been predicted to encode the N-methyltransferase, was chosen as a target (Gaisser et al., 1997; Summers et al., 1997).
  • the deduced desVI product is most closely related to that of eryCVI from the erythromycin producing strain Saccharopolyspora erythraea (70% identity), and also strongly resembles the predicted products of rdmD from the rhodomycin cluster of Streptomyces purpurascens (Niemi et al., 1995), srmX from the spiromycin cluster of Streptomyces ambofaciens (Geistlich et al., 1992), and tylMl from the tylosin cluster of Streptomyces fradiae (Gandecha et al., 1997).
  • All of these enzymes contain the consensus sequence LLDV(I)ACGTG (SEQ ID NO:25) (Gaisser et al., 1997; Summers et al., 1997), near their N-terminus, which is part of the S-adenosylmethionine binding site (Ingrosso et al., 1989; Haydock et al., 1991).
  • a plasmid pBL3001 in which desVI was replaced by the thiostrepton gene (tsr) (Bibb et al., 1985), was constructed and introduced into wild type S. venezuelae by conjugal transfer using E. coli S17-1 (Bierman et al., 1992).
  • Two identical double crossover mutants, KdesVI-21 and KdesVI-22 with phenotypes of thiostrepton resistance (Thio R ) and apamycin sensitivity (Apm s ) were obtained.
  • Southern blot hybridization using tsr or a 1.1 kb HincII fragment from the desVII region further confirmed that the desVI gene was indeed replaced by tsr on the chromosome of these mutants.
  • the KdesVI-21 mutant was first grown at 29° C. in seed medium (100 mL) for 48 hours, and then inoculated and grown in vegetative medium (3 L) for another 48 hours (Cane et al., 1993).
  • the fermentation broth was centrifuged to remove the cellular debris and mycelia, and the supernatant was adjusted to pH 9.5 with concentrated KOH, followed by extraction with chloroform.
  • No methymycin or neomethymycin was found; instead, the 10-deoxy-methynolide (6) (350 mg) (Lambalot et al., 1992) and two new macrolides containing an N-acetylated amino sugar, a compound of formula (7) (20 mg) and a compound of formula (8) (15 mg), were isolated.
  • Their structures were determined by spectral analyses and high-resolution MS.
  • methymycin/neomethymycin glycosyltransferase can also tolerate structural variants of its sugar substrate indicates that at least some glycosyltransferases in antibiotic biosynthetic pathways may be useful to create biologically active hybrid natural products via genetic engineering.
  • venezuelae deletion mutant strain resulted in the accumulation of a methymycin/neomethymycin analogue carrying an N-acetylated aminodeoxy sugar. Isolation and characterization of these derivatives not only provide the first direct evidence confirming the identity of desVI as the N-methyltransferase gene, but also demonstrate the feasibility of preparing novel sugars by the gene deletion approach. Most significantly, the results also revealed that the glycosyltransferase of methymycin/neomethymycin exhibits a relaxed specificity towards its sugar substrates.
  • E. coli DH5a was used as a cloning host.
  • E. coli LE392 was the host for a cosmid library derived from S. venezuelae genomic DNA.
  • LB medium was used in E. coli propagation.
  • Streptomyces venezuelae ATCC 15439 was obtained as a freeze-dried pellet from ATCC.
  • Media for vegetative growth and antibiotic production were used as described (Lambalot et al., 1992). Briefly, SGGP liquid medium was for propagation of S. venezuelae mycelia.
  • Sporulation agar (SPA) was used for production of S. venezuelae spores.
  • Methymycin production was conducted in either SCM or vegetative medium and pikromycin production was performed in Suzuki glucose-peptone medium.
  • pUC119 was the routine cloning vector
  • pNJ1 was the cosmid vector used for genomic DNA library construction.
  • Plasmid vectors for gene disruption were either pGM160 (Muth et al., 1989) or pKC1139 (Bierman et al., 1992). Plasmid, cosmid, and genomic DNA preparation, restriction digestion, fragment isolation, and cloning were performed using standard procedures (Sambrook et al., 1989; Hopwood et al., 1985).
  • the cosmid library was made according to instructions from the Packagene ?-packaging system (Promega).
  • nucleotide Sequence of the pik Cluster The nucleotide sequence of the pik cluster was completely determined and shown to contain 18 open reading frames (ORFs) that span approximately 60 kb. Central to the cluster are four large ORFs, pikAI, pikAII, pikAIII, and pikAIV, encoding a multifunctional PKS (FIG. 28). Analysis of the six modules comprising the pik PKS indicated that it would specify production of narbonolide, the 14-membered ring aglycone precursor of narbomycin and pikromycin (FIG. 28).
  • PikAI-AIII module L-5
  • PikAIII the domain organization of PikAI-AIII (module L-5) is consistent with the predicted biosynthesis of 10-deoxymethynolide except for the absence of a TE function at the C-terminus of Pik module 5 (PikAIII).
  • the lack of a TE domain in PikAIII may be compensated by the type II TE (encoded by pikAV) immediately downstream of pikAIV.
  • pikR1 and pikR2 are found upstream of the pik PKS (FIG. 29), which presumably provide cellular self-protection for S. venezuelae.
  • the genetic locus for desosamine biosynthesis and glycosyl transfer are immediately downstream of pikA. Seven genes, desI, desII, desIII, desIV, desV, desVI, and desVIII, are responsible for the biosynthesis of the deoxysugar, and the eighth gene, desVII, encodes a glycosyltransferase that apparently catalyzes transfer of desosamine onto the alternate (12- and 14-membered ring) polyketide aglycones. The existence of only one set of desosamine genes indicates that DesVIII can accept both 10-deoxymethynolide and narbonolide as substrates (Jacobsen et al., 1997). The largest ORF in the des locus, desR, encodes a ⁇ -glycosidase that is involved in a drug inactivation-reactivation cycle for bacterial self-protection.
  • a gene (pikC) encoding a cytochrome P450 hydroxylase similar to eryF (Andersen et al., 1992), and eryK (Stassi et al., 1993), PikC, and a gene (pikD) encoding a putative regulator protein, PikD (FIG. 28).
  • PikC is the only P450 hydroxylase identified in the entire pik cluster, suggesting that the enzyme can accept both 12- and 14-membered ring macrolide substrates and, more remarkably, it is active on both C-10 and C-12 of the YC-17 (12-membered ring intermediate) to produce methymycin and neomethymycin (FIG. 30).
  • PikD is a putative regulatory protein similar to ORFH in the rapamycin gene cluster (Schwecke et al., 1995).
  • the combined functionality coded by the eighteen genes in the pik cluster predicts biosynthesis of methymycin, neomethymycin, narbomycin and pikromycin (Table 2). Flanking the pik cluster locus are genes presumably involved in primary metabolism and genes that may be involved in both primary and secondary metabolism.
  • An S-adenosyl-methionine synthase gene is located downstream of pikD that may help to provide the methyl group in desosamine synthesis.
  • a threonine dehydratase gene was identified upstream of pikR1 that may provide precursors for polyketide biosynthesis. It is not apparent that any of these genes are dedicated to antibiotic biosynthesis and they are not directly linked to the pik cluster.
  • DesIII 292 a-D-Glucose-1-phosphate thymidylyltransferase DesIV 337 TDP-glucose 4, 6-dehydratase DesV 379 Transaminase DesVI 237 N,N-dimethyltransferase DesVII 426 Glycosyl transferase DesVIII 402 Tautomerase? DesR 809 ⁇ -Glucosidase (involved in resistance mechanism) PikC 418 P450 hydroxylase PikD 945? Putative regulator PikR1 336 rRNA methyltransferase (mls resistance) PikR2 288? rRNA methyltransferase (mls resistance)
  • mutant LZ3001 in which mutation in an enzyme downstream of pikA V accumulated 10-deoxymethynolide and narbonolide.
  • mutant AX905 failed to accumulate these intermediates suggested that the polyketide chains were not efficiently released from this PKS protein in the absence of Pik TEII. Therefore, Pik TEII plays a crucial role in polyketide chain release and cyclization, and it presumably provides the mechanism for alternative termination in pik polyketide biosynthesis.
  • PikC is the sole enzyme catalyzing hydroxylation of both YC-17 (at C-10 and C-12) and narbomycin (at C-12).
  • the relaxed substrate specificity of PikC and its regional specificity at C-10 and C-12 provide another layer of metabolite diversity in the pik-encoded biosynthetic system.
  • DesVII the glycosyltransferase in the pik cluster
  • PikC the P450 hydroxylase
  • pikA evolved in a line analogous to eryA and oleA since each of these PKSs specify the synthesis of 14-membered ring macrolactones. Therefore, pik may have acquired the capacity to generate methymycin when a mutation in the primordial pikAIII-pikAIV linker region caused splitting of Pik module 5 and 6 into two separate gene products. This notion is raised by two features of the nucleotide sequence. First, the intergenic region between pikAIII and pikAIV, which is 105 bp, may be the remanent of an intramodular linker peptide of 35 amino acids.
  • pikAIV the potential for independently regulated expression of pikAIV is implied by the presence of a 100 nucleotide region at the 5′ end of the gene that is relatively AT-rich (62% as comparing 74% G+C content in coding region).
  • Pik TEII The role of Pik TEII in alternative termination of polyketide chain elongation intermediates provides a unique aspect of diversity generation in natural product biosynthesis.
  • Engineered polyketides of different chain length are typically generated by moving the TE catalytic domain to alternate positions in a modular PKS (Cortes et al., 1995). Repositioning of the TE domain necessarily abolishes production of the original full-length polyketide so only one macrolide is produced each time.
  • the independent Pik TEII polypeptide presumably has the flexibility to catalyze termination at different stages of polyketide assembly, therefore enabling the system to produce multiple products of variant chain length.
  • Combinatorial biology technologies can now exploit this system for generating molecular diversity through construction of novel PKS systems with TEIIs for simultaneous production of several new molecules as opposed to the TE domains alone that limit catalysis to a single termination step.
  • Pik TEII sequences similar to Pik TEII are found in almost all known polyketide and non-ribosomal polypeptide biosynthetic systems (Marahiel et al., 1997).
  • the pik TEII is the first to be characterized in a modular PKS.
  • recent work on a TEII gene in the lipopeptide surfactin biosynthetic cluster demonstrated that srf-TEII plays an important role in polypeptide chain release, and may suggest that srf-TEII reacts at multiple stages in peptide assembly as well (Marahiel et al., 1997).
  • the pik cluster represents the least complex yet most versatile modular PKS system so far investigated. This simplicity provides the basis for a compelling expression system in which novel active ketoside products are engineered and produced with considerable facility for discovery of a diverse range of new biologically active compounds.
  • Combinatorial biology involves the genetic manipulation of multistep biosynthetic pathways to create molecular diversity in natural products for use in novel drug discovery.
  • PKSs represent one of the most amenable systems for combinatorial technologies because of their inherent genetic organization and ability to produce polyketide metabolites, a large group of natural products generated by bacteria (primarily actinomycetes and myxobacteria) and fungi with diverse structures and biological activities.
  • Complex polyketides are produced by multifunctional PKSs involving a mechanism similar to long-chain fatty acid synthesis in animals (Hopwood et al., 1990).
  • Streptomyces venezuelae ATCC 15439 is notable in its ability to produce two distinct groups of macrolide antibiotics.
  • Methymycin and neomethymycin are derived from the 12-membered ring macrolactone 10-deoxymethynolide, while narbomycin and pikromycin are derived from the 14-membered ring macrolactone, narbonolide.
  • the cloning and characterization of the biosynthetic gene cluster for these antibiotics reveals the key role of a type II thioesterase in forming a metabolic branch through which polyketides of different chain length are generated by the pikromycin multifunctional polyketide synthase (PKS).
  • PKS pikromycin multifunctional polyketide synthase
  • pikA a set of genes for desosamine (des) biosynthesis and macrolide ring hydroxylation.
  • the glycosyl transferase encoded by desVIII
  • the pikC-encoded P450 hydroxylase provides yet another layer of structural variability by introducing regiochemical diversity into the macrolide ring systems.
  • PikTEII is a small enzyme (281 amino acids) encoded by pikAV in S. venezuelae .
  • the primary function of the wild-type enzyme is to catalyze the release of a polyketide chain at the fifth module in the pikA pathway as 10-deoxymethonolide.
  • the enzyme most likely binds to the fifth module (PikAIII) ACP (ACP5) and releases the acyl chain attached to it.
  • TEII and its cognate ACP5 can be exploited to produce a polyketide having different chain lengths by moving Pik ACP5 to a different position in the cluster. For example, by moving ACP5 into the second module in place of ACP2, a triketide instead of hexoketide may be produced by the cluster. Further, moving KR5 together with ACP5 into the second module, and replacing the DH, KR, and ACP domains, a 3-hydroxyl triketide is produced that is structurally suitable as PHA monomer. A mutant TEII (mTEII) catalyzes the release of the triketide as CoA form.
  • mTEII mutant TEI
  • the triketide-CoA 3,5-dihydroxyl-4-methyl-heptonyl-CoA, is a substrate for PHA polymerase, e.g., PhaC1 from P. olivarus , which, in turn, can incorporate the monomer into a polymer.
  • PHA polymerase e.g., PhaC1 from P. olivarus
  • a second strategy includes the harvesting of a polyketide intermediate as a CoA derivative using a TEI which has been converted to an acyl-CoA transferase (mTE).
  • mTE acyl-CoA transferase
  • the second strategy for 3-hydroxyacyl-CoA monomer production is to exploit the TE domain (TEI) within the PKS module. It has been demonstrated that the TE domain can release polyketide intermediates attached to the ACP domain within the same module. Moving the TEI to a different position in a PKS cluster results in the production of a polyketide having a different chain length.
  • a mutant TEI (i.e., one which is an acyl-CoA transferase) releases the polyketide intermediate to acyl-CoA, which then is polymerized by PHA synthetase.
  • a mutant TE domain in the pikA gene cluster is moved into pik module 1, fusing it immediately downstream of ACP1.
  • the recombinant enzyme produces 2-(S)-methyl-3(R)-hydroxylveleratyl-CoA, which is a suitable substrate for PHA polymerase PhaC1. Therefore, the coexpression of the polymerase with the recombinant PKS produces a polymer.
  • a third strategy is to directly collect polyketide intermediates as substrates for PHA synthesis by fusing a PHA polymerase with a polyketide synthase.
  • the first two strategies produce 3-hydroxylacyl-CoA as a substrate for PHA synthesis by employing a mutant PKS enzyme (TEI or TEII).
  • TEI or TEII a mutant PKS enzyme
  • the third strategy fuses a PHA polymerase downstream of an ACP in a PKS protein.
  • the PHA synthetase then serves as a domain within the chimeric multifunctional enzyme in place of a TE domain.
  • the PKS portion of the protein catalyzes the synthesis of a 3-hydroxylacyl-ACP intermediate and then the PHA synthetase domain accepts it as substrate and adds the 3-hydroxylacyl monomer to the growing polyhydroxyalkanoate chain.
  • the process regenerates ACP function so that the reaction can go on repeatedly to synthesize a PHA of multiple units.
  • a phaC1 gene is fused directly downstream of pik ACP1 so as to produce a chimeric enzyme that catalyzes the synthesis of a polymer.
  • One aspect of the invention provides useful reagents and methods for the production of polyketides.
  • the invention provides recombinant vectors encoding the complete PKS gene cluster and associated modification enzymes for the polyketide narbomycin.
  • the KS domain of the PKS is inactivated, preferably by site-specific mutagenesis of the corresponding coding sequence, and non-natural activated diketides are fed to a strain harboring the mutant PKS (in the chromosome or in an extrachromasomally replicating vector) to produced a desired compound. This technique is more fully described in PCT/US98/14911 and U.S. Pat. No. 6,066,721, issued on May 23, 2000, both of which are incorporated herein by reference.
  • the invention provides nucleic acids that encode the various domains, including the KS, AT, ACP, KR, DH, ER, and TE domains of the loading and all six extender modules of the narbomycin gene cluster.
  • the invention provides nucleic acids that encode the modification enzymes that encode the activities that modify the narbomycin polyketide.
  • the present invention provides in recombinant form the desosamine biosynthetic and transferase enzymes.
  • the invention provides mutated versions of the foregoing that differ from their unmutated counterparts in activity or specificity.
  • the invention provides chimeric PKS modules, ORFs, and gene clusters comprising one or more domains of the narbonolide PKS (or a mutant form thereof) and one or more domains of a non-narbonolide PKS.
  • the invention provides host cells comprising such vectors, methods of culturing host cells to produce the recombinant PKS of the invention as well as the polyketides produced by those PKS, and a variety of novel polyketides.
  • cosmids pKOSO37-23, pKOSO37-25, and pKOSO37-26 are subjected to DNA sequence analysis.
  • the SuperCos.TM. vectors (Stratagene) from which these cosmids were derived comprise sequencing sites called T3 and T7 that facilitate sequencing.
  • Contig 143 is composed of two sequences, designated 143a and 143b, below.
  • Contig 143a (SEQ ID NO:1) ACAGGGGATATCCCGCTCCAGGCGAACGGTAGCCGCGTGCCCTCGCCGA ACGCCCCGCCCGCACCGGCCGCCTGCACGGCGGCGTCGAGCAGCGCCGG GTGGAGGCCGAACCGCGCGCCCTCGGCGCCCGCGACCTCCGTCGGCAGG GCCACGTCGGCGAACACCTCTTCGCCGCGCCGCCAGACGCCACGGACGC CCCGGAAGAGGGGCCCGTAGCCGTATCCGCTCGCCGCGAAGCGGTCGTA CAGACCGTCCACGTCCACTGCTTCGGCACCCGCCGGGGGCCAGGCCTCC GGGTCGGCGACAGGGGGGGCGGTGCGATCCGTACGGGCGAGCACACCGGTC GCGTGCCGCGTCCACTCCGGCTCGCCCGGCGCGTCCTCCGGGTGCGT GGAGCACGAAGGTA
  • Sequence information generated from cosmids of the invention can be used to generate additional nucleic acids of the invention as well as to generate additional sequence information regarding the narbonolide PKS enzyme and narbomycin modification enzymes.
  • Residue 4 is either V or I.

Landscapes

  • Organic Chemistry (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Health & Medical Sciences (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biomedical Technology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Molecular Biology (AREA)
  • Physics & Mathematics (AREA)
  • Biophysics (AREA)
  • Plant Pathology (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

A novel pathway for the synthesis of polyhydroxyalkanoates is provided. A method of synthesizing a recombinant polyhydroxyalkanoate monomer synthase is also provided. These recombinant polyhydroxyalkanoate synthases are derived from multifunctional fatty acid synthases or polyketide synthases and generate hydroxyacyl acids capable of polymerization by a polyhydroxyalkanoate synthase. Also provided is a biosynthetic gene cluster for methymycin and pikomycin as well as a biosynthetic gene cluster for desosamine.

Description

    CROSS-REFERENCE TO RELATED APPLICATIONS
  • This application is a continuation-in-part of U.S. application Ser. No. 09/836,821, filed on Apr. 17, 2001, U.S. application Ser. No. 09/860,846, filed on May 18, 2001, and U.S. application Ser. No. 09/861,289, filed on May 18, 2001, which are divisions of U.S. application Ser. No. 09/105,537, filed on Jun. 26, 1998, now U.S. Pat. No. 6,265,202, the disclosures of which are incorporated by reference herein.[0001]
  • STATEMENT OF GOVERNMENT RIGHTS
  • [0002] This invention was made with a grant from the Government of the United States of America (grants GM48562, GM35906 and GM54346 from the National Institutes of Health and a grant from the Office of Naval Research). The Government may have certain rights in the invention.
  • BACKGROUND OF THE INVENTION
  • Polyhydroxyalkanoates (PHAs) are one class of biodegradable polymers. The first identified member of the PHAs thermoplastics was polyhydroxybutyrate (PHB), the polymeric ester of D(−)-3-hydroxybutyrate. The biosynthetic pathway of PHB in the gram negative bacterium [0003] Alcaligenes eutrophus is depicted in FIG. 1. PHAs related to PHB differ in the structure of the pendant arm, R (FIG. 2). For example, R═CH3 in PHB, while R═CH2CH3 in polyhydroxyvalerate, and R═(CH2)4CH3 in polyhydroxyoctanoate.
  • The genes responsible for PHB synthesis in [0004] A. eutrophus have been cloned and sequenced. (Peoples et al., J. Biol. Chem., 264, 15293 (1989); Peoples et al., J. Biol. Chem., 264, 15298 (1989)). Three enzymes: β-ketothiolase (phbA), acetoacetyl-CoA reductase (phbB), and PHB synthase (phbC) are involved in the conversion of acetyl-CoA to PHB. The PHB synthase gene encodes a protein of Mr=63,900 which is active when introduced into E. coli (Peoples et al., J. Biol. Chem., 264, 15298 (1989)).
  • Although PHB represents the archetypical form of a biodegradable thermoplastic, its physical properties preclude significant use of the homopolymer form. Pure PHB is highly crystalline and, thus, very brittle. However, unique physical properties resulting form the structural characteristics of the R groups in a PHA copolymer may result in a polymer with more desirable characteristics. These characteristics include altered crystallinity, UV weathering resistance, glass to rubber transition temperature (T[0005] g), melting temperature of the crystalline phase, rigidity and durability (Holmes et al., EPO 00052 459; Anderson et al., Microbiol. Rev., 54, 450 (1990)). Thus, these polyesters behave as thermoplastics, with melting temperatures of 50-180° C., which can be processed by conventional extension and molding equipment.
  • Traditional strategies for producing random PHA copolymers involve feeding short- and long-chain fatty acid monomers to bacterial cultures. However, this technology is limited by the monomer units which can be incorporated into a polymer by the endogenous PHA synthase and the expense of manufacturing PHAs by existing fermentation methods (Haywood et al., [0006] FEMS Microbiol. Lett., 57, 1 (1989); Poi et al., Int. J. Biol. Macromol., 12, 106 (1990); Steinbuchel et al., In: Novel Biomaterials from Biological Sources. D. Byron (ed.), MacMillan, N.Y. (1991); Valentin et al., Appl. Microbiol. Biotechnical, 36, 507 (1992)).
  • The production of diverse hydroxyacylCoA monomers for homo- and co-polymeric PHAs also occurs in some bacteria through the reduction and condensation pathway of fatty acids. This pathway employs a fatty acid synthase (FAS) which condenses malonate and acetate. The resulting β-keto group undergoes three processing steps, β-keto reduction, dehydration, and enoyl reduction, to yield a fully saturated butyryl unit. However, this pathway provides only a limited array of PHA monomers which vary in alkyl chain length but not in the degree of alkyl group branching, saturation, or functionalization along the acyl chain. [0007]
  • The biosynthesis of polyketides, such as erythromycin, is mechanistically related to formation of long-chain fatty acids. However, polyketides, in contrast to FASs, retain ketone, hydroxyl, or olefinic functions and contain methyl or ethyl side groups interspersed along an acyl chain comparable in length to that of common fatty acids. This asymmetry in structure implies that the polyketide synthase (PKS), the enzyme system responsible for formation of these molecules, although mechanistically related to a FAS, results in an end product that is structurally very different than that of a long-chain fatty acid. [0008]
  • Because PHAs are biodegradable polymers that have the versatility to replace petrochemical-based thermoplastics, it is desirable that new, more economical methods be provided for the production of defined PHAs. Thus, what is needed are methods to produce recombinant PHA monomer synthases for the generation of PHA polymers. [0009]
  • SUMMARY OF THE INVENTION
  • The present invention provides a method of preparing a polyhydroxyalkanoate synthase. The method comprises introducing an expression cassette into a non-plant eukaryotic cell. The expression cassette comprises a DNA molecule encoding a polyhydroxyalkanoate synthase, e.g., a polyhydroxybutyrate synthase, operably linked to a promoter functional in the non-plant eukaryotic cell. The DNA molecule may be obtained from a bacterium such as [0010] Alcaligenes eutrophus. The DNA molecule encoding the polyhydroxyalkanoate synthase is then expressed in the cell. Thus, another embodiment of the invention provides a purified recombinant polyhydroxybutyrate synthase isolated from a host cell which expresses the synthase.
  • Another embodiment of the invention is a method of preparing a polyhydroxyalkanoate polymer. The method comprises introducing a first expression cassette and a second expression cassette into a eukaryotic cell. The first expression cassette comprises a DNA segment encoding a fatty acid synthase in which the dehydrase activity has been inactivated that is operably linked to a promoter functional in the eukaryotic cell, e.g., an insect cell. The inactivation preferably is via a mutation in the catalytic site of the dehydrase. The second expression cassette comprises a DNA segment encoding a polyhydroxyalkanoate synthase operably linked to a promoter functional in the eukaryotic cell. The expression cassettes may be on the same or separate molecules. The DNA segments in the expression cassettes are expressed in the cell so as to yield a polyhydroxyalkanoate polymer. [0011]
  • Another embodiment of the invention is a baculovirus expression cassette comprising a nucleic acid molecule encoding a polyhydroxyalkanoate synthase operably linked to a promoter functional in an insect cell. Preferably, the nucleic acid molecule is obtained from a bacterium, e.g., [0012] Alcaligenes eutrophus.
  • The present invention also provides an expression cassette comprising a nucleic acid molecule encoding a polyhydroxyalkanoate monomer synthase operably linked to a promoter functional in a host cell. The nucleic acid molecule comprises a plurality of DNA segments. Thus, the nucleic acid molecule comprises at least a first and a second DNA segment. No more than one DNA segment is derived from the eryA gene cluster of [0013] Saccharopolyspora erythraea. The first DNA segment encodes a first module and the second DNA segment encodes a second module, wherein the DNA segments together encode a polyhydroxyalkanoate monomer synthase. The source of at least one DNA segment is preferably bacterial DNA. It is preferred that the first DNA segment encodes the first module form the vep gene cluster and the second DNA segment encodes module 7 from the tyl P gene cluster. The nucleic acid molecule may optionally further comprise a third DNA segment encoding a polyhydroxyalkanoate synthase. Alternatively, a second nucleic acid molecule encoding a polyhydroxyalkanoate synthase may be introduced into the host cell.
  • Also provided is an isolated and purified DNA molecule. The DNA molecule comprises a plurality of DNA segments. Thus, the DNA molecule comprises at least a first and a second DNA segment. The first DNA segment encodes a first module and the second DNA segment encodes a second module. No more than one DNA segment is derived from the eryA gene cluster of [0014] Saccharopolyspora erythraea. Also, it is preferred that no more than one module is derived from the gene cluster from Streptomyces hygroscopicus that encodes rapamycin or the gene cluster that encodes spiramycin. Together the DNA segments encode a recombinant polyhydroxyalkanoate monomer synthase. A preferred embodiment of the invention employs a first DNA segment derived from the vep gene cluster of Streptomyces. Another preferred embodiment of the invention employs a second DNA segment derived from the tyl gene cluster of Streptomyces. A further preferred embodiment of the isolated DNA molecule of the invention includes a DNA segment encoding a polyhydroxyalkanoate synthase.
  • Yet another preferred embodiment is an isolated DNA molecule of the invention wherein the second DNA segment comprises a DNA encoding a thioesterase which is located at the 3′ end of the second DNA segment. More preferably, the second DNA segment comprises a DNA encoding an acyl carrier protein which is located 5′ to the DNA encoding the thioesterase. Even more preferably, the second DNA segment comprises a DNA encoding a linker region, wherein the DNA encoding the linker region is located between the DNA encoding the acyl carrier protein and the DNA encoding the thioesterase. [0015]
  • Another embodiment of the isolated DNA molecule of the invention comprises a first DNA segment comprising DNA encoding two acyl transferases, wherein the DNA encoding the first acyl transferase is 5′ to the DNA encoding the second acyl transferase. Preferably, the second acyl transferase adds acyl groups to malonylCoA. [0016]
  • Other embodiments of the isolated DNA molecule include a first DNA segment comprising a DNA encoding a dehydrase, a first DNA segment comprising a DNA encoding a dehydrase and an enoyl reductase, a second DNA segment comprising a DNA encoding an inactive dehydrase, or a first DNA segment comprising a DNA encoding an acyl transferase. A preferred acyl transferase binds an acyl CoA substrate. [0017]
  • A further embodiment of the isolated DNA molecule includes a first DNA segment encoding a first module and a second DNA segment encoding a second module, wherein the DNA segments together encode a recombinant polyhydroxyalkanoate monomer synthase, and wherein no more than one DNA segment is derived from the eryA gene cluster of [0018] Saccharopolyspora erythraea. Also preferably, at least one DNA segment is derived from the vep gene cluster or the tyl gene cluster. In one preferred embodiment, the first DNA segment encodes the first module from the vep gene cluster and the second DNA segment encodes module 7 from the tyl gene cluster.
  • Yet another embodiment of the invention is a method of providing a polyhydroxyalkanoate monomer. The method comprises introducing a DNA molecule into a host cell. The DNA molecule comprises a DNA segment encoding a recombinant polyhydroxyalkanoate monomer synthase operably linked to a promoter functional in the host cell. The DNA encoding the recombinant polyhydroxyalkanoate monomer synthase, which synthase comprises at least a first module and a second module, is expressed in the host cell so as to generate a polyhydroxyalkanoate monomer. Preferably, the first DNA segment encodes the first module from the vep gene cluster and the second DNA segment encodes [0019] module 7 from the tyl P gene cluster. Also preferably, the DNA molecule further comprises a DNA segment encoding a polyhydroxyalkanoate synthase.
  • Also provided is a method of preparing a polyhydroxyalkanoate polymer. The method comprises introducing a first DNA molecule and a second DNA molecule into a host cell. The first DNA molecule comprises a DNA segment encoding a recombinant polyhydroxyalkanoate monomer synthase. The recombinant polyhydroxyalkanoate monomer synthase comprises a plurality of modules. Thus, the monomer synthase comprises at least a first module and a second module. The first DNA molecule is operably linked to a promoter functional in a host cell. The second DNA molecule comprises a DNA segment encoding a polyhydroxyalkanoate synthase operably linked to a promoter functional in the host cell. The DNAs encoding the recombinant polyhydroxyalkanoate monomer synthase and polyhydroxyalkanoate synthase are expressed in the host cell so as to generate a polyhydroxyalkanoate polymer. [0020]
  • Yet another embodiment of the invention is an isolated and purified DNA molecule. The DNA molecule comprises a plurality of DNA segments. That is, the DNA molecule comprises at least a first and a second DNA segment. The first DNA segment encodes a fatty acid synthase and the second DNA segment encodes a module of a polyketide synthase. A preferred embodiment of the invention employs a second DNA segment encoding a module which comprises a β-ketoacyl synthase amino-terminal to an acyltransferase which is amino-terminal to a ketoreductase which is amino-terminal to an acyl carrier protein which is amino-terminal to a thioesterase. Other preferred embodiments of the invention include a second DNA segment that is 3′ to the DNA encoding the fatty acid synthase, a first DNA segment encoding a fatty acid synthase and a second DNA segment encoding a module of a polyketide synthase, or a second DNA segment that is separated from the first DNA segment by a DNA encoding a linker region. Preferred linker regions include the linker region from tyl ORF1 ACP[0021] 1-KS2, tyl ORF1 ACP2-KS3, tyl ORF3 ACP5-KS6, eryA ORF1 ACP1-KS1, eryA ORF1 ACP2-KS2, eryA ORF2 ACP3-KS4, and eryA ORF2 ACP5-KS6.
  • The invention also provides a method of preparing a polyhydroxyalkanoate monomer. The method comprises introducing a DNA molecule comprising a plurality of DNA segments into a host cell, e.g., an insect cell, a Streptomyces cell or a Pseudomonas cell. Thus, the DNA molecule comprises at least a first and a second DNA segment. The first DNA segment encodes a fatty acid synthase operably linked to a promoter functional in the host cell. Preferably, the fatty acid synthase is eukaryotic in origin. Alternatively, the fatty acid synthase is prokaryotic in origin. The second DNA segment encodes a polyketide synthase. Preferably, the second DNA segment encodes the tyl module F. The second DNA segment is located 3′ to the first DNA segment. The first DNA segment is linked to the second DNA segment so that the encoded protein is expressed as a fusion protein. The DNA molecule is then expressed in the host cell so as to generate a polyhydroxyalkanoate monomer. [0022]
  • Another embodiment of the invention is an expression cassette comprising a DNA molecule comprising a DNA segment encoding a fatty acid synthase and a polyhydroxyalkanoate synthase. [0023]
  • Also provided is a method of providing a polyhydroxyalkanoate monomer synthase. The method comprises introducing an expression cassette into a host cell. The expression cassette comprises a DNA molecule encoding a polyhydroxyalkanoate monomer synthase operably linked to a promoter functional in the host cell. The monomer synthase comprises a plurality of modules. Thus, the monomer synthase comprises at least a first and second module which together encode the monomer synthase. Optionally, the expression cassette further comprises a second DNA molecule encoding a polyhydroxyalkanoate synthase. [0024]
  • A further embodiment of the invention is an isolated and purified DNA molecule comprising a DNA segment which encodes a [0025] Streptomyces venezuelae polyketide synthase, e.g., a polyhydroxyalkanoate monomer synthase, a biologically active variant or subunit (fragment) thereof. Preferably, the DNA segment encodes a polypeptide having an amino acid sequence comprising SEQ ID NO:45. Preferably, the DNA segment comprises SEQ ID NO:44. The DNA molecules of the invention are double stranded or single stranded. A preferred embodiment of the invention is a DNA molecule that has at least about 70%, more preferably at least about 80%, and even more preferably at least about 90%, but less than 100%, contiguous sequence identity to the DNA segment comprising SEQ ID NO:44, e.g., a “variant” DNA molecule. A variant DNA molecule of the invention can be prepared by methods well known to the art, including oligonucleotide-mediated mutagenesis. See Adelman et al., DNA, 2, 183 (1983) and Sambrook et al., Molecular Cloning: A Laboratory Manual (1989).
  • The invention also provides an isolated, purified polyhydroxyalkanoate monomer synthase, e.g., a polypeptide having an amino acid sequence comprising SEQ ID NO:45, a biologically active subunit, or a biologically active variant thereof. Thus, the invention provides a variant polypeptide having at least about 80%, more preferably at least about 90%, and even more preferably at least about 95%, but less than 100%, contiguous amino acid sequence identity to the polypeptide having an amino acid sequence comprising SEQ ID NO:45. A preferred variant polypeptide, or a subunit of a polypeptide, of the invention includes a variant or subunit polypeptide having at least about 10%, more preferably at least about 50%, and even more preferably at least about 90%, the activity of the polypeptide having the amino acid sequence comprising SEQ ID NO:45. Preferably, a variant polypeptide of the invention has one or more conservative amino acid substitutions relative to the polypeptide having the amino acid sequence comprising SEQ ID NO:45. For example, conservative substitutions include aspartic-glutamic as acidic amino acids; lysine/arginine/histidine as basic amino acids; leucine/isoleucine, methionine/valine, alanine/valine as hydrophobic amino acids; serine/glycine/alanine/threonine as hydrophilic amino acids. The biological activity of a polypeptide of the invention can be measured by methods well known to the art, including but not limited to, methods described hereinbelow. [0026]
  • The invention also provides an isolated and purified nucleic acid segment comprising a nucleic acid sequence comprising a sugar (desosamine) biosynthetic gene cluster, a biologically active variant or fragment thereof, wherein the nucleic acid sequence is not derived from the eryC gene cluster of [0027] Saccharopolyspora erythraea. As described hereinbelow, the desosamine biosynthetic gene cluster from Streptomycyes venezuelae was isolated, cloned and sequenced. The isolated nucleic acid segment comprising the gene cluster preferably includes a nucleic acid sequence comprising SEQ ID NO:3, or a fragment or variant thereof. The cluster was found to encode nine polypeptides including DesI (e.g., SEQ ID NO:51 encoded by SEQ ID NO:50), DesII (e.g., SEQ ID NO:53 encoded by SEQ ID NO:52), DesIII (e.g., SEQ ID NO:55 encoded by SEQ ID NO:54), DesIV (e.g., SEQ ID NO:14 encoded by SEQ ID NO:13), DesV (e.g., SEQ ID NO:16 encoded by SEQ ID NO:15), DesVI (e.g., SEQ ID NO:18 encoded by SEQ ID NO:17), DesVII (e.g., SEQ ID NO:20 encoded by SEQ ID NO:19), DesVIII (e.g., SEQ ID NO:22 encoded by SEQ ID NO:21), and DesR (e.g., SEQ ID NO:24 encoded by SEQ ID NO:23) (see FIG. 24). It is also preferred that the nucleic acid segment of the invention encoding DesR is not derived from the eryB gene cluster of Saccharopolyspora erythraea or the oleD gene from Streptomyces antibioticus.
  • The invention also provides a variant polypeptide having at least about 80%, more preferably at least about 90%, and even more preferably at least about 95%, but less than 100%, contiguous amino acid sequence identity to the polypeptide having an amino acid sequence comprising SEQ ID NO:51, SEQ ID NO:53, SEQ ID NO:55, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:22, SEQ ID NO:24, or a fragment thereof. A preferred variant polypeptide, or a subunit or fragment of a polypeptide, of the invention includes a variant or subunit polypeptide having at least about 1%, more preferably at least about 10%, and even more preferably at least about 50%, the activity of the polypeptide having the amino acid sequence comprising SEQ ID NO:51, SEQ ID NO:53, SEQ ID NO:55, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:22, or SEQ ID NO:24. Thus, for example, the glycosyltransferase activity of a polypeptide of SEQ ID NO:20 can be compared to a variant of SEQ ID NO:20 having at least one amino acid substitution, insertion, or deletion relative to SEQ ID NO:20. [0028]
  • A variant nucleic acid sequence of the invention has at least about 80%, more preferably at least about 90%, and even more preferably at least about 95%, but less than 100%, contiguous nucleic acid sequence identity to a nucleic acid sequence comprising SEQ ID NO:46, SEQ ID NO:50, SEQ ID NO:52, SEQ ID NO:54, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:23, or a fragment thereof. [0029]
  • Also provided is an expression cassette comprising a nucleic acid sequence comprising a desosamine biosynthetic gene cluster, a biologically active variant or fragment thereof operably linked to a promoter functional in a host cell, as well as host cells comprising an expression cassette of the invention. Thus, the expression cassettes of the invention are useful to express individual genes within the cluster, e.g., the desR gene which encodes a glycosidase or the desVII gene which encodes a glycosyltransferase having relaxed substrate specificity for polyketides and deoxysugars, i.e., the glycosyltransferase processes sugar substrates other than TDP-desosamine. Thus, the desVII gene can be employed in combinatorial biology approaches to synthesize a library of macrolide compounds having various polyketide and deoxysugar structures. Moreover, the expression of a glycosylase in a host cell which synthesizes a macrolide antibiotic may be useful in a method to reduce toxicity of, e.g., inactivate, the antibiotic. For example, a host cell which produces the antibiotic is transformed with an expression cassette encoding the glycosyltransferase. The recombinant glycosyltransferase is expressed in an amount that reversibly inactivates the antibiotic. To activate the antibiotic, the antibiotic, preferably the isolated antibiotic which is recovered from the host cell, is contacted with an appropriate native or recombinant glycosidase. [0030]
  • Preferably, the nucleic acid segment encoding desosamine in the expression cassette of the invention is not derived form the eryC gene cluster of [0031] Saccharopolyspora erythraea. Preferred host cells are prokaryotic cells, although eukaryotic host cells are also envisioned. These host cells are useful to express desosamine, analogs or derivatives thereof. Also provided is an expression cassette or host cell comprising antisense sequences from at least a portion of the desosamine biosynthetic gene cluster.
  • Another embodiment of the invention is a recombinant host cell, e.g., a bacterial cell, in which a portion of a nucleic acid sequence encoding desosamine in the host chromosome is disrupted, e.g., deleted or interrupted (e.g., by an insertion) with heterologous sequences, or substituted with a variant nucleic acid sequence of the invention, preferably so as to result in a decrease or lack of desosamine synthesis, and/or so as to result in the synthesis of an analog or derivative of desosamine. Preferably, the nucleic acid sequence which is disrupted is not derived from the eryC gene cluster of [0032] Saccharopolyspora erythraea. Thus, the recombinant host cell of the invention has at least one gene, i.e., desI, desII, desIII, desIV, desV, desVI, desVII, desVIII or desR, which is disrupted. One embodiment of the invention includes a recombinant host cell in which the desVI gene, which encodes an N-methyltransferase, is disrupted, for example, by replacement with an antibiotic resistance gene. Preferably, such a host cell produces an aglycone having an N-acetylated aminodeoxy sugar, 10-deoxy-methylonide, a compound of formula (7), a compound of formula (8), or a combination thereof. Thus, the deletion or disruption of the desVI gene may be useful in a method for preparing novel sugars.
  • Another preferred embodiment of the invention is a recombinant bacterial host cell in which the desR gene, which encodes a glycosidase such as β-glucosidase, is disrupted. Preferably, the host cell synthesizes C-2′ β-glucosylated macrolide antibiotics, for example, a compound of formula (13), a compound of formula (14), or a combination thereof. Therefore, the invention further provides a compound of formula (8), (9), (13) or (14). It will be appreciated by those skilled in the art that each atom of the compounds of the invention having a chiral center may exist in and be isolated in optically active and racemic forms. Some compounds may exhibit polymorphism. It is to be understood that the present invention encompasses any racemic, optically active, polymorphic or stereoisomeric form, or mixtures thereof, of a compound of the invention, which possess the useful properties described herein, it being well known in the art how to prepare optically active forms (for example, by resolution of the racemic form by recrystallization techniques, by synthesis from optically active starting materials, by chiral synthesis, or by chromatographic separation using a chiral stationary phase) and how to determine activity using the standard tests described herein, or using other similar tests which are well known in the art. [0033]
  • Further provided is an isolated and purified nucleic acid segment comprising a nucleic acid sequence comprising a macrolide biosynthetic gene cluster (the “met/pik” or “pik” gene cluster) encoding methymycin, pikomycin, neomethymycin, narbomycin, or a combination thereof, or a biologically active variant or fragment thereof. It is preferred that the nucleic acid segment comprises SEQ ID NO:5, or a fragment or variant thereof. It is also preferred that the isolated and purified nucleic acid segment is from Streptomyces sp., such as [0034] Streptomyces venezuelae (e.g., ATCC 15439, MCRL 0306, SC 2366 or 3629), Streptomyces narbonensis, Streptomyces eurocidicus, Streptomyces zaomyceticus (MCRL 0405), Streptomyces flavochromogens, Streptomyces sp. AM400, and Streptomyces felleus, although isolated and purified nucleic acid from other organisms which produce methymycin, narbomycin, neomethymycin and/or pikomycin are also within the scope of the invention. The cloned genes can be introduced into an expression system and genetically manipulated so as to yield novel macrolide antibiotics, e.g., ketolides, as well as monomers for polyhydroxyalkanoate (PHA) biopolymers. Preferably, the nucleic acid sequence encodes PikR1 (e.g., SEQ ID NO:27 encoded by SEQ ID NO:26), PikR2 (e.g., SEQ ID NO:29 encoded by SEQ ID NO:28), PikAI (e.g., SEQ ID NO:31 encoded by SEQ ID NO:30), PikAII (e.g., SEQ ID NO:33 encoded by SEQ ID NO:32), PikAIII (e.g., SEQ ID NO:35 encoded by SEQ ID NO:34), PikAIV (e.g., SEQ ID NO:37 encoded by SEQ ID NO:36), PikB (which is the desosamine gene cluster described above), PikC (e.g., SEQ ID NO:39 encoded by SEQ ID NO:38), and PikD (e.g., SEQ ID NO:41 encoded by SEQ ID NO:40), a variant or a fragment thereof.
  • The invention also provides a variant polypeptide having at least about 80%, more preferably at least about 90%, and even more preferably at least about 95%, but less than 100%, contiguous amino acid sequence identity to the polypeptide having an amino acid sequence comprising SEQ ID NO:27, SEQ ID NO:29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO:37, SEQ ID NO:39, SEQ ID NO:41, or a fragment thereof. A preferred variant polypeptide, or a subunit of a polypeptide, of the invention includes a variant or subunit polypeptide having at least about 1%, more preferably at least about 10%, and even more preferably at least about 50%, the activity of the polypeptide having the amino acid sequence comprising SEQ ID NO:27, SEQ ID NO:29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO:37, SEQ ID NO:39, or SEQ ID NO:41. The activities of polypeptides of the macrolide biosynthetic pathway of the invention are described below. [0035]
  • A variant nucleic acid sequence of the pik biosynthetic gene cluster of the invention has at least about 80%, more preferably at least about 90%, and even more preferably at least about 95%, but less than 100%, contiguous nucleic acid sequence identity to a nucleic acid sequence comprising SEQ ID NO:48, SEQ ID NO:26, SEQ ID NO:28, SEQ ID NO:30, SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:38, SEQ ID NO:40, or a fragment thereof. [0036]
  • The pikA gene encodes a polyketide synthase which synthesizes macrolactone 10-deoxymethonolide and narbolide, pikB encodes desosamine synthases which catalyze the formation and transfer of a deoxysugar moiety onto aglycones, the pikC gene encodes a P450 hydoxylase which catalyzes the conversion of YC-17 and narbomycin into methymycin, neomethymycin, and pikromycin, and the pikR1, pikR2 (possibly one for a 12-membered ring and the other for a 14-membered ring) and desR genes which encode enzymes associated with bacterial self-protection. Thus, the isolated nucleic acid molecule of the invention encodes four active macrolide antibiotics two of which have a 12-membered ring while the other two have a 14-membered ring. The regulation of the synthesis of 12- or 14-membered rings may be the result of the sequences in the spacer region between [0037] modules 5 and 6, as discussed below. Thus, the genetic mechanism underlying the alternative termination of polyketide synthesis may be useful to prepare novel antibiotics and PHA monomers.
  • The invention further provides isolated and purified nucleic acid segments, e.g., in the form of an expression cassette, for each of the individual genes in the macrolide biosynthetic gene cluster. For example, the invention provides an isolated and purified pikAV gene that encodes a thioesterase II. In particular, the thioesterase is useful to enhance the structural diversity of antibiotics and in PHA production, as the thioesterase modulates chain release and cyclization. For example, a thioesterase II gene having acyl-ACP coenzyme A transferase activity (e.g., a mutant pik TEII, bacterial, fungal or plant medium-chain-length thioesterase, an animal fatty acid thioesterase or a thioesterase from a polyketide synthase) is introduced at the end of a recombinant monomer synthase (see FIG. 36), which, in the presence of a PHA synthase, e.g., phaC1, produces a novel polyhydroxyalkanoate polymer. Alternatively, in the absence of a TEII domain, a fusion of a portion of PKS gene cluster with a PHA synthase may result in the transfer of an acyl chain from the PHA to the polymerase. [0038]
  • Also provided is a pikC gene that encodes a hydroxylase which is active at two positions on a 12-membered ring or at one position on a 14-membered ring. Such a gene may be particularly useful to prepare novel compounds through bioconversion or biotransformation. [0039]
  • The invention also provides an expression cassette comprising a nucleic acid segment comprising a macrolide biosynthetic gene cluster encoding methymycin, pikomycin, neomethymycin, narbomycin, or a combination thereof, or a biologically active variant or fragment thereof, operably linked to a promoter functional in a host cell. Further provided is a host cell comprising the nucleic acid segment encoding methymycin, pikomycin, neomethymycin, narbomycin, or a combination thereof, or a biologically active variant or fragment thereof. Moreover, the invention provides isolated and purified polypeptides of the invention, preferably obtained from host cells having the nucleic acid molecules of the invention. In addition, expression cassettes and host cells comprising antisense sequences of at least a portion of the macrolide biosynthetic gene cluster of the invention are envisioned. [0040]
  • Yet another embodiment of the invention is a recombinant host cell, e.g., a bacterial cell, in which a portion of the macrolide biosynthetic gene cluster of the invention is disrupted or replaced with a heterologous sequence or a variant nucleic acid segment of the invention, preferably so as to result in a decrease or lack of methymycin, pikomycin, neomethymycin, narbomycin, or a combination thereof, and/or so as to result in the synthesis of novel macrolides. Therefore, the invention provides a recombinant host cell in which a pikAI gene, a pikAII gene, a pikAIII gene (12-membered rings), a pikIV gene (14-membered rings), a pikB gene cluster, a pikAV gene, a pikC gene, a pikD gene, a pikR1 gene, a pikR2 gene, or a combination thereof, is disrupted or replaced. A preferred embodiment of the invention is a host cell wherein the pikB (e.g., the desVI and desV genes), pikA1, pikAV or pikC gene, is disrupted. [0041]
  • Moreover, as the nucleic acid segment comprising the macrolide biosynthetic gene cluster of the invention encodes a polyketide synthase, modules of that synthase are useful in methods to prepare recombinant polyhydroxyalkanoate monomer synthases and polymers in addition to macrolide antibiotics and derivatives thereof. [0042]
  • Thus, the invention provides an isolated and purified DNA molecule comprising a first DNA segment encoding a first module and a second DNA segment encoding a second module, wherein the DNA segments together encode a recombinant polyhydroxyalkanoate monomer synthase, and wherein at least one DNA segment is derived from the pikA gene cluster of [0043] Streptomyces venezuelae. Preferably, no more than one DNA segment is derived from the eryA gene cluster of Saccharopolyspora erythraea. In one embodiment of the invention, the 3′ most DNA segment of the isolated DNA molecule of the invention encodes a thioesterase II. Also provided is an expression cassette comprising a nucleic acid molecule encoding the polyhydroxyalkanoate monomer synthase operably linked to a promoter functional in a host cell.
  • Yet another embodiment of the invention is a method of providing a polyhydroxyalkanoate monomer. The method comprises introducing into a host cell a DNA molecule comprising a DNA segment encoding a recombinant polyhydroxyalkanoate monomer synthase operably linked to a promoter functional in the host cell. The recombinant polyhydroxyalkanoate monomer synthase comprises a first module and a second module, wherein at least one DNA segment is derived from the pikA gene cluster of [0044] Streptomyces venezuelae. The DNA encoding the recombinant polyhydroxyalkanoate monomer synthase is then expressed in the host cell so as to generate a polyhydroxyalkanoate monomer. Optionally, a a second DNA molecule may be introduced into the host cell. The second DNA molecule comprises a DNA segment encoding a polyhydroxyalkanoate synthase operably linked to a promoter functional in the host cell. The two DNA molecules are expressed in the host cell so as to generate a polyhydroxyalkanoate polymer.
  • Another embodiment of the invention is an isolated and purified DNA molecule comprising a first DNA segment encoding a fatty acid synthase and a second DNA segment encoding a module from the pikA gene cluster of [0045] Streptomyces venezuelae. Such a DNA molecule can be employed in a method of providing a polyhydroxyalkanoate monomer. Thus, a DNA molecule comprising a first DNA segment encoding a fatty acid synthase and a second DNA segment encoding a polyketide synthase is introduced into a host cell. The first DNA segment is 5′ to the second DNA segment and the first DNA segment is operably linked to a promoter functional in the host cell. The first DNA segment is linked to the second DNA segment so that the linked DNA segments express a fusion protein. The DNA molecule is expressed in the host cell so as to generate a polyhydroxyalkanoate monomer.
  • Further provided is a method of providing a polyhydroxyalkanoate monomer synthase. The method comprises introducing an expression cassette comprising a DNA molecule encoding a polyhydroxyalkanoate synthase operably linked to a promoter functional in a host cell. The DNA molecule comprises a first DNA segment encoding a first module and a second DNA segment encoding a second module wherein the DNA segments together encode a polyhydroxyalkanoate monomer synthase. At least one DNA segment is derived from the pikA gene cluster of [0046] Streptomyces venezuelae. The DNA molecule is expressed in the host cell. Optionally, the DNA molecule further comprises a DNA segment encoding a polyhydroxyalkanoate synthase. Alternatively, a second, separate DNA molecule encoding a polyhydroxyalkanoate synthase is introduced into the host cell.
  • Also provided is a method for directing the biosynthesis of specific glycosylation-modified polyketides by genetic manipulation of a polyketide-producing microorganism. The method comprises introducing into a polyketide-producing microorganism a DNA sequence encoding enzymes in desosamine biosynthesis, e.g., a DNA sequence comprising SEQ ID NO:46, a variant or fragment thereof, so as to yield a microorganism that produces specific glycosylation-modified polyketides. Alternatively, an anti-sense DNA sequence of the invention may be employed. Then the glycosylation-modified polyketides are isolated from the microorganism. It is preferred that the DNA sequence is modified so as to result in the inactivation of at least one enzymatic activity in sugar biosynthesis or in the attachment of the sugar to a polyketide. [0047]
  • Thus, the modules encoded by the nucleic acid segments of the invention may be employed in the methods described hereinabove to prepare polyhydroxyalkanoates of varied chain length or having various side chain substitutions and/or to prepare glycosylated biopolymers. Therefore, the compounds produced by the recombinant host cells of the invention are useful as biopolymers, e.g., in packaging or biomedical applications, or to engineer PHA monomer synthases; pharmaceuticals such as chemotherapeutic agents, immunosuppressants, agents to treat asthma, chronic obstructive pulmonary disease as well as other diseases involving respiratory inflammation, cholesterol-lowering agents, or macrolide-based antibiotics which are active against a variety of organisms, e.g., bacteria, including multi-drug-resistant pneumococci and other respiratory pathogens, as well as viral and parasitic pathogens; or as crop protection agents (e.g., fungicides or insecticides) via expression of polyketides in plants. Methods employing these compounds, e.g., to treat a mammal, bird or fish in need of such therapy, such as a patient having a bacterial infection, are also envisioned. [0048]
  • As used herein, a “linker region” is an amino acid sequence present in a multifunctional protein which is less well conserved in an amino acid sequence than an amino acid sequence with catalytic activity. [0049]
  • As used herein, an “extender unit” catalytic or enzymatic domain is an acyl transferase in a module that catalyzes chain elongation by adding 2-4 carbon units to an acyl chain and is located carboxy-terminal to another acyl transferase. For example, an extender unit with methylmalonylCoA specificity adds acyl groups to a methylmalonylCoA molecule. [0050]
  • As used herein, a “polyhydroxyalkanoate” or “PHA” polymer includes, but is not limited to, linked units of related, preferably heterologous, hydroxyalkanoates such as 3-hydroxybutyrate, 3-hydroxyvalerate, 3-hydroxycaproate, 3-hydroxyheptanoate, 3-hydroxyhexanoate, 3-hydroxyoctanoate, 3-hydroxyundecanoate, and 3-hydroxydodecanoate, and their 4-hydroxy and 5-hydroxy counterparts. [0051]
  • As used herein, a “Type I polyketide synthase” is a single polypeptide with a single set of iteratively used active sites. This is in contrast to a Type II polyketide synthase which employs active sites on a series of polypeptides. [0052]
  • As used herein, a “recombinant” nucleic acid or protein molecule is a molecule where the nucleic acid molecule which encodes the protein has been modified in vitro, so that its sequence is not naturally occurring, or corresponds to naturally occurring sequences that are not positioned as they would be positioned in a genome which has not been modified. [0053]
  • A “recombinant” host cell of the invention has a genome that has been manipulated in vitro so as to alter, e.g., decrease or disrupt, or, alternatively, increase, the function or activity of at least one gene in the macrolide or desosamine biosynthetic gene cluster of the invention. [0054]
  • As used herein, a “multifunctional protein” is one where two or more enzymatic activities are present on a single polypeptide. [0055]
  • As used herein, a “module” is one of a series of repeated units in a multifunctional protein, such as a Type I polyketide synthase or a fatty acid synthase. [0056]
  • As used herein, a “premature termination product” is a product which is produced by a recombinant multifunctional protein which is different than the product produced by the non-recombinant multifunctional protein. In general, the product produced by the recombinant multifunctional protein has fewer acyl groups. [0057]
  • As used herein, a DNA that is “derived from” a gene cluster is a DNA that has been isolated and purified in vitro from genomic DNA, or synthetically prepared on the basis of the sequence of genomic DNA. [0058]
  • As used herein, the pik gene cluster includes sequences encoding a polyketide synthase (pikA), desosamine biosynthetic enzymes (pikB, also referred to as des), a cytochrome P450 (pikC), regulatory factors (pikD) and enzymes for cellular self-resistance (pikR). [0059]
  • As used herein, the terms “isolated and/or purified” refer to in vitro isolation of a DNA or polypeptide molecule from its natural cellular environment, and from association with other components of the cell, such as nucleic acid or polypeptide, so that is can be sequenced, replicated and/or expressed. Moreover, the DNA may encode more than one recombinant Type I polyketide synthase and/or fatty acid synthase. For example, “an isolated DNA molecule encoding a polyhydroxyalkanoate monomer synthase” is RNA or DNA containing greater than 7, preferably 15, and more preferably 20 or more sequential nucleotide bases that encode a biologically active polypeptide, fragment, or variant thereof, that is complementary to the non-coding, or complementary to the coding strand, of a polyhydroxyalkanoate monomer synthase RNA, or hybridizes to the RNA or DNA encoding the polyhydroxyalkanoate monomer synthase and remains stably bound under stringent conditions, as defined by methods well known to the art, e.g., in Sambrook et al., supra. [0060]
  • An “antibiotic” as used herein is a substance produced by a microorganism which, either naturally or with limited chemical modification, will inhibit the growth of or kill another microorganism or eukaryotic cell. [0061]
  • An “antibiotic biosynthetic gene” is a nucleic acid, e.g., DNA, segment or sequence that encodes an enzymatic activity which is necessary for an enzymatic reaction in the process of converting primary metabolites into antibiotics. [0062]
  • An “antibiotic biosynthetic pathway” includes the entire set of antibiotic biosynthetic genes necessary for the process of converting primary metabolites into antibiotics. These genes can be isolated by methods well known to the art, e.g., see U.S. Pat. No. 4,935,340. [0063]
  • Antibiotic-producing organisms include any organism, including, but not limited to, Actinoplanes, Actinomadura, Bacillus, Cephalosporium, Micromonospora, Penicillium, Nocardia, and Streptomyces, which either produces an antibiotic or contains genes which, if expressed, would produce an antibiotic. [0064]
  • An antibiotic resistance-conferring gene is a DNA segment that encodes an enzymatic or other activity which confers resistance to an antibiotic. [0065]
  • The term “sequence” as used in the art means a series of nucleic acid units that appears within genetic material. With regard to individual references in the literature, sequences may be disclosed that are actually arbitrary segments taken from the genetic material. By arbitrarily selecting segments of different lengths, starting at different positions within the identified DNA from which a segment is being designated, an extraordinarily large number of different segments may be defined that are nothing more than different size puzzle pieces selected from the same picture. Given a disclosure of a specific source of DNA, identification of conventional processing to provide the genome for a species DNA, and the identification of a genetic sequence of a related species that has been clearly identified and includes segments of similar or identical sequences, the entire DNA is included within the disclosure and each arbitrary sequence is disclosed. [0066]
  • The term “polyketide” as used herein refers to a large and diverse class of natural products, including but not limited to antibiotic, antifungal, anticancer, and anti-helminthic compounds. Antibiotics include, but are not limited to anthracyclines and macrolides of different types (polyenes and avermectins as well as classical macrolides such as erythromycins). Macrolides are produced by, for example, [0067] S. erytheus, S. antibioticus, S. venezuelae, S. fradiae and S. narbonensis.
  • The term “glycosylated polyketide” refers to any polyketide that contains one or more sugar residues. [0068]
  • The term “glycosylation-modified polyketide” refers to a polyketide having a changed glycosylation pattern or configuration relative to that particular polyketide's unmodified or native state. [0069]
  • The term “polyketide-producing microorganism” as used herein includes any microorganism that can produce a polyketide naturally or after being suitably engineered (i.e., genetically). Examples of actinomycetes that naturally produce polyketides include but are not limited to [0070] Micromonospora rosaria, Micromonospora megalomicea, Saccharopolyspora erythraea, Streptomyces antibioticus, , Streptomyces albereticuli, Streptomyces ambofaciens, Streptomyces avermitilis, Streptomyces fradiae, Streptomyces griseus, Streptomyces hydroscopicus, Streptomyces tsukulubaensis, Streptomyces mycarofasciens, Streptomyces platenesis, Streptomycesviolaceoniger, Streptomyces violaceoniger, Streptomyces thermotolerans, Streptomyces rimosus, Streptomyces peucetius, Streptomyces coelicolor, Streptomyces glaucescens, Streptomyces roseofulvus, Streptomyces cinnamonensis, Streptomyces curacoi, and Amycolatopsis mediterranei (see Hopwood, D. A. and Sherman, D. H., Annu. Rev. Genet., 24:37-66 (1990), incorporated herein by reference). Other examples of polyketide-producing microorganisms that produce polyketides naturally include various Actinomadura, Dactylosporangium and Nocardia strains.
  • The term “sugar biosynthesis genes” as used herein refers to nucleic acid sequences from organisms such as [0071] Streptomyces venezuelae that encode sugar biosynthesis enzymes and is intended to include sequences of DNA from other polyketide-producing microorganisms which are identical or analogous to those obtained from Streptomyces venezuelae.
  • The term “sugar biosynthesis enzymes” as used herein refers to polypeptides which are involved in the biosynthesis and/or attachment of polyketide-associated sugars and their derivatives and intermediates. [0072]
  • The term “polyketide-associated sugar” refers to a sugar that is known to attach to polyketides or that can be attached to polyketides by the processes described herein. [0073]
  • The term “sugar derivative” refers to a sugar which is naturally associated with a polyketide but which is altered relative to the unmodified or native state, including but not limited to, N-3-a-desdimethyl D-desosamine. [0074]
  • The term “sugar intermediate” refers to an intermediate compound produced in a sugar biosynthesis pathway. [0075]
  • BRIEF DESCRIPTION OF THE FIGURES
  • FIG. 1. The PHB biosynthetic pathway in [0076] A. eutrophus.
  • FIG. 2. Molecular structure of common bacterial PHAs. Most of the known PHAs are polymers of 3-hydroxy acids possessing the general formula shown. For example, R═CH[0077] 3 in PHB, T═CH2CH3 in polyhydroxyvalerate (PHV), and R═(CH2)4CH3 in polyhydroxyoctanoate (PHO).
  • FIG. 3. Comparison of the natural and recombinant pathways for PHB synthesis. The three enzymatic steps of PHB synthesis in bacteria involving 3-ketothiolase, acetoacetyl-CoA reductase, and PHB synthase are shown on the left. The two enzymatic steps involved in PHB synthesis in the pathway in Sf21 cells containing a rat fatty acid synthase with an inactivated dehydrase domain (ratF AS206) are shown on the right. [0078]
  • FIG. 4. Schematic diagram of the molecular organization of the tyl polyketide synthase (PKS) gene cluster. Open arrows correspond to individual open reading frames (ORFs) and numbers above an ORF denote a multifunctional module or synthase unit (SU). AT=acyltransferase; ACP=acyl carrier protein; KS=β-ketoacyl synthase; KR=ketoreductase; DH=dehydrase; ER=enoyl reductase; TE=thioesterase; MM=methylmalonylCoA; M=malonyl CoA; EM=ethylmalonyl CoA. [0079] Module 7 in tyl is also known as Module F.
  • FIG. 5. Schematic diagram of the molecular organization of the met PKS gene cluster. [0080]
  • FIG. 6. Strategy for producing a recombinant PHA monomer synthase by domain replacement. [0081]
  • FIG. 7. (A) 10% SDS-PAGE gel showing samples from various stages of the purification of PHA synthase; [0082] lane 1, molecular weight markers; lane 2, total protein of uninfected insect cells; lane 3, total protein or insect cells expressing a rat FAS (200 kDa; Joshi et al., Biochem. J., 296, 143 (1993)); lane 4, total protein of insect cells expressing PHA synthase; lane 5, soluble protein from sample in lane 4; lane 6, pooled hydroxylapatite (HA) fractions containing PHA synthase. (B) Western analysis of an identical gel using rabbit-a-PHA synthase antibody as probe. Bands designated with arrows are: a, intact PHB synthase with N-terminal alanine at residue 7 and serine at residue 10 (A7/S10); b, 44 kDa fragment of PHB synthase with N-terminal alanine at residue 181 and asparagine at residue 185 (A181/N185); c, PHB synthase fragment of approximately 30 kDa apparently blocked based on resistance to Edman degradation; d, 22 kDa fragment with N-terminal glycine at residue 187 (G187). Band d apparently does not react with rabbit-a-PHB synthase antibody (B, lane 6). The band of similar size in B, lane 4 was not further identified.
  • FIG. 8. N-terminal analysis of PHA synthase purified from insect cells. (a) The expected N-[0083] terminal 25 amino acid sequence of A. eutrophus PHA synthase. (b&c) The two N-terminal sequences determined for the A. eutrophus PHA synthase produced in insect cells. The bolded sequences are the actual N-termini determined.
  • FIG. 9. Spectrophotometric scans of substrate, 3-hydroxybutyrate CoA (HBCoA) and product, CoA. The wavelength at which the direct spectrophotometric assays were carried out (232 nm) is denoted by the arrow; substrate, HBCoA () and product, CoA (∘). [0084]
  • FIG. 10. Velocity of the hydrolysis of HBCoA as a function of substrate concentration. Assays were carried out in 40 or 200 μl assay volumes with enzyme concentration remaining constant at 0.95 mg/ml (3.8 μg/40 μl assay). Velocities were calculated from the linear portions of the assay curves subsequent to the characteristic lag period. The substrate concentration at half-optimal velocity, the apparent K[0085] m value, was estimated to be 2.5 mM from this data.
  • FIG. 11. Double reciprocal plot of velocity versus substrate concentration. The concave upward shape of this plot is similar to results obtained by Fukui et al. ([0086] Arch. Microbiol., 110, 149 (1976)) with granular PHA synthase from Z. ramigera.
  • FIG. 12. Velocity of the hydrolysis of HBCoA as a function of enzyme concentration. Assays were carried out in 40 μl assay volumes with the concentration HBCoA remaining constant at 8 μM. [0087]
  • FIG. 13. Specific activity of PHA synthase as a function of enzyme concentration. [0088]
  • FIG. 14. pH activity curve for soluble PHA synthase produced using the baculovirus system. Reactions were carried out in the presence of 200 mM P[0089] i. Buffers of pH<10 were prepared with potassium phosphate, while buffers of pH>10 were prepared with the appropriate proportion of Na3PO4.
  • FIG. 15. Assays of the hydrolysis of HBCoA with varying amounts of PHA synthase. Assays were carried out in 40 μl assay volumes with the concentration of HBCoA remaining constant at 8 μM. Initial A[0090] 232 values, originally between 0.62 and 0.77, were normalized to 0.70. Enzyme amounts used in these assays were, from the uppermost curve, 0.38, 0.76, 1.14, 1.52, 1.90, 2.28, 2.66, 3.02, 3.42, 7.6, and 15.2 μg, respectively.
  • FIG. 16. SDS/PAGE analysis of proteins synthesized at various time points during infection of Sf21 cells. Approximately 0.5 mg of total cellular protein from various samples was fractionated on a 10% polyacrylamide gel. Samples include: uninfected cells, lanes 1-4, [0091] days 0, 1, 2, 3, respectively; infection with BacPAK6::phbC alone, lanes 5-8, days, 0, 1, 2, 3, respectively, infection with baculoviral clone containing ratFAS206 alone, lanes 9-12, days 0, 1, 2, 3, respectively; and ratFAS206 and BacPAK6 infected cells, lanes 13-16, days 0, 1, 2, 3, respectively. A=mobility of FAS, B=mobility of PHA synthase. Molecular weight standard lanes are marked M.
  • FIG. 17. Gas chromatographic evidence for PHB accumulation in Sf21 cells. Gas chromatograms from various samples are superimposed. PHB standard (Sigma) is [0092] chromatogram #7 showing a propylhydroxybutyrate elution time of 10.043 minutes (s, arrow). The gas chromatograms of extracts of the uninfected (#1); singly infected with ratFAS206 (#2, day 3); and singly infected with PHA synthase (#3, day 3) are shown at the bottom of the figure. Gas chromatograms of extracts of dual-infected cells at day 1 (#4), 2 (#5), and 3 (#6) are also shown exhibiting a peak eluting at 10.096 minutes (x, arrow). The peak of dual-infected, day 3 extract (#6) was used for mass spectrometry (MS) analysis.
  • FIG. 18. Gas chromatography-mass spectrometry analysis of PHB. The characteristic fragmentation of propylhydroxybutyrate at m/z of 43, 60, 87, and 131 is shown. A) standard PHB from bacteria (Sigma), and B) peak X from ratFAS206 and BacPAK6: phbC baculovirus infected, day 3 (#6, FIG. 17) Sf21 cells expressing rat FAS dehydrase inactivated protein and PHA synthase. [0093]
  • FIG. 19. Map of the vep ([0094] Streptomyces venezuelae polyene encoding) gene cluster.
  • FIG. 20. Plasmid map of pDHS502. [0095]
  • FIG. 21. Plasmid map of pDHS505. [0096]
  • FIG. 22. Cloning protocol for pDHS505. [0097]
  • FIG. 23. Nucleotide sequence (SEQ ID NO:45) and corresponding amino acid sequence (SEQ ID NO:22) of vep ORFI. [0098]
  • FIG. 24. Schematic diagram of the desosamine biosynthetic pathway and the enzymatic activity associated with each of the desosamine biosynthetic polypeptides. [0099]
  • FIG. 25. Schematic of the conversion of the inactive (diglycosylated) form of methymycin and pikromycin to the active form of methymycin and pikromycin. [0100]
  • FIG. 26. Schematic diagram of the desosamine biosynthetic pathway. [0101]
  • FIG. 27. Pathway for the synthesis of a compound of [0102] formula 7 and 8 in desVI mutants of Streptomyces.
  • FIG. 28. The methymycin/pikromycin biosynthetic gene cluster and the structure and biosynthesis of methymycin, neomethymycin, narbomycin, and pikromycin in [0103] S. venezuelae. Methymycin: R1=OH, R2=H, neomethymycin: R1=H, R2=OH; narbomycin R3=H, pikromycin R3=OH. Each circle represents an enzymatic domain in PKS protein. ACP, acyl carrier protein; KS, β-ketoacyl-ACP synthase; KSQ, a KS-like domain; AT, acyltransferase; KR, β-ketoacyl ACP reductase; DH, β-hydroxyl-thioester dehydratase; ER, enoyl reductase; TEI, thioesterase domain; TEII, type II thioesterase. Des represents all eight enzymes in desosamine synthesis and transfer which include DesI, DesII, DesIII, DesIV, DesV, DesVI, DesVIII, and DesVII.
  • FIG. 29. Organization of the pik cluster in [0104] S. venezuelae. Each arrow represents an open reading frame (ORF). The direction of transcription and relative sizes of the ORFs deduced from nucleotide sequence are indicated. The cluster is composed of four genetic loci: pikA, pikB (des), pikC, and pikR. Cosmid clones are denoted as overlapping lines.
  • FIG. 30. Conversion of YC-17 and narbomycin by PikC P450 hydroxylase. [0105]
  • FIG. 31. Nucleotide sequence (SEQ ID NO:48) and inferred amino acid sequence (SEQ ID NO:49) of the pik gene cluster. [0106]
  • FIG. 32. Nucleotide sequence (SEQ ID NO:46) and inferred amino acid sequence (SEQ ID NO:47) of the desosamine gene cluster. [0107]
  • FIG. 33. [0108] S. venezuelae AX916 construct useful to prepare a polyketide having a shorter chain length compared to wild-type pikA. pik module 2 is fused to pik module 5, and module 3 and 4 are deleted, so as to encode a three module PKS which produces two macrolides, a triketide and a tetraketide.
  • FIG. 34. Recombinant PKS having a wild-type thioesterase II. [0109]
  • FIG. 35. pAX703 construct, an expression and complementation vector. The PikTEII gene can be replaced with an EcoRI-NsiI fragment. The phaC1 gene can be replaced with a PacI-DraI fragment. [0110]
  • FIG. 36. Strategy for C7 polymer production. mTEII is a mutant pikTEII, an acyl-ACP CoA transferase; phaC1 is a [0111] PHA polymerase 1 from P. olivarus which may have racemase activity. In a strain having these constructs, AX916, a PHA polymer is produced.
  • FIG. 37. Strategy for C5 polymer production. A PHA polymerase gene phaC1 is directly fused to pik [0112] module 2, so as to result in a fusion that transfers an acyl chain from the PKS protein directly to the polymerase by the prosthetic group on the ACP domain of the PKS.
  • FIG. 38. Codons for specified amino acids. [0113]
  • FIG. 39. Exemplary and preferred amino acid substitutions. [0114]
  • DETAILED DESCRIPTION OF THE INVENTION
  • The invention described herein can be used for the production of a diverse range of biodegradable PHA polymers through genetic redesign of DNA encoding a FAS or a PKS such as that found in Streptomyces spp. Type I PKS polypeptide to provide a recombinant PHA monomer synthase. Different PHA synthases can then be tested for their ability to polymerize the monomers produced by the recombinant PHA synthase into a biodegradable polymer. The invention also provides a method by which various PHA synthases can be tested for their specificity with respect to different monomer substrates. [0115]
  • The potential uses and applications of PHAs produced by PHA monomer synthases and PHA synthases include both medical and industrial applications. Medical applications of PHAs include surgical pins, sutures, staples, swabs, wound dressings, blood vessel replacements, bone replacements and plates, stimulation of bone growth by piezoelectric properties, and biodegradable carrier for long-term dosage of pharmaceuticals. Industrial applications of PHAs include disposable items such as baby diapers, packaging containers, bottles, wrappings, bags, and films, and biodegradable carriers for long-term dosage of herbicides, fungicides, insecticides, or fertilizers. [0116]
  • In animals, the biosynthesis of fatty acids de novo from malonyl-CoA is catalyzed by FAS. For example, the rat FAS is a homodimer with a subunit structure consisting of 2505 amino acid residues having a molecular weight of 272,340 Da. Each subunit consists of seven catalytic activities in separate physical domains (Amy et al., [0117] Proc. Natl. Acad. Sci. USA, 86, 3114 (1989)). The physical location of six of the catalytic activities, ketoacyl synthase (KS), malonyl/acetyltransferase (M/AT), enoyl reductase (ER), ketoreductase (KR), acyl carrier protein (ACP), and thioesterase (TE), has been established by (1) the identification of the various active site residues within the overall amino acid sequence by isolation of catalytically active fragments from limited proteolytic digests of the whole FAS, (2) the identification of regions within the FAS that exhibit sequence similarity with various monofunctional proteins, (3) expression of DNA encoding an amino acid sequence with catalytic activity to produce recombinant proteins, and (4) the identification of DNA that does not encode catalytic activity, i.e., DNA encoding a linker region. (Smith et al., Proc. Natl. Acad. Sci. USA, 73, 1184 (1976); Tsukamoto et al., J. Biol. Chem., 263, 16225 (1988); Rangan et al., J. Biol. Chem., 266, 19180 (1991)).
  • The seventh catalytic activity, dehydrase (DH), was identified as physically residing between AT and ER by an amino acid comparison of FAS with the amino acid sequences encoded by the three open reading frames of the eryA polyketide synthase (PKS) gene cluster of [0118] Saccharopolyspora erythraea. The three polypeptides that comprise this PKS are constructed from “modules” which resemble animal FAS, both in terms of their amino acid sequence and in the ordering of the constituent domains (Donadio et al., Gene, 111, 51 (1992); Benh et al., Eur. J. Biochem., 204, 39 (1992)).
    Among the disclosures of the Streptomyces Narbonensis is LOCUS
    AF193252 437 bp DNA linear BCT 04 Apr. 2000
    DEFINITION Streptomyces narbonensis polyketide synthase module 5
    and polyketide synthase module 6 genes, partial cds.
    ACCESSION AF193252
    VERSION AF193252.1 GI:7406991
    KEYWORDS .
    SOURCE Streptomyces narbonensis.
    ORGANISM Streptomyces narbonensis
    Bacteria; Firmicutes; Actinobacteria; Actinobacteridae;
    Actinomycetales; Streptomycineae; Streptomycetaceae;
    Streptomyces.
    REFERENCE 1 (bases 1 to 437)
    AUTHORS Xue, Y., Wilson, D. and Sherman, D. H.
    TITLE Genetic architecture of the polyketide syntheses for
    methymycin and pikromycin series macrolides
    JOURNAL Gene 245 (1), 203-211 (2000)
    MEDLINE 20179700
    PUBMED 10713461
    REFERENCE 2 (bases 1 to 437)
    AUTHORS Xue, Y., Wilson, D. and Sherman, D. H.
    TITLE Direct Submission
    JOURNAL Submitted (07 Oct. 1999) Department of Microbiology,
    University of Minnesota, 420 Delaware Street SE,
    Minneapolis, MN 55455, USA
    FEATURES Location/Qualifiers
    source
    1 . . . 437
    /organism=“Streptomyces narbonensis
    /strain=“ATCC19790”
    /db_xref=“taxon:67333”
    CDS <1 . . . 206
    /codon_start=3
    /transl_table=11
    /product=“polyketide synthase module 5”
    /protein_id=“AAF61861.1”
    /db_xref=“GI:7406992”
    /translation=“AELPLDRLRDAGVLDTVLRLTGIEPEPVPGGPGSVAAGPAADPE
    PETSIDDLDAEALIRMALGPRNA”
    CDS 348 . . . >437
    /codon_start=1
    /transl_table=11
    /product=“polyketide synthase module 6”
    /protein_id=“AAF61862.1”
    /db_xref=“GI:7406993”
    /translation=“MTSSNEOLVDALRASLKENEELRKESRRRD”
  • [0119]
    BASE COUNT
    ORIGIN        73 a    187 c    136 g     41 t
    1 tggccgaact gcccctcgac cggctgcggg acgccggggt cctcgacacc gtcctgcgac
    61 tcaccggcat cgagcccgag ccggtgcccg gcggcccggg cagcgtcgcc gccggccccg
    121 ccgcggatcc ggaaccggag acgtcgatcg acgacctcga cgccgaggcc ctgatccgga
    181 tggctctcgg cccgcggaac gcctgagcac ccgccccggc ccgtggctgc cccggccctt
    241 gcccgactgc gggccgggcc ccgggcccgc acaccgccac gtaccacccc gcaccaccgc
    301 cccccacacg cccacaacgc catccacgag cggaagacca cacccagatg acgagttcca
    361 acgagcagtt ggtggacgct ctgcqcgcct ccctcaagga gaacgaagaa ctccggaaag
    421 agagccgtcg ccgggac and
  • [0120]
    LOCUS AF193867 327 bp DNA linear BCT 04 Apr. 2000
    DEFINITION Streptomyces narbonensis type II thioesterase gene,
    partial cds.
    ACCESSION AF193867
    VERSION AF193867.1 GI:7406998
    KEYWORDS .
    SOURCE Streptomyces narbonensis.
    ORGANISM Streptomyces narbonensis
    Bacteria; Firmicutes; Actinobacteria; Actinobacteridae;
    Actinomycetales; Streptomycineae; Streptomycetaceae;
    Streptomyces.
    REFERENCE 1 (bases 1 to 327)
    AUTHORS Xue, Y., Wilson, D. and Sherman, D. H.
    TITLE Genetic architecture of the polyketide synthases for
    methymycin and pikromycin series macrolides
    JOURNAL Gene 245 (1), 203-211 (2000)
    MEDLINE 20179700
    PUBMED 10713461
    REFERENCE 2 (bases 1 to 327)
    AUTHORS Xue, Y., Wilson, D. and Sherman, D. H.
    TITLE Direct Submission
    JOURNAL Submitted (11 Oct. 1999) Department of Microbiology,
    University of Minnesota, 420 Delaware Street SE.
    Room 1060, Minneapolis, MN 55455, USA
    FEATURES Location/Qualifiers
    source
    1 . . . 327
    /organism=“Streptomyces narbonensis
    /strain=“ATCC19790”
    /db_xref=“taxon:67333”
    CDS 59 . . . >327
    /function=“involved in narbonolide
    biosynthesis”
    /codon_start=1
    /transl_table=11
    /product=“type II thioesterase”
    /protein_id=“AAF61865.1”
    /db_xref=“GI:7406999”
    /translation=“MTDRVLNVDSSLWIRRFHPSPNSAVRLVCLPHAGGSASYFFRFS
    EELHPSVEALSVQYPCRQDRRAEPCLENVEELAEHVVAATEAWWR”
  • [0121]
    BASE COUNT
    ORIGIN        47 a    114 c    118 g     48 t
    1 tcgacggcat cgagcgggac accgccgccg ggcggcggac cgcgcagggg gcggaccagt
    61 gaccgacaga gttctgaacg tggacagcag cctgtggatc cgacgcttcc acccctcgcc
    121 gaacagcgcg gtgcggctgg tctgtctgcc gcacgccggt ggttccgcca gctacttctt
    181 ccgcttctcg gaggagctcc acccctcggt cgaggccttg tcggtgcagt accccggccg
    241 ccaggaccgg cgtgccgagc cgtgtctgga gaacgtcgag gagctcgccg agcacgtggt
    301 cgcggccacc gaagcctggt ggcggga
  • One embodiment of the invention employs a FAS in which the DH is inactivated (FAS DH−). The FAS DH− employed in this embodiment of the invention is preferably a eukaryotic FAS DH− and, more preferably, a mammalian FAS DH−. The most preferred embodiment of the invention is a FAS where the active site in the DH has been inactivated by mutation. For example, Joshi et al. ([0122] J. Biol. Chem., 268, 22508 (1993)) changed the His878 residue in the rat FAS to an alanine residue by site-directed mutagenesis. In vitro studies showed that a FAS with this change (ratFAS206) produced 3-hydroxybutyrylCoA as a premature termination product from acetyl-CoA, malonyl-CoA and NADPH.
  • As shown below, a FAS DH− effectively replaces the β-ketothiolase and acetoacetyl-CoA reductase activities of the natural pathway by producing D(−)-3-hydroxybutyrate as a premature termination product, rather than the usual 16-carbon product, palmitic acid. This premature termination product can then be incorporated into PHB by a PHB synthase (See Example 2). [0123]
  • Another embodiment of the invention employs a recombinant Streptomyces spp. PKS to produce a variety of β-hydroxyCoA esters that can serve as monomers for a PHA synthase. One example of a DNA encoding a Type I PKS is the eryA gene cluster, which governs the synthesis of erythromycin aglycone deoxyerythronolide B (DEB). The gene cluster encodes six repeated units, termed modules or synthase units (SUs). Each module or SU, which comprises a series of putative FAS-like activities, is responsible for one of the six elongation cycles required for DEB formation. Thus, the processive synthesis of asymmetric acyl chains found in complex polyketides is accomplished through the use of a programmed protein template, where the nature of the chemical reactions occurring at each point is determined by the specificities in each SU. [0124]
  • Two other Type I PKS are encoded by the tyl (tylosin) (FIG. 4) and met (methymycin) (FIG. 5) gene clusters. The macrolide multifunctional synthases encoded by tyl and met provide a greater degree of metabolic diversity than that found in the eryA gene cluster. The PKSs encoded by the eryA gene cluster only catalyze chain elongation with methylmalonylCoA, as opposed to tyl and met PKSs, which catalyze chain elongation with malonylCoA, methylmalonylCoA and ethylmalonylCoA. Specifically, the tyl PKS includes two malonylCoA extender units and one ethylmalonylCoA extender unit, and the met PKS includes one malonylCoA extender unit. Thus, a preferred embodiment of the invention includes, but is not limited to, replacing catalytic activities encoded in met PKS open reading frame 1 (ORF1) to provide a DNA encoding a protein that possesses the required keto group processing capacity and short-chain acylCoA ester starter and extender unit specificity necessary to provide a saturated β-hydroxyhexanoylCoA or unsaturated B-hydroxyhexenoylCoA monomer. [0125]
  • In order to manipulate the catalytic specificities within each module, DNA encoding a catalytic activity must remain undisturbed. To identify the amino acid sequences between the amino acid sequences with catalytic activity, the “linker regions,” amino acid sequences of related modules, preferably those encoded by more than one gene cluster, are compared. Linker regions are amino acid sequences which are less well conserved than amino acid sequences with catalytic activity. Witkowski et al., Eur. [0126] J. Biochem., 198, 571 (1991).
  • In an alternative embodiment of the invention, to provide a DNA encoding a Type I PKS module with a TE and lacking a functional DH, a DNA encoding a module F, containing KS, MT, KR, ACP, and TE catalytic activities, is introduced at the 3′ end of a DNA encoding a first module (FIG. 6). Module F introduces the final (R)-3-hydroxyl acyl group at the final step of PHA monomer synthesis, as a result of the presence of a TE domain. DNA encoding a module F is not present in the eryA PKS gene cluster (Donadio et al., supra, 1991). [0127]
  • A DNA encoding a recombinant monomer synthase is inserted into an expression vector. The expression vector employed varies depending on the host cell to be transformed with the expression vector. That is, vectors are employed with transcription, translation and/or post-translational signals, such as targeting signals, necessary for efficient expression of the genes in various host cells into which the vectors are introduced. Such vectors are constructed and transformed into host cells by methods well known in the art. See Sambrook et al., [0128] Molecular Cloning: A Laboratory Manual, Cold Spring Harbor (1989). Preferred host cells for the vectors of the invention include insect, bacterial, and plant cells. Preferred insect cells include Spodoptera frugiperda cells such as Sf2 1, and Trichoplusia ni cells. Preferred bacterial cells include Escherichia coli, Streptomyces and Pseudomonas. Preferred plant cells include monocot and dicot cells, such as maize, rice, wheat, tobacco, legumes, carrot, squash, canola, soybean, potato, and the like.
  • Moreover, the appropriate subcellular compartment in which to locate the enzyme in eukaryotic cells must be considered when constructing eukaryotic expression vectors. Two factors are important: the site of production of the acetyl-CoA substrate, and the available space for storage of the PHA polymer. To direct the enzyme to a particular subcellular location, targeting sequences may be added to the sequences encoding the recombinant molecules. [0129]
  • The baculovirus system is particularly amenable to the introduction of DNA encoding a recombinant FAS or a PKS monomer synthase because an increasing variety of transfer plasmids are becoming available which can accommodate a large insert, and the virus can be propagated to high titers. Moreover, insect cells are adapted readily to suspension culture, facilitating relatively large-scale recombinant protein production. Further, recombinant proteins tend to be produced exclusively as soluble proteins in insect cells, thus, obviating the need for refolding, a task that might be particularly daunting in the case of a large multifunctional protein. The Sf21/baculovirus system has routinely expressed milligram quantities of catalytically active recombinant fatty acid synthase. Finally, the baculovirus/insect cell system provides the ability to construct and analyze different synthase proteins for the ability to polymerize monomers into unique biodegradable polymers. [0130]
  • A further embodiment of the invention is the introduction of at least one DNA encoding a PHA synthase and a DNA encoding a PHA monomer synthase into a host cell. Such synthases include, but are not limited to, [0131] A. eutrophus 3-hydroxy, 4-hydroxy, and 5-hydroxy alkanoate synthases, Rhodococcus ruber C3-C5 hydroxyalkanoate synthases, Pseudomonas oleororans C6-C14 hydroxyalkanoate synthases, P. putida C6-C14 hydroxyalkanoate synthases, P. aeruginosa C5-C10 hydroxyalkanoate synthases, P. resinovorans C4-C10 hydroxyalkanoate synthases, Rhodospirillum rubrum C4-C7 hydroxyalkanoate syntheses, R. gelatinorus C4-C7 , Thiocapsa pfennigii C4-C8 hydroxyalkanoate synthases, and Bacillus megaterium C4-C5 hydroxyalkanoate synthases.
  • The introduction of DNA(s) encoding more than one PHA synthase may be necessary to produce a particular PHA polymer due to the specificities exhibited by different PHA synthases. As multifunctional proteins are altered to produce unusual monomeric structures, synthase specificity may be problematic for particular substrates. Although the [0132] A. eutrophus PHB synthase utilizes only C4 and C5 compounds as substrates, it appears to be a good prototype synthase for initial studies since it is known to be capable of producing copolymers of 3-hydroxybutyrate and 4-hydroxybutyrate (Kunioka et al., Macromolecules, 22, 694 (1989)) as well as copolymers of 3-hydroxyvalerate, 3-hydroxybutyrate, and 5-hydroxyvalerate (Doi et al., Macromolecules, 19, 2860 (1986)). Other synthases, especially those of Pseudomonas aeruginosa (Timm et al., Eur. J. Biochem., 209, 15 (1992)) and Rhodococcus ruber (Pieper et al., FEMS Microbiol. Lett., 96, 73 (1992)), can also be employed in the practice of the invention. Synthase specificity may be alterable through molecular biological methods.
  • In yet another embodiment of the invention, a DNA encoding a FAS and a PHA synthase can be introduced into a single expression vector, obviating the need to introduce the genes into a host cell individually. [0133]
  • A further embodiment of the invention is the generation of a DNA encoding a recombinant multifunctional protein, which comprises a FAS, of either eukaryotic or prokaryotic origin, and a PKS module F. Module F will carry out the final chain extension to include two additional carbons and the reduction of the β-keto group, which results in a (R)-3-hydroxy acyl CoA moiety. [0134]
  • To produce this recombinant protein, DNA encoding the FAS TE is replaced with a DNA encoding a linker region which is normally found in the ACP-KS interdomain region of bimodular ORFs. DNA encoding a module F is then inserted 3′ to the DNA encoding the linker region. Different linker regions, such as those described below which vary in length and amino acid composition, can be tested to determine which linker most efficiently mediates or allows the required transfer of the nascent saturated fatty acid intermediate to module F for the final chain elongation and keto reduction steps. The resulting DNA encoding the protein can then be tested for expression of long-chain β-hydroxy fatty acids in insect cells, such as Sf21 cells, or Streptomyces, or Pseudomonas. The expected 3-hydroxy C-18 fatty acid can serve as a potential substrate for PHA synthases which are able to accept long-chain alkyl groups. A preferred embodiment of the invention is a FAS that has a chain length specificity between 4-22 carbons. [0135]
  • Examples of linker regions that can be employed in this embodiment of the invention include, but are not limited to, the ACP-KS linker regions encoded by the tyl ORFI (ACP[0136] 1-KS2; ACP2-KS3), and ORF3 (ACP5-KS6), and eryA ORFI (ACP1-KS1; ACP2-KS2), ORF2 (ACP3-KS4) and ORF3 (ACP5-KS6).
  • This approach can also be used to produce shorter chain fatty acid groups by limiting the ability of the FAS unit to generate long-chain fatty acids. Mutagenesis of DNA encoding various FAS catalytic activities, starting with the KS, may result in the synthesis of short-chain (R)-3-hydroxy fatty acids. [0137]
  • The PHA polymers are then recovered from the biomass. Large-scale solvent extraction can be used, but is expensive. An alternative method involving heat shock with subsequent enzymatic and detergent digestive processes is also available (Byron, [0138] Trends Biotechnical, 5, 246 (1987); Holmes, In: Developments in Crystalline Polymers, D. C. Bassett (ed.), pp. 1-65 (1988)). PHB and other PHAs are readily extracted from microorganisms by chlorinated hydrocarbons. Refluxing with chloroform has been extensively used; the resulting solution is filtered to remove debris and concentrated, and the polymer is precipitated with methanol or ethanol, leaving low-molecular-weight lipids in solution. Longer side-chain PHAs show a less restricted solubility than PHB and are, for example, soluble in acetone. Other strategies adopted include the use of ethylene carbonate and propylene carbonate as disclosed by Lafferty et al. (Chem. Rundschau, 30, 14 (1977)) to extract PHB from biomass. Scandola et al. (Int. J. Biol. Microbiol., 10, 373 (1988)) reported that 1 M HCl-chloroform extraction of Rhizobium meliloti yielded PHB of MW=6×104 compared with 1.4×106 when acetone was used.
  • Methods are well known in the art for the determination of the PHB or PHA content of microorganisms, the composition of PHAs, and the distribution of the monomer units in the polymer. Gas chromatography and high-pressure liquid chromatography are widely used for quantitative PHB analysis. See Anderson et al., [0139] Microbiol. Rev., 54, 450 (1990) for a review of such methods. NMR techniques can also be used to determine polymer composition, and the distribution of monomer units.
  • Preparation of Variant Nucleic Acid Molecules and Variant Polypeptides of the Invention [0140]
  • The present invention also contemplates nucleic acid sequences which hybridize under stringent hybridization conditions to the nucleic acid sequences set forth herein. Stringent hybridization conditions are well known in the art and define a degree of sequence identity greater than about 80 to about 90%. Thus, nucleic acid sequences encoding variant polypeptides (FIG. 38), or nucleic acid sequences having conservative (silent) nucleotide substitutions (FIG. 37), are within the scope of the invention. Preferably, variant polypeptides encoded by the nucleic acid sequences of the invention are biologically active. The present invention also contemplates naturally occurring allelic variations and mutations of the nucleic acid sequences described herein. [0141]
  • As is well known in the art, because of the degeneracy of the genetic code, there are numerous other DNA and RNA molecules that can code for the same polypeptides as those encoded by the exemplified biosynthetic genes and fragments thereof. The present invention, therefore, contemplates those other DNA and RNA molecules which, on expression, encode the polypeptides of, for example, portions of SEQ ID NO:47 or SEQ ID NO:49. Having identified the amino acid residue sequence encoded by a sugar biosynthetic or macrolide biosynthetic gene, and with knowledge of all triplet codons for each particular amino acid residue, it is possible to describe all such encoding RNA and DNA sequences. DNA and RNA molecules other than those specifically disclosed herein and, which molecules are characterized simply by a change in a codon for a particular amino acid, are within the scope of this invention. [0142]
  • The 20 common amino acids and their representative abbreviations, symbols and codons are well known in the art (see, for example, [0143] Molecular Biology of the Cell, Second Edition, B. Alberts et al., Garland Publishing Inc., New York and London, 1989). As is also well known in the art, codons constitute triplet sequences of nucleotides in mRNA molecules and as such, are characterized by the base uracil (U) in place of base thymidine (T) which is present in DNA molecules. A simple change in a codon for the same amino acid residue within a polynucleotide will not change the structure of the encoded polypeptide. By way of example, it can be seen from SEQ ID NO:49 that a TCT codon for serine exists at nucleotide positions 1735-1737. However, it can also be seen from that same sequence that serine can be encoded by a TCA codon (see, e.g., nucleotide positions 1738-1740) and a TCC codon (see, e.g., nucleotide positions 1874-1876). Substitution of the latter codons for serine with the TCT codon for serine or vice versa, does not substantially alter the DNA sequence of SEQ ID NO:49 and results in production of the same polypeptide. In a similar manner, substitutions of the recited codons with other equivalent codons can be made in a like manner without departing from the scope of the present invention.
  • A nucleic acid molecule, segment or sequence of the present invention can also be an RNA molecule, segment or sequence. An RNA molecule contemplated by the present invention corresponds to, is complementary to or hybridizes under stringent conditions to any of the DNA sequences set forth herein. Exemplary and preferred RNA molecules are mRNA molecules that encode sugar biosynthetic or macrolide biosynthetic enzymes of this invention. [0144]
  • Mutations can be made to the native nucleic acid sequences of the invention and such mutants used in place of the native sequence, so long as the mutants are able to function with other sequences to collectively catalyze the synthesis of an identifiable polyketide or macrolides. Such mutations can be made to the native sequences using conventional techniques such as by preparing synthetic oligonucleotides including the mutations and inserting the mutated sequence into the gene using restriction endonuclease digestion. (See, e.g., Kunkel, T. A. [0145] Proc. Natl. Acad. Sci. USA (1985) 82:448; Geisselsoder et al. BioTechniques (1987) 5:786.) Alternatively, the mutations can be effected using a mismatched primer (generally 10-20 nucleotides in length) which hybridizes to the native nucleotide sequence (generally cDNA corresponding to the RNA sequence), at a temperature below the melting temperature of the mismatched duplex. The primer can be made specific by keeping primer length and base composition within relatively narrow limits and by keeping the mutant base centrally located. Zoller and Smith, Methods Enzymol., (1983) 100:468. Primer extension is effected using DNA polymerase, the product cloned and clones containing the mutated DNA, derived by segregation of the primer extended strand, selected. Selection can be accomplished using the mutant primer as a hybridization probe. The technique is also applicable for generating multiple point mutations. See, e.g., Dalbie-McFarland et al., Proc. Natl. Acad. Sci. USA (1982) 79:6409. PCR mutagenesis will also find use for effecting the desired mutations.
  • Random mutagenesis of the nucleotide sequence can be accomplished by several different techniques known in the art, such as by altering sequences within restriction endonuclease sites, inserting an oligonucleotide linker randomly into a plasmid, by irradiation with X-rays or ultraviolet light, by incorporating incorrect nucleotides during in vitro DNA synthesis, by error-prone PCR mutagenesis, by preparing synthetic mutants or by damaging plasmid DNA in vitro with chemicals. Chemical mutagens include, for example, sodium bisulfite, nitrous acid, hydroxylamine, agents which damage or remove bases thereby preventing normal base-pairing such as hydrazine or formic acid, analogues of nucleotide precursors such as nitrosoguanidine, 5-bromouracil, 2-aminopurine, or acridine intercalating agents such as proflavine, acriflavine, quinacrine, and the like. Generally, plasmid DNA or DNA fragments are treated with chemicals, transformed into [0146] E. coli and propagated as a pool or library of mutant plasmids.
  • Large populations of random enzyme variants can be constructed in vivo using “recombination-enhanced mutagenesis.” This method employs two or more pools of, for example, 10[0147] 6 mutants each of the wild-type encoding nucleotide sequence that are generated using any convenient mutagenesis technique and then inserted into cloning vectors.
  • The gene sequences can be inserted into one or more expression vectors, using methods known to those of skill in the art. Expression vectors may include control sequences operably linked to the desired genes. Suitable expression systems for use with the present invention include systems which function in eukaryotic and prokaryotic host cells. Prokaryotic systems are preferred, and in particular, systems compatible with Streptomyces spp. are of particular interest. Control elements for use in such systems include promoters, optionally containing operator sequences, and ribosome binding sites. Particularly useful promoters include control sequences derived from the gene clusters of the invention. However, other bacterial promoters, such as those derived from sugar metabolizing enzymes, such as galactose, lactose (lac) and maltose, will also find use in the expression cassettes encoding desosamine. Additional examples include promoter sequences derived from biosynthetic enzymes such as tryptophan (trp), the β-lactamase (bla) promoter system, bacteriophage lambda PL, and T5. In addition, synthetic promoters, such as the tac promoter (U.S. Pat. No. 4,551,433), which do not occur in nature, also function in bacterial host cells. [0148]
  • Other regulatory sequences may also be desirable which allow for regulation of expression of the genes relative to the growth of the host cell. Regulatory sequences are known to those of skill in the art, and examples include those which cause the expression of a gene to be turned on or off in response to a chemical or physical stimulus, including the presence of a regulatory compound. Other types of regulatory elements may also be present in the vector, for example, enhancer sequences. [0149]
  • Selectable markers can also be included in the recombinant expression vectors. A variety of markers are known which are useful in selecting for transformed cell lines and generally comprise a gene whose expression confers a selectable phenotype on transformed cells when the cells are grown in an appropriate selective medium. Such markers include, for example, genes which confer antibiotic resistance or sensitivity to the plasmid. Alternatively, several polyketides are naturally colored and this characteristic provides a built-in marker for selecting cells successfully transformed by the present constructs. [0150]
  • The various subunits of interest can be cloned into one or more recombinant vectors as individual cassettes, with separate control elements, or under the control of, e.g., a single promoter. The subunits can include flanking restriction sites to allow for the easy deletion and insertion of other subunits so that hybrid PKSs can be generated. The design of such unique restriction sites is known to those of skill in the art and can be accomplished using the techniques described above, such as site-directed mutagenesis and PCR. [0151]
  • For sequences generated by random mutagenesis, the choice of vector depends on the pool of mutant sequences, i.e., donor or recipient, with which they are to be employed. Furthermore, the choice of vector determines the host cell to be employed in subsequent steps of the claimed method. Any transducible cloning vector can be used as a cloning vector for the donor pool of mutants. It is preferred, however, that phagemids, cosmids, or similar cloning vectors be used for cloning the donor pool of mutant encoding nucleotide sequences into the host cell. Phagemids and cosmids, for example, are advantageous vectors due to the ability to insert and stably propagate therein larger fragments of DNA than in M13 phage and ? phage, respectively. Phagemids which will find use in this method generally include hybrids between plasmids and filamentous phage cloning vehicles. Cosmids which will find use in this method generally include ? phage-based vectors into which cos sites have been inserted. Recipient pool cloning vectors can be any suitable plasmid. The cloning vectors into which pools of mutants are inserted may be identical or may be constructed to harbor and express different genetic markers (see, e.g., Sambrook et al., supra). The utility of employing such vectors having different marker genes may be exploited to facilitate a determination of successful transduction. [0152]
  • Thus, for example, the cloning vector employed may be a phagemid and the host cell may be [0153] E. coli. Upon infection of the host cell which contains a phagemid, single-stranded phagemid DNA is produced, packaged and extruded from the cell in the form of a transducing phage in a manner similar to other phage vectors. Thus, clonal amplification of mutant encoding nucleotide sequences carried by phagemids is accomplished by propagating the phagemids in a suitable host cell.
  • Following clonal amplification, the cloned donor pool of mutants is infected with a helper phage to obtain a mixture of phage particles containing either the helper phage genome or phagemids mutant alleles of the wild-type encoding nucleotide sequence. [0154]
  • Infection, or transfection, of host cells with helper phage is generally accomplished by methods well known in the art (see., e.g., Sambrook et al., supra; and Russell et al. (1986) [0155] Gene 45:333-338).
  • The helper phage may be any phage which can be used in combination with the cloning phage to produce an infective transducing phage. For example, if the cloning vector is a cosmid, the helper phage will necessarily be a ? phage. Preferably, the cloning vector is a phagemid and the helper phage is a filamentous phage, and preferably phage M13. [0156]
  • If desired after infecting the phagemid with helper phage and obtaining a mixture of phage particles, the transducing phage can be separated from helper phage based on size difference (Barnes et al. (1983) [0157] Methods Enzymol. 101:98-122), or other similarly effective technique.
  • The entire spectrum of cloned donor mutations can now be transduced into clonally amplified recipient cells into which has been transduced or transformed a pool of mutant encoding nucleotide sequences. Recipient cells which may be employed in the method disclosed and claimed herein may be, for example, [0158] E. coli, or other bacterial expression systems which are not recombination deficient. A recombination deficient cell is a cell in which recombinatorial events is greatly reduced, such as rec mutants of E. coli (see, Clark et al. (1965) Proc. Natl. Acad. Sci. USA 53:451-459).
  • These transductants can now be selected for the desired expressed protein property or characteristic and, if necessary or desirable, amplified. Optionally, if the phagemids into which each pool of mutants is cloned are constructed to express different genetic markers, as described above, transductants may be selected by way of their expression of both donor and recipient plasmid markers. [0159]
  • The recombinants generated by the above-described methods can then be subjected to selection or screening by any appropriate method, for example, enzymatic or other biological activity. [0160]
  • The above cycle of amplification, infection, transduction, and recombination may be repeated any number of times using additional donor pools cloned on phagemids. As above, the phagemids into which each pool of mutants is cloned may be constructed to express a different marker gene. Each cycle could increase the number of distinct mutants by up to a factor of 10[0161] 6. Thus, if the probability of occurrence of an inter-allelic recombination event in any individual cell is f (a parameter that is actually a function of the distance between the recombining mutations), the transduced culture from two pools of 106 allelic mutants will express up to 1012 distinct mutants in a population of 1012/f cells.
  • I. Experimental Procedures
  • Materials and Methods [0162]
  • Materials. Sodium R-(−)-3-hydroxybutyrate, coenzyme-A, ethylchloroformate, pyridine and diethyl ether were purchased from Sigma Chemical Co. Amberlite IR-120 was purchased from Mallinckrodt Inc. 6-O-(N-Heptylcarbamoyl)methyl a-D-glycopyranoside (Hecameg) was obtained from Vegatec (Villeejuif, France). Two-piece spectrophotometer cells with pathlengths of 0.1 (#20/0-Q-1) and 0.01 cm (#20/0-Q-0.1) were obtained from Starna Cells Inc. (Atascadero, Calif.). Rabbit anti-[0163] A. eutrophus PHA synthase antibody was a gracious gift from Dr. F. Srienc and S. Stoup (Biological Process Technology Institute, University of Minnesota). Sf21 cells and T. ni cells were kindly provided by Greg Franzen (R&D Systems, Minneapolis, Minn.) and Stephen Harsch (Department of Veterinary Pathobiology, University of Minnesota), respectively.
  • Plasmid pFAS206 and a recombinant baculoviral clone encoding FAS206 (Joshi et al., [0164] J. Biol. Chem., 268, 22508 (1993)) were generous gifts of A. Joshi and S. Smith. Plasmid pAet41 (Peoples et al., J. Biol. Chem., 264, 15298 (1989)), the source of the A. eutrophus PHB synthase, was obtained from A. Sinskey. Baculovirus transfer vector, pBaePAK9, and linearized baculoviral DNA, were obtained from Clontech Inc. (Palo Alto, Calif.). Restriction enzymes, T4 DNA ligase, E. coli DH5a competent cells, molecular weight standards, lipofectin reagent, Grace's insect cell medium, fetal bovine serum (FBS), and antibiotic/antimycotic reagent were obtained from GIBCO-BRL (Grand Island, N.Y.). Tissue culture dishes were obtained from Coming Inc. Spinner flasks were obtained from Bellco Glass Inc. Seaplaque agarose GTG was obtained from FMC Bioproducts Inc.
  • Methods [0165]
  • Preparation of R-3HBCoA. R-(−)-3 HBCoA was prepared by the mixed anhydride method described by Haywood et al., [0166] FEMS Microbiol. Lett., 57, 1 (1989). 60 mg (0.58 nmol) of R-(−)-3 hydroxybutyric acid was freeze dried and added to a solution of 72 mg of pyridine in 10 ml diethyl ether at 0° C. Ethylchloroformate (100 mg) was added, and the mixture was allowed to stand at 4° C. for 60 minutes. Insoluble pyridine hydrochloride was removed by centrifugation. The resulting anhydride was added, dropwise with mixing, to a solution of 100 mg coenzyme-A (0.13 mmol) in 4 ml 0.2 M potassium bicarbonate, pH 8.0 at 0° C. The reaction was monitored by the nitroprusside test of Stadtman, Meth. Enzymol., 3, 931 (1957), to ensure sufficient anhydride was added to esterify all the coenzyme-A. The concentration of R-3-HBCoA was determined by measuring the absorbance at 260 nm (e=16.8 nM−1 cm−1; 18).
  • Construction of pBP-phbC. The phbC gene (approximately 1.8 kb) was excised from pAet4l (Peoples et al., [0167] J. Biol. Chem., 264, 15293 (1989)) by digestion with BstBI and StuI, purified as described by Williams et al. (Gene, 109, 445 (1991)), and ligated to pBacPAK9 digested with BstBI and StuI. This resulted in pBP-phbC, the baculovirus transfer vector used in formation of recombinant baculovirus particles carrying phbC.
  • Large-scale expression of PHA synthase. A 1 L culture of [0168] T. ni cells (1.2×106 cells/ml) in logarithmic growth was infected by the addition of 50 ml recombinant viral stock solution (2.5×108 pfu/ml) resulting in a multiplicity of infection (MOI) of 10. This infected culture was split between two Bellco spinners (350 ml/500 ml spinner, 700 ml/1 L spinner) to facilitate oxygenation of the culture. These cultures were incubated at 28° C. and stirred at 60 rpm for 60 hours. Infected cells were harvested by centrifugation at 1000×g for 10 minutes at 4° C. Cells were flash frozen in liquid N2 and stored in 4 equal aliquots, at −80° C. until purification.
  • Insect cell maintenance and recombinant baculovirus formation. Sf21 cells were maintained at 26-28° C. in Grace's insect cell medium supplemented with 10% FBS, 1.0% pluronic F68, and 1.0% antibiotic/antimycotic (GIBCO-BRL). Cells were typically maintained in suspension at 0.2-2.0×10[0169] 6/ml in 60 ml total culture volume in 100 ml spinner flasks at 55-65 rpm. Cell viability during the culture period was typically 95-100%. The procedures for use of the transfer vector and baculovirus were essentially those described by the manufacturer (Clontech, Inc.). Purified pBP-phbC and linearized baculovirus DNA were used for cotransfection of Sf21 cells using the liposome-mediated method (Feigner et al., Proc. Natl. Acad. Sci. USA, 84, 7413 (1987)) utilizing Lipofectin (GIBCO-BRL). Four days later cotransfection supernatants were utilized for plaque purification. Recombinant viral clones were purified from plaque assay plates containing 1.5% Seaplaque GTG after 5-7 days at 28° C. Recombinant viral clone stocks were then amplified in T25-flask cultures (4 ml, 3×106/ml on day 0) for 4 days; infected cells were determined by their morphology and size and then screened by SDS/PAGE using 10% polyacrylamide gels (Laemmli, Nature, 227, 680 (1970)) for production of PHA synthase.
  • Purification of PHA synthase from BTI-TN-5BI-4 [0170] T. ni cells. Purification of PHA synthase was performed according to the method of Gerngross et al., Biochemistry, 33, 9311 (1994) with the following alterations. One aliquot (110 mg protein) of frozen cells was thawed on ice and resuspended in 10 mM KPi (pH 7.2), 5% glycerol, and 0.05% Hecameg (Buffer A) containing the following protease inhibitors at the indicated final concentrations: benzamidine (2 mM), phenylmethylsulfonyl fluoride (PMSF, 0.4 mM), pepstatin (2 mg/ml), leupeptin (2.5 mg/ml), and Na-p-tosyl-1-lysine chloromethyl ketone (TLCK, 2 mM). EDTA was omitted at this stage due to its incompatibility with hydroxylapatite (HA). This mixture was homogenized with three series of 10 strokes each in two Thomas homogenizers while partially submerged in an ice bath and then sonicated for 2 minutes in a Branson Sonifier 250 at 30% cycle, 30% power while on ice. All subsequent procedures were carried out at 4° C.
  • The lysate was immediately centrifuged at 100000×g in a Beckman 50.2Ti rotor for 80 minutes, and the resulting supernatant (10.5 ml, 47 mg) was immediately filtered through a 0.45 mm Uniflow filter (Schleicher and Schuell Inc., Keene, N.H.) to remove any remaining insoluble matter. Aliquots of the soluble fraction (1.5 ml, 7 mg) were loaded onto a 5 ml BioRad Econo-Pac HTP column that had been equilibrated with Buffer A (+protease inhibitor mix) attached to a BioRad Econo-system, and the column was washed with 30 ml Buffer A. All chromatographic steps were carried out at a flow rate of 0.8 ml/minute. PHA synthase was eluted form the HA column with a 32×32 ml linear gradient from 10 to 300 mM KPi. [0171]
  • Fraction collection tubes were prepared by addition of 30 ml of 100 mM EDTA to provide a metalloprotease inhibitor at 1 mM immediately after HA chromatography. PHA synthase was eluted in a broad peak between 110-180 mM KPi. Fractions (3 ml) containing significant PHA synthase activity were pooled and stored at 0° C. until the entire soluble fraction had been run through the chromatographic process. Pooled fractions then were concentrated at 4° C. by use of a Centriprep-30 concentrator (Amicon) to 3.8 mg/ml. Aliquots (0.5 ml) were either flash frozen and stored in liquid N[0172] 2 or glycerol was added to a final concentration of 50% and samples (1.9 mg/ml) were stored at −20° C.
  • Western analysis. Samples of [0173] T. ni cells were fractionated by SDS-PAGE on 10% polyacrylamide gels, and the proteins then were transferred to 0.2 mm nitrocellulose membranes using a BioRad Transblot SD Semi-Dry electrophoretic transfer cell according to the manufacturer. Proteins were transferred for 1 hour at 15 V. The membrane was rinsed with doubly distilled H2O, dried, and treated with phosphate-buffered saline (PBS) containing 0.05% Tween-20 (PBS-Tween) and 3% nonfat dry milk to block non-specific binding sites. Primary antibody (rabbit anti-PHA synthase) was applied in fresh blocking solution and incubated at 25° C. for 2 hours. Membranes were then washed four times for 10 minutes with PBS-Tween followed by the addition of horseradish peroxidase-conjugated goat-anti-rabbit antibody (Boehringer-Mannheim) diluted 10,000× in fresh blocking solution and incubated at 25° C. for 1 hour. Membranes were washed finally in three changes (10 minutes) of PBS, and the immobilized peroxidase label was detected using the chemiluminescent LumiGLO substrate kit (Kirkegaard and Perry, Gaithersburg, Md.) and X-ray film.
  • N-terminal analysis. Approximately 10 mg of purified PHA synthase was run on a 10% SDS-polyacrylamide gel, transferred to PVDF (Immobilon-PSQ, Millipore Corporation, Bedford, Mass.), stained with Amido Black, and sequenced on a 494 Procise Protein Sequencer (Perkin-Elmer, Applied Biosystems Division, Foster City, Calif.). [0174]
  • Double-infection protocol. Four 100 ml spinner flasks were each inoculated with 8×10[0175] 7 cells in 50 ml of fresh insect medium. To flask 1, an additional 20 ml of fresh insect medium was added (uninfected control); to flask 2, 10 ml BacPAK6::phbC viral stock (1×108 pfu/ml) and 10 ml fresh insect medium were added; to flask 3, 10 ml BacPAK6::FAS206 viral stock (1×108 pfu/ml) and 10 ml fresh insect medium were added; and to flask 4, 10 ml BacPAK6::phbC viral stock (1×108 pfu/ml) and 10 ml BacPAK6::FAS206 viral stock (1×108 pfu/ml) were added. These viral infections were carried out at a multiplicity of infection of approximately 10. Cultures were maintained under normal growth conditions and 15 ml samples were removed at 24, 48, and 72 hour time points. Cells were collected by gentle centrifugation at 1000×g for 5 minutes, the medium was discarded, and the cells were immediately stored at −70° C.
  • PHA synthase assays. Coenzyme A released by PHA synthase in the process of polymerization was monitored precisely as described by Gemgross et al. (supra) using 5,5′-dithiobis (2-nitrobenzoic acid, DTNB) (Ellman, [0176] Arch. Biochem. Biophys., 82, 70 (1959)).
  • The presence of HBCoA was monitored spectrophotometrically. Assays were performed at 25° C. in a Hewlett Packard 8452A diode array spectrophotometer equipped with a water-jacketed cell holder. Two-piece Starna Spectrosil spectrophotometer cells with pathlengths of 0.1 and 0.01 cm were employed to avoid errors arising from the compression of the absorbance scale at higher values. Absorbance was monitored at 232 nm, and E[0177] 232 nm of 4.5×103 M−1 cm−1 was used in calculations. One unit (U) of enzyme is the amount required to hydrolyze 1 mmol of substrate minute−1. Buffer (0.15 M KPi, pH 7.2) and substrate were equilibrated to 25° C. and then combined in an Eppendorf tube also at 25° C. Enzyme was added and mixed once in the pipet tip used to transfer the entire mixture to the spectrophotometer cell. The two-piece cell was immediately assembled, placed in the spectrophotometer with the cell holder (type CH) adapted for the standard 10 mm pathlength cell holder of the spectrophotometer. Manipulations of sample, from mixing to initiation of monitoring, took only 10-15 seconds. Absorbance was continually monitored for up to 10 minutes. Calibration of reactions was against a solution of buffer and enzyme (no substrate) which led to absorbance values that represented substrate only.
  • PHB assay. PHB was assayed from Sf21 cell samples according to the propanolysis method of Riis et al., [0178] J. Chromo., 445, 285 (1988). Cell pellets were thawed on ice, resuspended in 1 ml cold ddH2O and transferred to 5 ml screwtop test tubes with teflon seals. Two ml of ddH2O were added, the cells were washed and centrifuged and then 3 ml of acetone were added and the cells washed and centrifuged. The samples were then desiccated by placing them in a 94° C. oven for 12 hours. The following day 0.5 ml of 1,2-dichloroethane, 0.5 ml acidified propanol (20 ml HCl, 80 ml 1-propanol) and 50 ml benzoic acid standard were added and the sealed tubes were heated to 100° C. in a boiling water bath for 2 hours with periodic vortexing. The tubes were cooled to room temperature and the organic phase was used for gas-chromatographic (GC) analysis using a Hewlett Packard 5890A gas chromatograph equipped with a Hewlett Packard 7673A automatic injector and a fused silica capillary column, DB-WAX 30W of 30 meter length. Positive samples were further subjected to GC-mass spectrometric (MS) analysis for the presence of propylhydroxybutyrate using a Kratos MS25 GC/MS. The following parameters were used: source temperature, 210° C.; voltage, 70 eV; and accelerating voltage, 4 KeV.
  • Catalytic Activities [0179]
  • Ketoacyl synthase (KS) activity was assessed radiochemically by the condensation-[0180] 14CO2 exchange reaction (Smith et al., PNAS USA, 73, 1184 (1976)).
  • Transferase (AT) activity was assayed, using malonyl-CoA as donor and pantetheine as acceptor, by determining spectrophotometrically the free CoA released in a coupled ATP citrate-lyase-malate dehydrogenase reaction (see, Rangen et al., [0181] J. Biol. Chem., 266, 19180 (1991).
  • Ketoreductase (KR) was assayed spectrophotometrically at 340 nm: assay systems contained 0.1 M potassium phosphate buffer (pH 7), 0.15 mM NADPH, enzyme and either 10 mM trans-1-decalone or 0.1 mM acetoacetyl-CoA substrate. [0182]
  • Dehydrase (DH) activity was assayed spectrophotometrically at 270 nm using S-DL-β-hydyroxybutyryl N-acetylcysteamine as substrate (Kumar et al., [0183] J. Biol. Chem., 245, 4732 (1970)).
  • Enoyl reductase (ER) activity was assayed spectrophotometrically at 340 nm essentially as described by Strom et al. ([0184] J. Biol. Chem., 254, 8159 (1979)); the assay system contained 0.1 M potassium phosphate buffer (pH 7), 0.15 mM NADPH, 0.375 nM crotonoyl-CoA, 20 μM CoA and enzyme.
  • Thioesterase (TE) activity was assessed radiochemically by extracting and assaying the [[0185] 14C]palmitic acid formed from [1-14C]palmitoyl-CoA during a 3 minute incubation Smith, Meth. Enzymol., 71 C, 181 (1981); the assay was in a final volume of 0.1 ml, 25 mM potassium phosphate buffer (pH 8), 20 μM [1-14C]palmitoyl-CoA (20 nCi) and enzyme.
  • Assay of overall fatty acid synthase activity was performed spectrophotometrically as described previously by Smith et al. ([0186] Meth. Enzymol., 35, 65 (1975)). All enzyme activities were assayed at 37° C. except the transferase, which was assayed at 20° C. Activity units indicate nmol of substrate consumed/minute. All assays were conducted, at a minimum, at two different protein concentrations with the appropriate enzyme and substrate blanks included.
  • II. EXAMPLES Example 1 Expression of A. Eutrophus PHA Synthase Using a Baculovirus System
  • Recent work has shown that PHA synthase from [0187] A. eutrophus can be overexpressed in E. coli, in the absence of 3-ketothiolase and acetoacetyl-CoA reductase (Gerngross et al., supra) and can be expressed in plants (See Poirier et al., Biotech, 1584 13, 142 (1995) for a review). Isolation of the soluble form of PHA synthase provides opportunities to examine the mechanistic details of the priming and initiation reactions. Because the baculovirus system has been successful for the expression of a number of prokaryotic genes as soluble proteins, and insect cells, unlike bacterial expression systems, carry out a wide array of post-translational modifications, the baculovirus expression system appeared ideal for the expression of large quantities of soluble PHA synthase, a protein that must be modified by phosphopantetheine in order to be catalytically active (Gerngross et al., supra).
  • Purification of PHA synthase. The purification procedure employed for PHA synthase is a modification of Gerngross et al. (supra) involving the elimination of the second liquid chromatographic step and inclusion of a protease-inhibitor cocktail in all buffers. All steps were carried out on ice or at 4° C. except where noted. Frozen cells were thawed on ice in 10 ml of Buffer A (10 mM KPi, pH 7.2, 05% glycerol, and 0.05% Hecameg) and then immediately homogenized prior to centrifugation and HA chromatography. [0188]
  • The results of these efforts are summarized in Table 1 and FIG. 7. A prominent band at 64 kDa is visible in total, soluble, and HA eluate protein samples fractionated by SDS/PAGE ([0189] lanes 4, 5, and 6 of FIG. 7, respectively). The initial specific activity of the isolated PHA synthase was 20-fold higher than previous attempts at expression and purification of this polypeptide. Approximately 1000 units of PHB synthase have been purified, based on calculations from the direct spectrophotometric assay detailed below, with an overall recovery of activity of 70%. The large proportion of synthase present in the membrane fraction, and the fact that over 90% of the initial activity was found in the soluble fraction, suggest either that the synthase in the membrane fraction is in an inactive form or that the direct assay is not applicable to the initial, 12 U/mg, crude extract.
    TABLE 1
    Purification of PHA Synthase
    protein specific
    sample total units vol (mL) (mg) (mg/ml) activity recovery
    total 1430 11.5 113 9.8 12.7 100
    protein
    soluble 1340 10.5 47 4.5 28.6 93
    protein
    pooled 1020 7.9 30 3.8 34.2 71
    HA
    fractions
  • N-terminal sequencing of the 64 kDa protein confirmed its identity as PHA synthase (FIG. 8). Two prominent N-termini, at amino acid residue 7 (alanine) and residue 10 (scrine) were obtained in a 3:2 ratio. This heterogeneous N-terminus presumably is the result of aminopeptidase activity. Western analysis using a rabbit-anti-PHA synthase antibody corroborated the results of the sequencing and indicated the presence of at least three bands that resulted from proteolysis of PHA synthase (FIG. 7B, lanes 4-6). The antibody was specific for PHA synthase since neither [0190] T. ni nor baculoviral proteins showed reactivity (FIG. 7B, lanes 2 and 3). N-terminal protein sequencing (FIG. 8) showed directly that the 44 kDa (band b) and 32 kDa (band d) proteins were derived from PHA synthase (fragments beginning at A181/N185 and at G387, respectively). The 35-40 kDa (band c) protein gave low sequencing yields and may contain a blocked N-terminus. Inspection of FIG. 7B suggests that most degradation occurs following cell disruption since the total protein sample of this gel (lane 4) was prepared by boiling intact cells directly in SDS sample buffer while the HA sample (lane 6) went through the purification procedure described above.
  • Assay of synthase activity. Due to the significant level of expression obtained using the baculovirus system, the synthase activity could be assayed spectrophotometrically by monitoring hydrolysis of the thioester bond at 232 nm, the wavelength at which there is a maximum decrease in absorbance upon hydrolysis. The difference between substrate (HBCOA) and product (CoA) at this wavelength is shown in FIG. 9. Absorbance of HBCoA and CoA at 232 nm occurs at a trough between two well-separated peaks. Assays were carried out at pH 7.2 for comparative analysis with previous studies (Gerngross et al., supra). Substrate (R-(−)3-HBCoA) substrate for these studies was prepared using the mixed anhydride method (Haywood et al., supra), and its concentration was determined by measuring A[0191] 260. The short pathlength cells (0.1 cm and 0.01 cm) allowed use of relatively high reaction concentrations while conserving substrate and enzyme. Assay results showed an initial lag period of 60 seconds prior to the linear decrease in A232, and velocities were determined from the slope of these linear regions of the assay curves. The length of the lag period was variable and was inversely related to enzyme concentration. These data are consistent with those using PHA synthase purified from E. coli (Gerngross et al., supra).
  • FIGS. 10 and 11 show the V versus S and 1/V versus 1/S plots, respectively. The double reciprocal plot was concave upward which is similar to results obtained from studies of the granular PHA synthase from [0192] Zooglea ramigera (Fukui et al., Arch. Microbiol., 110, 149 (1976)) and suggests a complex reaction mechanism. Examinations of velocity and specific activity as a function of enzyme concentration are shown in FIGS. 12 and 13. These results confirm that specific activity of the synthase depends upon enzyme concentration. The pH activity curve for A. eutrophus PHA synthase purified from T. ni cells is shown in FIG. 14. The curve shows a broad activity maximum centered around pH 8.5. This result agrees well with prior work on the A. eutrophus PHB synthase although it is significantly different than results obtained for the PHB synthase from Z. ramigera for which the optimum was determined to be pH 7.0.
  • The effect of varying enzyme concentration in the presence of a fixed amount of substrate revealed an intriguing trend (FIG. 15). From these data it appears that the extent of polymerization is dependent on the amount of enzyme included in the reaction mixture. This could be explained if there is a “terminal length” limitation of the polymer, which, once reached, cannot be extended any further. If this is the case, it would also suggest that termination of the polymerization reaction, the release of the synthase from the polymer, and/or reinitiation of polymerization by the newly released synthase are relatively slow events since no evidence of these reactions are seen within the time course of these studies. The phenomenon observed in FIG. 15 is not the result of decay of the enzyme over the course of the assay since virtually identical results are obtained following a 10 minute preincubation of the synthase at 25° C. [0193]
  • It must also be noted that comparisons of the direct spectrophotometric assays used here and the more common assay involving the use of Ellman's reagent, DTNB, (Ellman, supra) in the formation of thiolate of coenzyme-A showed that the values determined by the direct method were approximately 70% of the values determined using Ellman's reagent. This may be due to phase separation occurring in the cuvettes as the relatively insoluble polymer is formed. In support of this notion, a faint haze or opalescence in the cuvette developed during the course of the reaction, particularly at higher substrate concentrations. [0194]
  • PHA synthase purified from insect cells appears to be relatively stable. Examination of activity following storage, in liquid N[0195] 2 and at −20° C. in the presence of 50% glycerol showed that approximately 50% of synthase activity remained after 7 weeks when stored in liquid N2 and approximately 75% of synthase activity remained after 7 weeks when stored at −20° C. in the presence of 50% glycerol.
  • The expression of PHA synthase from [0196] A. eutrophus in a baculovirus expression system results in the synthase constituting approximately 50% of total protein 60 hours post-infection; however, approximately 50-75% of the synthase is observed in the membrane-associated fraction. This elevated level of expression allowed purification of the soluble PHA synthase using a single chromatographic step on HA. The purity of this preparation is estimated to be approximately 90% (intact PHA synthase and 3 proteolysis products).
  • The initial specific activity of 12 U/mg was approximately 20-fold higher than the most successful previous efforts at overexpression of [0197] A. eutrophus PHA synthase. The synthase reported here was isolated from a 250 ml culture with 70% recovery which represents an improvement of 500-fold (1000 U/64 U×8 L/0.25 L) when compared to an 8 L E. coli culture with 40% recovery. This high expression level should provide sufficient PHA synthase for extensive structural, functional, and mechanistic studies. Furthermore, it is clear that the baculovirus expression system is an attractive option for isolation of other PHA synthases from various sources.
  • PHA synthase produced in the baculovirus system was of sufficient potency to allow direct spectrophotometric analysis of the hydrolysis of the thioester bond of HBCoA at 232 nm. These assays revealed a lag period of approximately 60 seconds, the length of which was variable and inversely related to enzyme concentration. Such a lag period presumably reflects a slow step in the reaction, perhaps correlating to dimerization of the enzyme, the priming, and/or initiation steps in formation of PHB. Size exclusion chromatographic examination of the PHB synthase native MW indicated two forms of the synthase. One form showed a MW of approximately 100-160 kDa and the other showed a MW of approximately 50-80 kDA; these two forms likely represent the dimer and monomer of PHA synthase, respectively. Similar results have been reported previously in which two forms of approximately 60 and 130 kDa were observed. Comparisons of the direct assay reported here and the indirect assay using DTNB revealed that the former resulted in values that were 70% of the values determined by the DTNB indirect assay. Although the reason for this difference has not been examined in detail, it is probable that the apparent phase separation that occurred upon PHB formation in the short pathlength cuvettes used, particularly with high [HBCoA], results in this discrepancy. [0198]
  • Enzymatic analyses of the PHA synthase have found that the enzyme has a broad pH optimum centered at pH 8.5; however, the studies described herein have been performed at pH 7.2 to provide comparative values with the results of others. Moreover, the specific activity of this enzyme is dependent upon enzyme concentration which confirms and extends earlier results (Gerngross et al., supra). [0199]
  • In studies intended to examine the dependence of activity upon enzyme concentration, it became apparent that the extent of the polymerization reaction is dependent on the amount of enzyme included in the reaction mixture. Specifically, decreasing the amount of enzyme leads not only to decreased velocity of reaction but also to a decreased extent of condensation (FIG. 15). One possible explanation is that the enzyme is thermally labile; however, identical assays in which the enzyme is preincubated at 25° C. for 10 minutes prior to initiation of the reaction had similar results. Another possibility is that a terminal-length of the polymer is reached precluding further condensations until the particular synthase molecule is released from the terminal-length polymer. [0200]
  • This work clearly demonstrates the value of the baculovirus expression system for the production of [0201] A. eutrophus PHA synthase and for the potential application to studies of other PHA synthases. Furthermore, the high level of expression obtained using the baculoviral system should allow convenient analysis for substrate-specificity and structure-function studies of PHA synthases from relatively crude insect cell extracts.
  • Example 2 Co-expression of Rat FAS Dehydrase Mutant cDNA and PHB Synthase Gene in Insect Cells
  • Expression of a rat FAS DH-cDNA in Sf9 cells has been reported previously (Rangan et al., [0202] J. Biol. Chem., 266, 19180 (1991); Joshi et al., Biochem. J., 296, 143 (1993)). Once activity of the phbC gene product had been established in insect cells (see Example 1), baculovirus clones containing the rat FAS DH-cDNA and BacPAK6::phbC were employed in a double-infection strategy to determine if PHB would be produced in insect cells. It was not known if an intracellular pool of R(−)-3-hydroxybutyrate would be stable or available as a substrate for the PHB synthase. In order for the R-(−)-3-hydroxybutyrylCoA to be available as a substrate, the R-(−)-3-hydroxybutyrylCoA released from rat FAS DH-protein must be trapped by the PHB synthase and incorporated into a polyrner at a rate faster than β-oxidation, which would regenerate acetylCoA. It was also not known if the stereochemical configuration of the 3-hydroxyl group, which must be in the R form, would be recognized as a substrate by PHB synthase. Fortunately, previous biochemical studies on eukaryotic FASs indicated that the R form of 3-hydroxybutyrylCoA would be generated (Wakil et al., J. Biol. Chem., 237, 687 (1962)).
  • SDS-PAGE of protein samples from a time course of uninfected, single-infected, and dual-infected Sf21 cells was performed (FIG. 16). From these data, it is clear that the rat FAS DH mutant and PHB synthase polypeptides are efficiently co-expressed in Sf21 cells. However, co-expression results in ˜50% reduced levels of both polypeptides compared to Sf21 cells that are producing the individual proteins. Western analysis using anti-rat FAS (Rangan et al., supra) and anti-PHA synthase antibodies confirmed simultaneous production of the corresponding proteins. [0203]
  • To provide further evidence that PHB was being synthesized in insect cells, [0204] T. ni cells which had been infected with a baculovirus vector encoding rat FAS DH0 and/or a baculovirus vector encoding PHA synthase were analyzed for the presence of granules. Infected cells were fixed in paraformaldehyde and incubated with anti-PHA synthase antibodies (Williams et al., Protein Exp. Purif., 7, 203 (1996)). Granules were observed only in doubly infected cells (Williams et al., App. Environ. Micro., 62, 2540 (1996)).
  • Characterization of PHB production in insect cells. In order to determine if de novo synthesis of PHB was occurring in Sf21 cells that co-express the rat FAS DH mutant and PHB synthase, fractions of these samples were extracted, the extract subjected to propanolysis, and analyzed for the presence of propylhydroxybutyrate by gas chromatography (FIG. 17). A unique peak with a retention time that coincided with a propylhydroxybutyrate standard was detected only in the double infection samples at 48 and 72 hours, in contrast to the individually expressed gene products and uninfected controls, which were negative. These samples were analyzed further by GC/MS to confirm the identity of the product. FIG. 18 shows mass spectroscopy data corresponding to the material obtained from peak 10.1 in the gas chromatograph compared to a propylhydroxybutyrate standard. The results show that PHB synthesis is occurring only in Sf21 cells co-expressing the rat FAS DH mutant CDNA and the phbC gene from [0205] A. eutrophus. Integration of the peak in the gas chromatograph corresponding to propylhydroxybutyrate revealed that approximately 1 mg of PHB was isolated from 1 liter culture of Sf21 cells (approximately 600 mg dry cell weight of Sf21 cells). Thus, the ratFAS206 protein effectively replaces the β-ketothiolase and acetoacetyl-CoA reductase functions, resulting in the production of PHB by a novel pathway.
  • The approach described here provides a new strategy to combine metabolic pathways that are normally engaged in primary anabolic functions for production of polyesters. The premature termination of the normal fatty acid biosynthetic pathway to provide suitably modified acylCoA monomers for use in PHA synthesis can be applied to both prokaryotic and eukaryotic expression since the formation of polymer will not be dependent on specialized feedstocks. Thus, once a recombinant PHA monomer synthase is introduced into a prokaryotic or eukaryotic system, and co-expressed with the appropriate PHA synthase, novel bipolymer formation can occur. [0206]
  • Example 3 Cloning and Sequencing of the Vep ORFI PKS Gene Cluster
  • The entire PKS cluster fonn [0207] Streptomyces venezuelae was cloned using a heterologous hybridization strategy. A 1.2 kb DNA fragment that hybridized strongly to a DNA encoding an eryA PKS β-ketoacyl synthase domain was cloned and used to generate a plasmid for gene disruption. This method generated a mutant strain blocked in the synthesis of the antibiotic. A S. venezuelae genomic DNA library was generated and used to clone a cosmid containing the complete methymycin aglycone PKS DNA. Fine-mapping analysis was performed to identify the order and sequence of catalytic domains along the multifunctional PKS (FIG. 19). DNA sequence analysis of the vep ORFI showed that the order of catalytic domains is KSQ/AT/ACP/KS/AT/KR/ACP/KS/AT/DH/KR/ACP. The complete DNA sequence, and corresponding amino acid sequence, of the vep ORFI is shown in FIG. 23 (SEQ ID NO:44 and SEQ ID NO:45, respectively).
  • The sequence data indicated that the PKS gene cluster encodes a polyene of twelve carbons. The vep gene cluster contains 5 polyketide synthase modules, with a loading module at its 5′ end and an ending domain at its 3′ end. Each of the sequenced modules includes a keto-ACP (KS), an acyltransferase (AT), a dehydratase (DH), a keto-reductase (KR), and an acyl carrier protein domain. The six acyltransferase domains in the cluster are responsible for the incorporation of six acetyl-CoA moieties into the product. The loading module contains a KS[0208] Q, an AT and an ACP domain. KSQ refers to a domain that is homologous to a KS domain except that the active site cysteine (C) is replaced by glutamine (Q). There is no counterpart to the KSQ domain in the PKS clusters which have been previously characterized.
  • The ending domain (ED) is an enzyme which is responsible for the attachment of the nascent polyketide chain onto another molecule. The amino acid sequence of ED resembles an enzyme, HetM, which is involved in Anabaena heterocyst formation. The homology between vep and HetM suggests that the polypeptide encoded by the vep gene cluster may synthesize a polyene-containing composition which is present in the spore coat or cell wall of its natural host, [0209] S. venezuelae.
  • Example 4 Preparation of a Vector Encoding a Saturated β-hydroxyhexanoyl CoA Monomer or an Unsaturated β-hydroxyhexanoyl CoA Monomer
  • To provide a recombinant monomer synthase that generates a saturated β-hydroxyhexanoylCoA or unsaturated β-hydroxyhexanoylCoA monomer, the linear correspondence between the genetic organization of the Type I macrolide PKS and the catalytic domain organization in the multifunctional proteins is assessed (Donadio et al., supra, 1991; Katz et al., [0210] Ann. Rev. Microbiol., 47, 875 (1993)). First, a DNA encoding a TE is added to the 3′ end of an ORFI of a Type I PKS, preferably the met ORF I (FIG. 6) as recently described by Cortes et al. (Science, 268, 1487 (1995)) in the erythromycin system. To ensure that the DNA encoding the TE is completely active, DNA encoding a linker region separating a normal ACP-TE region in a PKS, for example, the one found in met PKS ORF5 (FIG. 5), will be incorporated into the DNA. The resulting vector can be introduced into a host cell and the TE activity, rate of release of the CoA product, and identity of the fatty acid chain determined.
  • The acyl chain that is most likely to be released is the CoA ester, specifically the 3-hydroxy-4-methyl heptenoylCoA ester, since the fully elongated chain is presumably released in this form prior to macrolide cyclization. If the CoA form of the acyl chain is not observed, then a gene encoding a CoA ligase will be cloned and co-expressed in the host cell to catalyze formation of the desired intermediate. [0211]
  • There is clear precedent for release of the predicted premature termination products from mutant strains of macrolide-producing Streptomyces that produce intermediates in macrolide synthesis (Huber et al., [0212] Antimicrob. Agents Chemother., 34, 1535 (1990); Kinoshita et al., J. Chem. Soc., Chem. Comm., 14, 943 (1988)). The structure of these intermediates is consistent with the linear organization of functional domains in macrolide PKSs, particularly those related to eryA, tyl, and met. Other known PKS gene clusters include, but are not limited to, the gene cluster encoding 6-methylsalicylic acid synthase (Beck et al., Eur. J. Biochem., 192, 487 (1990)), soraphen A (Schupp et al., J. Bacteriol., 177, 3673 (1995)), and sterigmatocystin (Yu et al., J. Bacteriol., 177, 4792 (1995)).
  • Once the release of the 3-hydroxy-4-methyl heptenoylCoA ester is established, DNA encoding the extender unit AT in [0213] met module 1 is replaced to change the specificity from methylmalonylCoA to malonylCoA (FIGS. 4-6). This change eliminates methyl group branching in the β-hydroxy acyl chain. While comparison of known AT amino acid sequences shows high overall amino acid sequence conservation, distinct regions are readily apparent where significant deletions or insertions have occurred. For example, comparison of malonyl and methylmalonyl amino acid sequences reveals a 37 amino acid deletion in the central region of the malonyltransferase. Thus, to change the specificity of the methylmalonyl transferase to malonyl transferase, the met ORFI DNA encoding the 37 amino acid sequence of MMT will be deleted, and the resulting gene will be tested in a host cell for production of the desmethyl species, 3-hydroxyheptenoylCoA. Alternatively, the DNA encoding the entire MMT can be replaced with a DNA encoding an intact MT to affect the desired chain construction.
  • After replacing MMT with MT, DNA encoding DH/ER will be introduced into DNA encoding met [0214] ORFI module 1. This modification results in a multifunctional protein that generates a methylene group at C-3 of the acyl chain (FIG. 6). The DNA encoding DH/ER will be PCR amplified from the available eryA or tyl PKS sequences, including the DNA encoding the required linker regions, employing a primer pair to conserved sequences 5′ and 3′ of the DNA encoding DH/ER. The PCR fragment will then be cloned into the met ORFI. The result is a DNA encoding a multifunctional protein (MT*DH/ER*TE*). This protein possesses the full complement of keto group processing steps and results in the production of heptenoylCoA.
  • The DNA encoding dehydrase in met [0215] module 2 is then inactivated, using site-directed mutagenesis in a scheme similar to that used to generate the rat FAS DH—described above (Joshi et al., J. Biol. Chem., 268, 22508 (1993)). This preserves the required (R)-3-hydroxy group which serves as the substrate for PHA synthases and results in (R)-3-hydroxyheptanoylCoA species.
  • The final domain replacement will involve the DNA encoding the starter unit acyltransferase in met module 1 (FIG. 5), to change the specificity from propionyl CoA to acetyl CoA. This shortens the (R)-3-hydroxy acyl chain from heptanoyl to hexanoyl. The DNA encoding the catalytic domain will need to be generated based on a FAS or 6-methylsalicylic acid synthase model (Beck et al., [0216] Eur. J. Biochem., 192, 487 (1990)) or by using site-directed mutagenesis to alter the specificity of the resident met PKS propionyltransferase sequence. Limiting the initiator species to acetylCoA can result in the use of this starter unit by the monomer synthase. Previous work with macrolide synthases have shown that some are able to accept a wide range of starter unit carboxylic acids. This is particularly well documented for avermectin synthase, where over 60 new compounds have been produced by altering the starter unit substrate in precursor feeding studies (Dutton et al., J. Antibiotics, 44, 357 (1991)).
  • Example 5 Preparation of a Vector Encoding a Recombinant Monomer Synthase that Synthesizes 3-Hydroxyl-4-Hexenoic Acid
  • To provide a recombinant monomer synthase that synthesizes 3-hydroxyl-4-hexenoic acid, a precursor for polyhydroxyhexenoate, the DNA segment encoding the loading and the first module of the vep gene cluster was linked to the DNA [0217] segment encoding module 7 of the tyl gene cluster so as to yield a recombinant DNA molecule encoding a fusion polypeptide which has no amino acid differences relative to the corresponding amino acid sequence of the parent modules. The fusion polypeptide catalyzes the synthesis of 3-hydroxyl-4-hexenoic acid. The recombinant DNA molecule was introduced into SCP2, a Streptomyces vector, under the control of the act promoter (pDHS502, FIG. 20). A polyhydroxyalkanoate polymerase gene, phaC1 from Pseudomonas oleavorans, was then introduced downstream of the recombinant PKS cluster (pDHS505; FIGS. 22 and 23). The DNA segment encoding the polyhydroxyalkanoate polymerase is linked to the DNA segment encoding the recombinant PKS synthase so as to yield a fusion polypeptide which synthesizes polyhydroxyhexenoate in Streptomyces. Polyhydroxyhexenoate, a biodegradable thermoplastic, is not naturally synthesized in Streptomyces, or as a major product in any other organism. Moreover, the unsaturated double bond in the side chain of polyhydroxyhexenoate may result in a polymer which has superior physical properties as a biodegradable thermoplastic over the known polyhydroxyalkanoates.
  • Example 6 Deletion of the desR Gene of the Desosamine Biosynthetic Gene Cluster
  • As some macrolides have more than one attached sugar moiety, the assignment of sugar biosynthetic genes to the appropriate sugar biosynthetic pathway can be quite difficult. Since methymycin (a compound of formula (1)) and neomethymycin (a compound of formula (2)) (FIG. 24) (Donin et al., 1953; Djerassi et al., 1956), two closely related macrolide antibiotics produced by [0218] Streptomyces venezuelae, contain desosamine as their sole sugar component, the organization of the sugar biosynthetic genes in the methymycin/neomethymycin gene cluster may be less complicated. Thus, this system was chosen for the study of the biosynthesis of desosamine, a N,N-dimethylamino-3,4,6-trideoxyhexose, which also exists in the erythromycin structure (Flinn et al., 1954).
  • To study the formation of this unusual sugar, a DNA library was constructed by partially digesting the genomic DNA of [0219] S. venezuelae (ATCC 15439) with Sau3A I into 35-40 kb fragments which were ligated into the cosmid vector pNJ1 (Tuan et al., 1990). The recombinant DNA was packaged into bacteriophage ? which was used to transfect E. coli DH5a. The resulting cosmid library was screened for desired clones using the tylA1 and tylA2 genes from the tylosin biosynthetic cluster as probes (Baltz et al., 1988; Merson-Davies et al., 1994). These two probes are specific for sugar biosynthetic genes whose products catalyze the first two steps universally followed by all unusual 6-deoxyhexoses studied thus far. The initial reaction involves conversion of glucose-1-phosphate to TDP-D-glucose by a-D-glucose-1-phosphate thymidylyltransferase (TylA1) and subsequently, TDP-D-glucose is transformed to TDP-4-keto-6-deoxy-D-glucose by TDP-D-glucose 4,6-dehydratase (TylA2). Three cosmids were found to contain genes homologous to tylA1 and tylA2. Further analysis of these cosmids led to the identification of nine open reading frames (ORFs) downstream of the PKS genes (FIG. 24). Based on sequence similarities to other sugar biosynthetic genes, especially those derived form the erythromycin cluster (Gaisser et al., 1997; Summers et al., 1997), eight of these nine ORFs are believed to be involved in the biosynthesis of TDP-D-desosamine. Interestingly, the ery cluster lacks homologs of the tylA1 and tylA2 genes that are responsible for the first two steps in desosamine pathway. It is possible that the erythromycin biosynthetic machinery may rely on a general cellular pool of TDP-4-keto-6-deoxy-D-glucose for mycarose and desosamine formation. Depicted in FIG. 24 is a biosynthetic pathway for TDP-D-desosamine.
  • Although eight of the nine ORFs have been assigned to desosamine formation, the presence of desr, which shows strong sequence homology to β-glucosidases (as high as 39% identity and 46% similarity) (Castle et al., 1998), within the desosamine gene cluster is puzzling. To investigate the function of DesR relative to the biosynthesis of methymycin/neomethymycin, a disruption plasmid (pBL1005) derived from pKC1139 (containing an apramycin resistance marker) (Bierman et al., 1992) was constructed in which a 1.0 kb NcoI/XhoI fragment of the desR gene was deleted and replaced by the thiostrepton resistance (tsr) gene (1.1 kb) (Bibb et al., 1985) via blunt-end ligation. This plasmid was used to transform [0220] E. coli S17-1, which serves as the donor strain to introduce the pBL1005 construct through conjugal transfer into the wild-type S. venezuelae (Bierman et al., 1992). The double crossover mutants in which chromosomal desR had been replaced with the disrupted gene were selected according to their thiostrepton-resistant and apramycin-sensitive characteristics. Southern blot hybridization analysis was used to confirm the gene replacement.
  • The desired mutant was first grown at 29° C. in seed medium for 48 hours, and then inoculated and grown in vegetative medium for another 48 hours (Cane et al., 1993). After the fermentation broth was centrifuged at 10,000 g to remove cellular debris and mycelia, the supernatant was adjusted to pH 9.5 with concentrated KOH, and extracted with an equivolume of chloroform (four times). The organic layer was dried over sodium sulfate and evaporated to dryness. The amber oil-like crude products were first subjected to flash chromatography on silica gel using a gradient of 0-40% methanol in chloroform, followed by HPLC purification on a C[0221] 18 column eluted isocratically with 45% acetonitrile in 57 mM ammonium acetate (pH 6.7). In addition to methymycin (a compound of formula (1)) and neomethymycin (a compound of formula (2)), two new products were isolated. The yield of a compound of formula (13) and a compound of formula (14) was each in the range of 5-10 mg/L of fermentation broth. However, a compound of formula (1) and a compound of formula (2) remained to be the major products. High-resolution FAB-MS revealed that both compounds have identical molecular compositions that differ from methymycin/neomethymycin by an extra hexose. The chemical nature of these two new compounds were elucidated to be C-2′β-glucosylated methymycin and neomethymycin (a compound of formula (13) and formula (14), respectively) by extensive spectral analysis.
  • The spectral data of (13): [0222] 1H NMR (acetone-d6) d 6.56 (1H, d, J=16.0, 9-H), 6.46 (1H, d, J=16.0, 8-H), 4.67 (1H, dd, J=10.8, 2.0, 11-H), 4.39 (1H, d, J=7.5, 1′-H), 4.32 (1H, d, J=8.0, 141 -H), 3.99 (1H, dd, J=11.5, 2.5, 6″-H), 3.72 (1H, dd, J=11.5, 5.5, 6″-H), 3.56 (1H, m, 5′-H), 3.52 (1H, d, J=10.0, 3-H), 3.37 (1H, t, J=8.5, 3″-H), 3.33 (1H, m, 5″-H), 3.28 (1H, t, J=8.5, 4″-H), 3.23 (1H, dd, J=10.5, 7.5, 2′-H), 3.15 (1H, dd, J=8.5, 8.0, 2″-H), 3.10 (1H, m, 2-H), 2.75 (1H, 3′-H, buried under H2O peak), 2.42 (1H, m, 6H), 2.28 (6H, s, NMe2), 1.95 (1H, m, 12-H), 1.9 (1H, m, 5-H), 1.82 (1H, m, 4′-H), 1.50 (1H, m, 12-H), 1.44 (3H, d, J=7.0, 2-Me), 1.4 (1H, m, 5-H), 1.34 (3H, s, 10-Me), 1.3 (1H, m, 4-H), 1.25 (1H, m, 4′-H), 1.20 (3H, d, J=6.0, 5′-Me), 1.15 (3H, d, J=7.0, 6-Me), 0.95 (3H, d, J=6.0, 4-Me), 0.86 (3H, t, J=7.5, 12-Me). High-resolution FAB-MS: calc for C31H54NO12 (M+H)+ 632.3646, found 632.3686.
  • Spectral data of (14): [0223] 1H NMR (acetone-d6) d 6.69 (1H, dd, J=16.0, 5.5 Hz, 9-H), 6.55 (1H, dd, J=16.0, 1.3, 8-H), 4.71 (1H, dd, J=9.0, 2.0, 11-H), 4.37 (1H, d, J=7.0′-H),4.31 (1H, d, J=8.0, 1″-H), 3.97 (1H, dd, J=11.5, 2.5, 6″-H), 3.81 (1H, dq, J=9.0, 6.0, 12-H), 3.72 (1H, dd, J=11.5, 5.0, 6″-H), 3.56 (1H, m, 5′-H), 3.50 (1H, bd, J=10.0, 3-H), 3.36 (1H, t, J=8.5, 3″-H), 3.32 (1H, m, 5″-H), 3.30 (1H, t, J=8.5, 4″-H), 3.23 (1H, dd, J=10.2, 7.0, 2′-H), 3.13, (1H, dd, J=8.5, 8.0, 2″-H), 3.09 (1H, m, 2-H), 3.08 (1H, m, 10-H), 2.77 (1H, ddd, J=12.5, 10.2, 4.5, 3′-H), 2.41 (1H, m, 6-H), 2.28 (6H, s, NMe2), 1.89 (1H, t, J=13.0, 5-H), 1.83 (1H ddd, J=12.5, 4.5, 1.5, 4′-H), 1.41 (3H, d, J=7.0, 2-Me), 1.3 (1H, m, 4-H), 1.25 (1H, m, 5-H), 1.2 (1H, m, 4′-H, 1.20 (3H, d, J=6.0, 5′-Me), 1.17 (6H, d, J=7.0, 6-Me, 10-Me), 1.12 (3H, d, J=6.0, 12-me), 0.96 (3H, d, J=6.0, 4-Me). 13C NMR (acetone-d6) d 204.1 (C-7), 175.8 (C-1), 148.2 (C-9), 126.7 (C-8), 108.3 (C-1″), 104.2 (C-1′), 85.1 (C-3), 83.0 (C-2′), 78.2 (C-3″), 78.1 (C-5″), 76.6 (C-2″), 76.4 (C-11), 71.8 (C-4″), 69.3 (C-5′), 66.1 (C-12), 66.0 (C-3′), 63.7 (C-6″), 46.2 (C-6), 44.4 (C-2), 40.8 (NMe2), 36.4 (C-10), 34.7 (C-5), 34.0 (C-4), 29.5 (C-4′), 21.5 (5′Me), 21.5 (12-Me), 17.9 (6-Me), 17.7 (4-Me), 17.2 (2-Me), 9.9 (10-Me). High-resolution FAB-MS: calc for C31H54NO12 (M+H)+ 632.3646, found 632.3648.
  • The coupling constant (d, J=8.0 Hz) of the anomeric hydrogen (1″-H) of the added glucose and the magnitude of the downfield shift (11.8 ppm) of C-2′ of desosamine are all consistent with the assigned C-2′ β-configuration (Seo et al., 1978). [0224]
  • The antibiotic activity of a compound of formula (13) and (14) against [0225] Streptococcus pyogenes was examined by separately applying 20 μL of each sample (1.6 mM in MeOH) to sterilized filter paper discs which were placed onto the surface of S. pyogenes grown on Mueller-Hinton agar plates (Mangahas, 1996). After being grown overnight at 37° C., the plates of the controls (a compound of formula (1) and (2)) showed clearly visible inhibition zones. In contrast, no such clearings were discernible around the discs of a compound of formula (13) and (14). Evidently, β-glucosylation at C-2′ of desosamine in methymycin/neomethymycin renders these antibiotics inactive.
  • It should be noted that similar phenomena involving inactivation of macrolide antibiotics by glycosylation are known (Celmer et al., 1985; Kuo et al., 1989; Sasaki et al., 1996). For example, it was found that when erythromycin was given to [0226] Streptomyces lividans, which contains a macrolide glycosyltransferase (MgtA), the bacterium was able to defend itself by glycosylating the drug (Cundliffe, 1992; Jenkins et al., 1991). Such a macrolide glycosyltransferase activity has been detected in 15 out of a total of 32 actinomycete strains producing various polyketide antibiotics (Sasaki et al., 1996). Interestingly, the co-existence of a macrolide glycosyltransferase (OleD) capable of deactivating oleandomycin by glucosylation (Hernandez et al., 1993), and an extracellular β-glucosidase capable of removing the added glucose from the deactivated oleandomycin in Streptomyces antibioticus (Vilches et al., 1992) has led to the speculation of glycosylation as a possible self-resistance mechanism in S. antibioticus. Although the genes of the aforementioned glycosyltransferases have been cloned in a few cases, such as mgtA of S. lividans and oleD of S. antibioticus, the whereabouts of macrolide β-glycosidase genes remain obscure. Interestingly, the recently released eryBI sequence, which is part of the erythromycin biosynthetic cluster, is highly homologous to desR (55% identity) (Gaisser et al., 1997).
  • The discovery of desR, a macrolide β-glucosidase gene, within the desosamine gene cluster is thus significant, and the accumulation of deactivated compounds of formula (13) and (14) after desR disruption provides direct molecular evidence indicating that a similar self-defense mechanism via glycosylation/deglycosylation may also be operative in [0227] S. venezuelae. However, because a significant amount of methymycin and neomethymycin also exist in the fermentation broth of the mutant strain, glucosylation of desosamine may not be the primary self-resistance mechanism in S. venezuelae. Indeed, an rRNA methyltransferase gene found upstream from the PKS genes in this cluster may confer the primary self-resistance protection. Thus, these results are consistent with the fact that antibiotic producing organisms generally have more than one defensive option (Cundliffe, 1989). In light of this observation, it is conceivable that methymycin/neomethymycin may be produced in part as the inert diglycosides (a compound of formula (13) or (14)), and the macrolide β-glucosidase encoded by desR is responsible for transforming methymycin/neomethymycin from their dormant state to their active form. Supporting this idea, the translated desR gene has a leader sequence characteristic of secretory proteins (von Heijne, 1986; von Heijne, 1989). Thus, DesR may be transported through the cell membrane and hydrolyze the modified antibiotics extracellularly to activate them (FIG. 25).
  • Summary [0228]
  • Inspired by the complex assembly and the enzymology of aminodeoxy sugars that are frequently found as essential components of macrolide antibiotics, the entire desosamine biosynthetic gene cluster from the methymycin and neomethymycin producing strain [0229] Streptomyces venezuelae was cloned, sequenced, and mapped. Eight of the nine mapped genes were assigned to the biosynthesis of TDP-D-desosamine based on sequence similarities to those derived from the erythromycin cluster. The remaining gene, designated desR, showed strong sequence homology to β-glucosidases.
  • To investigate the function of the encoded protein (DesR), a disruption mutant was constructed in which a NcoI/XhoI fragment of the desR gene was deleted and replaced by the thiostrepton resistance (tsr) gene. In addition to methymycin and neomethymycin, two new products were isolated from the fermentation of the mutant strain. These two new compounds, which are biologically inactive, were found to be C-2′ β-glucosylated methymycin and neomethymycin. Since the translated desR gene has a leader sequence characteristic of secretory proteins, the DesR protein may be an extracellular β-glucosidase capable of removing the added glucose from the modified antibiotics to activate them. Thus, the occurrence of desR within the desosamine gene cluster and the accumulation of deactivated glucosylated methymycin/neomethymycin upon disruption of desR provide strong molecular evidence suggesting that a self-resistance mechanism via glucosylation may be operative in [0230] S. venezuelae.
  • Thus, the desR gene can be used as a probe to identify homologs in other antibiotic biosynthetic pathways. Deletion of the corresponding macrolide glycosidase gene in other antibiotic biosynthetic pathways may lead to the accumulation of the glycosylated products which may be used as prodrugs with reduced cytotoxicity. Glycosylation also holds promise as a tool to regulate and/or minimize the potential toxicity associated with new macrolide antibiotics produced by genetically engineered microorganisms. Moreover, the availability of macrolide glycosidases, which can be used for the activation of newly formed antibiotics that have been deliberately deactivated by engineered glycosyltransferases, may be useful in the development of novel antibiotics using the combinatorial biosynthetic approach (Hopwood et al., 1990; Katz et al., 1993; Hutchinson et al., 1995; Carreras et al., 1997; Kramer et al., 1996; Khosla et al., 1996; Jacobsen et al., 1997; Marsden et al., 1998). [0231]
  • Example 7 Deletion of the desVI Gene of the Desosamine Biosynthetic Gene Cluster
  • The emergence of pathogenic bacteria resistant to many commonly used antibiotics poses a serious threat to human health and has been the impetus of the present resurgent search for new antimicrobial agents (Box et al., 1997; Davies, 1996; Service, 1995). Since the first report on using genetic engineering techniques to create “hybrid” polyketides (Hopwood et al., 1995), the potential of manipulating the genes governing the biosynthesis of secondary metabolites to create new bioactive compounds, especially macrolide antibiotics, has received much attention (Kramer et al., 1996; Khosla et al., 1996). This class of clinically important drugs consists of two essential structural components: a polyketide aglycone and the appended deoxy sugars (Omura, 1984). The aglycone is synthesized via sequential condensations of acyl thioesters catalyzed by a highly organized multi-enzyme complex, polyketide synthase (PKS) (Hopwood et al., 1990; Katz, 1993; Hutchinson et al., 1995; Carreras et al., 1997). Recent advances in the understanding of the polyketide biosynthesis have allowed recombination of the PKS genes to construct an impressive array of novel skeletons (Kramer et al., 1996; Khosla et al., 1996; Hopwood et al., 1990; Katz, 1993; Hutchinson et al., 1995; Carreras et al., 1997; Epp et al., 1989; Donadio et al., 1993; Arisawa et al., 1994; Jacobsen et al., 1997; Marsden et al., 1998). Without the sugar components, however, these new compounds are usually biologically impotent. Hence, if one plans to make new macrolide antibiotics by a combinatorial biosynthetic approach, two immediate challenges must be overcome: assembling a repertoire of novel sugar structures and then having the capacity to couple these sugars to the structurally diverse macrolide aglycones. [0232]
  • Unfortunately, knowledge of the formation of the unusual sugars in these antibiotics remains limited (Liu et al., 1994; Kirschning et al., 1997; Johnson et al., 1998). Part of the reason for this comes from the fact that the sugar genes are generally scattered at both ends of the PKS genes. Such an organization within the macrolide biosynthetic gene cluster makes it difficult to distinguish the sugar genes from those encoding regulatory proteins or aglycone modification enzymes that are also interspersed in the same regions. The task can be made even more formidable if the macrolides contain multiple sugar components. In view of the “scattered” nature of the sugar biosynthetic genes, the antibiotic methymycin (a compound of formula (1) in FIG. 24) and its co-metabolite, neomethymycin (a compound of formula (2) in FIG. 24)), of [0233] Streptomyces venezuelae present themselves as an attractive system to study the formation of deoxy sugars (Donin et al., 1953; Djerassi et al., 1956). First, they carry D-desosamine (a compound of formula (3)) a prototypical aminodeoxy sugar that also exists in erythromycin. Second, since desosamine is the only sugar attached to the macrolactone of formula (1) and (2), identification of the sugar biosynthetic genes within the methymycin/neomethymycin gene cluster should be possible with much more certainty.
  • A 10 kb stretch of DNA downstream from the methymycin/neomethymycin gene cluster, which is about 60 kb in length, was found to harbor the entire desosamine biosynthetic gene cluster (FIG. 26). Among the nine open reading frames (ORFs) mapped in this segment, eight are likely to be involved in desosamine formation, while the remaining one, desR, encodes a macrolide β-glycosidase that may be involved in a self-resistance mechanism. Their identities, shown in FIG. 26, are assigned based on sequence similarities to other sugar biosynthetic genes (Gaisser et al., 1997; Summers et al., 1997). The proposed pathway is well founded on literature precedent and mechanistic intuition for the construction of aminodeoxy sugars (Liu et al., 1994; Kirschning et al., 1997; Johnson et al., 1998). [0234]
  • To determine whether new methymycin/neomethymycin analogues carrying modified sugars could be generated by altering the desosamine biosynthetic genes, the desVI gene, which has been predicted to encode the N-methyltransferase, was chosen as a target (Gaisser et al., 1997; Summers et al., 1997). The deduced desVI product is most closely related to that of eryCVI from the erythromycin producing strain [0235] Saccharopolyspora erythraea (70% identity), and also strongly resembles the predicted products of rdmD from the rhodomycin cluster of Streptomyces purpurascens (Niemi et al., 1995), srmX from the spiromycin cluster of Streptomyces ambofaciens (Geistlich et al., 1992), and tylMl from the tylosin cluster of Streptomyces fradiae (Gandecha et al., 1997). All of these enzymes contain the consensus sequence LLDV(I)ACGTG (SEQ ID NO:25) (Gaisser et al., 1997; Summers et al., 1997), near their N-terminus, which is part of the S-adenosylmethionine binding site (Ingrosso et al., 1989; Haydock et al., 1991).
  • The deletion of desVI should have little polar effect (Lin et al., 1984) on the expression of other desosamine biosynthetic genes because the ORF (desr) lying immediately downstream from desVI is not directly involved in desosamine formation, and those lying further downstream are transcribed in the opposite direction. Second, since N,N-dimethylation is almost certainly the last step in the desosamine biosynthetic pathway (Liu et al., 1994; Kirschning et al., 1997; Johnson et al., 1998; Gaisser et al., 1997; Summers et al., 1997), perturbing this step may lead to the accumulation of a compound of formula (4), which stands the best chance among all other intermediates of being recognized by the glycosyltransferase (DesVII) for successful linkage to the macrolactone of formula (6) (FIG. 25). Deletion and/or disruption of a single biosynthetic gene often affects the pathway at more than one specific step. In fact, disruption of eryCVI, the desVI equivalent in the erythromycin cluster, which has been predicted to encode a similar N-methylase to make desosamine in erythromycin (Gaisser et al., 1997; Summers et al., 1997), led to the accumulation of an intermediate devoid of the entire desosamine moiety (Summers et al., 1997). [0236]
  • A plasmid pBL3001, in which desVI was replaced by the thiostrepton gene (tsr) (Bibb et al., 1985), was constructed and introduced into wild type [0237] S. venezuelae by conjugal transfer using E. coli S17-1 (Bierman et al., 1992). Two identical double crossover mutants, KdesVI-21 and KdesVI-22 with phenotypes of thiostrepton resistance (ThioR) and apamycin sensitivity (Apms) were obtained. Southern blot hybridization using tsr or a 1.1 kb HincII fragment from the desVII region further confirmed that the desVI gene was indeed replaced by tsr on the chromosome of these mutants. The KdesVI-21 mutant was first grown at 29° C. in seed medium (100 mL) for 48 hours, and then inoculated and grown in vegetative medium (3 L) for another 48 hours (Cane et al., 1993). The fermentation broth was centrifuged to remove the cellular debris and mycelia, and the supernatant was adjusted to pH 9.5 with concentrated KOH, followed by extraction with chloroform. No methymycin or neomethymycin was found; instead, the 10-deoxy-methynolide (6) (350 mg) (Lambalot et al., 1992) and two new macrolides containing an N-acetylated amino sugar, a compound of formula (7) (20 mg) and a compound of formula (8) (15 mg), were isolated. Their structures were determined by spectral analyses and high-resolution MS.
  • Spectral data of formula 7 are: [0238] 1H NMR (CDCl3) d 6.62 (1H, d, J=16.0, H-9), 6.22 (1H, d, J=16.0, H-8), 5.75 (1H, d, J=7.5, N—H), 4.75 (1H, dd, J=10.8, 2.2, H-11), 4.28 (1H, d, J=7.5, H-1′), 3.95 (1H, m, H-3′), 3.64 (1H, d, J=10.5, H-3), 3.56 (1H, m, H-5′), 3.16 (1H, dd, J=10.0, 7.5, H-2′), 2.84 (1H, dq, J=10.5, 7.0, H-2), 2.55 (1H, m, H-6), 2.02 (3H, s, NAc), 1.95 (1H, m, H-12), 1.90 (1H, m, H-4′), 1.66 (1H, m, H-5), 1.50 (1H, m, H-12), 1.41 (3H, d, J=7.0, 2-Me), 1.40 (1H, m, H-5), 1.34 (3H, s, 10-Me), 1.25 (1H, m, H-4), 1.22 (1H, m, H-4′), 1.21 (3H, d, J=6.0, H-6′), 1.17 (3H, d, J=7.0, 6-Me), 1.01 (3H, d, J=6.5, 4-Me), 0.89 (3H, t, J=(7.2, 12-Me); 13C NMR (CDCl3) d 204.3 (C-7), 175.1 (C-1), 171.8 (Me-C═O), 149.1 (C-9), 125.3 (C-8), 104.4 (C-1′), 85.4 (C-3), 76.3 (C-11), 75.4 (C-2′), 74.1 (C-10), 68.6 (C-5′), 51.9 (C-3′), 45.0 (C-6), 44.0 (C-2), 38.5 (C-4′), 33.8 (C-5), 33.3 (C-4), 23.1 (Me-C═O), 21.1 (C-12), 20.6 (C-6′), 19.2 (10-Me), 17.5 (6-Me), 17.2 (4-Me), 16.2 (2-Me), 10.6 (12-Me). High-resolution FABMS: calc for C25H43O8N (M+H)+ 484.2910, found 484.2903.
  • Spectral data of formula 8 are: [0239] 1H NMR (CDCl3) d 6.76 (1H, dd, J=16.0, 5.5, H-9), 6.44 (1H, dd, J=16.0, 1.5, H-8), 5.50 (1H, d, J=6.5, N—H), 4.80 (1H, dd, J=9.0, 2.0, H-11), 4.28 (1H, d, J=7.5, H-1′), 3.95 (1H, m, H-3′), 3.88 (1H, m, H-12), 3.62 (1H, d, J=11.0, H-3), 3.57 (1H, m, H-5′), 3.18 (1H, dd, J=10.0, 7.5, H-2′), 3.06 (1H, m, H-10), 2.86 (1H, dq, J=11.0, 7.0, H-2), 2.54 (1H, m, H-6), 2.04 (3H, s, NAc), 1.98 (1H, m, H-4′), 1.67 (1H, m, H-5), 1.40 (1H, m, H-5), 1.39 (3H, d, J=7.0, 2-Me), 1.25 (1H, m, H-4), 1.22 (1H, m, H-4′), 1.22 (3H, d, J=6.0, H-6′), 1.21 (3H, d, J=6.0, 6-Me), 1.19 (3H, d, J=7.0, 12-Me), 1.16 (3H, d, J=6.5, 10-Me), 1.01 (3H, d, J=6.5, 4-Me); 13C NMR (CDCl3) d 205.1 (C-7), 174.6 (C-1), 171.9 (Me-C═O), 147.2 (C-9), 126.2 (C-8), 104.4 (C-1′), 85.3 (C-3), 75.7 (C-11), 75.4 (C-2′), 68.7 (C-5′), 66.4 (C-12), 52.0 (C-3′), 45.1 (C-6), 43.8 (C-2), 38.6 (C-4′), 35.4 (C-10), 34.1 (C-5), 33.4 (C-4), 23.1 (Me-C═O), 21.0 (12-Me), 20.7 (C-6′), 17.7 (6-Me), 17.4 (4-Me), 16.1 (2-Me), 9.8 (10-Me). High-resolution FABMS: calc for C25H43O8N (M+H)+ 484.2910, found 484.2892.
  • The fact that compounds of formula (7) and (8) bearing modified desosamine are produced by the desVI-deletion mutant is a thrilling discovery. However, this result is also somewhat surprising since the sugar component in the products is expected to be the aminodeoxy hexose (4). As illustrated in FIG. 27, it is possible that a compound of formula (7) and (8) are derived from the predicted compound of formula (9) and (10), respectively, by a post-synthetic nonspecific acetylation of the attached aminodeoxy sugar. It is also conceivable that N-acetylation of (4) occurs first, followed by coupling of the resulting sugar (11) to the 10-deoxymethynolide (6). Nevertheless, the lack of N-methylation of the sugar component in these new products provides convincing evidence sustaining the assignment of desVI as the N-methyltransferase gene. Most significantly, the production of a compound of formula (7) and (8) by the desVI-deletion mutant attests to the fact that the glycosyltransferase (DesVII) in methymycin/neomethymycin pathway is capable of recognizing and processing sugar substrates other than TDP-desosamine (5). [0240]
  • Since both compounds of formula (7) and (8) are new compounds synthesized in vivo by the [0241] S. venezuelae mutant strain, the observed N-acetylation might be a necessary step for self-protection (Cundliffe, 1989). In view of these results, the potential toxicity associated with new macrolide antibiotics produced by genetically engineered microorganisms can be minimized and newly formed antibiotics that have been deactivated (either deliberately or not) during production can be activated. Such an approach can be part of an overall strategy for the development of novel antibiotics using the combinatorial biosynthetic approach. Indeed, purified compounds of formula (7) and (8) are inactive against Streptococcus pyogenes grown on Mueller-Hinton agar plates (Mangahas, 1996), while the controls (a compound of formula (1) and (2)) show clearly visible inhibition zones.
  • It should be pointed out that a few glycosyltransferases involved in the biosynthesis of antibiotics have been shown to have relaxed specificity towards modified macrolactones (Jacobsen et al., 1997; Marsden et al., 1998; Weber et al., 1991). However, a similar relaxed specificity toward sugar substrates has only been reported for the daunorubicin glycosyltransferase, which is able to recognize a modified daunosamine and catalyze its coupling to the aglycone, e-rhodomycinone (Madduri et al., 1998). Thus, the fact that the methymycin/neomethymycin glycosyltransferase can also tolerate structural variants of its sugar substrate indicates that at least some glycosyltransferases in antibiotic biosynthetic pathways may be useful to create biologically active hybrid natural products via genetic engineering. [0242]
  • Summary [0243]
  • The appended sugars in macrolide antibiotics are indispensable to the biological activities of these clinically important drugs. Therefore, the development of new antibiotics via a biological combinatorial approach requires detailed knowledge of the biosynthesis of these unusual sugars, as well as the ability to manipulate the biosynthetic genes to create novel sugars that can be incorporated into the final macrolide structures. A targeted deletion of the desVI gene of [0244] Streptomyces venezuelae, which has been predicted to encode an N-methyltransferase based on sequence comparison, was prepared to determine whether new methymycin/neomethymycin analogues bearing modified sugars can be generated by altering the desosamine biosynthetic genes. Growth of the S. venezuelae deletion mutant strain resulted in the accumulation of a methymycin/neomethymycin analogue carrying an N-acetylated aminodeoxy sugar. Isolation and characterization of these derivatives not only provide the first direct evidence confirming the identity of desVI as the N-methyltransferase gene, but also demonstrate the feasibility of preparing novel sugars by the gene deletion approach. Most significantly, the results also revealed that the glycosyltransferase of methymycin/neomethymycin exhibits a relaxed specificity towards its sugar substrates.
  • Example 8 Cloning and Sequencing of the Met/Pik Biosynthetic Gene Cluster
  • Materials and Methods [0245]
  • Bacterial Strains and Media. [0246] E. coli DH5a was used as a cloning host. E. coli LE392 was the host for a cosmid library derived from S. venezuelae genomic DNA. LB medium was used in E. coli propagation. Streptomyces venezuelae ATCC 15439 was obtained as a freeze-dried pellet from ATCC. Media for vegetative growth and antibiotic production were used as described (Lambalot et al., 1992). Briefly, SGGP liquid medium was for propagation of S. venezuelae mycelia. Sporulation agar (SPA) was used for production of S. venezuelae spores. Methymycin production was conducted in either SCM or vegetative medium and pikromycin production was performed in Suzuki glucose-peptone medium.
  • Vectors, DNA Manipulation and Cosmid Library Construction. pUC119 was the routine cloning vector, and pNJ1 was the cosmid vector used for genomic DNA library construction. Plasmid vectors for gene disruption were either pGM160 (Muth et al., 1989) or pKC1139 (Bierman et al., 1992). Plasmid, cosmid, and genomic DNA preparation, restriction digestion, fragment isolation, and cloning were performed using standard procedures (Sambrook et al., 1989; Hopwood et al., 1985). The cosmid library was made according to instructions from the Packagene ?-packaging system (Promega). [0247]
  • DNA Sequencing and Analysis. An Exonuclease III (ExoIII) nested deletion series combined with PCR-based double stranded DNA sequencing was employed to sequence the pik cluster. The ExoIII procedure followed the Erase-a-Base protocol (Stratagene) and DNA sequencing reactions were performed using the Dye Primer Cycle Sequencing Ready Reaction Kit (Applied Biosystems). The nucleotide sequences were read from an ABI PRISM 377 sequencer on both DNA strands. DNA and deduced protein sequence analyses were performed using GeneWorks and GCG sequence analysis package. All analyses were performed using the specific program default parameters. [0248]
  • Gene Disruption. A replicative plasmid-mediated homologous recombination approach was developed to conduct gene disruption in [0249] S. venezuelae. Plasmids for insertional inactivation were constructed by cloning a kanamycin resistance marker into target genes, and plasmid for gene deletion/replacement was constructed by replacing the target gene with a kanamycin or thiostrepton resistance gene in the plasmid. Disruption plasmids were introduced into S. venezuelae by either PEG-mediated protoplast transformation (Hopwood et al., 1985) or RK2-mediated conjugation (Bierman et al., 1992). Then, spores from individual transformants or transconjugants were cultured on non-selective plates to induce recombination. The cycle was repeated three times to enhance the opportunity for recombination. Double crossovers yielding targeted gene disruption mutants were selected and screened using the appropriate combination of antibiotics and finally confirmed by Southern hybridization.
  • Antibiotic Extraction and Analysis. Methymycin, pikromycin, and related compounds were extracted following published procedures (Cane et al., 1993). Thin layer chromatography (TLC) was routinely used to detect methymycin, neomethymycin, narbomycin and pikromycin. Further purification was conducted using flash column chromatography and HPLC, and the purified compounds were analyzed by [0250] 1H, 13C NMR spectroscopy and MS spectrometry.
  • Results [0251]
  • Cloning and Identification of the pik Cluster. Heterologous hybridization was used to identify genes for methymycin, neomethymycin, narbomycin and pikromycin biosynthesis in [0252] S. venezuelae. Initial Southern blot hybridization analysis using a type I PKS DNA probe revealed two multifunctional PKS clusters of uncharacterized function in the genome. Since these four antibiotics are all comprised of an identical desosamine residue, a tylAI a-D-glucose-1-phosphate thymidylyltransferase DNA probe (for mycaminose/mycorose/mycinose biosynthesis in the tylosin pathway) (Merson-Davies et al., 1994) was used to locate the corresponding biosynthetic gene cluster(s). This analysis established that only one of the PKS pathways contained a cluster of desosamine biosynthetic genes. Nine overlapping cosmid clones were isolated spanning over 80 kilobases (kb) on the bacterial chromosome that encompassed the entire gene cluster (pik) for methymycin, neomethymycin, narbomycin and pikromycin biosynthesis (FIG. 28). Through subsequent gene disruption, the other PKS cluster (vep, devoid of linked desosamine biosynthetic genes) was found to play no role in production of methymycin, neomethymycin, narbomycin or pikromycin.
  • Nucleotide Sequence of the pik Cluster. The nucleotide sequence of the pik cluster was completely determined and shown to contain 18 open reading frames (ORFs) that span approximately 60 kb. Central to the cluster are four large ORFs, pikAI, pikAII, pikAIII, and pikAIV, encoding a multifunctional PKS (FIG. 28). Analysis of the six modules comprising the pik PKS indicated that it would specify production of narbonolide, the 14-membered ring aglycone precursor of narbomycin and pikromycin (FIG. 28). [0253]
  • Initial analysis unveiled two significant architectural differences in the pikA-encoded PKS. First, compared with eryA (Donadio et al., 1998) and oleA (Swan et al., 1994), two PKS clusters that produce 14-membered ring macrolides erythromycin and oleadomycin similar to pikromycin, the presence of separate ORFs, pikAIII and pikAIV, encoding [0254] Pik module 5 and Pik module 6 (as individual modules) as opposed to one bimodular protein as in eryAIII and oleAIII is striking. Secondly, the presence of a type II thioesterase immediately downstream of the type I PKS cluster is also unprecedented (FIG. 28). These two characteristics suggest that pika may produce the 12-membered ring macrolactone 10-deoxymethynolide as well. Indeed, the domain organization of PikAI-AIII (module L-5) is consistent with the predicted biosynthesis of 10-deoxymethynolide except for the absence of a TE function at the C-terminus of Pik module 5 (PikAIII). The lack of a TE domain in PikAIII may be compensated by the type II TE (encoded by pikAV) immediately downstream of pikAIV. Consistent with the supposition that two distinct polyketide ring systems are assembled from the pik PKS, two macrolide-lincosamide-streptogramin B type resistant genes, pikR1 and pikR2, are found upstream of the pik PKS (FIG. 29), which presumably provide cellular self-protection for S. venezuelae.
  • The genetic locus for desosamine biosynthesis and glycosyl transfer are immediately downstream of pikA. Seven genes, desI, desII, desIII, desIV, desV, desVI, and desVIII, are responsible for the biosynthesis of the deoxysugar, and the eighth gene, desVII, encodes a glycosyltransferase that apparently catalyzes transfer of desosamine onto the alternate (12- and 14-membered ring) polyketide aglycones. The existence of only one set of desosamine genes indicates that DesVIII can accept both 10-deoxymethynolide and narbonolide as substrates (Jacobsen et al., 1997). The largest ORF in the des locus, desR, encodes a β-glycosidase that is involved in a drug inactivation-reactivation cycle for bacterial self-protection. [0255]
  • Just downstream of the des locus is a gene (pikC) encoding a cytochrome P450 hydroxylase similar to eryF (Andersen et al., 1992), and eryK (Stassi et al., 1993), PikC, and a gene (pikD) encoding a putative regulator protein, PikD (FIG. 28). Interestingly, PikC is the only P450 hydroxylase identified in the entire pik cluster, suggesting that the enzyme can accept both 12- and 14-membered ring macrolide substrates and, more remarkably, it is active on both C-10 and C-12 of the YC-17 (12-membered ring intermediate) to produce methymycin and neomethymycin (FIG. 30). PikD is a putative regulatory protein similar to ORFH in the rapamycin gene cluster (Schwecke et al., 1995). [0256]
  • The combined functionality coded by the eighteen genes in the pik cluster predicts biosynthesis of methymycin, neomethymycin, narbomycin and pikromycin (Table 2). Flanking the pik cluster locus are genes presumably involved in primary metabolism and genes that may be involved in both primary and secondary metabolism. An S-adenosyl-methionine synthase gene is located downstream of pikD that may help to provide the methyl group in desosamine synthesis. A threonine dehydratase gene was identified upstream of pikR1 that may provide precursors for polyketide biosynthesis. It is not apparent that any of these genes are dedicated to antibiotic biosynthesis and they are not directly linked to the pik cluster. [0257]
    TABLE 2
    Deduced function of ORFs in the pik cluster
    Polypeptide Amino
    (ORF) acids, no. Proposed function or sequence similarity detected
    PikAI 4,613   PKS
    Loading KSQ AT(P) ACP
    module
    Module
    1 KS AT(P) KR ACP
    Module
    2 KS AT(A) DH KR ACP
    PikAII 3,739   PKS
    Module
    3 KS AT(P) KR0 ACP
    Module 4 KS AT(P) DH ER KR ACP
    PikAIII 1,562   PKS
    Module
    5 KS AT(P) KR ACP
    PikAIV 1,346   PKS
    Module
    6 KS AT(P) ACP TE
    PikAV 281 Thioesterase II (TEII)
    DesI 415 4-Dehydrase
    DesII
    485 Reductase?
    DesIII 292 a-D-Glucose-1-phosphate
    thymidylyltransferase
    DesIV 337 TDP-glucose 4, 6-dehydratase
    DesV
    379 Transaminase
    DesVI 237 N,N-dimethyltransferase
    DesVII 426 Glycosyl transferase
    DesVIII 402 Tautomerase?
    DesR 809 β-Glucosidase (involved
    in resistance mechanism)
    PikC 418 P450 hydroxylase
    PikD 945? Putative regulator
    PikR1
    336 rRNA methyltransferase
    (mls resistance)
    PikR2 288? rRNA methyltransferase
    (mls resistance)
  • [0258]
    TABLE 3
    Summary of mutational analyses of the pik cluster
    Antibiotic production/
    Type of Target Intermediate accumulation
    Mutant mutation gene Met & neomethymycin Pikromycin
    AX903 Insertion pikAI No/No No/No
    LZ3001 Deletion/ desVI No/10-deoxymethynolide No/
    replacement narbonolide
    LZ4001 Deletion/ desV No/10-deoxymethynolide No/
    replacement norbonolide
    AX905 Deletion/ pikAV <5%/No <5%/No
    replacement
    AX906 Insertion pikC No/YC-17 No/
    narbomycin
  • Mutational Analysis of the pik Cluster. Extensive disruption of genes in the pik cluster were carried out to address the role of key enzymes in antibiotic production (Table 3). First, PikAI, the first putative enzyme involved in the biosynthesis of 10-deoxymethynolide and narbonolide was inactivated by insertional mutagenesis. The resulting mutant, AX903, produced neither methymycin or neomethymycin, nor narbomycin or pikromycin, indicating that pikA encodes a PKS required for both 12- and 14-membered ring macrolactone formation. [0259]
  • Second, deletion of both desVI and desV abolished methymycin, neomethymycin, narbomycin and pikromycin production, and the resulting mutants, LZ3001 and LZ4001, accumulate 10-deoxymethynolide and narbonolide in their culture broth, indicating that enzymes for desosamine synthesis and transfer are also shared by the 12- and 14-membered ring macrolides. [0260]
  • In order to understand the mechanism of polyketide chain termination at PikAIII (PIKAIII (module 5) is presumed to be the termination point in construction of 10-deoxymethynolide), the pik TEII gene, pikAV, was deleted. The deletion/replacement mutant, AX905, produces less than 5% of methymycin, neomethymycin, and less than 5% of pikromycin compared to wild type [0261] S. venezuelae. This abrogation in product formation occurs without significant accumulation of the expected aglycone intermediates, suggesting that pik TEII is involved in the termination of 12- as well as 14-membered ring macrolides at PikAIII and PikAIV, respectively. Although the polar effects may influence the observed phenotype in AX905, this has been ruled out after the consideration of mutant LZ3001, in which mutation in an enzyme downstream of pikA V accumulated 10-deoxymethynolide and narbonolide. The fact that mutant AX905 failed to accumulate these intermediates suggested that the polyketide chains were not efficiently released from this PKS protein in the absence of Pik TEII. Therefore, Pik TEII plays a crucial role in polyketide chain release and cyclization, and it presumably provides the mechanism for alternative termination in pik polyketide biosynthesis.
  • Finally, disruption of pikC confirmed that PikC is the sole enzyme catalyzing hydroxylation of both YC-17 (at C-10 and C-12) and narbomycin (at C-12). The relaxed substrate specificity of PikC and its regional specificity at C-10 and C-12 provide another layer of metabolite diversity in the pik-encoded biosynthetic system. [0262]
  • Discussion [0263]
  • The work described herein has established that methymycin, neomethymycin, narbomycin and pikromycin biosynthesis is encoded by the pik cluster in [0264] S. venezuelae. Three key enzymes as well as the unique architecture of the cluster enable this relatively compact system to produce multiple macrolide antibiotics. Foremost, the presence of pik module 5 and 6 as separate proteins, PikAIII and PikAIV, and the activity of pik TEII enable the bacterium to terminate the polyketide chain at two different points of assembly, thereby producing two macrolactones of different ring size. Second, DesVII, the glycosyltransferase in the pik cluster, can accept both 12- and 14-membered ring macrolactones as substrates. Finally, PikC, the P450 hydroxylase, has a remarkable substrate and regiochemical specificity that introduces another layer of diversity into the system.
  • It is interesting to consider that pikA evolved in a line analogous to eryA and oleA since each of these PKSs specify the synthesis of 14-membered ring macrolactones. Therefore, pik may have acquired the capacity to generate methymycin when a mutation in the primordial pikAIII-pikAIV linker region caused splitting of [0265] Pik module 5 and 6 into two separate gene products. This notion is raised by two features of the nucleotide sequence. First, the intergenic region between pikAIII and pikAIV, which is 105 bp, may be the remanent of an intramodular linker peptide of 35 amino acids. Moreover, the potential for independently regulated expression of pikAIV is implied by the presence of a 100 nucleotide region at the 5′ end of the gene that is relatively AT-rich (62% as comparing 74% G+C content in coding region). Thus, as the mutation in an original ORF encoding the bimodular multifunctional protein (PikAIII-PikAIV) occurred, so too may have evolved a mechanism for regulated synthesis of the new gene product (PikAIV).
  • The role of Pik TEII in alternative termination of polyketide chain elongation intermediates provides a unique aspect of diversity generation in natural product biosynthesis. Engineered polyketides of different chain length are typically generated by moving the TE catalytic domain to alternate positions in a modular PKS (Cortes et al., 1995). Repositioning of the TE domain necessarily abolishes production of the original full-length polyketide so only one macrolide is produced each time. In contrast to the fixed-position TE domain, the independent Pik TEII polypeptide presumably has the flexibility to catalyze termination at different stages of polyketide assembly, therefore enabling the system to produce multiple products of variant chain length. Combinatorial biology technologies can now exploit this system for generating molecular diversity through construction of novel PKS systems with TEIIs for simultaneous production of several new molecules as opposed to the TE domains alone that limit catalysis to a single termination step. [0266]
  • It is noteworthy that sequences similar to Pik TEII are found in almost all known polyketide and non-ribosomal polypeptide biosynthetic systems (Marahiel et al., 1997). Currently, the pik TEII is the first to be characterized in a modular PKS. However, recent work on a TEII gene in the lipopeptide surfactin biosynthetic cluster (Schneider et al., 1998) demonstrated that srf-TEII plays an important role in polypeptide chain release, and may suggest that srf-TEII reacts at multiple stages in peptide assembly as well (Marahiel et al., 1997). [0267]
  • The enzymes involved in post-polyketide assembly of 10-deoxymethynolide and narbonolide are particularly intriguing, especially the glycosyltransferase, DesVII, and P450 hydroxylase, PikC. Both have the remarkable ability to accept substrates with significant structural variability. Moreover, disruption of desVI demonstrated that DesVII also tolerates variations in deoxysugar structure (Example 6). Likewise, PikC has recently been shown to convert YC-17 to methymycin/neomethymycin and narbomycin to pikromycin in vitro. [0268]
  • Targeted gene disruption of ORF1 abolished both pikromycin and methymycin production, indicating that the single cluster is responsible for biosynthesis of both antibiotics. Deletion of the TE2 gene substantially reduced methymycin and pikromycin production, which demonstrates that TE2, in contrast to the position-fixed TE1 domain, has the capacity to release polyketide chain at different points during the assembly process, thereby producing polyketides of different chain length. [0269]
  • The results described above were unexpected in that it was surprising that one PKS cluster produces two macrolides which differ in the number of atoms in their ring structure, that [0270] module 5 and module 6 of the PKS are in ORFs that are separated by a spacer region, that PikAIII lacked TE, that there was a Type II thioesterase, that TEI domain was not separate, and that 2 resistance genes were identified which may be specific for either a 12- or 14-membered ring.
  • With eighteen genes spanning less than 60 kb of DNA capable of producing four active macrolide antibiotics, the pik cluster represents the least complex yet most versatile modular PKS system so far investigated. This simplicity provides the basis for a compelling expression system in which novel active ketoside products are engineered and produced with considerable facility for discovery of a diverse range of new biologically active compounds. [0271]
  • Summary [0272]
  • Complex polyketide synthesis follows a processive reaction mechanism, and each module within a PKS harbors a string of three to six enzymatic domains that catalyze reactions in nearly linear order as described in particular detail for the erythromycin-producing PKS (Katz, 1997; Khosla, 1997; Staunton et al. 1997). The combined set of PKS modules and catalytic domains along with genes that encode enzymes for post-polyketide tailoring (e.g., glycosyl transferases, hydroxylases) typically limits a biosynthetic system to the generation of a single polyketide product. [0273]
  • Combinatorial biology involves the genetic manipulation of multistep biosynthetic pathways to create molecular diversity in natural products for use in novel drug discovery. PKSs represent one of the most amenable systems for combinatorial technologies because of their inherent genetic organization and ability to produce polyketide metabolites, a large group of natural products generated by bacteria (primarily actinomycetes and myxobacteria) and fungi with diverse structures and biological activities. Complex polyketides are produced by multifunctional PKSs involving a mechanism similar to long-chain fatty acid synthesis in animals (Hopwood et al., 1990). Pioneering studies (Cortes et al., 1990; Donadio et al., 1991) on the erythromycin PKS in [0274] Saccharopolyspora erythraea revealed a modular organization. Characterization of this multidomain protein system, followed by molecular analysis of rapamycin (Aparicio et al., 1996), FK506 (Motamedi et al., 1997), soraphen A (Schupp et al., 1995), niddamycin (Kakavas et al., 1997), and rifamycin (August et al., 1998) PKSs, demonstrated a co-linear relationship between modular structure of a multifunctional bacterial PKS and the structure of its polyketide product.
  • In a survey of microbial systems capable of generating unusual metabolite structural variability, [0275] Streptomyces venezuelae ATCC 15439 is notable in its ability to produce two distinct groups of macrolide antibiotics. Methymycin and neomethymycin are derived from the 12-membered ring macrolactone 10-deoxymethynolide, while narbomycin and pikromycin are derived from the 14-membered ring macrolactone, narbonolide. The cloning and characterization of the biosynthetic gene cluster for these antibiotics reveals the key role of a type II thioesterase in forming a metabolic branch through which polyketides of different chain length are generated by the pikromycin multifunctional polyketide synthase (PKS). Immediately downstream of the PKS genes (pikA) are a set of genes for desosamine (des) biosynthesis and macrolide ring hydroxylation. The glycosyl transferase (encoded by desVIII) has the remarkable ability to catalyze glycosylation of both the 12- and 14-membered ring macrolactones. Moreover, the pikC-encoded P450 hydroxylase provides yet another layer of structural variability by introducing regiochemical diversity into the macrolide ring systems.
  • Example 9 Strategies Employing Modular PKS as PHA Monomer Providers
  • One strategy to exploit modular PKSs, e.g., modules of pikA or a FAS, to provide PHA monomers is to harvest polyketide intermediates as CoA derivatives using a TEII which is converted to an acyl-CoA transferase (mTEII). PikTEII is a small enzyme (281 amino acids) encoded by pikAV in [0276] S. venezuelae. The primary function of the wild-type enzyme is to catalyze the release of a polyketide chain at the fifth module in the pikA pathway as 10-deoxymethonolide. The enzyme most likely binds to the fifth module (PikAIII) ACP (ACP5) and releases the acyl chain attached to it. This relationship, TEII and its cognate ACP5, can be exploited to produce a polyketide having different chain lengths by moving Pik ACP5 to a different position in the cluster. For example, by moving ACP5 into the second module in place of ACP2, a triketide instead of hexoketide may be produced by the cluster. Further, moving KR5 together with ACP5 into the second module, and replacing the DH, KR, and ACP domains, a 3-hydroxyl triketide is produced that is structurally suitable as PHA monomer. A mutant TEII (mTEII) catalyzes the release of the triketide as CoA form. The triketide-CoA, 3,5-dihydroxyl-4-methyl-heptonyl-CoA, is a substrate for PHA polymerase, e.g., PhaC1 from P. olivarus, which, in turn, can incorporate the monomer into a polymer.
  • A second strategy includes the harvesting of a polyketide intermediate as a CoA derivative using a TEI which has been converted to an acyl-CoA transferase (mTE). Thus, the second strategy for 3-hydroxyacyl-CoA monomer production is to exploit the TE domain (TEI) within the PKS module. It has been demonstrated that the TE domain can release polyketide intermediates attached to the ACP domain within the same module. Moving the TEI to a different position in a PKS cluster results in the production of a polyketide having a different chain length. Similarly, a mutant TEI (mTEI) (i.e., one which is an acyl-CoA transferase) releases the polyketide intermediate to acyl-CoA, which then is polymerized by PHA synthetase. Preferably, a mutant TE domain in the pikA gene cluster is moved into [0277] pik module 1, fusing it immediately downstream of ACP1. The recombinant enzyme produces 2-(S)-methyl-3(R)-hydroxylveleratyl-CoA, which is a suitable substrate for PHA polymerase PhaC1. Therefore, the coexpression of the polymerase with the recombinant PKS produces a polymer.
  • A third strategy is to directly collect polyketide intermediates as substrates for PHA synthesis by fusing a PHA polymerase with a polyketide synthase. The first two strategies produce 3-hydroxylacyl-CoA as a substrate for PHA synthesis by employing a mutant PKS enzyme (TEI or TEII). As PHA polymerase may be active on acyl-ACP itself if the acyl-ACP is properly oriented, the third strategy fuses a PHA polymerase downstream of an ACP in a PKS protein. The PHA synthetase then serves as a domain within the chimeric multifunctional enzyme in place of a TE domain. The PKS portion of the protein catalyzes the synthesis of a 3-hydroxylacyl-ACP intermediate and then the PHA synthetase domain accepts it as substrate and adds the 3-hydroxylacyl monomer to the growing polyhydroxyalkanoate chain. The process regenerates ACP function so that the reaction can go on repeatedly to synthesize a PHA of multiple units. For example, a phaC1 gene is fused directly downstream of pik ACP1 so as to produce a chimeric enzyme that catalyzes the synthesis of a polymer. [0278]
  • The strategies described above can produce PHAs of complex structure, and having superior properties. In addition, the structure can be easily fine-tuned by modifying the PKS gene, thus resulting in PHAs having desired properties or functions. [0279]
  • One aspect of the invention provides useful reagents and methods for the production of polyketides. In one aspect, the invention provides recombinant vectors encoding the complete PKS gene cluster and associated modification enzymes for the polyketide narbomycin. In another embodiment, the KS domain of the PKS is inactivated, preferably by site-specific mutagenesis of the corresponding coding sequence, and non-natural activated diketides are fed to a strain harboring the mutant PKS (in the chromosome or in an extrachromasomally replicating vector) to produced a desired compound. This technique is more fully described in PCT/US98/14911 and U.S. Pat. No. 6,066,721, issued on May 23, 2000, both of which are incorporated herein by reference. [0280]
  • In another aspect, the invention provides nucleic acids that encode the various domains, including the KS, AT, ACP, KR, DH, ER, and TE domains of the loading and all six extender modules of the narbomycin gene cluster. In another aspect, the invention provides nucleic acids that encode the modification enzymes that encode the activities that modify the narbomycin polyketide. In particular, the present invention provides in recombinant form the desosamine biosynthetic and transferase enzymes. In another aspect, the invention provides mutated versions of the foregoing that differ from their unmutated counterparts in activity or specificity. In another aspect, the invention provides chimeric PKS modules, ORFs, and gene clusters comprising one or more domains of the narbonolide PKS (or a mutant form thereof) and one or more domains of a non-narbonolide PKS. Further, the invention provides host cells comprising such vectors, methods of culturing host cells to produce the recombinant PKS of the invention as well as the polyketides produced by those PKS, and a variety of novel polyketides. [0281]
  • Example 10 Narbonolide PKS Sequence
  • To facilitate the construction of the narbonolide nucleic acids, cosmids pKOSO37-23, pKOSO37-25, and pKOSO37-26 are subjected to DNA sequence analysis. The SuperCos.™. vectors (Stratagene) from which these cosmids were derived comprise sequencing sites called T3 and T7 that facilitate sequencing. [0282]
  • Each sequence is preceded by a contig number. Contig 143 is composed of two sequences, designated 143a and 143b, below. [0283]
    Contig 143a (SEQ ID NO:1)
    ACAGGGGATATCCCGCTCCAGGCGAACGGTAGCCGCGTGCCCTCGCCGA
    ACGCCCCGCCCGCACCGGCCGCCTGCACGGCGGCGTCGAGCAGCGCCGG
    GTGGAGGCCGAACCGCGCGCCCTCGGCGCCCGCGACCTCCGTCGGCAGG
    GCCACGTCGGCGAACACCTCTTCGCCGCGCCGCCAGACGCCACGGACGC
    CCCGGAAGAGGGGCCCGTAGCCGTATCCGCTCGCCGCGAAGCGGTCGTA
    CAGACCGTCCACGTCCACTGCTTCGGCACCCGCCGGGGGCCAGGCCTCC
    GGGTCGGCGACAGGGGGCGGTGCGATCCGTACGGGCGAGCACACCGGTC
    GCGTGCCGCGTCCACTCCGGCTCGCCCGGCGCGTCCTCCGGGTGCGCGT
    GGAGCACGAAGGTACGGCGCCCGGACTCGTCGCTCGCGCCGACGGACA
    GCTGCACGCGGACCGCGCCGCGACGGGGCAGGACGAGCGGGGCGTCGA
    GGGTGAGCTCCTCGACCAGATCGCAGCCGACCTGGTCACCGGCCCGGAA
    GGCCAGCTCCACGAACGCCGTTCCCGGCAGCAGCACCGTGCCGGCCACC
    GCGTGGTCCGCCAGCCAGGGGTGCGTACGGAGGGAGAGGCTCCCCGTG
    AGCAGGCAGCCGTCGGAGTCGGCGAGCGCGACGGCCGCGCCGAGCAGC
    GGGTGCTCGGCCGCCCCGAGACCGGCGGACGTGATGTCACCGACGGCGG
    AGTGCTCGGGCCGCGGCCAGTAGCGCTCGGTCTGGAAGGCGTAGGTGGG
    GAGGTCGGGGAGGTCGGCGTTCGTCGCGTTCTTCGTGGTCGTGGTGGGG
    AGGACGGGTGTCCAGTCGAGGGGGAGGCCGTTGGTCCAGGCCTCGGCG
    AGCGAGGTGACCAGACGCTCCTGGCCGCCGTCCTCGCGGCGGAGGGTGC
    CGAGGCCGGTGACGGTGTCGGGGAGGGCCATGGTGAGGACGGGGTGGG
    CGCTGACCTCGACGAAGTGGGTGAACCCTTCGTCGGTGGCGAGGGTTTC
    GACGGCGGGGGCGAAGCCGACGGGGTGGCGGAGGTTGCGGTACCAGTA
    CGTGGCGTCGAGGGCGGGTTCGGTGATCCAGGCACCGTCGAGCGTGGAG
    AAGAAGGGGACGCGCGGAGCGTGCGGGGTGAGTCCGGCGAGGACGTCG
    GCGAGCTCGTTCTCGATGGTCTCGACGTGGGCGCTGTGGGAGGCGTAGT
    CGACGGGGATGATCCGCGCGCGGATGCCGTCGGCCTTGCAGGTCTTCGC
    GAGCTCTTCGATCTGTGCGGGGTCGCCGGAGACCACGGTGGCGGTGGGG
    CCGTGACGGCGGCGATCGACAGTCCGTCGAGGGTGTCGATCCGCTCCA
    GGACGTCGGCCTGGCTGAGGGCGAGGGAGACCATGCCGCCCCTGCCGGC
    GAGGTGAGCGGCGATGGACCGGCTGCGTAGGGCGACGACGCGGGCGGGC
    ATCCTCCAGGCTCAGTGCCCCGGCGACGTACGCGGCGGCGATCTCGCCC
    TGGAGTGGCCGATGACGGCCTGGGGGGTGATGCCGTGGTGCTGCCAGA
    TC TTCGCGAGGGAGACCATGACGGCGAAGGTG
    Contig 143b (SEQ NO:2)
    CGGGCTGGACGACGTCGACGCGGTCGAGCGTCGGGGCGCCGGGAGCCT
    GTCGTACGACGGCTTCGAGGGACCAGTCGACGTGACGGGAGAGCGCGG
    TCTCGCACGCGGCCATCTCCGCCGCGAACTCCGCAGAGGAGTCCAGCAG
    TTCGGCACCCATCCCGGACCACTGCGTGCCCTGGCCGGGGAACACGAAC
    GCCACGCGCCCGACAGCGGAAGCCGTGCCACGAATCAGCCCGTCCGGGT
    CGGCCAGGGCCTGTACGAGGTCGCCCGCCCCGGTGCCCAGCGCGACGGC
    CCGGTGCTCGAACTGCGCCCGCCCGTCGGCCAGTACGCGGGCGACGGCG
    CCGGCGTCGACGTCATCCGTACGCCCCTGAGAGGCGTACGCGGCGAGCC
    GCTCGATCTGGGCGTCGAGTGCACCGGCGGACTTCGCCGACACCACCCA
    CGGCACCACGCCACCCGACGACGGCTCGTCCACGGCGGTGTTTTCCACC
    GTCGGGGCCTCTTCGAGGACGACGTGAGCGTTCGTCCCGCTGATGCCGA
    AGGAGGAGCGGCGGCGCGGCGCA           CTGCTTCTCCGGCCA
    GTCCACGGCCTCGGTGAGGAGTTCCACGGCACCGGCCGACCAGTCGATC
    TGGTCCGAGGGGGCGTCCACGTGAAGCGTCTTCGGGAGTAGCCCGTGGC
    GCATCGCCTGGACCATCTTGATGACACCGGCGACACCGGCCGCGGCCTG
    GGTGTGCCCGATGTTGGACTTCAACGATCCGAGCAGCAACGGACGTTCG
    CCGCCCCGGTCCTGCCCGTAGGTGGCGATCAGGGCCTGCGCCTCGATCG
    GGTCGCCGAGCCGCGTCCCCGTGCCGTGCGCCTCGACGACATCGACCTC
    GCCCGGCGTGAGCCGGGCGTCG             GGATGACGCGCTGC
    TGCGACGGCCCGTTCGGAGCCGTGAGACCGTTGCTGGCGCCGTCCTGGT
    TCACGGCGCTGCCGCGGACGACCGCGAGGACCCGGTGTCCGTGGCGGCG
    GGCGTCCGACAGGCGCTCGACGAGGAGGACACCGACACCCTCGGACCA
    ACTGGTGCCGTCCGCCGACGCGGCGAACGCCTTCGACCGACCGTCCCCG
    GCCAGCCCGCGCTGCCGGCTGAACTCCACGAACATCCCCGGCGTGGGCA
    TCACGGCCACGCCGCCGGCGAGCGCCATGTCGACCTCGCCCTTGCGCAG
    GGCCTGCACGGCGAGGTGCAGGGCGACCAGCGACGACGAGCAGGCGGT
    GTCCACCGTCAGGGCGGGGCCCTCAAGGCCGAGCGTGTACGAGACGCG
    GCCCGACATCACGCTGGCCGTGTTGCCGGTCAGCAGGTATCCGTCGAGG
    CCCTCCCCGCCGTCGCGCAGGCTCGGCCCGTACTCGTGGGTCATCGCCCC
    GG
    Contig 132 (SEQ ID NO:3)
    GAACCCGTCGGCGTCCGCCGAGAAGGCCTTGCTCCGGCCGTCCGGGGCG
    AGCGCCCGCTGCCGGCTGAACTCCACGAACATGTGCGGGGTCGCCATCA
    TCGCCACACCACCGGCGAGTGCCATCGAGCATTCACCGCTCCGCAGCGC
    CCGCACCGCCAGGTGCAGGGCGGTCAGCGAGGACGAGCAGGCGGTGTC
    GACGGTCGTCGCGGGCCCTTCGAGACCGAAGGTGTACGCGATGCGGCCG
    GACGCGACGCTCGGCGTGCTGCCGGTCAGCAGGTAACCCTCCACGCCGC
    GCGGGGCGTTCGGGACGCGGGCCGCGTAGTCCTGGTAGGAGAGGCCGA
    TGAAGACACCGGTGCTGCTGCCGCGCAGCGAGCCCGGCTCGATGCCGGC
    CCGCTCGAACGCCTCCCAGGACGTCGCCAGGAGCATCCGCTGCTGCGGG
    TCCATGGCGAGCGCCTCGCGCGGCGAGACACCGAAGAACTCCGCGTCGA
    ACTCGGCCGCGTCGTGCAGGAACCCGCCCTCGCGGACGTACGCCTTGCC
    GAGCGCGTCCGGGTCGGCGTCGTACAGGCCGTCGAGGTCCCAGCCCCGG
    TCGGTGGGGAAGGGCGTGATGCCCTCGCCGCCCTCGGCCAGCATCCGCC
    ACAGGTCCTCAGGGCTGCGGATGCCACCGGGGTATCGGCAGCTCATGGC
    GACGATCGCGATCGGATCGTCGTCGACACCGAGACCGACACCGAGACCG
    AGACCGACACCGAGACCGACACCGGATCCGCCACCGACACCGGATCCG
    CCACCGAGACCAGCACCAGCTCCGCCACCGAGACCAGCACCAGCTCCGG
    CACCGAGACCAGCGCCGACAGCCCGCGTCCCCCTGGCCCACGTGGACTC
    CGCCGCCGCGTCCTCGTCACCGAGGAACTCGGCACGGAGCAGTGACGCG
    AGGGCCAGCGGCGTCGGGTGGTCGAAGACGAGCGTCGCGGGCAAGGGG
    AGCCCGGTCGCCCGGGTCAGCCGGTTGCGGAGCTCGACTCCGGCGAGCG
    AGTCGAAGCCGATGTCCTTGAAGGCCCGGTCGGCGGCGACGTCCTCAGG
    TGAACGCATCCGGAGCACGGCGGCGGCCTGGGCCCGTACGAGACCGAG
    GAGGATCTCCGTACGCTCGCCGGGAGCCGCGGCGGCCAGCCGCTCGGCC
    AGCGGGTTCCCGCCCGCGGCGGAGCTGCCGCCCGGCCCGGCCGGGGCGC
    TCTCCCGCGCGTCGATGATGCGCCGCACCTCGGGCAGCTCCTCGACGAG
    GGGCTGAGGGCGGCCGGAGGAGTACGCGAGGTAGAAACGGTCCCAGTC
    GATGTCCGCGACGGTGATCGCGGTCTCGTCCCGGCCGAGGGCGGACTCC
    AGTGCGGTCAGGGCGAGTTCCGGGTCCATGCCGGGTACGCCGTGATCGC
    GCAGGCGCTCGGCCACCCC
    Contig 116 (SEQ ID NO:4)
    AGCGGGCCAGGCCGGAGCCGGGGACCGGGACCGGGACGTGTCCACGCC
    GTCCAGGAGCACCGCCCACACGGATGCCCTGCTGGCACAACTCACCAGG
    CTGGAAGGCGCCTTGGTGCTGACGGGCCTCCCGGGCGCCCCCGGGAGCG
    AAGAAGTCCTGGAGCACCTGCGCTCCCTTCGCGCGATGGTCACGGGCGA
    GACCGGGAGCGGGACCGGGGCCGGAAGCGGGGGCGGGGGCGCGTCCGC
    GGAATCCGGGGGCGGAGACCCCTACTACGCCGACGGGGGCGGGAGTGA
    GGACCGCGCGGGAGTGCCGGACTTCATGAACGCCTCGGCCGAGGAACTC
    TTCGGCCTCCTCGACATGGACCCCAGCACGGACTGATCCCTGCCGCACG
    GCCGCCTCCCGCCCCGGGCCCCGTCCGAGACCCCGTCCCGGACCCGTCC
    CGGGCACCTCGACTCGAATCACTTCATGCGCGCCTCGGGCGCCTCCAGG
    AACTCAAGGGGACAGCGTGTCCACGGTGAACGAAGAGAAGTACCTCGA
    CTACCTGCGTCGCGCCACGGCGGACCTCCACGAGGCCCGCGGCCGCCTC
    CGCGAGCTGGAGGCCAGGGCGGGCGAGCCGGTGGCGATCGTCGGCATG
    GCCTGCCGCCTGCCGGGCGGTGTCGCCTCGCCGGAGGACCTGTGGCGGC
    TTGTGGCCGGTGGCGAGGACGCGATCTCGGAGTTCCCGCAGGACCGCGG
    CTGGGACGTGGAGGGGCTGTACGACCCGAACCCGGAGGCCACGGGCAG
    GAGTTACGCCCGTGAGGCCGGATTCCTGTACGAGGCGGGCGAGTTCGAC
    GCCGACTTCTTCGGGATCTCGCCGCGCGAGGCCCTCGCCATGGACCCGC
    AGCAGCGGCTCCTCCTGGAGGCCTCCTGGGAGGCGTTCGAGCACGCCGG
    CATCCCGGCGGCCAGTGCGCGCGGCACGTCGGTCGGCGTCTTCACCGGC
    GTGATGTACCACGACTACGCGACCCGTCTCACCGACGTCCCCGAGGGCA
    TCGAGGGCTACCTGGGCACCGGGAACTCCGGCAGCGTCGCCTCGGGCCG
    GGTCGCCTACACGCTGGGCCTGGAGGGCCCGGCCGTCACGGTCGACACG
    GCCTGCTCGTCCTCGCTCGTCGCCCTGCACCTCGCCGTGCAGGCCCTGCG
    CAAGGGCGAGGTCGACATGGCGCTCGCCGGCGGCGTGACGGTCATGTCG
    ACTCCCAGCACCTTCGTCGAGTTCAGCCGCCAGCGCGGACTGGCCCCCG
    ACGGCCGGTCGAAGTCCTTCTCGTCGACGGCGGACGGCACCAGCTGGTC
    CGAGGGCGTCGGCGTCCTCCTCGTCGAGCGCCTGTCGGACGCCCGTCGC
    AAGGGCCACCGGGTGCTCGCCGTGGTCCGGGGCACGGCCGTCAACCAGG
    ACGGCGCGAGCAGC GGCCTCACCGCCCCGAACGGCCCGTCTCAGCA
    Contig 109 (SEQ ID NO:5)
    GGTGCTCCAGGGCGGCGACCCTGCCCATGCCCCACACCATGGCCTGGGC
    GGGGGAGGAGATGTGGTCGGCGCGGCCGACGGACACCGCGCCACGGGT
    GACGCACCACAGCGGAGCGGCGACACCGGCGTCCTCCAGCGCCTGCACC
    AGGGTGAGGGTGGCGCCGGTGCCCCGGGTGAAGGGGGCGGGGTGGCCG
    GGGTGCGCGTCCTCGTCCCAGGCGAGCAGCGAGACGACACCGCCGACG
    GCTCCACCGGCCGCCGCCAGGGCTTCGCCCAGCGCCTCCGTGAGCCGCT
    GCCGGTCGCTCGGTGCGGACACGTCCAGCCGTACGGGGTCGGCGCCCGC
    ACCGGACAGCGCGGCGAGCACCGGGGCGGCCTCGGAGGACCGGCCCTC
    GGGGGCGACGACGAGCCAGCGACCGGACAGGCCGGGGCTCTCGGTGCC
    CTCGGCGACCGCGAGCCGCTTCCAGTCGACGCGGTAGCGCCAGGAGTCC
    TGCACGGAGCCCTGGGCGGCGGGGGAGTCGTGGAGCCAGTAGTGACGG
    CGCTGGAAGGCGTAGGTGGGGAGGTCGGGGAGGTCGCCGGTCGCGGCC
    GGGAGGACGGGCGCCCAGTCGACGGTGAGGCCGTGGGCCCAGGCTTCG
    GCGAGGGAGGTGATCAGGCGGTCGAGGCCGCCTTGTTCGCGGCGGAGG
    GTGCTGAGGCCTGTGACGGTGTCGGGGAGGGCCATGGTGAGGACGGGG
    TGGGCGGAGACCTCGATGAAGTGGGTGAAGCCTTCGGTTGTGGCGAGGG
    TTTCGATGGCGGGGGCGAAGCCGACGGGGTGGCGGAGGTTGCGGTACC
    AGTAGGTGGCGTCGAGGGCGGGTTCGGTGATCCAGGTGCCTTCGAGGGT
    GGAGAAGAAGGGGACGCGCGGAGCGTGCGGGGTGAGTCCGGTGAGGAC
    GTCGGCGAGCTCGTTCTCGATGGTCTCGACGTGGGCGCTGTGGGAGGCG
    TAGTCGACGGGGATGACCCGCGCGCGGACCCCGTCCGCCTTGCACGTAC
    GGGCGAGCTCCTCGATCTGTGCGGGGTCGCCCGAAACGACGGTGGCGGT
    GGGCCCGTTGAGGGCGGCGACGGACAGCCCGTCGAGGTTCTGGATCCGC
    TCCAGGACGTCGGTCTGGCTGAGGGCGAGGGAGATCATGCCGCCCTTGC
    CGGCGAGGTGAGCGGCGATGGACCGGCTGCGTAGGGCGACGACGCGGG
    CGGCATCCTCCAGGCTCAGTGCCCCGGCGACGTACGCGGCGGCGATCTC
    GCCTTGCGAGTGCCCGATGACGGCCTGCGGGGTCACGCCGTGGTGCTGC
    CAGAGCTTGGCCAGCGAGACCATGACGGCGAAGGTGACGGGCTGCACC
    ACATCGACGCGGTCGAGCGTGGGGGCGCCGGGTGTCTGCCGGACGACG
    GCCTCCAGTGACCAGTCCACATACGGCGCGAGCGCGGCCTCGCACTCGG
    CCATCGTCTCCGCGAACTCCTTCGACGTGTCGAGGAGTTCGGCTCCCATT
    CCGGCCCACTGCGTGCCCTGGCCGGGGAAGACGAACGCCACCCGGCCCA
    CGTCCGTGGACGTTCCCCGTATCAGCCCTTCCGGAGCGGTCAGCGCCTGT
    GCGAAGTCGCCCGTCCCGGTGCCGATCGCGACGGCCCGGTGCTCGAACT
    GCGCGCGCCCGTCGGCCAGTACGCGGGCGACGGCGCCGGCGTCGACGTC
    ATCCGTACCGCCCTGCGAGGCGTACGCGGCGAGGCGCCCGATCTGGGCG
    TCCAGCGCGGCCGGAGACTTCGCCGAGACCAGCCACGGCACCAGGCCGC
    CGGCGGACGGCTCGACGGCCGGGGTCTCGTTTGTCAGGGTCTCGTCCGC
    CGGGGTCTCGACGACCCCCGGGGCCTCTTCGA
    Contig 95 (SEQ ID NO:6)
    GGCCCGGCGGCCCTGGACCTCATGGCCACCGTCCTCGCCGGCGGTACCG
    GTGAGGACCAGGTCGCCGTGCGCGCCTCCGGGCTGCTCGCCCGCCGCCT
    CGTCCGCGCCGCCCTCCCCGCTCACGGGACGGCTTCGCCGTGGTGGCAG
    GCCGACGGCACGGTGCTCGTCACCGGTGCCGACGAGCCGGCCGCCGCCG
    AGGCCGCGCGCCGCCTGGCCCGCGACGGCGCCGGACACCTCCTCCTCCA
    CACCGGCCCCGTGGCGGGTACGGAGGACTCCGACCCCACCGACCCCACC
    GACCCCACCGACCCCACCGGCCTCACCGGCCTCGTCGCCGAGCTCGCCG
    ACCTCGGCGCGACGGCCACCGTCGTGTCCTGCGACCTCACGGACCGGGA
    GGCGGCCGCCCGGCTGCTCGCCGGCGTCTCCGACGAGCACCCGCTCAGC
    GCCGTCCTCCACCTGCCGCCCACCGTCGACTCCGAGCCGCTCGCCGCCAC
    CGACCCGGACGCACTCGCCCGCGTCGTAACCGCGAAGGCCACCGCCGCG
    CTGCACCTGGACAGCCTGCTGCGGGAGTCCGCGGCGGCCGGACGCCGTG
    CACCCGTCCTCGTCCTCTTCTCCTCGGTCGCCGCGACCTGGGGCGGCGCC
    GGACAGGGCGCGTACGCCGCCGGTACGGCCTTCCTCGACGCCCTCGCCG
    GTCAGCACCGTGCCGAAGGGCCCACCGTGACCTCCGTGGCCTGGAGCCC
    CTGGGAGGGCAGCCGCGTCACCGAGGGCGCGACCGGGGAGCGGCTGCG
    CCGCCTCGGCCTGCGCCCCCTCGCTCCCGCGACGGCGCTCACCGCCCTGG
    ACACCGCACTCGGCCACGGCGACACGGCCGTCACGATCGCCGACGTCGA
    CTGGTCGAGCTTC
    Contig 115 (SEQ ID NO:7)
    ACGTGGGAACACGTCCTGCGTCCCAAGGTCGACGCGGCGTTCCTCCTCG
    ACGAGCTGACCTCCACACCCGCCCACGACCTGGCCGCGTTCGTCATGTTC
    TCCTCCGCCGCCGCCGTCTTCGGCGGCGCGGGGCAGGGCGCATACGCCG
    CCGCCAACGCCACCCTCGACGCCCTCGCCTGGCGCCGCCGCGCCGCCGG
    ACTCCCCGCCCTCTCCCTCGGCTGGGGCCTCTGGGCAGAGAACAGCAGC
    ATGACCGGCGGACTGAGCGACACCGACCGCTCGCGGCTGGCTCGTTCCG
    GGGCGACGCCCATGGACAGCGAGGTGACCCTGTCCCTCCTGGACGCGGC
    CATGCGCCGCGACGACCCGGCGCTCGTCCCGATCGCCCTGGACGTCGCC
    GCGCTCCGGGCCCAGGAGCGCGACGGCATGCTGGCGCCGCTGCTCAGCG
    GGCTCACCCGCGGGTCGCGGGCCGGCGGCGCTCCGGTCGGCCGCCGCAG
    GGCCGCCGCCGACGGCACCGGCCAGGCGGAGAGGGACCTGGGCGGGCG
    GCTCGCCGCGATGACCCCGGACGACAGGACCGCGCACCTGCGGGACCTC
    GTCCGTACGCACGTGGCGACCGTCCTGGGACACGGCGCCCCGAGCCGGG
    TCGACCTGGAGCGCGCCTTCCGCGACACCGGTTTCGACTCCCTCACCGCC
    GTCGAGCTCCGCAACCGCCTCAACGCCGCCACCGGGCTGCGCCTCCCGG
    CCACGCTCGTCTTCGACCACCCCACTCCGGGGGAGCTCGCCGGGCACCT
    GCTCGACGAACTCGCCGCCGCCGCAGGCGGGTCCTGGGCGGATGACACC
    GGGTCCGGCTCTGCTTCCGGCTCCGGCTCCGGCTCCGGAGGCGCGGTCTC
    GGCTGCGGACCGGCAGACCGCGGCGGCACTCGCCGAGCTCGACCGGCTG
    GAAGGCGTACTCGCCGCCCTCGCGCCCGCCGCCGGCGGCCGTCCGGAGC
    TCGCCGCCCGGCTCAGGGCGCTGGCCGCGGCCCTGGGGGACGACGGCGG
    CGCCGCCACCGAACTGGACGAGGCGTCCGACGACGACCTCTTCTCCTTC
    ATCGACAAGGAGCTGGGCGAATCCGACTTCTGACCTGACCTGACCCGAC
    CCGACCGGCGCGACAAGCGACATCAGCACCAGCACCAGCACCACCCAG
    CCCCCACACACACGGAACGGACAGGCGAGAACGGGAGCCATGGCGAAC
    AACGAAGACAAGCTCCGCGACTACCTCAAGCGCGTTACCGCCGAGCTGC
    AGCAGAACACCCGGCGTCTGCGCGAGATCGAGGGACGCACGCACGAGC
    CGGTGGCGATCGTGGGCATGGCCTGCCGCCTGCCGGGCGGTGTCGCCTC
    GCCCGAGGACCTGTGGCAGCTGGTGGCCGGGGACGGCGACGCGATCTCG
    GAGTTCCCGCAGGACCGCGGCTGGGACGTGGAGGGGCTGTACGACCCG
    GACCCGGACGCGTCCGGGCGTACGTACTGCCGGTCCGGCGGGTTCCTCC
    ACGACGCGGGCGAGTTCGACGCCGACTTCTTCGGGATCTCGCCGCGCGA
    GGCCCTCGCCATGGACCCGCAGCAGCGGCTGTCCCTCACCACCGCGTGG
    GAGGCGATCGAGCACGCGGGCATCGACCCGACGAGCCTGAAGGGCAGC
    GGCCTCGGCGTCTTCGTC
    Contig 98 (SEQ ID NO:8)
    GAGCCCGAGCCGGTGCCCGGCGGCCCGGGCAGCGTCGCCGCCGGCCCCG
    CCGCGGATCCGGAACCGGAGACGTCGATCGACGACCTCGACGCCGAGG
    CCCTGATCCGGATGGCTCTCGGCCCGCGGAACGCCTGAGCACCCGCCCC
    GGCCCGTGGCTGCCCCGGCCCTTGCCCGACTGCGGGCCGGGCCCCGGGC
    CCGCACACCGCCACGTACCACCCCGCACCACCGCCCCCCACACGCCCAC
    AACGCCATCCACGAGCGGAAGACCACACCCAGATGACGAGTTCCAACG
    AGCAGTTGGTGGACGCTCTGCGCGCCTCCCTCAAGGAGAACGAAGAACT
    CCGGAAAGAGAGCCGTCGCCGGGACGACCGGCGGCAGGAGCCCATGGC
    GATCGTCGGCATGAGCTGTCGGTTCGCGGGCGGCATCCAGTCCCCCGAG
    GACCTCTGGGACGCGGTGGCCGCCGGCAAGGACCTCGTATCCGACGTAC
    CTGAGGAGCGCGGCTGGGACTTCGACTCCCTGTACGACCCGGAGCCCGG
    GCGGAAGGGCACGACGTACGTCCGCAACGCCGCGTTCCTCGACGACGCC
    GCCGGCTTCGACGCCGCGTTCTTCGGGATCTCGCCGCGCGAGGCCCTCG
    CCATGGACCCGCAGCAGCGGCAGCTCCTCGAAGCCTCCTGGGAGGTCTT
    CGAGCGGGCCGGCATCGACCCCGCGTCGGTGCGCGGCACCGATGTCGGC
    GTGTACGTGGGATGCGGCTACCAGGACTACGCGCCGGACATCCGGGTCG
    CCCCCGAGGGGACCGACGGTTACGTCGTCACCGGCAACTCATCCGCCGT
    GGCCTCCGGGCGCATCGCGTACTCCCTCGGTCTCGAGGGGCC
    Contig 184 (SEQ ID NO:9)
    GCTCGGCGAACTCCCCGCGCCGACCCGCCGGCACACCGAGCACCGCGGC
    CGCCGCGCCCGTCACCGCCGGACGGACGAAACCCCCCACCAACTCGAAG
    GCGTACGAAGCCGACGGGTCCGGCGCGAGACCCTCCAGGATCTGCCGGT
    GGACCTCCTCGACCACGGCCCGGCGCTGCCCCGCCCACGCCCCCGGCAC
    CTCGGCGGCCGCCCGCGGCGCCTGCTCGTGCTCCAGCGGGCAGCCCTCC
    CCGTAGGAGAGGACCTGCTGCGGCACCGGGACGCCGTGGCACCCGGCA
    CCCCGAACTCCGTCGAGCACAGGACGCTCGCCGCCACGGCGTGATCGGC
    GGTGACCCAGCTGCCCGTCGGGCTGAAGGAGAGCACGCCCCGGGCGCG
    CACCCGCTCGTACGCGGGATACGGATCGTCGGCCTGCCCGCGCAGCACG
    GCGGCGTACGGGTCGCCGTTCGCGGCGTGGATCCAGTGGATGCCGCGGG
    TCTCCAGGAGGTGGGCACCGAGCTCGGGGTCGGCCACCGCGCTGACGGT
    GCGGCCCAGCGGAGGCTGCGTGAGCGCCCGCGCCGGGTCGTCGGTCACC
    GTGGGTTCTGCCATCGTTTCGCCGCTCCTTCGATCAGTCGGGTCGGGGGC
    TGCACGACGCGGGAATCGGGCGCGCCGCGGGTGACGAGCAGGTGGTCG
    GAGATGTCGTTGCAGATCCCGTGCCACTGGTCGTTGAGGTAGAAGTGAC
    CGCCGGAGTACGCCCGCAGGCAGAACGGCCCGCTGGTGTGCCGGCGCCA
    CTCGGCCACCTCGTTCAGCGGCGCCTTCGGGTCGCGGTCGCCGGCCACG
    GCCATCACCGGGCAGGCGAGCTTCGCGGAGGGCCGGTGCTCGTACGTCT
    CCGCCGCCTTGTAGTCGCTGCGCAGCGCGGGCAGCACCAGCCGCATCAG
    CTCGTCGTCCTGGAGGAACCGCTCGTCCGTGCCGCTGAGCTGCCGGATCT
    CGGCCAGGAACGCCCGGTCGTCCAGCTGGTGGACGAGCCGGTCCGGTGC
    CAGGGACGGGGCGCGCCGGCCGGAGACGTACAGGCCCTCGGGCCGTAC
    CCCGTGCCGCTGTTCGAGGATGCGGGCCG CCTCGTA
    Contig 88 (SEQ ID NO:1O)
    GGGGACGATCCCCGCCGGGGTGGGGTCGCGATGGGTCTCCTCGCGCAGC
    CGGTGCGCGGCGGCGAGGACCGAGGGGTCGTCGAGGATGCGGACGACC
    GCGTCCCGCACCGCCTGCGGGGTGAGGCCGGCAGGCGGCAGGAAGAAC
    CCCGCCCCCTGCTCCGCGACGGCCCGCGCCTTGACCGGCGCGTCCCACA
    GCTCGGCGAGCATGACCTGCGGCACCGCGTTGATCACGGCGGTCGCGTA
    CGTACCGGCCCCGCCGTGGTGGACGATCGCCGAACAGCTCGGCAGCAGC
    GCGTGCATCGGCACGAAGTCCGTGAACCGCGTGTGCTTCGGATAGGAGC
    GGATCTCCGCGCGCTGACCCGCGTCGAGCGTGGCCACGAGCTCGATGTC
    GAGGTCGGCGAGCGCCTCCAGGATGTCGGCCTGCGAGACCCCGTCGCCG
    CCGAGGACCTCCCGCGCGGAGACACCGAGAGTGAGGCAGACCCGGGGC
    CGCGCCGGCGGCTCGGCGAGCCAGTCCGGCACGACCGACGTGCCGTTGT
    ACGGAACGTACTGCACCCCGACGGTCGGCAGACCCGTGTCGAGACGCAG
    ACTCGGCGGAGTCGGGTCGACCGTGAACTGGCCGGTGAGCAGCTCCTCT
    TCGAAGGAGGCGCCGAACCGGTCCAGCGTCCACGTCAGCCACTCCGCCG
    TGGGGTCCTCACGGTGCTCCGGCGGCTGCCGGTCCCGCAGCGCGACGAA
    CTTGCGGCGGGCGCTCCCCATCACGTCGGGCCCCCACAGGACCCGGGCG
    TGCGCGGCGCCCGTGACCTGGGCGGCGACGGCGCCCGCGTACGTCGTCG
    GCTCCCACAGCACCAGGTCCGGCTGCCAGGACCTGGCGAAGCCGACCAG
    GTCGTCGATCATCGAGTCGTTGTTGGCGAGCAGATAGAAGTACGGGGCG
    AGGATCGCGTCGATGCCGAGGGCGTGGTCCCAGTCCAGCGGCTCGCTAC
    GGGCCTCGTCGAAGGCGATCGCCGGATGGTTCGGGCGCGGCTCGCCCGC
    CATCCGCACCCGGTACTCGTGGATGAGGTGATCCGTGCCGACGGGCACG
    GCCGCGAGCCCTGACCCGGTGATGGTGTCCGTGAGCGCGGGCTGGCTCG
    CGACCCGCACCTCGTGCCCGGCGGCGAGCAGCGCCCAGGCCAGGGGAA
    CGAGGCCGTAGTAGTGCGTGTGATGTGCGAACGAGGTCAGCAGGACGC
    GCATGGCGTCGTGTCCTTCCTTGCCGGTGAAGGGTCGGGGTGGGGAGGC
    GGGGTGGGGAGGTCGGAACGGACTCAGGAGCCGACCGGGACGCTCAGC
    GGCCCGCGGCCGACAGGGGCGCGGCGGGGACGGAGCACGGGCCCGGCC
    TTCCGCAGCCCGGGGAAACGCCCGGCCAGGGTCCGCAGCGCGACCTCCG
    CCTGGAGCCGCACCAGCGACGCCACCGGGCCGTACGGACCGGCGGGGT
    GCAGCGCGAGGTGCGCCGTGGCGTCGGGGCGCGGAGGTCGAAACGCTC
    CGGGTCCGTGAAGACCCCCGGGTCCCGGCCGGTGCCGGCGGTGAGGACG
    ACGACATGCGCCCCGGCCGGGAGACGCCGGCCCGCCAGCT
    Contig 93 (SEQ ID NO:11)
    GCAGGAGTCCCGTGTACGAAGTCGACCACGCCGACGTCTACGACCTCTT
    CTACCTCGGTCGCGGCAAGGACTACGCCGCCGAGGCCTCCGACATCGCC
    GACCTGGTGCGGACCCGTACCCCCGAGGCCTCCTCGCTCCTGGACGTGG
    CCTGCGGTACGGGCACGCATCTGGAGCACTTCACCAAGGAGTTCGGCGA
    CACCGCCGGCCTGGAGCTGTCCGAGGACATGCTGACCCACGCCCGGAAG
    CGGCTGCCCGACGCGACGCTCCACCAGGGCGACATGCGGGACTTCCGCC
    TCGGCCGCCGGTTCTCCGCGGTGGTCAGCATGTTCAGCTCCGTCGGCTAC
    CTGCGGACGACGGCCGAACTCGACGCGGCCGTCGCCTCGTTCGCCGCGC
    ACCTGGAGCCCGGCGGCGTCGTCGTCGTCGAGCCGTGGTGGTTCCCGGA
    GACCTTCGCCGACGGCTGGGTGAGCGCCGATGTCGTCCGGCGGGACGGG
    CGGACCGTGGCCCGTGTCTCGCACTCGGTGCGGGACGGCGACGCGACGC
    GCATGGAGGTGCACTTCACCGTGGCGGACCCGGGCCGCGGCGTACGGCA
    CTTCTCCGACGTCCACCTCATCACCCTGTTCCACCGGGCGGAGTACGAGG
    CGGCCTTCACGGCCGCCGGGCTGCGCGTCGAGTACCTGGAGGGCGGCCC
    GTCGGGCCGTGGCCTCTTCGTCGGGGTCCCCGCCTAGTCCCTCGCCCGGT
    CACCCCACACAGACCCCCGGGGCGTCCCGGGTGCACCAAGCACAGAGA
    GAGAAATCCACCGTGACAGGTAAGACCCGAATACCGCGTGTCCGCCGCA
    GCCGTACGACCCCCAGGGCCTTCACCCTGGCCGTCGTCGGCACCCTGCT
    GGCGGGCACCACCGTGGCGGCCGCCGCTCCCGGCGCCGCCGGCACGGGC
    CACGTGCAGTACACGAGCAAGGCGGCGGAGCTCGTCGCGCAGATGACG
    CTCGACGAGAAGATCAGCTTCGTCCACTGGGCGCTGGACCCCGACCGGC
    AGAACGTCGGCTACCTTCCGGGCGTGCCGCGTCTCGGCATCCCGGAGCT
    GCGCGCCGCCGACGGCCCGAACGGCATCCGTCTGGTGGGCAGGACCGCC
    ACCGCGCTGCCCGCGCCGGTCGCCCTGGCCAGCACCTTCGACGACTCCA
    TGGCCGACAGCTACGGCAGGGTCATGGGCCGCGACGGACGCGCGCTGG
    GCCAGGACATGGTTCTGGGCCCGATGATGAACAACATCCGGGTGCCACA
    CGGCGGCCGGAACTACGAGACCTTCAGCGAGGACCCCCTGGTCTCCTCG
    CGCACCGCGGTCGCCCAGATCAAGGGCATCCAGGGTGCGGGTCTGATGA
    CCACGGCCAAGCACTTCGCGGCCAACAACCAGGAGAACAACCGCTTCAG
    CGTCAACGCCACGGTCGACGAGCAGACGCTCCGCGAGATCGAGTTCCCG
    GCGTTCGAGGCGTCCTCGAAGGCCGGCGCGGCCTCCTTCATGTGTGCCT
    ATAACGGCGTCAACGGCAAGCCGTCCTGCGGCAACGACGAGCTGCTCAA
    CAACGTGCTGCGCACGCAGTGGGGCTTCCAGGGCTGGGTGATGTCCGAC
    TGGCTCGCCACCCCGGGCACGGACGCCATCACCAAGGGCCTCGACCAGG
    AGATGGGCGTCGAGCTCCCCGGCGACATCCCGCCGGGCGAGCCCTCGCC
    GCCGGCCAAGTTCTTCGGTGACGCGCTGAAGCAGGCCGTCCTGAACGGC
    ACGGTCCCCGAGGCGGCCGTGACGCGGTCGGCGGAGCGCATCGTCAACC
    AGATGGACAAGTTCGGTCTGCTCCTCGCGACTCCGGCGCCCCGCCCCGA
    GCGTGACAAGGCGGGCGCCCAGGCGGTGTCCCGCAAGGTCGCCGAGAA
    CGGCGCGGTGCTCCTGCGCAACGAGGGCCAGGCCCTGCCGCTCGCCGGT
    GACGCCGGCAAGAGCATCGCCGTCATCGGCCCGACGGCCGTCGACCCCA
    AGGTCACCGGCCTGGGCAGCGCCCACGTCGTCCCGGACTCGGCGGCGGC
    GCCGCTCGACACCATCAAGGCCCGCGCGGGCGCGGGTGCGACGGTGAC
    GTACGAGACGGGTGAGGAGACCTTCGGGACGCGGATCCCGGCGGCGCA
    GCTCAGCCCGGCGTTCAACCAGGGCCACCAGCTGGAGCCGGGCAAGGC
    GGGGGCGCTGTACGACGGCACGCTGACCGTGCCCGCCGACGGCGAGTAC
    CGCATCTCGGTCAAGGCCACCGGTGGCTACGCGACGGTGCAGCTCGGCA
    CCTCAAGCTGACCAAGGGCACGCACAAGCTCACGATCTCGGGCTTCGCG
    ATGAGCGCCACGCCGCTCTCCCTGGAGCTGGGCTGGGTGACGCCGGAGG
    CAGCCGACGCGACGATCGCGAAGGCCGTGGAGTCGGCGCGGAAGGCCC
    GTACGGCCATCGTGTTCGCGTACGACGACGGCACCGAGGGCGTCGACCG
    TCCGAACCTGTCGCTGCCGGGTACGCAGGACAAGCTGATCTCGGCGGTC
    GCCGACGCGAACCCGAACACGATCGTGGTCCTCAACACCGGTTCGTCGG
    TGCTGATGCCGTGGCTGTCCAAGACCCGCGCGGTCCTGGACATGTGGTA
    CCCGGGCCAGGCGGGCGCCGAGGCGACCGCCGCGCTGCTCTACGGTGAC
    GTGAACCCGAGCGGCAAGCTCACGCAGAGCTTCCCGGCCGCCGAGAACC
    AGCACGCCGTCGCCGGCGACCCGAACCGCTACCCGGGCGTCGACAACCA
    GCAGACGTACAGCGAGGGCATCCACGTCGGGTACCGCTGGTTCGACAAG
    GAGAACGTCAAGCCGCTGTTCCCGTTCGGGCACGGCCTGTCGTACACCT
    CGTTCACGCAGAGCGCCCCGACCGTGGTGCGCACGTCCACGGGCGGCCT
    GAAGGTCACGGTCACGGTGCGCAACAGCGGGCAGCGCGCGGGCCAGGA
    GGTCGTCCAGGCGTATCTCGGCGCGAGCCCGAAGGTGACGGCTCCGCAG
    GCGGAGAAGAAGCTCGTGGGCTACACGAAGGTCGCGCTCGCGGCGGGC
    GAGTCGAAGACGGTGACGGTGAACGTCGACCGCCGTCAGCTGCAGTACT
    GGGACGCCGCGTCGGACTCGTGGAGGACGGGAACGGGCAGCAGGCTCC
    TCCAGACCGGTTCGT
    Contig 122 (SEQ ID NO:12)
    GGGGGTGATCGCCTTCTCGACGAGCAGCGGGTCGAGGGTGGGGTGGTCC
    TCGTTCGGCTCGACGGGCACGGGGGTCGCGCCGGTGGCGGAGACCGCGA
    GCCAGCTGGCGATGTACGTGTGCGAGGGGACGTCACCTCGTCCCCGGGT
    CCGATGCCGAGGCCGCGGAGCGCGAGCTGGAGGGCGTCCATGCCGCT
    GTTCACGCCGACGGCGTGGTCG    GCAGTAGGTGGCGAACTCGGCT
    TCGAAGGCTTCGAGTT
    CGGGGCCGAGGAGGTAGCGCCCCGAGTCGAGTACGCGGGCGATGGCGG
    CGTCGGTCTCCGGGCGC
    AGTTCCTCGTAGGCGGCCTTGAGGTCGAGGAAGGGGACCCGGCCGGTCT
    CGGTGCGGGCGGTCAC
    GCGGACACCCCCACGGCGGTGGCGGGCGGCTGCGGGGCGGTGGCGGGC
    GGCTGCGGGGCGGTGGC
    CTTGAGCGGTTCCCACCAGTCGCGGTTCTCCCGGTACCAGCGGATGGTG
    CGCGCGAGGCCGTCCG
    CGAAGGCGATCTGCGGGCGGTAGCCGAGTTCGCGCTCGATCTTGCCGCC
    GTCGAGGGAGTAGCGC
    AGGTCGTGGCCCTGGCGGTCGGCGACCCGCCGGACCGAGGACCAGTCGG
    CGCCGAGCGAGTCCAG
    GAGGATGCCGGTGAGTTCGCGGTTGGTCAGCTCCCGGCCGCCGCCGATG
    TGGTAGACCTCGCCGG
    CCCGGCCGCCCGCGAGGACGAGCGCGATGCCCCGGCAGTGGTCGTCGGT
    GTGGACCCACTCGCGG
    ACGTTCGCGCCGTCGCCGTACAGCGGGAGCGTCCCGCCGTCGAGGAGGT
    TCGTCACGAAGAGGGG
    GATGAGCTTCTCGGGGTGCTGGTACGGCCCGTAGTTGTTGCAGCAGCGG
    GTGATCCGTACGTCGA
    GGCCGTAGGTGCGGTGGTAGGCGCGGGCGACGAGGTCGGAGCCGGCCT
    TGGAGGCCGCGTAGGGG
    GAGTTGGGTTCCAGCGGGCTGCTCTCGTTCCACGAGCCGGAGTCGATCG
    ACCCGTACACCTCGTC
    GGTGGAGACGTGCACGACCCGGCCGACGCCGGCGTCGAGGGCGCACTG
    GAGCAGGGTCTGCGTGC
    CCTGGACGTTGGTCCCGGTGAACACGGACGCCCCCGCGATGGAGCGGTC
    GACGTGGCTCTCGGCG
    GCGAAGTGGACGACGGCGTCGACAGTTCCCGGGCGAGGAGG
    TCGGCGTCGCGGATGTC
    GCCGTGGACGAACCGCAGCCGCGGGTCCGCTTCCACCGGGGCGAGGTTG
    GCGCGGTTGCCCGCGT
    AGGTGAGGCTGTCCAGGACGATCACCTCACCGGCGGGGACGTCGGGGTA
    CCCCCCGGCGAGGAGC
    TGCCGCACGAAGTGCGAGCCGATGAAGCCCGCACCTCCGGTCACCAGAA
    GCCGCACTGCCGTCTT
    CCTTTCGGTCGCGCTGTCGGTGGCACTGCCGGTGGTGGGGGGAACG
  • Sequence information generated from cosmids of the invention can be used to generate additional nucleic acids of the invention as well as to generate additional sequence information regarding the narbonolide PKS enzyme and narbomycin modification enzymes. [0284]
  • The invention having now been described by way of written description and example, those of skill in the art will recognize that the invention can be practiced in a variety of embodiments, that the foregoing description and example is for purposes of illustration and not limitation of the following claims. [0285]
    SEQUENCE LISTING
    <100> GENERAL INFORMATION:
    <160> NUMBER OF SEQ ID NOS: 12
    <200> SEQUENCE CHARACTERISTICS:
    <210> SEQ ID NO 1
    <211> LENGTH: 1590
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces narbonensis
    <400> SEQUENCE: 1
    acaggggata tcccgctcca ggcgaacggt agccgcgtgc cctcgccgaa
    cgccccgccc 60
    gcaccggccg cctgcacggc ggcgtcgagc agcgccgggt ggaggccgaa
    ccgcgcgccc 120
    tcggcgcccg cgacctccgt cggcagggcc acgtcggcga acacctcttc
    gccgcgccgc 180
    cagacgccac ggacgccccg gaagaggggc ccgtagccgt atccgctcgc
    cgcgaagcgg 240
    tcgtacagac cgtccacgtc cactgcttcg gcacccgccg ggggccaggc
    ctccgggtcg 300
    gcgacagggg cggtgcgatc cgtacgggcg agcacaccgg tcgcgtgccg
    cgtccactcc 360
    ggctcgcccg gcgcgtcctc cgggtgcgcg tggagcacga aggtacggcg
    cccggactcg 420
    tcgctcgcgc cgacggacag ctgcacgcgg accgcgccgc gacggggcag
    gacgagcggg 480
    gcgtcgaggg tgagctcctc gaccagatcg cagccgacct ggtcaccggc
    ccggaaggcc 540
    agctccacga acgccgttcc cggcagcagc accgtgccgg ccaccgcgtg
    gtccgccagc 600
    caggggtgcg tacggaggga gaggctcccc gtgagcaggc agccgtcgga
    gtcggcgagc 660
    gcgacggccg cgccgagcag cgggtgctcg gccgccccga gaccggcgga
    cgtgatgtca 720
    ccgacggcgg agtgctcggg ccgcggccag tagcgctcgg tctggaaggc
    gtaggtgggg 780
    aggtcgggga ggtcggcgtt cgtcgcgttc ttcgtggtcg tggtggggag
    gacgggtgtc 840
    cagtcgaggg ggaggccgtt ggtccaggcc tcggcgagcg aggtgaccag
    acgctcctgg 900
    ccgccgtcct cgcggcggag ggtgccgagg ccggtgacgg tgtcggggag
    ggccatggtg 960
    aggacggggt gggcgctgac ctcgacgaag tgggtgaacc cttcgtcggt
    ggcgagggtt 1020
    tcgacggcgg gggcgaagcc gacggggtgg cggaggttgc ggtaccagta
    cgtggcgtcg 1080
    agggcgggtt cggtgatcca ggcaccgtcg agcgtggaga agaaggggac
    gcgcggagcg 1140
    tgcggggtga gtccggcgag gacgtcggcg agctcgttct cgatggtctc
    gacgtgggcg 1200
    ctgtgggagg cgtagtcgac ggggatgatc cgcgcgcgga tgccgtcggc
    cttgcaggtc 1260
    ttcgcgagct cttcgatctg tgcggggtcg ccggagacca cggtggcggt
    ggggccgttg 1320
    acggcggcga tcgacagtcc gtcgagggtg tcgatccgct ccaggacgtc
    ggcctggctg 1380
    agggcgaggg agaccatgcc gcccctgccg gcgaggtgag cggcgatgga
    ccggctgcgt 1440
    agggcgacga cgcgggcggc atcctccagg ctcagtgccc cggcgacgta
    cgcggcggcg 1500
    atctcgccct gggagtggcc gatgacggcc tggggggtga tgccgtggtg
    ctgccagatc 1560
    ttcgcgaggg agaccatgac ggcgaaggtg
    1590
    <200> SEQUENCE CHARACTERISTICS:
    <210> SEQ ID NO 2
    <211> LENGTH: 1419
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces narbonensis
    <400> SEQUENCE: 2
    cgggctggac gacgtcgacg cggtcgagcg tcggggcgcc gggagcctgt
    cgtacgacgg 60
    cttcgaggga ccagtcgacg tgacgggaga gcgcggtctc gcacgcggcc
    atctccgccg 120
    cgaactccgc agaggagtcc agcagttcgg cacccatccc ggaccactgc
    gtgccctggc 180
    cggggaacac gaacgccacg cgcccgacag cggaagccgt gccacgaatc
    agcccgtccg 240
    ggtcggccag ggcctgtacg aggtcgcccg ccccggtgcc cagcgcgacg
    gcccggtgct 300
    cgaactgcgc ccgcccgtcg gccagtacgc gggcgacggc gccggcgtcg
    acgtcatccg 360
    tacgcccctg agaggcgtac gcggcgagcc gctcgatctg ggcgtcgagt
    gcaccggcgg 420
    acttcgccga caccacccac ggcaccacgc cacccgacga cggctcgtcc
    acggcggtgt 480
    tttccaccgt cggggcctct tcgaggacga cgtgagcgtt cgtcccgctg
    atgccgaagg 540
    aggagacggc ggcgcggcgc agcccgccgt cctgcttctc cggccagtcc
    acggcctcgg 600
    tgaggagttc cacggcaccg gccgaccagt cgatctggtc cgagggggcg
    tccacgtgaa 660
    gcgtcttcgg gagtagcccg tggcgcatcg cctggaccat cttgatgaca
    ccggcgacac 720
    cggccgcggc ctgggtgtgc ccgatgttgg acttcaacga tccgagcagc
    aacggacgtt 780
    cgccgccccg gtcctgcccg taggtggcga tcagggcctg cgcctcgatc
    gggtcgccga 840
    gccgcgtccc cgtgccgtgc gcctcgacga catcgacctc gcccggcgtg
    agccgggcgt 900
    cggccagggc ccgccggatg acgcgctgct gcgacggccc gttcggagcc
    gtgagaccgt 960
    tgctggcgcc gtcctggttc acggcgctgc cgcggacgac cgcgaggacc
    cggtgtccgt 1020
    ggcggcgggc gtccgacagg cgctcgacga ggaggacacc gacaccctcg
    gaccaactgg 1080
    tgccgtccgc cgacgcggcg aacgccttcg accgaccgtc cccggccagc
    ccgcgctgcc 1140
    ggctgaactc cacgaacatc cccggcgtgg gcatcacggc cacgccgccg
    gcgagcgcca 1200
    tgtcgacctc gcccttgcgc agggcctgca cggcgaggtg cagggcgacc
    agcgacgacg 1260
    agcaggcggt gtccaccgtc agggcggggc cctcaaggcc gagcgtgtac
    gagacgcggc 1320
    ccgacatcac gctggccgtg ttgccggtca gcaggtatcc gtcgaggccc
    tccccgccgt 1380
    cgcgcaggct cggcccgtac tcgtgggtca tcgccccgg
    1419
    <200> SEQUENCE CHARACTERISTICS:
    <210> SEQ ID NO 3
    <211> LENGTH: 1434
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces narbonensis
    <400> SEQUENCE: 3
    gaacccgtcg gcgtccgccg agaaggcctt gctccggccg tccggggcga
    gcgcccgctg 60
    ccggctgaac tccacgaaca tgtgcggggt cgccatcatc gccacaccac
    cggcgagtgc 120
    catcgagcat tcaccgctcc gcagcgcccg caccgccagg tgcagggcgg
    tcagcgagga 180
    cgagcaggcg gtgtcgacgg tcgtcgcggg cccttcgaga ccgaaggtgt
    acgcgatgcg 240
    gccggacgcg acgctcggcg tgctgccggt cagcaggtaa ccctccacgc
    cgcgcggggc 300
    gttcgggacg cgggccgcgt agtcctggta ggagaggccg atgaagacac
    cggtgctgct 360
    gccgcgcagc gagcccggct cgatgccggc ccgctcgaac gcctcccagg
    acgtcgccag 420
    gagcatccgc tgctgcgggt ccatggcgag cgcctcgcgc ggcgagacac
    cgaagaactc 480
    cgcgtcgaac tcggccgcgt cgtgcaggaa cccgccctcg cggacgtacg
    ccttgccgag 540
    cgcgtccggg tcggcgtcgt acaggccgtc gaggtcccag ccccggtcgg
    tggggaaggg 600
    cgtgatgccc tcgccgccct cggccagcat ccgccacagg tcctcagggc
    tgcggatgcc 660
    accggggtat cggcagctca tggcgacgat cgcgatcgga tcgtcgtcga
    caccgagacc 720
    gacaccgaga ccgagaccga caccgagacc gacaccggat ccgccaccga
    caccggatcc 780
    gccaccgaga ccagcaccag ctccgccacc gagaccagca ccagctccgg
    caccgagacc 840
    agcgccgaca gcccgcgtcc ccctggccca cgtggactcc gccgccgcgt
    cctcgtcacc 900
    gaggaactcg gcacggagca gtgacgcgag ggccagcggc gtcgggtggt
    cgaagacgag 960
    cgtcgcgggc aaggggagcc cggtcgcccg ggtcagccgg ttgcggagct
    cgactccggc 1020
    gagcgagtcg aagccgatgt ccttgaaggc ccggtcggcg gcgacgtcct
    caggtgaacg 1080
    catccggagc acggcggcgg cctgggcccg tacgagaccg aggaggatct
    ccgtacgctc 1140
    gccgggagcc gcggcggcca gccgctcggc cagcgggttc ccgcccgcgg
    cggagctgcc 1200
    gcccggcccg gccggggcgc tctcccgcgc gtcgatgatg cgccgcacct
    cgggcagctc 1260
    ctcgacgagg ggctgagggc ggccggagga gtacgcgagg tagaaacggt
    cccagtcgat 1320
    gtccgcgacg gtgatcgcgg tctcgtcccg gccgagggcg gactccagtg
    cggtcagggc 1380
    gagttccggg tccatgccgg gtacgccgtg atcgcgcagg cgctcggcca cccc
    1434
    <200> SEQUENCE CHARACTERISTICS:
    <210> SEQ ID NO 4
    <211> LENGTH: 1462
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces narbonensis
    <400> SEQUENCE: 4
    agcgggccag gccggagccg gggaccggga ccgggacgtg tccacgccgt
    ccaggagcac 60
    cgcccacacg gatgccctgc tggcacaact caccaggctg gaaggcgcct
    tggtgctgac 120
    gggcctcccg ggcgcccccg ggagcgaaga agtcctggag cacctgcgct
    cccttcgcgc 180
    gatggtcacg ggcgagaccg ggagcgggac cggggccgga agcgggggcg
    ggggcgcgtc 240
    cgcggaatcc gggggcggag acccctacta cgccgacggg ggcgggagtg
    aggaccgcgc 300
    gggagtgccg gacttcatga acgcctcggc cgaggaactc ttcggcctcc
    tcgacatgga 360
    ccccagcacg gactgatccc tgccgcacgg ccgcctcccg ccccgggccc
    cgtccgagac 420
    cccgtcccgg acccgtcccg ggcacctcga ctcgaatcac ttcatgcgcg
    cctcgggcgc 480
    ctccaggaac tcaaggggac agcgtgtcca cggtgaacga agagaagtac
    ctcgactacc 540
    tgcgtcgcgc cacggcggac ctccacgagg cccgcggccg cctccgcgag
    ctggaggcca 600
    gggcgggcga gccggtggcg atcgtcggca tggcctgccg cctgccgggc
    ggtgtcgcct 660
    cgccggagga cctgtggcgg cttgtggccg gtggcgagga cgcgatctcg
    gagttcccgc 720
    aggaccgcgg ctgggacgtg gaggggctgt acgacccgaa cccggaggcc
    acgggcagga 780
    gttacgcccg tgaggccgga ttcctgtacg aggcgggcga gttcgacgcc
    gacttcttcg 840
    ggatctcgcc gcgcgaggcc ctcgccatgg acccgcagca gcggctcctc
    ctggaggcct 900
    cctgggaggc gttcgagcac gccggcatcc cggcggccag tgcgcgcggc
    acgtcggtcg 960
    gcgtcttcac cggcgtgatg taccacgact acgcgacccg tctcaccgac
    gtccccgagg 1020
    gcatcgaggg ctacctgggc accgggaact ccggcagcgt cgcctcgggc
    cgggtcgcct 1080
    acacgctggg cctggagggc ccggccgtca cggtcgacac ggcctgctcg
    tcctcgctcg 1140
    tcgccctgca cctcgccgtg caggccctgc gcaagggcga ggtcgacatg
    gcgctcgccg 1200
    gcggcgtgac ggtcatgtcg actcccagca ccttcgtcga gttcagccgc
    cagcgcggac 1260
    tggcccccga cggccggtcg aagtccttct cgtcgacggc ggacggcacc
    agctggtccg 1320
    agggcgtcgg cgtcctcctc gtcgagcgcc tgtcggacgc ccgtcgcaag
    ggccaccggg 1380
    tgctcgccgt ggtccggggc acggccgtca accaggacgg cgcgagcagc
    ggcctcaccg 1440
    ccccgaacgg cccgtctcag ca
    1462
    <200> SEQUENCE CHARACTERISTICS:
    <210> SEQ ID NO 5
    <211> LENGTH: 1881
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces narbonensis
    <400> SEQUENCE: 5
    ggtgctccag ggcggcgacc ctgcccatgc cccacaccat ggcctgggcg
    ggggaggaga 60
    tgtggtcggc gcggccgacg gacaccgcgc cacgggtgac gcaccacagc
    ggagcggcga 120
    caccggcgtc ctccagcgcc tgcaccaggg tgagggtggc gccggtgccc
    cgggtgaagg 180
    gggcggggtg gccggggtgc gcgtcctcgt cccaggcgag cagcgagacg
    acaccgccga 240
    cggctccacc ggccgccgcc agggcttcgc ccagcgcctc cgtgagccgc
    tgccggtcgc 300
    tcggtgcgga cacgtccagc cgtacggggt cggcgcccgc accggacagc
    gcggcgagca 360
    ccggggcggc ctcggaggac cggccctcgg gggcgacgac gagccagcga
    ccggacaggc 420
    cggggctctc ggtgccctcg gcgaccgcga gccgcttcca gtcgacgcgg
    tagcgccagg 480
    agtcctgcac ggagccctgg gcggcggggg agtcgtggag ccagtagtga
    cggcgctgga 540
    aggcgtaggt ggggaggtcg gggaggtcgc cggtcgcggc cgggaggacg
    ggcgcccagt 600
    cgacggtgag gccgtgggcc caggcttcgg cgagggaggt gatcaggcgg
    tcgaggccgc 660
    cttgttcgcg gcggagggtg ctgaggcctg tgacggtgtc ggggagggcc
    atggtgagga 720
    cggggtgggc ggagacctcg atgaagtggg tgaagccttc ggttgtggcg
    agggtttcga 780
    tggcgggggc gaagccgacg gggtggcgga ggttgcggta ccagtaggtg
    gcgtcgaggg 840
    cgggttcggt gatccaggtg ccttcgaggg tggagaagaa ggggacgcgc
    ggagcgtgcg 900
    gggtgagtcc ggtgaggacg tcggcgagct cgttctcgat ggtctcgacg
    tgggcgctgt 960
    gggaggcgta gtcgacgggg atgacccgcg cgcggacccc gtccgccttg
    cacgtacggg 1020
    cgagctcctc gatctgtgcg gggtcgcccg aaacgacggt ggcggtgggc
    ccgttgaggg 1080
    cggcgacgga cagcccgtcg aggttctgga tccgctccag gacgtcggtc
    tggctgaggg 1140
    cgagggagat catgccgccc ttgccggcga ggtgagcggc gatggaccgg
    ctgcgtaggg 1200
    cgacgacgcg ggcggcatcc tccaggctca gtgccccggc gacgtacgcg
    gcggcgatct 1260
    cgccttgcga gtgcccgatg acggcctgcg gggtcacgcc gtggtgctgc
    cagagcttgg 1320
    ccagcgagac catgacggcg aaggtgacgg gctgcaccac atcgacgcgg
    tcgagcgtgg 1380
    gggcgccggg tgtctgccgg acgacggcct ccagtgacca gtccacatac
    ggcgcgagcg 1440
    cggcctcgca ctcggccatc gtctccgcga actccttcga cgtgtcgagg
    agttcggctc 1500
    ccattccggc ccactgcgtg ccctggccgg ggaagacgaa cgccacccgg
    cccacgtccg 1560
    tggacgttcc ccgtatcagc ccttccggag cggtcagcgc ctgtgcgaag
    tcgcccgtcc 1620
    cggtgccgat cgcgacggcc cggtgctcga actgcgcgcg cccgtcggcc
    agtacgcggg 1680
    cgacggcgcc ggcgtcgacg tcatccgtac cgccctgcga ggcgtacgcg
    gcgaggcgcc 1740
    cgatctgggc gtccagcgcg gccggagact tcgccgagac cagccacggc
    accaggccgc 1800
    cggcggacgg ctcgacggcc ggggtctcgt ttgtcagggt ctcgtccgcc
    ggggtctcga 1860
    cgacccccgg ggcctcttcg a
    1881
    <200> SEQUENCE CHARACTERISTICS:
    <210> SEQ ID NO 6
    <211> LENGTH: 897
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces narbonensis
    <400> SEQUENCE: 6
    ggcccggcgg ccctggacct catggccacc gtcctcgccg gcggtaccgg
    tgaggaccag 60
    gtcgccgtgc gcgcctccgg gctgctcgcc cgccgcctcg tccgcgccgc
    cctccccgct 120
    cacgggacgg cttcgccgtg gtggcaggcc gacggcacgg tgctcgtcac
    cggtgccgac 180
    gagccggccg ccgccgaggc cgcgcgccgc ctggcccgcg acggcgccgg
    acacctcctc 240
    ctccacaccg gccccgtggc gggtacggag gactccgacc ccaccgaccc
    caccgacccc 300
    accgacccca ccggcctcac cggcctcgtc gccgagctcg ccgacctcgg
    cgcgacggcc 360
    accgtcgtgt cctgcgacct cacggaccgg gaggcggccg cccggctgct
    cgccggcgtc 420
    tccgacgagc acccgctcag cgccgtcctc cacctgccgc ccaccgtcga
    ctccgagccg 480
    ctcgccgcca ccgacccgga cgcactcgcc cgcgtcgtaa ccgcgaaggc
    caccgccgcg 540
    ctgcacctgg acagcctgct gcgggagtcc gcggcggccg gacgccgtgc
    acccgtcctc 600
    gtcctcttct cctcggtcgc cgcgacctgg ggcggcgccg gacagggcgc
    gtacgccgcc 660
    ggtacggcct tcctcgacgc cctcgccggt cagcaccgtg ccgaagggcc
    caccgtgacc 720
    tccgtggcct ggagcccctg ggagggcagc cgcgtcaccg agggcgcgac
    cggggagcgg 780
    ctgcgccgcc tcggcctgcg ccccctcgct cccgcgacgg cgctcaccgc
    cctggacacc 840
    gcactcggcc acggcgacac ggccgtcacg atcgccgacg tcgactggtc gagcttc
    897
    <200> SEQUENCE CHARACTERISTICS:
    <210> SEQ ID NO 7
    <211> LENGTH: 1681
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces narbonensis
    <400> SEQUENCE: 7
    acgtgggaac acgtcctgcg tcccaaggtc gacgcggcgt tcctcctcga
    cgagctgacc 60
    tccacacccg cccacgacct ggccgcgttc gtcatgttct cctccgccgc
    cgccgtcttc 120
    ggcggcgcgg ggcagggcgc atacgccgcc gccaacgcca ccctcgacgc
    cctcgcctgg 180
    cgccgccgcg ccgccggact ccccgccctc tccctcggct ggggcctctg
    ggcagagaac 240
    agcagcatga ccggcggact gagcgacacc gaccgctcgc ggctggctcg
    ttccggggcg 300
    acgcccatgg acagcgaggt gaccctgtcc ctcctggacg cggccatgcg
    ccgcgacgac 360
    ccggcgctcg tcccgatcgc cctggacgtc gccgcgctcc gggcccagga
    gcgcgacggc 420
    atgctggcgc cgctgctcag cgggctcacc cgcgggtcgc gggccggcgg
    cgctccggtc 480
    ggccgccgca gggccgccgc cgacggcacc ggccaggcgg agagggacct
    gggcgggcgg 540
    ctcgccgcga tgaccccgga cgacaggacc gcgcacctgc gggacctcgt
    ccgtacgcac 600
    gtggcgaccg tcctgggaca cggcgccccg agccgggtcg acctggagcg
    cgccttccgc 660
    gacaccggtt tcgactccct caccgccgtc gagctccgca accgcctcaa
    cgccgccacc 720
    gggctgcgcc tcccggccac gctcgtcttc gaccacccca ctccggggga
    gctcgccggg 780
    cacctgctcg acgaactcgc cgccgccgca ggcgggtcct gggcggatga
    caccgggtcc 840
    ggctctgctt ccggctccgg ctccggctcc ggaggcgcgg tctcggctgc
    ggaccggcag 900
    accgcggcgg cactcgccga gctcgaccgg ctggaaggcg tactcgccgc
    cctcgcgccc 960
    gccgccggcg gccgtccgga gctcgccgcc cggctcaggg cgctggccgc
    ggccctgggg 1020
    gacgacggcg gcgccgccac cgaactggac gaggcgtccg acgacgacct
    cttctccttc 1080
    atcgacaagg agctgggcga atccgacttc tgacctgacc tgacccgacc
    cgaccggcgc 1140
    gacaagcgac atcagcacca gcaccagcac cacccagccc ccacacacac
    ggaacggaca 1200
    ggcgagaacg ggagccatgg cgaacaacga agacaagctc cgcgactacc
    tcaagcgcgt 1260
    taccgccgag ctgcagcaga acacccggcg tctgcgcgag atcgagggac
    gcacgcacga 1320
    gccggtggcg atcgtgggca tggcctgccg cctgccgggc ggtgtcgcct
    cgcccgagga 1380
    cctgtggcag ctggtggccg gggacggcga cgcgatctcg gagttcccgc
    aggaccgcgg 1440
    ctgggacgtg gaggggctgt acgacccgga cccggacgcg tccgggcgta
    cgtactgccg 1500
    gtccggcggg ttcctccacg acgcgggcga gttcgacgcc gacttcttcg
    ggatctcgcc 1560
    gcgcgaggcc ctcgccatgg acccgcagca gcggctgtcc ctcaccaccg
    cgtgggaggc 1620
    gatcgagcac gcgggcatcg acccgacgag cctgaagggc agcggcctcg
    gcgtcttcgt 1680
    c
    1681
    <200> SEQUENCE CHARACTERISTICS:
    <210> SEQ ID NO 8
    <211> LENGTH: 872
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces narbonensis
    <400> SEQUENCE: 8
    gagcccgagc cggtgcccgg cggcccgggc agcgtcgccg ccggccccgc
    cgcggatccg 60
    gaaccggaga cgtcgatcga cgacctcgac gccgaggccc tgatccggat
    ggctctcggc 120
    ccgcggaacg cctgagcacc cgccccggcc cgtggctgcc ccggcccttg
    cccgactgcg 180
    ggccgggccc cgggcccgca caccgccacg taccaccccg caccaccgcc
    ccccacacgc 240
    ccacaacgcc atccacgagc ggaagaccac acccagatga cgagttccaa
    cgagcagttg 300
    gtggacgctc tgcgcgcctc cctcaaggag aacgaagaac tccggaaaga
    gagccgtcgc 360
    cgggacgacc ggcggcagga gcccatggcg atcgtcggca tgagctgtcg
    gttcgcgggc 420
    ggcatccagt cccccgagga cctctgggac gcggtggccg ccggcaagga
    cctcgtatcc 480
    gacgtacctg aggagcgcgg ctgggacttc gactccctgt acgacccgga
    gcccgggcgg 540
    aagggcacga cgtacgtccg caacgccgcg ttcctcgacg acgccgccgg
    cttcgacgcc 600
    gcgttcttcg ggatctcgcc gcgcgaggcc ctcgccatgg acccgcagca
    gcggcagctc 660
    ctcgaagcct cctgggaggt cttcgagcgg gccggcatcg accccgcgtc
    ggtgcgcggc 720
    accgatgtcg gcgtgtacgt gggatgcggc taccaggact acgcgccgga
    catccgggtc 780
    gcccccgagg ggaccgacgg ttacgtcgtc accggcaact catccgccgt
    ggcctccggg 840
    cgcatcgcgt actccctcgg tctcgagggg cc
    872
    <200> SEQUENCE CHARACTERISTICS:
    <210> SEQ ID NO 9
    <211> LENGTH: 1112
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces narbonensis
    <400> SEQUENCE: 9
    gctcggcgaa ctccccgcgc cgacccgccg gcacaccgag caccgcggcc
    gccgcgcccg 60
    tcaccgccgg acggacgaaa ccccccacca actcgaaggc gtacgaagcc
    gacgggtccg 120
    gcgcgagacc ctccaggatc tgccggtgga cctcctcgac cacggcccgg
    cgctgccccg 180
    cccacgcccc cggcacctcg gcggccgccc gcggcgcctg ctcgtgctcc
    agcgggcagc 240
    cctccccgta ggagaggacc tgctgcggca ccgggacgcc gtggcacccg
    gcaccccgaa 300
    ctccgtcgag cacaggacgc tcgccgccac ggcgtgatcg gcggtgaccc
    agctgcccgt 360
    cgggctgaag gagagcacgc cccgggcgcg cacccgctcg tacgcgggat
    acggatcgtc 420
    ggcctgcccg cgcagcacgg cggcgtacgg gtcgccgttc gcggcgtgga
    tccagtggat 480
    gccgcgggtc tccaggaggt gggcaccgag ctcggggtcg gccaccgcgc
    tgacggtgcg 540
    gcccagcgga ggctgcgtga gcgcccgcgc cgggtcgtcg gtcaccgtgg
    gttctgccat 600
    cgtttcgccg ctccttcgat cagtcgggtc gggggctgca cgacgcggga
    atcgggcgcg 660
    ccgcgggtga cgagcaggtg gtcggagatg tcgttgcaga tcccgtgcca
    ctggtcgttg 720
    aggtagaagt gaccgccgga gtacgcccgc aggcagaacg gcccgctggt
    gtgccggcgc 780
    cactcggcca cctcgttcag cggcgccttc gggtcgcggt cgccggccag
    ggccatcacc 840
    gggcaggcga gcttcgcgga gggccggtgc tcgtacgtct ccgccgcctt
    gtagtcgctg 900
    cgcagcgcgg gcagcaccag ccgcatcagc tcgtcgtcct ggaggaaccg
    ctcgtccgtg 960
    ccgctgagct gccggatctc ggccaggaac gcccggtcgt ccagctggtg
    gacgagccgg 1020
    tccggtgcca gggacggggc gcgccggccg gagacgtaca ggccctcggg
    ccgtaccccg 1080
    tgccgctgtt cgaggatgcg ggccgcctcg ta
    1112
    <200> SEQUENCE CHARACTERISTICS:
    <210> SEQ ID NO 10
    <211> LENGTH: 1600
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces narbonensis
    <400> SEQUENCE: 10
    ggggacgatc cccgccgggg tggggtcgcg atgggtctcc tcgcgcagcc
    ggtgcgcggc 60
    ggcgaggacc gaggggtcgt cgaggatgcg gacgaccgcg tcccgcaccg
    cctgcggggt 120
    gaggccggca ggcggcagga agaaccccgc cccctgctcc gcgacggccc
    gcgccttgac 180
    cggcgcgtcc cacagctcgg cgagcatgac ctgcggcacc gcgttgatca
    cggcggtcgc 240
    gtacgtaccg gccccgccgt ggtggacgat cgccgaacag ctcggcagca
    gcgcgtgcat 300
    cggcacgaag tccgtgaacc gcgtgtgctt cggataggag cggatctccg
    cgcgctgacc 360
    cgcgtcgagc gtggccacga gctcgatgtc gaggtcggcg agcgcctcca
    ggatgtcggc 420
    ctgcgagacc ccgtcgccgc cgaggacctc ccgcgcggag acaccgagag
    tgaggcagac 480
    ccggggccgc gccggcggct cggcgagcca gtccggcacg accgacgtgc
    cgttgtacgg 540
    aacgtactgc accccgacgg tcggcagacc cgtgtcgaga cgcagactcg
    gcggagtcgg 600
    gtcgaccgtg aactggccgg tgagcagctc ctcttcgaag gaggcgccga
    accggtccag 660
    cgtccacgtc agccactccg ccgtggggtc ctcacggtgc tccggcggct
    gccggtcccg 720
    cagcgcgacg aacttgcggc gggcgctccc catcacgtcg ggcccccaca
    ggacccgggc 780
    gtgcgcggcg cccgtgacct gggcggcgac ggcgcccgcg tacgtcgtcg
    gctcccacag 840
    caccaggtcc ggctgccagg acctggcgaa gccgaccagg tcgtcgatca
    tcgagtcgtt 900
    gttggcgagc agatagaagt acggggcgag gatcgcgtcg atgccgaggg
    cgtggtccca 960
    gtccagcggc tcgctacggg cctcgtcgaa ggcgatcgcc ggatggttcg
    ggcgcggctc 1020
    gcccgccatc cgcacccggt actcgtggat gaggtgatcc gtgccgacgg
    gcacggccgc 1080
    gagccctgac ccggtgatgg tgtccgtgag cgcgggctgg ctcgcgaccc
    gcacctcgtg 1140
    cccggcggcg agcagcgccc aggccagggg aacgaggccg tagtagtgcg
    tgtgatgtgc 1200
    gaacgaggtc agcaggacgc gcatggcgtc gtgtccttcc ttgccggtga
    agggtcgggg 1260
    tggggaggcg gggtggggag gtcggaacgg actcaggagc cgaccgggac
    gctcagcggc 1320
    ccgcggccga caggggcgcg gcggggacgg agcacgggcc cggccttccg
    cagcccgggg 1380
    aaacgcccgg ccagggtccg cagcgcgacc tccgcctgga gccgcaccag
    cgacgccacc 1440
    gggccgtacg gaccggcggg gtgcagcgcg aggtgcgccg tggcgtcggg
    gcgcgcgagg 1500
    tcgaaacgct ccgggtccgt gaagaccccc gggtcccggc cggtgccggc
    ggtgaggacg 1560
    acgacatgcg ccccggccgg gagacgccgg cccgccagct
    1600
    <200> SEQUENCE CHARACTERISTICS:
    <210> SEQ ID NO 11
    <211> LENGTH: 3241
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces narbonensis
    <400> SEQUENCE: 11
    gcaggagtcc cgtgtacgaa gtcgaccacg ccgacgtcta cgacctcttc
    tacctcggtc 60
    gcggcaagga ctacgccgcc gaggcctccg acatcgccga cctggtgcgg
    acccgtaccc 120
    ccgaggcctc ctcgctcctg gacgtggcct gcggtacggg cacgcatctg
    gagcacttca 180
    ccaaggagtt cggcgacacc gccggcctgg agctgtccga ggacatgctg
    acccacgccc 240
    ggaagcggct gcccgacgcg acgctccacc agggcgacat gcgggacttc
    cgcctcggcc 300
    gccggttctc cgcggtggtc agcatgttca gctccgtcgg ctacctgcgg
    acgacggccg 360
    aactcgacgc ggccgtcgcc tcgttcgccg cgcacctgga gcccggcggc
    gtcgtcgtcg 420
    tcgagccgtg gtggttcccg gagaccttcg ccgacggctg ggtgagcgcc
    gatgtcgtcc 480
    ggcgggacgg gcggaccgtg gcccgtgtct cgcactcggt gcgggacggc
    gacgcgacgc 540
    gcatggaggt gcacttcacc gtggcggacc cgggccgcgg cgtacggcac
    ttctccgacg 600
    tccacctcat caccctgttc caccgggcgg agtacgaggc ggccttcacg
    gccgccgggc 660
    tgcgcgtcga gtacctggag ggcggcccgt cgggccgtgg cctcttcgtc
    ggggtccccg 720
    cctagtccct cgcccggtca ccccacacag acccccgggg cgtcccgggt
    gcaccaagca 780
    cagagagaga aatccaccgt gacaggtaag acccgaatac cgcgtgtccg
    ccgcagccgt 840
    acgaccccca gggccttcac cctggccgtc gtcggcaccc tgctggcggg
    caccaccgtg 900
    gcggccgccg ctcccggcgc cgccggcacg ggccacgtgc agtacacgag
    caaggcggcg 960
    gagctcgtcg cgcagatgac gctcgacgag aagatcagct tcgtccactg
    ggcgctggac 1020
    cccgaccggc agaacgtcgg ctaccttccg ggcgtgccgc gtctcggcat
    cccggagctg 1080
    cgcgccgccg acggcccgaa cggcatccgt ctggtgggca ggaccgccac
    cgcgctgccc 1140
    gcgccggtcg ccctggccag caccttcgac gactccatgg ccgacagcta
    cggcagggtc 1200
    atgggccgcg acggacgcgc gctgggccag gacatggttc tgggcccgat
    gatgaacaac 1260
    atccgggtgc cacacggcgg ccggaactac gagaccttca gcgaggaccc
    cctggtctcc 1320
    tcgcgcaccg cggtcgccca gatcaagggc atccagggtg cgggtctgat
    gaccacggcc 1380
    aagcacttcg cggccaacaa ccaggagaac aaccgcttca gcgtcaacgc
    cacggtcgac 1440
    gagcagacgc tccgcgagat cgagttcccg gcgttcgagg cgtcctcgaa
    ggccggcgcg 1500
    gcctccttca tgtgtgccta taacggcgtc aacggcaagc cgtcctgcgg
    caacgacgag 1560
    ctgctcaaca acgtgctgcg cacgcagtgg ggcttccagg gctgggtgat
    gtccgactgg 1620
    ctcgccaccc cgggcacgga cgccatcacc aagggcctcg accaggagat
    gggcgtcgag 1680
    ctccccggcg acatcccgcc gggcgagccc tcgccgccgg ccaagttctt
    cggtgacgcg 1740
    ctgaagcagg ccgtcctgaa cggcacggtc cccgaggcgg ccgtgacgcg
    gtcggcggag 1800
    cgcatcgtca accagatgga caagttcggt ctgctcctcg cgactccggc
    gccccgcccc 1860
    gagcgtgaca aggcgggcgc ccaggcggtg tcccgcaagg tcgccgagaa
    cggcgcggtg 1920
    ctcctgcgca acgagggcca ggccctgccg ctcgccggtg acgccggcaa
    gagcatcgcc 1980
    gtcatcggcc cgacggccgt cgaccccaag gtcaccggcc tgggcagcgc
    ccacgtcgtc 2040
    ccggactcgg cggcggcgcc gctcgacacc atcaaggccc gcgcgggcgc
    gggtgcgacg 2100
    gtgacgtacg agacgggtga ggagaccttc gggacgcgga tcccggcggc
    gcagctcagc 2160
    ccggcgttca accagggcca ccagctggag ccgggcaagg cgggggcgct
    gtacgacggc 2220
    acgctgaccg tgcccgccga cggcgagtac cgcatctcgg tcaaggccac
    cggtggctac 2280
    gcgacggtgc agctcggcag ccacaccatc gaggccggtc aggtctacgg
    caaggtgagc 2340
    agcccgctcc tcaagctgac caagggcacg cacaagctca cgatctcggg
    cttcgcgatg 2400
    agcgccacgc cgctctccct ggagctgggc tgggtgacgc cggaggcagc
    cgacgcgacg 2460
    atcgcgaagg ccgtggagtc ggcgcggaag gcccgtacgg ccatcgtgtt
    cgcgtacgac 2520
    gacggcaccg agggcgtcga ccgtccgaac ctgtcgctgc cgggtacgca
    ggacaagctg 2580
    atctcggcgg tcgccgacgc gaacccgaac acgatcgtgg tcctcaacac
    cggttcgtcg 2640
    gtgctgatgc cgtggctgtc caagacccgc gcggtcctgg acatgtggta
    cccgggccag 2700
    gcgggcgccg aggcgaccgc cgcgctgctc tacggtgacg tgaacccgag
    cggcaagctc 2760
    acgcagagct tcccggccgc cgagaaccag cacgccgtcg ccggcgaccc
    gaaccgctac 2820
    ccgggcgtcg acaaccagca gacgtacagc gagggcatcc acgtcgggta
    ccgctggttc 2880
    gacaaggaga acgtcaagcc gctgttcccg ttcgggcacg gcctgtcgta
    cacctcgttc 2940
    acgcagagcg ccccgaccgt ggtgcgcacg tccacgggcg gcctgaaggt
    cacggtcacg 3000
    gtgcgcaaca gcgggcagcg cgcgggccag gaggtcgtcc aggcgtatct
    cggcgcgagc 3060
    ccgaaggtga cggctccgca ggcggagaag aagctcgtgg gctacacgaa
    ggtcgcgctc 3120
    gcggcgggcg agtcgaagac ggtgacggtg aacgtcgacc gccgtcagct
    gcagtactgg 3180
    gacgccgcgt cggactcgtg gaggacggga acgggcagca ggctcctcca
    gaccggttcg 3240
    t
    3241
    <200> SEQUENCE CHARACTERISTICS:
    <210> SEQ ID NO 12
    <211> LENGTH: 1476
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces narbonensis
    <400> SEQUENCE: 12
    gggggtgatc gccttctcga cgagcagcgg gtcgagggtg gggtggtcct
    cgttcggctc 60
    gacgggcacg ggggtcgcgc cggtggcgga gaccgcgagc cagctggcga
    tgtacgtgtg 120
    cgaggggacg atcacctcgt ccccgggtcc gatgccgagg ccgcggagcg
    cgagctggag 180
    ggcgtccatg ccgctgttca cgccgacggc gtggtcggtc tcgcagtagg
    tggcgaactc 240
    ggcttcgaag gcttcgagtt cggggccgag gaggtagcgc cccgagtcga
    gtacgcgggc 300
    gatggcggcg tcggtctccg ggcgcagttc ctcgtaggcg gccttgaggt
    cgaggaaggg 360
    gacccggccg gtctcggtgc gggcggtcac gcggacaccc ccacggcggt
    ggcgggcggc 420
    tgcggggcgg tggcgggcgg ctgcggggcg gtggccttga gcggttccca
    ccagtcgcgg 480
    ttctcccggt accagcggat ggtgcgcgcg aggccgtccg cgaaggcgat
    ctgcgggcgg 540
    tagccgagtt cgcgctcgat cttgccgccg tcgagggagt agcgcaggtc
    gtggccctgg 600
    cggtcggcga cccgccggac cgaggaccag tcggcgccga gcgagtccag
    gaggatgccg 660
    gtgagttcgc ggttggtcag ctcccggccg ccgccgatgt ggtagacctc
    gccggcccgg 720
    ccgcccgcga ggacgagcgc gatgccccgg cagtggtcgt cggtgtggac
    ccactcgcgg 780
    acgttcgcgc cgtcgccgta cagcgggagc gtcccgccgt cgaggaggtt
    cgtcacgaag 840
    agggggatga gcttctcggg gtgctggtac ggcccgtagt tgttgcagca
    gcgggtgatc 900
    cgtacgtcga ggccgtaggt gcggtggtag gcgcgggcga cgaggtcgga
    gccggccttg 960
    gaggccgcgt agggggagtt gggttccagc gggctgctct cgttccacga
    gccggagtcg 1020
    atcgacccgt acacctcgtc ggtggagacg tgcacgaccc ggccgacgcc
    ggcgtcgagg 1080
    gcgcactgga gcagggtctg cgtgccctgg acgttggtcc cggtgaacac
    ggacgccccc 1140
    gcgatggagc ggtcgacgtg gctctcggcg gcgaagtgga cgacggcgtc
    gacgccgcgc 1200
    agttcccggg cgaggaggtc ggcgtcgcgg atgtcgccgt ggacgaaccg
    cagccgcggg 1260
    tccgcttcca ccggggcgag gttggcgcgg ttgcccgcgt aggtgaggct
    gtccaggacg 1320
    atcacctcac cggcggggac gtcggggtac gccccggcga ggagctgccg
    cacgaagtgc 1380
    gagccgatga agcccgcacc tccggtcacc agaagccgca ctgccgtctt
    cctttcggtc 1440
    gcgctgtcgg tggcactgcc ggtggtgggg ggaacg
    1476
  • References [0286]
  • Andersen, J. R., Hutchinson, C. R. [0287] J. Bacteriol., 174:725-735 (1992).
  • Aparicio, J. F., Molnar, I., Schwecke, T., Konig, A., Haydock, S. F., Khaw, L. E., Staunton, J., Leadlay, P. F. [0288] Gene, 169:9-16 (1996).
  • Arisawa, A., Kawamura, N., Takeda, K., Tsunekawa, H., Okamura, K., Okamoto, R. [0289] Appi. Environ. Microbiol., 60:2657-2660 (1994).
  • August, P. R., Tang, L., Yoon, Y. J., Ning, S., Muller, R., Yu, T. W., Taylor, M., Hoffmann, D., Kim, C. G., Zhang, X., Hutchinson, C. R. & Floss, H. G. [0290] Chem. Biol., 5:69-79 (1998).
  • Baltz, R. H., Seno, E. T. [0291] Annu. Rev. Microbiol., 42:547-574 (1988).
  • Bibb, M. J., Bibb, M. J., Ward, J. M., Cohen, S. N. [0292] Mol. Gen. Genet., 199:26-36 (1985).
  • Bierman, M., Logan, R., O'Brien, K., Seno, G., Nagaraja, R., Schoner, B. E. [0293] Gene, 116:43-49 (1992).
  • Box, R. P. [0294] Clin. Infect. Dis., 24:S151 (1997).
  • Cane, D. E., Lambalot, R. H., Prabhakaran, P. C., Ott, W. R. [0295] J. Am. Chem. Soc., 115:522-526 (1993).
  • Carreras, C. W., Pieper, R., Khosla, C. In [0296] Bioorganic Chemistry Deoxysugars, Polyketides & Related Classes: Synthesis, Biosynthesis, Enzymes, Rohr, J. (ed.), Springer:Berlin, 85-126 (1997).
  • Castle, L. A., Smith, K. D., Morris, R. O. [0297] J. Bacteriol., 174:1478-1486 (1992).
  • Celmer, W. D., Nagel, A. A., Wadlow, J. W., Tatematsu, H., Ikenaga, S., Nakanishi, S. Abstracts of Papers of 24th Intersci. Conf. on Antimicrob. Agents Chemother., No. 1142, Washington, D. C. (1985). [0298]
  • Cortes, J. Haydock, S. F., Roberts, G. A., Bevitt, D. J., Leadlay, P. F. [0299] Nature, 348:176-8 (1990).
  • Cortes, J., Wiesmann, K. E., Roberts, G. A., Brown, M. J., Staunton, J., Leadlay, P. F. [0300] Science, 268:1487-9 (1995).
  • Cundliffe, E. C. [0301] Annu. Rev. Microbiol., 43:207-233 (1989).
  • Cundliffe, E. [0302] Antimicrob. Agents Chemother., 36:348-352 (1992).
  • Davies, J. [0303] Nature, 383:219-220 (1996).
  • Djerassi, C., Zderic, J. A. [0304] J. Am. Chem. Soc., 78:6390-6395 (1956).
  • Donadio, S., McAlpine, J. B., Sheldon, P. J., Jackson, M., Katz, L. [0305] Proc. Natl. Acad. Sci. U.S.A., 90:7119-7123 (1993).
  • Donadio, S., Staver, M. J., McAlpine, J. B., Swanson, S. J., Katz, L. [0306] Science, 252:675-9 (1991).
  • Donadio, S., Katz, L. [0307] Gene, 111:51-60 (1992).
  • Donin, M. N., Pagano, J., Dutcher, J. D., McKee, C. M. [0308] Antibiotics Annu., 1:179-185 (1953-1954).
  • Epp, J., Huber, M. L. B., Tuner, J. R., Goodson, T., Schoner, B. E. [0309] Gene, 85:293-301 (1989).
  • Flinn, E. H., Sigal, M. V., Jr., Wiley, P. F., Gerzon, K. [0310] J. Am. Chem. Soc., 76:3121-3131 (1954).
  • Gaisser, S., Bohm, G. A., Cortes, J., Leadlay, P. F. [0311] Mol. Gen. Genet., 256:239-251 (1997).
  • Gandecha, A. R., Large, S. L., Cundliffe, E. [0312] Gene, 184:197-203 (1997).
  • Geistlich, M., Losick, R., Turner, J. R., Rao, R. N. [0313] Mol. Microbiol., 6:2019-2029 (1992).
  • Haydock, S. F., Dowson, J. A., Dhillon, N., Roberts, G. A., Cortés, J., Leadlay, P. F. [0314] Mol. Gen. Genet., 230:120-128 (1991).
  • Hernandez, C., Olano, C., Mendez, C., Salas, J. A. [0315] Gene, 134:139-140 (1993).
  • Hopwood, D. A., Sherman, D. H. [0316] Annu. Rev. Genet., 24:37-66 (1990).
  • Hopwood, D. A., Malpartida, F., Kieser, H. M., Ikeda, H., Duncan, J., Fujii, I., Rudd, B. A., Floss, H. G., Omura, S. [0317] Nature, 314:642-644 (1985).
  • Hopwood, D. A., Bibb, M. J., Chater, K. J., Kieser, T., Bruton, C. J., Kieser, H. M., Lydiate, D. J., Smith, C. P., Ward, J. M., Schrempf, H., [0318] Genetic Manipulation of Streptomyces: A Laboratory Manual (The John Innes Foundation) (1985).
  • Hori et al., [0319] Chem. Comm., 304 (1971).
  • Hutchinson, C. R., Fujii, I. [0320] Annu. Rev. Microbiol., 49:201-238 (1995).
  • Ingrosso, D., Fowler, A. V., Bleibaum, J., Clarke, S. [0321] J. Biol. Chem., 264:20130-20139 (1989).
  • Jacobsen, J. R., Hutchinson, C. R., Cane, D. E., Khosla, C. [0322] Science, 277:367-369 (1997).
  • Jenksins, G., Cundliffe, E. [0323] Gene, 108, 55-62 (1991).
  • Kakavas, S. J., Katz, L., Stassi, D. [0324] J. Bacteriol., 179:7515-22 (1997).
  • Katz, L., Donadio, S. [0325] Annu. Rev. Microbiol., 47:875-912 (1993).
  • Katz, L., [0326] Chem. Rev., 97:2557-2575 (1997).
  • Khosla, C., [0327] Chem. Rev., 97:2577-2590 (1997).
  • Khosla, C., Zawada, R. J. [0328] Trends Biotechnol., 14:335-341 (1996).
  • Kirschning, A., Bechthold, A. F.-W., Rohr, J. In [0329] Bioorganic Chemistry Deoxysugars, Polyketides & Related Classes: Synthesis, Biosynthesis, Enzymes, Rohr, J. (ed.), Springer:Berlin 1-84 (1997).
  • Kramer, P. J., Khosla, C. [0330] Annu. N.Y. Acad. Sci., 799:32-45 (1996).
  • Kuo, M.-S., Chirby, D. G., Argoudelis, A. D., Cialdella, J. I., Coats, J. H., Marshall, V. P. [0331] Antimicrob. Agents Chemother., 33:2089-2091 (1989).
  • Lambalot, R. H., Cane, D. E. [0332] J. Antibiot., 45:1981-1982 (1992).
  • Lin, E. C. C., Goldstein, R., Syvanen, M. [0333] Bacteria, Plasmids, and Phages, An Introduction to Molecular Biology, Harvard University Press:Cambridge, p.123 (1984).
  • Liu, H.-w., Thorson, J. S. [0334] Annu. Rev. Microbiol., 48:223-256 (1994).
  • Madduri, K., Kennedy, J., Rivola, G., Inventi-Solari, A., Filippini, S., Zanuso, G., Colombo, A. L., Gewain, K. M., Occi, J. L., MacNeil, D. J., Hutchinson, C. R. [0335] Nature Biotech., 16:69-74 (1998).
  • Mangahas, F. R. MS Thesis, University of Minnesota, 1996 . [0336]
  • Marahiel, M. A., Stachelhaus, T., Mootz, H. D., [0337] Chem. Rev., 97:2651-2673 (1997).
  • Marsden, A. F. A., Wilkinson, B., Cortes, J., Dunster, N. J., Staunton, J., Leadlay, P. F. [0338] Science, 279:199-201 (1998).
  • Merson-Davies, L. A., Cundliffe, E. [0339] Mol. Microbiol., 13:349-355 (1994).
  • Merson-Davies, L. A., Cundliffe, E. [0340] Mol. Microbiol., 13:347-355 (1994).
  • Motamedi, H., Cai, S. J., Shafiee, A., Elliston, K. O. [0341] Eur. J. Biochem., 244:74-80 (1997).
  • Muth, G., Nubhaumer, B., Wohlleben, W., Puhler, A. [0342] Mol. Gene. Genet., 219:341-348 (1989).
  • Niemi, J., Mantsala, P. [0343] J. Bacteriol., 177:2942-2945 (1995).
  • Omura, S. (ed.) [0344] Macrolide Antibiotics, Chemistry, Biology, and Practice, Academic Press:New York (1984).
  • Omuras et al., [0345] J. Antibio., 29, 316 (1971).
  • Sambrook, J., Fritsch, E. F., Maniatis, T. [0346] Molecular Cloning: A Laboratory Manual (Cold Spring Harbor Laboratory Press), 2nd edition (1989).
  • Sasaki, J., Mizoue, K., Morimoto, S., Omura, S. J. [0347] Antibiotics, 49:1110-1118 (1996).
  • Schneider, A., Marahiel, M. A., [0348] Arch. Microbiol., 169:404-410 (1998).
  • Schupp, T., Toupet, C., Cluzel, B., Neff, S., Hill, S., Beck, J. J., Ligon, J. M., [0349] J. Bacteriol., 177:3673-9 (1995).
  • Schwecke, T., Aparicio, J. F., Molnar, I., Konig, A., Khaw, L. E., Haydock, S. F., Oliynyk, M., Caffrey, P., Cortes, J., Lester, J. B., et al. [0350] Proc. Natl. Acad. Sci. U.S.A., 92:7839-7843 (1995).
  • Seo, S., Tomita, Y., Tori, K., Yoshimura, Y. [0351] J. Am. Chem. Soc., 100:3331-3339 (1978).
  • Service, R. F. [0352] Science, 270:724-727 (1995).
  • Stassi, D., Donadio, S., Staver, M. J., Katz, L. [0353] J. Bacteriol., 175:182-189 (1993).
  • Staunton, J., Wilkinson, B., [0354] Chem. Rev., 97:2611-2629 (1997).
  • Summers, R. G., Donadio, S., Staver, M. J., Wendt-Pienkowski, E., Hutchinson, C. R., Katz, L. [0355] Microbiology, 143:3251-3262 (1997).
  • Swan, D. G., Rodriguez, A. M., Vilches, C., Mendez, C., Salas, J. A. [0356] Mol. Gen. Genet., 242:358-362 (1994).
  • Tuan, J. S., Weber, J. M., Staver, M. J., Leung, J. O., Donadio, S., Katz, L. [0357] Gene, 90:21-29 (1990).
  • Vilches, C., Hernandez, C., Mendez, C., Salas, J. A. [0358] J. Bacteriol., 174:161-165 (1992).
  • von Heijne, G. [0359] Nucleic Acids Res., 14:4683-4690 (1986).
  • von Heijne, G., Abrahmsen, L. [0360] FEBS Lett., 244:439-446 (1989).
  • Weber, J. M., Leung, J. O., Swanson, S. J., Idler, K. B., McAlpine, J. B. [0361] Science, 252:114-117 (1991).
  • The complete disclosure of all patents, patent documents and publications cited herein are incorporated herein by reference as if individually incorporated. The foregoing detailed description and examples have been given for clarity of understanding only. No unnecessary limitations are to be understood therefrom. The invention is not limited to the exact details shown and described for variations obvious to one skilled in the art will be included within the invention defined by the claims. [0362]
  • 0
    SEQUENCE LISTING
    <160> NUMBER OF SEQ ID NOS: 55
    <210> SEQ ID NO 1
    <211> LENGTH: 1590
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces narbonensis
    <400> SEQUENCE: 1
    acaggggata tcccgctcca ggcgaacggt agccgcgtgc cctcgccgaa cgccccgccc 60
    gcaccggccg cctgcacggc ggcgtcgagc agcgccgggt ggaggccgaa ccgcgcgccc 120
    tcggcgcccg cgacctccgt cggcagggcc acgtcggcga acacctcttc gccgcgccgc 180
    cagacgccac ggacgccccg gaagaggggc ccgtagccgt atccgctcgc cgcgaagcgg 240
    tcgtacagac cgtccacgtc cactgcttcg gcacccgccg ggggccaggc ctccgggtcg 300
    gcgacagggg cggtgcgatc cgtacgggcg agcacaccgg tcgcgtgccg cgtccactcc 360
    ggctcgcccg gcgcgtcctc cgggtgcgcg tggagcacga aggtacggcg cccggactcg 420
    tcgctcgcgc cgacggacag ctgcacgcgg accgcgccgc gacggggcag gacgagcggg 480
    gcgtcgaggg tgagctcctc gaccagatcg cagccgacct ggtcaccggc ccggaaggcc 540
    agctccacga acgccgttcc cggcagcagc accgtgccgg ccaccgcgtg gtccgccagc 600
    caggggtgcg tacggaggga gaggctcccc gtgagcaggc agccgtcgga gtcggcgagc 660
    gcgacggccg cgccgagcag cgggtgctcg gccgccccga gaccggcgga cgtgatgtca 720
    ccgacggcgg agtgctcggg ccgcggccag tagcgctcgg tctggaaggc gtaggtgggg 780
    aggtcgggga ggtcggcgtt cgtcgcgttc ttcgtggtcg tggtggggag gacgggtgtc 840
    cagtcgaggg ggaggccgtt ggtccaggcc tcggcgagcg aggtgaccag acgctcctgg 900
    ccgccgtcct cgcggcggag ggtgccgagg ccggtgacgg tgtcggggag ggccatggtg 960
    aggacggggt gggcgctgac ctcgacgaag tgggtgaacc cttcgtcggt ggcgagggtt 1020
    tcgacggcgg gggcgaagcc gacggggtgg cggaggttgc ggtaccagta cgtggcgtcg 1080
    agggcgggtt cggtgatcca ggcaccgtcg agcgtggaga agaaggggac gcgcggagcg 1140
    tgcggggtga gtccggcgag gacgtcggcg agctcgttct cgatggtctc gacgtgggcg 1200
    ctgtgggagg cgtagtcgac ggggatgatc cgcgcgcgga tgccgtcggc cttgcaggtc 1260
    ttcgcgagct cttcgatctg tgcggggtcg ccggagacca cggtggcggt ggggccgttg 1320
    acggcggcga tcgacagtcc gtcgagggtg tcgatccgct ccaggacgtc ggcctggctg 1380
    agggcgaggg agaccatgcc gcccctgccg gcgaggtgag cggcgatgga ccggctgcgt 1440
    agggcgacga cgcgggcggc atcctccagg ctcagtgccc cggcgacgta cgcggcggcg 1500
    atctcgccct gggagtggcc gatgacggcc tggggggtga tgccgtggtg ctgccagatc 1560
    ttcgcgaggg agaccatgac ggcgaaggtg 1590
    <210> SEQ ID NO 2
    <211> LENGTH: 1419
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces narbonensis
    <400> SEQUENCE: 2
    cgggctggac gacgtcgacg cggtcgagcg tcggggcgcc gggagcctgt cgtacgacgg 60
    cttcgaggga ccagtcgacg tgacgggaga gcgcggtctc gcacgcggcc atctccgccg 120
    cgaactccgc agaggagtcc agcagttcgg cacccatccc ggaccactgc gtgccctggc 180
    cggggaacac gaacgccacg cgcccgacag cggaagccgt gccacgaatc agcccgtccg 240
    ggtcggccag ggcctgtacg aggtcgcccg ccccggtgcc cagcgcgacg gcccggtgct 300
    cgaactgcgc ccgcccgtcg gccagtacgc gggcgacggc gccggcgtcg acgtcatccg 360
    tacgcccctg agaggcgtac gcggcgagcc gctcgatctg ggcgtcgagt gcaccggcgg 420
    acttcgccga caccacccac ggcaccacgc cacccgacga cggctcgtcc acggcggtgt 480
    tttccaccgt cggggcctct tcgaggacga cgtgagcgtt cgtcccgctg atgccgaagg 540
    aggagacggc ggcgcggcgc agcccgccgt cctgcttctc cggccagtcc acggcctcgg 600
    tgaggagttc cacggcaccg gccgaccagt cgatctggtc cgagggggcg tccacgtgaa 660
    gcgtcttcgg gagtagcccg tggcgcatcg cctggaccat cttgatgaca ccggcgacac 720
    cggccgcggc ctgggtgtgc ccgatgttgg acttcaacga tccgagcagc aacggacgtt 780
    cgccgccccg gtcctgcccg taggtggcga tcagggcctg cgcctcgatc gggtcgccga 840
    gccgcgtccc cgtgccgtgc gcctcgacga catcgacctc gcccggcgtg agccgggcgt 900
    cggccagggc ccgccggatg acgcgctgct gcgacggccc gttcggagcc gtgagaccgt 960
    tgctggcgcc gtcctggttc acggcgctgc cgcggacgac cgcgaggacc cggtgtccgt 1020
    ggcggcgggc gtccgacagg cgctcgacga ggaggacacc gacaccctcg gaccaactgg 1080
    tgccgtccgc cgacgcggcg aacgccttcg accgaccgtc cccggccagc ccgcgctgcc 1140
    ggctgaactc cacgaacatc cccggcgtgg gcatcacggc cacgccgccg gcgagcgcca 1200
    tgtcgacctc gcccttgcgc agggcctgca cggcgaggtg cagggcgacc agcgacgacg 1260
    agcaggcggt gtccaccgtc agggcggggc cctcaaggcc gagcgtgtac gagacgcggc 1320
    ccgacatcac gctggccgtg ttgccggtca gcaggtatcc gtcgaggccc tccccgccgt 1380
    cgcgcaggct cggcccgtac tcgtgggtca tcgccccgg 1419
    <210> SEQ ID NO 3
    <211> LENGTH: 1434
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces narbonensis
    <400> SEQUENCE: 3
    gaacccgtcg gcgtccgccg agaaggcctt gctccggccg tccggggcga gcgcccgctg 60
    ccggctgaac tccacgaaca tgtgcggggt cgccatcatc gccacaccac cggcgagtgc 120
    catcgagcat tcaccgctcc gcagcgcccg caccgccagg tgcagggcgg tcagcgagga 180
    cgagcaggcg gtgtcgacgg tcgtcgcggg cccttcgaga ccgaaggtgt acgcgatgcg 240
    gccggacgcg acgctcggcg tgctgccggt cagcaggtaa ccctccacgc cgcgcggggc 300
    gttcgggacg cgggccgcgt agtcctggta ggagaggccg atgaagacac cggtgctgct 360
    gccgcgcagc gagcccggct cgatgccggc ccgctcgaac gcctcccagg acgtcgccag 420
    gagcatccgc tgctgcgggt ccatggcgag cgcctcgcgc ggcgagacac cgaagaactc 480
    cgcgtcgaac tcggccgcgt cgtgcaggaa cccgccctcg cggacgtacg ccttgccgag 540
    cgcgtccggg tcggcgtcgt acaggccgtc gaggtcccag ccccggtcgg tggggaaggg 600
    cgtgatgccc tcgccgccct cggccagcat ccgccacagg tcctcagggc tgcggatgcc 660
    accggggtat cggcagctca tggcgacgat cgcgatcgga tcgtcgtcga caccgagacc 720
    gacaccgaga ccgagaccga caccgagacc gacaccggat ccgccaccga caccggatcc 780
    gccaccgaga ccagcaccag ctccgccacc gagaccagca ccagctccgg caccgagacc 840
    agcgccgaca gcccgcgtcc ccctggccca cgtggactcc gccgccgcgt cctcgtcacc 900
    gaggaactcg gcacggagca gtgacgcgag ggccagcggc gtcgggtggt cgaagacgag 960
    cgtcgcgggc aaggggagcc cggtcgcccg ggtcagccgg ttgcggagct cgactccggc 1020
    gagcgagtcg aagccgatgt ccttgaaggc ccggtcggcg gcgacgtcct caggtgaacg 1080
    catccggagc acggcggcgg cctgggcccg tacgagaccg aggaggatct ccgtacgctc 1140
    gccgggagcc gcggcggcca gccgctcggc cagcgggttc ccgcccgcgg cggagctgcc 1200
    gcccggcccg gccggggcgc tctcccgcgc gtcgatgatg cgccgcacct cgggcagctc 1260
    ctcgacgagg ggctgagggc ggccggagga gtacgcgagg tagaaacggt cccagtcgat 1320
    gtccgcgacg gtgatcgcgg tctcgtcccg gccgagggcg gactccagtg cggtcagggc 1380
    gagttccggg tccatgccgg gtacgccgtg atcgcgcagg cgctcggcca cccc 1434
    <210> SEQ ID NO 4
    <211> LENGTH: 1462
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces narbonensis
    <400> SEQUENCE: 4
    agcgggccag gccggagccg gggaccggga ccgggacgtg tccacgccgt ccaggagcac 60
    cgcccacacg gatgccctgc tggcacaact caccaggctg gaaggcgcct tggtgctgac 120
    gggcctcccg ggcgcccccg ggagcgaaga agtcctggag cacctgcgct cccttcgcgc 180
    gatggtcacg ggcgagaccg ggagcgggac cggggccgga agcgggggcg ggggcgcgtc 240
    cgcggaatcc gggggcggag acccctacta cgccgacggg ggcgggagtg aggaccgcgc 300
    gggagtgccg gacttcatga acgcctcggc cgaggaactc ttcggcctcc tcgacatgga 360
    ccccagcacg gactgatccc tgccgcacgg ccgcctcccg ccccgggccc cgtccgagac 420
    cccgtcccgg acccgtcccg ggcacctcga ctcgaatcac ttcatgcgcg cctcgggcgc 480
    ctccaggaac tcaaggggac agcgtgtcca cggtgaacga agagaagtac ctcgactacc 540
    tgcgtcgcgc cacggcggac ctccacgagg cccgcggccg cctccgcgag ctggaggcca 600
    gggcgggcga gccggtggcg atcgtcggca tggcctgccg cctgccgggc ggtgtcgcct 660
    cgccggagga cctgtggcgg cttgtggccg gtggcgagga cgcgatctcg gagttcccgc 720
    aggaccgcgg ctgggacgtg gaggggctgt acgacccgaa cccggaggcc acgggcagga 780
    gttacgcccg tgaggccgga ttcctgtacg aggcgggcga gttcgacgcc gacttcttcg 840
    ggatctcgcc gcgcgaggcc ctcgccatgg acccgcagca gcggctcctc ctggaggcct 900
    cctgggaggc gttcgagcac gccggcatcc cggcggccag tgcgcgcggc acgtcggtcg 960
    gcgtcttcac cggcgtgatg taccacgact acgcgacccg tctcaccgac gtccccgagg 1020
    gcatcgaggg ctacctgggc accgggaact ccggcagcgt cgcctcgggc cgggtcgcct 1080
    acacgctggg cctggagggc ccggccgtca cggtcgacac ggcctgctcg tcctcgctcg 1140
    tcgccctgca cctcgccgtg caggccctgc gcaagggcga ggtcgacatg gcgctcgccg 1200
    gcggcgtgac ggtcatgtcg actcccagca ccttcgtcga gttcagccgc cagcgcggac 1260
    tggcccccga cggccggtcg aagtccttct cgtcgacggc ggacggcacc agctggtccg 1320
    agggcgtcgg cgtcctcctc gtcgagcgcc tgtcggacgc ccgtcgcaag ggccaccggg 1380
    tgctcgccgt ggtccggggc acggccgtca accaggacgg cgcgagcagc ggcctcaccg 1440
    ccccgaacgg cccgtctcag ca 1462
    <210> SEQ ID NO 5
    <211> LENGTH: 1881
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces narbonensis
    <400> SEQUENCE: 5
    ggtgctccag ggcggcgacc ctgcccatgc cccacaccat ggcctgggcg ggggaggaga 60
    tgtggtcggc gcggccgacg gacaccgcgc cacgggtgac gcaccacagc ggagcggcga 120
    caccggcgtc ctccagcgcc tgcaccaggg tgagggtggc gccggtgccc cgggtgaagg 180
    gggcggggtg gccggggtgc gcgtcctcgt cccaggcgag cagcgagacg acaccgccga 240
    cggctccacc ggccgccgcc agggcttcgc ccagcgcctc cgtgagccgc tgccggtcgc 300
    tcggtgcgga cacgtccagc cgtacggggt cggcgcccgc accggacagc gcggcgagca 360
    ccggggcggc ctcggaggac cggccctcgg gggcgacgac gagccagcga ccggacaggc 420
    cggggctctc ggtgccctcg gcgaccgcga gccgcttcca gtcgacgcgg tagcgccagg 480
    agtcctgcac ggagccctgg gcggcggggg agtcgtggag ccagtagtga cggcgctgga 540
    aggcgtaggt ggggaggtcg gggaggtcgc cggtcgcggc cgggaggacg ggcgcccagt 600
    cgacggtgag gccgtgggcc caggcttcgg cgagggaggt gatcaggcgg tcgaggccgc 660
    cttgttcgcg gcggagggtg ctgaggcctg tgacggtgtc ggggagggcc atggtgagga 720
    cggggtgggc ggagacctcg atgaagtggg tgaagccttc ggttgtggcg agggtttcga 780
    tggcgggggc gaagccgacg gggtggcgga ggttgcggta ccagtaggtg gcgtcgaggg 840
    cgggttcggt gatccaggtg ccttcgaggg tggagaagaa ggggacgcgc ggagcgtgcg 900
    gggtgagtcc ggtgaggacg tcggcgagct cgttctcgat ggtctcgacg tgggcgctgt 960
    gggaggcgta gtcgacgggg atgacccgcg cgcggacccc gtccgccttg cacgtacggg 1020
    cgagctcctc gatctgtgcg gggtcgcccg aaacgacggt ggcggtgggc ccgttgaggg 1080
    cggcgacgga cagcccgtcg aggttctgga tccgctccag gacgtcggtc tggctgaggg 1140
    cgagggagat catgccgccc ttgccggcga ggtgagcggc gatggaccgg ctgcgtaggg 1200
    cgacgacgcg ggcggcatcc tccaggctca gtgccccggc gacgtacgcg gcggcgatct 1260
    cgccttgcga gtgcccgatg acggcctgcg gggtcacgcc gtggtgctgc cagagcttgg 1320
    ccagcgagac catgacggcg aaggtgacgg gctgcaccac atcgacgcgg tcgagcgtgg 1380
    gggcgccggg tgtctgccgg acgacggcct ccagtgacca gtccacatac ggcgcgagcg 1440
    cggcctcgca ctcggccatc gtctccgcga actccttcga cgtgtcgagg agttcggctc 1500
    ccattccggc ccactgcgtg ccctggccgg ggaagacgaa cgccacccgg cccacgtccg 1560
    tggacgttcc ccgtatcagc ccttccggag cggtcagcgc ctgtgcgaag tcgcccgtcc 1620
    cggtgccgat cgcgacggcc cggtgctcga actgcgcgcg cccgtcggcc agtacgcggg 1680
    cgacggcgcc ggcgtcgacg tcatccgtac cgccctgcga ggcgtacgcg gcgaggcgcc 1740
    cgatctgggc gtccagcgcg gccggagact tcgccgagac cagccacggc accaggccgc 1800
    cggcggacgg ctcgacggcc ggggtctcgt ttgtcagggt ctcgtccgcc ggggtctcga 1860
    cgacccccgg ggcctcttcg a 1881
    <210> SEQ ID NO 6
    <211> LENGTH: 897
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces narbonensis
    <400> SEQUENCE: 6
    ggcccggcgg ccctggacct catggccacc gtcctcgccg gcggtaccgg tgaggaccag 60
    gtcgccgtgc gcgcctccgg gctgctcgcc cgccgcctcg tccgcgccgc cctccccgct 120
    cacgggacgg cttcgccgtg gtggcaggcc gacggcacgg tgctcgtcac cggtgccgac 180
    gagccggccg ccgccgaggc cgcgcgccgc ctggcccgcg acggcgccgg acacctcctc 240
    ctccacaccg gccccgtggc gggtacggag gactccgacc ccaccgaccc caccgacccc 300
    accgacccca ccggcctcac cggcctcgtc gccgagctcg ccgacctcgg cgcgacggcc 360
    accgtcgtgt cctgcgacct cacggaccgg gaggcggccg cccggctgct cgccggcgtc 420
    tccgacgagc acccgctcag cgccgtcctc cacctgccgc ccaccgtcga ctccgagccg 480
    ctcgccgcca ccgacccgga cgcactcgcc cgcgtcgtaa ccgcgaaggc caccgccgcg 540
    ctgcacctgg acagcctgct gcgggagtcc gcggcggccg gacgccgtgc acccgtcctc 600
    gtcctcttct cctcggtcgc cgcgacctgg ggcggcgccg gacagggcgc gtacgccgcc 660
    ggtacggcct tcctcgacgc cctcgccggt cagcaccgtg ccgaagggcc caccgtgacc 720
    tccgtggcct ggagcccctg ggagggcagc cgcgtcaccg agggcgcgac cggggagcgg 780
    ctgcgccgcc tcggcctgcg ccccctcgct cccgcgacgg cgctcaccgc cctggacacc 840
    gcactcggcc acggcgacac ggccgtcacg atcgccgacg tcgactggtc gagcttc 897
    <210> SEQ ID NO 7
    <211> LENGTH: 1681
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces narbonensis
    <400> SEQUENCE: 7
    acgtgggaac acgtcctgcg tcccaaggtc gacgcggcgt tcctcctcga cgagctgacc 60
    tccacacccg cccacgacct ggccgcgttc gtcatgttct cctccgccgc cgccgtcttc 120
    ggcggcgcgg ggcagggcgc atacgccgcc gccaacgcca ccctcgacgc cctcgcctgg 180
    cgccgccgcg ccgccggact ccccgccctc tccctcggct ggggcctctg ggcagagaac 240
    agcagcatga ccggcggact gagcgacacc gaccgctcgc ggctggctcg ttccggggcg 300
    acgcccatgg acagcgaggt gaccctgtcc ctcctggacg cggccatgcg ccgcgacgac 360
    ccggcgctcg tcccgatcgc cctggacgtc gccgcgctcc gggcccagga gcgcgacggc 420
    atgctggcgc cgctgctcag cgggctcacc cgcgggtcgc gggccggcgg cgctccggtc 480
    ggccgccgca gggccgccgc cgacggcacc ggccaggcgg agagggacct gggcgggcgg 540
    ctcgccgcga tgaccccgga cgacaggacc gcgcacctgc gggacctcgt ccgtacgcac 600
    gtggcgaccg tcctgggaca cggcgccccg agccgggtcg acctggagcg cgccttccgc 660
    gacaccggtt tcgactccct caccgccgtc gagctccgca accgcctcaa cgccgccacc 720
    gggctgcgcc tcccggccac gctcgtcttc gaccacccca ctccggggga gctcgccggg 780
    cacctgctcg acgaactcgc cgccgccgca ggcgggtcct gggcggatga caccgggtcc 840
    ggctctgctt ccggctccgg ctccggctcc ggaggcgcgg tctcggctgc ggaccggcag 900
    accgcggcgg cactcgccga gctcgaccgg ctggaaggcg tactcgccgc cctcgcgccc 960
    gccgccggcg gccgtccgga gctcgccgcc cggctcaggg cgctggccgc ggccctgggg 1020
    gacgacggcg gcgccgccac cgaactggac gaggcgtccg acgacgacct cttctccttc 1080
    atcgacaagg agctgggcga atccgacttc tgacctgacc tgacccgacc cgaccggcgc 1140
    gacaagcgac atcagcacca gcaccagcac cacccagccc ccacacacac ggaacggaca 1200
    ggcgagaacg ggagccatgg cgaacaacga agacaagctc cgcgactacc tcaagcgcgt 1260
    taccgccgag ctgcagcaga acacccggcg tctgcgcgag atcgagggac gcacgcacga 1320
    gccggtggcg atcgtgggca tggcctgccg cctgccgggc ggtgtcgcct cgcccgagga 1380
    cctgtggcag ctggtggccg gggacggcga cgcgatctcg gagttcccgc aggaccgcgg 1440
    ctgggacgtg gaggggctgt acgacccgga cccggacgcg tccgggcgta cgtactgccg 1500
    gtccggcggg ttcctccacg acgcgggcga gttcgacgcc gacttcttcg ggatctcgcc 1560
    gcgcgaggcc ctcgccatgg acccgcagca gcggctgtcc ctcaccaccg cgtgggaggc 1620
    gatcgagcac gcgggcatcg acccgacgag cctgaagggc agcggcctcg gcgtcttcgt 1680
    c 1681
    <210> SEQ ID NO 8
    <211> LENGTH: 872
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces narbonensis
    <400> SEQUENCE: 8
    gagcccgagc cggtgcccgg cggcccgggc agcgtcgccg ccggccccgc cgcggatccg 60
    gaaccggaga cgtcgatcga cgacctcgac gccgaggccc tgatccggat ggctctcggc 120
    cgcggaacg cctgagcacc cgccccggcc cgtggctgcc ccggcccttg cccgactgcg 180
    gccgggccc cgggcccgca caccgccacg taccaccccg caccaccgcc ccccacacgc 240
    cacaacgcc atccacgagc ggaagaccac acccagatga cgagttccaa cgagcagttg 300
    tggacgctc tgcgcgcctc cctcaaggag aacgaagaac tccggaaaga gagccgtcgc 360
    gggacgacc ggcggcagga gcccatggcg atcgtcggca tgagctgtcg gttcgcgggc 420
    gcatccagt cccccgagga cctctgggac gcggtggccg ccggcaagga cctcgtatcc 480
    acgtacctg aggagcgcgg ctgggacttc gactccctgt acgacccgga gcccgggcgg 540
    agggcacga cgtacgtccg caacgccgcg ttcctcgacg acgccgccgg cttcgacgcc 600
    cgttcttcg ggatctcgcc gcgcgaggcc ctcgccatgg acccgcagca gcggcagctc 660
    tcgaagcct cctgggaggt cttcgagcgg gccggcatcg accccgcgtc ggtgcgcggc 720
    ccgatgtcg gcgtgtacgt gggatgcggc taccaggact acgcgccgga catccgggtc 780
    cccccgagg ggaccgacgg ttacgtcgtc accggcaact catccgccgt ggcctccggg 840
    gcatcgcgt actccctcgg tctcgagggg cc 872
    <210> SEQ ID NO 9
    <211> LENGTH: 1112
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces narbonensis
    <400> SEQUENCE: 9
    gctcggcgaa ctccccgcgc cgacccgccg gcacaccgag caccgcggcc gccgcgcccg 60
    tcaccgccgg acggacgaaa ccccccacca actcgaaggc gtacgaagcc gacgggtccg 120
    gcgcgagacc ctccaggatc tgccggtgga cctcctcgac cacggcccgg cgctgccccg 180
    cccacgcccc cggcacctcg gcggccgccc gcggcgcctg ctcgtgctcc agcgggcagc 240
    cctccccgta ggagaggacc tgctgcggca ccgggacgcc gtggcacccg gcaccccgaa 300
    ctccgtcgag cacaggacgc tcgccgccac ggcgtgatcg gcggtgaccc agctgcccgt 360
    cgggctgaag gagagcacgc cccgggcgcg cacccgctcg tacgcgggat acggatcgtc 420
    ggcctgcccg cgcagcacgg cggcgtacgg gtcgccgttc gcggcgtgga tccagtggat 480
    gccgcgggtc tccaggaggt gggcaccgag ctcggggtcg gccaccgcgc tgacggtgcg 540
    gcccagcgga ggctgcgtga gcgcccgcgc cgggtcgtcg gtcaccgtgg gttctgccat 600
    cgtttcgccg ctccttcgat cagtcgggtc gggggctgca cgacgcggga atcgggcgcg 660
    ccgcgggtga cgagcaggtg gtcggagatg tcgttgcaga tcccgtgcca ctggtcgttg 720
    aggtagaagt gaccgccgga gtacgcccgc aggcagaacg gcccgctggt gtgccggcgc 780
    cactcggcca cctcgttcag cggcgccttc gggtcgcggt cgccggccac ggccatcacc 840
    gggcaggcga gcttcgcgga gggccggtgc tcgtacgtct ccgccgcctt gtagtcgctg 900
    cgcagcgcgg gcagcaccag ccgcatcagc tcgtcgtcct ggaggaaccg ctcgtccgtg 960
    ccgctgagct gccggatctc ggccaggaac gcccggtcgt ccagctggtg gacgagccgg 1020
    tccggtgcca gggacggggc gcgccggccg gagacgtaca ggccctcggg ccgtaccccg 1080
    tgccgctgtt cgaggatgcg ggccgcctcg ta 1112
    <210> SEQ ID NO 10
    <211> LENGTH: 1599
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces narbonensis
    <400> SEQUENCE: 10
    ggggacgatc cccgccgggg tggggtcgcg atgggtctcc tcgcgcagcc ggtgcgcggc 60
    ggcgaggacc gaggggtcgt cgaggatgcg gacgaccgcg tcccgcaccg cctgcggggt 120
    gaggccggca ggcggcagga agaaccccgc cccctgctcc gcgacggccc gcgccttgac 180
    cggcgcgtcc cacagctcgg cgagcatgac ctgcggcacc gcgttgatca cggcggtcgc 240
    gtacgtaccg gccccgccgt ggtggacgat cgccgaacag ctcggcagca gcgcgtgcat 300
    cggcacgaag tccgtgaacc gcgtgtgctt cggataggag cggatctccg cgcgctgacc 360
    cgcgtcgagc gtggccacga gctcgatgtc gaggtcggcg agcgcctcca ggatgtcggc 420
    ctgcgagacc ccgtcgccgc cgaggacctc ccgcgcggag acaccgagag tgaggcagac 480
    ccggggccgc gccggcggct cggcgagcca gtccggcacg accgacgtgc cgttgtacgg 540
    aacgtactgc accccgacgg tcggcagacc cgtgtcgaga cgcagactcg gcggagtcgg 600
    gtcgaccgtg aactggccgg tgagcagctc ctcttcgaag gaggcgccga accggtccag 660
    cgtccacgtc agccactccg ccgtggggtc ctcacggtgc tccggcggct gccggtcccg 720
    cagcgcgacg aacttgcggc gggcgctccc catcacgtcg ggcccccaca ggacccgggc 780
    gtgcgcggcg cccgtgacct gggcggcgac ggcgcccgcg tacgtcgtcg gctcccacag 840
    caccaggtcc ggctgccagg acctggcgaa gccgaccagg tcgtcgatca tcgagtcgtt 900
    gttggcgagc agatagaagt acggggcgag gatcgcgtcg atgccgaggg cgtggtccca 960
    gtccagcggc tcgctacggg cctcgtcgaa ggcgatcgcc ggatggttcg ggcgcggctc 1020
    gcccgccatc cgcacccggt actcgtggat gaggtgatcc gtgccgacgg gcacggccgc 1080
    gagccctgac ccggtgatgg tgtccgtgag cgcgggctgg ctcgcgaccc gcacctcgtg 1140
    cccggcggcg agcagcgccc aggccagggg aacgaggccg tagtagtgcg tgtgatgtgc 1200
    gaacgaggtc agcaggacgc gcatggcgtc gtgtccttcc ttgccggtga agggtcgggg 1260
    tggggaggcg gggtggggag gtcggaacgg actcaggagc cgaccgggac gctcagcggc 1320
    ccgcggccga caggggcgcg gcggggacgg agcacgggcc cggccttccg cagcccgggg 1380
    aaacgcccgg ccagggtccg cagcgcgacc tccgcctgga gccgcaccag cgacgccacc 1440
    gggccgtacg gaccggcggg gtgcagcgcg aggtgcgccg tggcgtcggg gcgcggaggt 1500
    cgaaacgctc cgggtccgtg aagacccccg ggtcccggcc ggtgccggcg gtgaggacga 1560
    cgacatgcgc cccggccggg agacgccggc ccgccagct 1599
    <210> SEQ ID NO 11
    <211> LENGTH: 3241
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces narbonensis
    <400> SEQUENCE: 11
    gcaggagtcc cgtgtacgaa gtcgaccacg ccgacgtcta cgacctcttc tacctcggtc 60
    gcggcaagga ctacgccgcc gaggcctccg acatcgccga cctggtgcgg acccgtaccc 120
    ccgaggcctc ctcgctcctg gacgtggcct gcggtacggg cacgcatctg gagcacttca 180
    ccaaggagtt cggcgacacc gccggcctgg agctgtccga ggacatgctg acccacgccc 240
    ggaagcggct gcccgacgcg acgctccacc agggcgacat gcgggacttc cgcctcggcc 300
    gccggttctc cgcggtggtc agcatgttca gctccgtcgg ctacctgcgg acgacggccg 360
    aactcgacgc ggccgtcgcc tcgttcgccg cgcacctgga gcccggcggc gtcgtcgtcg 420
    tcgagccgtg gtggttcccg gagaccttcg ccgacggctg ggtgagcgcc gatgtcgtcc 480
    ggcgggacgg gcggaccgtg gcccgtgtct cgcactcggt gcgggacggc gacgcgacgc 540
    gcatggaggt gcacttcacc gtggcggacc cgggccgcgg cgtacggcac ttctccgacg 600
    tccacctcat caccctgttc caccgggcgg agtacgaggc ggccttcacg gccgccgggc 660
    tgcgcgtcga gtacctggag ggcggcccgt cgggccgtgg cctcttcgtc ggggtccccg 720
    cctagtccct cgcccggtca ccccacacag acccccgggg cgtcccgggt gcaccaagca 780
    cagagagaga aatccaccgt gacaggtaag acccgaatac cgcgtgtccg ccgcagccgt 840
    acgaccccca gggccttcac cctggccgtc gtcggcaccc tgctggcggg caccaccgtg 900
    gcggccgccg ctcccggcgc cgccggcacg ggccacgtgc agtacacgag caaggcggcg 960
    gagctcgtcg cgcagatgac gctcgacgag aagatcagct tcgtccactg ggcgctggac 1020
    cccgaccggc agaacgtcgg ctaccttccg ggcgtgccgc gtctcggcat cccggagctg 1080
    cgcgccgccg acggcccgaa cggcatccgt ctggtgggca ggaccgccac cgcgctgccc 1140
    gcgccggtcg ccctggccag caccttcgac gactccatgg ccgacagcta cggcagggtc 1200
    atgggccgcg acggacgcgc gctgggccag gacatggttc tgggcccgat gatgaacaac 1260
    atccgggtgc cacacggcgg ccggaactac gagaccttca gcgaggaccc cctggtctcc 1320
    tcgcgcaccg cggtcgccca gatcaagggc atccagggtg cgggtctgat gaccacggcc 1380
    aagcacttcg cggccaacaa ccaggagaac aaccgcttca gcgtcaacgc cacggtcgac 1440
    gagcagacgc tccgcgagat cgagttcccg gcgttcgagg cgtcctcgaa ggccggcgcg 1500
    gcctccttca tgtgtgccta taacggcgtc aacggcaagc cgtcctgcgg caacgacgag 1560
    ctgctcaaca acgtgctgcg cacgcagtgg ggcttccagg gctgggtgat gtccgactgg 1620
    ctcgccaccc cgggcacgga cgccatcacc aagggcctcg accaggagat gggcgtcgag 1680
    ctccccggcg acatcccgcc gggcgagccc tcgccgccgg ccaagttctt cggtgacgcg 1740
    ctgaagcagg ccgtcctgaa cggcacggtc cccgaggcgg ccgtgacgcg gtcggcggag 1800
    cgcatcgtca accagatgga caagttcggt ctgctcctcg cgactccggc gccccgcccc 1860
    gagcgtgaca aggcgggcgc ccaggcggtg tcccgcaagg tcgccgagaa cggcgcggtg 1920
    ctcctgcgca acgagggcca ggccctgccg ctcgccggtg acgccggcaa gagcatcgcc 1980
    gtcatcggcc cgacggccgt cgaccccaag gtcaccggcc tgggcagcgc ccacgtcgtc 2040
    ccggactcgg cggcggcgcc gctcgacacc atcaaggccc gcgcgggcgc gggtgcgacg 2100
    gtgacgtacg agacgggtga ggagaccttc gggacgcgga tcccggcggc gcagctcagc 2160
    ccggcgttca accagggcca ccagctggag ccgggcaagg cgggggcgct gtacgacggc 2220
    acgctgaccg tgcccgccga cggcgagtac cgcatctcgg tcaaggccac cggtggctac 2280
    gcgacggtgc agctcggcag ccacaccatc gaggccggtc aggtctacgg caaggtgagc 2340
    agcccgctcc tcaagctgac caagggcacg cacaagctca cgatctcggg cttcgcgatg 2400
    agcgccacgc cgctctccct ggagctgggc tgggtgacgc cggaggcagc cgacgcgacg 2460
    atcgcgaagg ccgtggagtc ggcgcggaag gcccgtacgg ccatcgtgtt cgcgtacgac 2520
    gacggcaccg agggcgtcga ccgtccgaac ctgtcgctgc cgggtacgca ggacaagctg 2580
    atctcggcgg tcgccgacgc gaacccgaac acgatcgtgg tcctcaacac cggttcgtcg 2640
    gtgctgatgc cgtggctgtc caagacccgc gcggtcctgg acatgtggta cccgggccag 2700
    gcgggcgccg aggcgaccgc cgcgctgctc tacggtgacg tgaacccgag cggcaagctc 2760
    acgcagagct tcccggccgc cgagaaccag cacgccgtcg ccggcgaccc gaaccgctac 2820
    ccgggcgtcg acaaccagca gacgtacagc gagggcatcc acgtcgggta ccgctggttc 2880
    gacaaggaga acgtcaagcc gctgttcccg ttcgggcacg gcctgtcgta cacctcgttc 2940
    acgcagagcg ccccgaccgt ggtgcgcacg tccacgggcg gcctgaaggt cacggtcacg 3000
    gtgcgcaaca gcgggcagcg cgcgggccag gaggtcgtcc aggcgtatct cggcgcgagc 3060
    ccgaaggtga cggctccgca ggcggagaag aagctcgtgg gctacacgaa ggtcgcgctc 3120
    gcggcgggcg agtcgaagac ggtgacggtg aacgtcgacc gccgtcagct gcagtactgg 3180
    gacgccgcgt cggactcgtg gaggacggga acgggcagca ggctcctcca gaccggttcg 3240
    t 3241
    <210> SEQ ID NO 12
    <211> LENGTH: 1475
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces narbonensis
    <400> SEQUENCE: 12
    gggggtgatc gccttctcga cgagcagcgg gtcgagggtg gggtggtcct cgttcggctc 60
    gacgggcacg ggggtcgcgc cggtggcgga gaccgcgagc cagctggcga tgtacgtgtg 120
    cgaggggacg tcacctcgtc cccgggtccg atgccgaggc cgcggagcgc gagctggagg 180
    gcgtccatgc cgctgttcac gccgacggcg tggtcggtct cgcagtaggt ggcgaactcg 240
    gcttcgaagg cttcgagttc ggggccgagg aggtagcgcc ccgagtcgag tacgcgggcg 300
    atggcggcgt cggtctccgg gcgcagttcc tcgtaggcgg ccttgaggtc gaggaagggg 360
    acccggccgg tctcggtgcg ggcggtcacg cggacacccc cacggcggtg gcgggcggct 420
    gcggggcggt ggcgggcggc tgcggggcgg tggccttgag cggttcccac cagtcgcggt 480
    tctcccggta ccagcggatg gtgcgcgcga ggccgtccgc gaaggcgatc tgcgggcggt 540
    agccgagttc gcgctcgatc ttgccgccgt cgagggagta gcgcaggtcg tggccctggc 600
    ggtcggcgac ccgccggacc gaggaccagt cggcgccgag cgagtccagg aggatgccgg 660
    tgagttcgcg gttggtcagc tcccggccgc cgccgatgtg gtagacctcg ccggcccggc 720
    cgcccgcgag gacgagcgcg atgccccggc agtggtcgtc ggtgtggacc cactcgcgga 780
    cgttcgcgcc gtcgccgtac agcgggagcg tcccgccgtc gaggaggttc gtcacgaaga 840
    gggggatgag cttctcgggg tgctggtacg gcccgtagtt gttgcagcag cgggtgatcc 900
    gtacgtcgag gccgtaggtg cggtggtagg cgcgggcgac gaggtcggag ccggccttgg 960
    aggccgcgta gggggagttg ggttccagcg ggctgctctc gttccacgag ccggagtcga 1020
    tcgacccgta cacctcgtcg gtggagacgt gcacgacccg gccgacgccg gcgtcgaggg 1080
    cgcactggag cagggtctgc gtgccctgga cgttggtccc ggtgaacacg gacgcccccg 1140
    cgatggagcg gtcgacgtgg ctctcggcgg cgaagtggac gacggcgtcg acgccgcgca 1200
    gttcccgggc gaggaggtcg gcgtcgcgga tgtcgccgtg gacgaaccgc agccgcgggt 1260
    ccgcttccac cggggcgagg ttggcgcggt tgcccgcgta ggtgaggctg tccaggacga 1320
    tcacctcacc ggcggggacg tcggggtacg ccccggcgag gagctgccgc acgaagtgcg 1380
    agccgatgaa gcccgcacct ccggtcacca gaagccgcac tgccgtcttc ctttcggtcg 1440
    cgctgtcggt ggcactgccg gtggtggggg gaacg 1475
    <210> SEQ ID NO 13
    <211> LENGTH: 1014
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 13
    gtgcggcttc tggtgaccgg aggtgcgggc ttcatcggct cgcacttcgt gcggcagctc 60
    ctcgccgggg cgtaccccga cgtgcccgcc gatgaggtga tcgtcctgga cagcctcacc 120
    tacgcgggca accgcgccaa cctcgccccg gtggacgcgg acccgcgact gcgcttcgtc 180
    cacggcgaca tccgcgacgc cggcctcctc gcccgggaac tgcgcggcgt ggacgccatc 240
    gtccacttcg cggccgagag ccacgtggac cgctccatcg cgggcgcgtc cgtgttcacc 300
    gagaccaacg tgcagggcac gcagacgctg ctccagtgcg ccgtcgacgc cggcgtcggc 360
    cgggtcgtgc acgtctccac cgacgaggtg tacgggtcga tcgactccgg ctcctggacc 420
    gagagcagcc cgctggagcc caactcgccc tacgcggcgt ccaaggccgg ctccgacctc 480
    gttgcccgcg cctaccaccg gacgtacggc ctcgacgtac ggatcacccg ctgctgcaac 540
    aactacgggc cgtaccagca ccccgagaag ctcatccccc tcttcgtgac gaacctcctc 600
    gacggcggga cgctcccgct gtacggcgac ggcgcgaacg tccgcgagtg ggtgcacacc 660
    gacgaccact gccggggcat cgcgctcgtc ctcgcgggcg gccgggccgg cgagatctac 720
    cacatcggcg gcggcctgga gctgaccaac cgcgaactca ccggcatcct cctggactcg 780
    ctcggcgccg actggtcctc ggtccggaag gtcgccgacc gcaagggcca cgacctgcgc 840
    tactccctcg acggcggcga gatcgagcgc gagctcggct accgcccgca ggtctccttc 900
    gcggacggcc tcgcgcggac cgtccgctgg taccgggaga accgcggctg gtgggagccg 960
    ctcaaggcga ccgccccgca gctgcccgcc accgccgtgg aggtgtccgc gtga 1014
    <210> SEQ ID NO 14
    <211> LENGTH: 337
    <212> TYPE: PRT
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 14
    Met Arg Leu Leu Val Thr Gly Gly Ala Gly Phe Ile Gly Ser His Phe
    1 5 10 15
    Val Arg Gln Leu Leu Ala Gly Ala Tyr Pro Asp Val Pro Ala Asp Glu
    20 25 30
    Val Ile Val Leu Asp Ser Leu Thr Tyr Ala Gly Asn Arg Ala Asn Leu
    35 40 45
    Ala Pro Val Asp Ala Asp Pro Arg Leu Arg Phe Val His Gly Asp Ile
    50 55 60
    Arg Asp Ala Gly Leu Leu Ala Arg Glu Leu Arg Gly Val Asp Ala Ile
    65 70 75 80
    Val His Phe Ala Ala Glu Ser His Val Asp Arg Ser Ile Ala Gly Ala
    85 90 95
    Ser Val Phe Thr Glu Thr Asn Val Gln Gly Thr Gln Thr Leu Leu Gln
    100 105 110
    Cys Ala Val Asp Ala Gly Val Gly Arg Val Val His Val Ser Thr Asp
    115 120 125
    Glu Val Tyr Gly Ser Ile Asp Ser Gly Ser Trp Thr Glu Ser Ser Pro
    130 135 140
    Leu Glu Pro Asn Ser Pro Tyr Ala Ala Ser Lys Ala Gly Ser Asp Leu
    145 150 155 160
    Val Ala Arg Ala Tyr His Arg Thr Tyr Gly Leu Asp Val Arg Ile Thr
    165 170 175
    Arg Cys Cys Asn Asn Tyr Gly Pro Tyr Gln His Pro Glu Lys Leu Ile
    180 185 190
    Pro Leu Phe Val Thr Asn Leu Leu Asp Gly Gly Thr Leu Pro Leu Tyr
    195 200 205
    Gly Asp Gly Ala Asn Val Arg Glu Trp Val His Thr Asp Asp His Cys
    210 215 220
    Arg Gly Ile Ala Leu Val Leu Ala Gly Gly Arg Ala Gly Glu Ile Tyr
    225 230 235 240
    His Ile Gly Gly Gly Leu Glu Leu Thr Asn Arg Glu Leu Thr Gly Ile
    245 250 255
    Leu Leu Asp Ser Leu Gly Ala Asp Trp Ser Ser Val Arg Lys Val Ala
    260 265 270
    Asp Arg Lys Gly His Asp Leu Arg Tyr Ser Leu Asp Gly Gly Glu Ile
    275 280 285
    Glu Arg Glu Leu Gly Tyr Arg Pro Gln Val Ser Phe Ala Asp Gly Leu
    290 295 300
    Ala Arg Thr Val Arg Trp Tyr Arg Glu Asn Arg Gly Trp Trp Glu Pro
    305 310 315 320
    Leu Lys Ala Thr Ala Pro Gln Leu Pro Ala Thr Ala Val Glu Val Ser
    325 330 335
    Ala
    <210> SEQ ID NO 15
    <211> LENGTH: 1140
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 15
    gtgagcagcc gcgccgagac cccccgcgtc cccttcctcg acctcaaggc cgcctacgag 60
    gagctccgcg cggagaccga cgccgcgatc gcccgcgtcc tcgactcggg gcgctacctc 120
    ctcggacccg aactcgaagg attcgaggcg gagttcgccg cgtactgcga gacggaccac 180
    gccgtcggcg tgaacagcgg gatggacgcc ctccagctcg ccctccgcgg cctcggcatc 240
    ggacccgggg acgaggtgat cgtcccctcg cacacgtaca tcgccagctg gctcgcggtg 300
    tccgccaccg gcgcgacccc cgtgcccgtc gagccgcacg aggaccaccc caccctggac 360
    ccgctgctcg tcgagaaggc gatcaccccc cgcacccggg cgctcctccc cgtccacctc 420
    tacgggcacc ccgccgacat ggacgccctc cgcgagctcg cggaccggca cggcctgcac 480
    atcgtcgagg acgccgcgca ggcccacggc gcccgctacc ggggccggcg gatcggcgcc 540
    gggtcgtcgg tggccgcgtt cagcttctac ccgggcaaga acctcggctg cttcggcgac 600
    ggcggcgccg tcgtcaccgg cgaccccgag ctcgccgaac ggctccggat gctccgcaac 660
    tacggctcgc ggcagaagta cagccacgag acgaagggca ccaactcccg cctggacgag 720
    atgcaggccg ccgtgctgcg gatccggctc gcccacctgg acagctggaa cggccgcagg 780
    tcggcgctgg ccgcggagta cctctccggg ctcgccggac tgcccggcat cggcctgccg 840
    gtgaccgcgc ccgacaccga cccggtctgg cacctcttca ccgtgcgcac cgagcgccgc 900
    gacgagctgc gcagccacct cgacgcccgc ggcatcgaca ccctcacgca ctacccggta 960
    0cccgtgcacc tctcgcccgc ctacgcgggc gaggcaccgc cggaaggctc gctcccgcgg 1020
    gccgagagct tcgcgcggca ggtcctcagc ctgccgatcg gcccgcacct ggagcgcccg 1080
    caggcgctgc gggtgatcga cgccgtgcgc gaatgggccg agcgggtcga ccaggcctag 1140
    <210> SEQ ID NO 16
    <211> LENGTH: 379
    <212> TYPE: PRT
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 16
    Met Ser Ser Arg Ala Glu Thr Pro Arg Val Pro Phe Leu Asp Leu Lys
    1 5 10 15
    Ala Ala Tyr Glu Glu Leu Arg Ala Glu Thr Asp Ala Ala Ile Ala Arg
    20 25 30
    Val Leu Asp Ser Gly Arg Tyr Leu Leu Gly Pro Glu Leu Glu Gly Phe
    35 40 45
    Glu Ala Glu Phe Ala Ala Tyr Cys Glu Thr Asp His Ala Val Gly Val
    50 55 60
    Asn Ser Gly Met Asp Ala Leu Gln Leu Ala Leu Arg Gly Leu Gly Ile
    65 70 75 80
    Gly Pro Gly Asp Glu Val Ile Val Pro Ser His Thr Tyr Ile Ala Ser
    85 90 95
    Trp Leu Ala Val Ser Ala Thr Gly Ala Thr Pro Val Pro Val Glu Pro
    100 105 110
    His Glu Asp His Pro Thr Leu Asp Pro Leu Leu Val Glu Lys Ala Ile
    115 120 125
    Thr Pro Arg Thr Arg Ala Leu Leu Pro Val His Leu Tyr Gly His Pro
    130 135 140
    Ala Asp Met Asp Ala Leu Arg Glu Leu Ala Asp Arg His Gly Leu His
    145 150 155 160
    Ile Val Glu Asp Ala Ala Gln Ala His Gly Ala Arg Tyr Arg Gly Arg
    165 170 175
    Arg Ile Gly Ala Gly Ser Ser Val Ala Ala Phe Ser Phe Tyr Pro Gly
    180 185 190
    Lys Asn Leu Gly Cys Phe Gly Asp Gly Gly Ala Val Val Thr Gly Asp
    195 200 205
    Pro Glu Leu Ala Glu Arg Leu Arg Met Leu Arg Asn Tyr Gly Ser Arg
    210 215 220
    Gln Lys Tyr Ser His Glu Thr Lys Gly Thr Asn Ser Arg Leu Asp Glu
    225 230 235 240
    Met Gln Ala Ala Val Leu Arg Ile Arg Leu Ala His Leu Asp Ser Trp
    245 250 255
    Asn Gly Arg Arg Ser Ala Leu Ala Ala Glu Tyr Leu Ser Gly Leu Ala
    260 265 270
    Gly Leu Pro Gly Ile Gly Leu Pro Val Thr Ala Pro Asp Thr Asp Pro
    275 280 285
    Val Trp His Leu Phe Thr Val Arg Thr Glu Arg Arg Asp Glu Leu Arg
    290 295 300
    Ser His Leu Asp Ala Arg Gly Ile Asp Thr Leu Thr His Tyr Pro Val
    305 310 315 320
    Pro Val His Leu Ser Pro Ala Tyr Ala Gly Glu Ala Pro Pro Glu Gly
    325 330 335
    Ser Leu Pro Arg Ala Glu Ser Phe Ala Arg Gln Val Leu Ser Leu Pro
    340 345 350
    Ile Gly Pro His Leu Glu Arg Pro Gln Ala Leu Arg Val Ile Asp Ala
    355 360 365
    Val Arg Glu Trp Ala Glu Arg Val Asp Gln Ala
    370 375
    <210> SEQ ID NO 17
    <211> LENGTH: 714
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 17
    gtgtacgaag tcgaccacgc cgacgtctac gacctcttct acctgggtcg cggcaaggac 60
    tacgccgccg aggcctccga catcgccgac ctggtgcgct cccgtacccc cgaggcctcc 120
    tcgctcctgg acgtggcctg cggtacgggc acgcatctgg agcacttcac caaggagttc 180
    ggcgacaccg ccggcctgga gctgtccgag gacatgctca cccacgcccg caagcggctg 240
    cccgacgcca cgctccacca gggcgacatg cgggacttcc ggctcggccg gaagttctcc 300
    gccgtggtca gcatgttcag ctccgtcggc tacctgaaga cgaccgagga actcggcgcg 360
    gccgtcgcct cgttcgcgga gcacctggag cccggtggcg tcgtcgtcgt cgagccgtgg 420
    tggttcccgg agaccttcgc cgacggctgg gtcagcgccg acgtcgtccg ccgtgacggg 480
    cgcaccgtgg cccgtgtctc gcactcggtg cgggagggga acgcgacgcg catggaggtc 540
    cacttcaccg tggccgaccc gggcaagggc gtgcggcact tctccgacgt ccatctcatc 600
    accctgttcc accaggccga gtacgaggcc gcgttcacgg ccgccgggct gcgcgtcgag 660
    tacctggagg gcggcccgtc gggccgtggc ctcttcgtcg gcgtccccgc ctga 714
    <210> SEQ ID NO 18
    <211> LENGTH: 237
    <212> TYPE: PRT
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 18
    Met Tyr Glu Val Asp His Ala Asp Val Tyr Asp Leu Phe Tyr Leu Gly
    1 5 10 15
    Arg Gly Lys Asp Tyr Ala Ala Glu Ala Ser Asp Ile Ala Asp Leu Val
    20 25 30
    Arg Ser Arg Thr Pro Glu Ala Ser Ser Leu Leu Asp Val Ala Cys Gly
    35 40 45
    Thr Gly Thr His Leu Glu His Phe Thr Lys Glu Phe Gly Asp Thr Ala
    50 55 60
    Gly Leu Glu Leu Ser Glu Asp Met Leu Thr His Ala Arg Lys Arg Leu
    65 70 75 80
    Pro Asp Ala Thr Leu His Gln Gly Asp Met Arg Asp Phe Arg Leu Gly
    85 90 95
    Arg Lys Phe Ser Ala Val Val Ser Met Phe Ser Ser Val Gly Tyr Leu
    100 105 110
    Lys Thr Thr Glu Glu Leu Gly Ala Ala Val Ala Ser Phe Ala Glu His
    115 120 125
    Leu Glu Pro Gly Gly Val Val Val Val Glu Pro Trp Trp Phe Pro Glu
    130 135 140
    Thr Phe Ala Asp Gly Trp Val Ser Ala Asp Val Val Arg Arg Asp Gly
    145 150 155 160
    Arg Thr Val Ala Arg Val Ser His Ser Val Arg Glu Gly Asn Ala Thr
    165 170 175
    Arg Met Glu Val His Phe Thr Val Ala Asp Pro Gly Lys Gly Val Arg
    180 185 190
    His Phe Ser Asp Val His Leu Ile Thr Leu Phe His Gln Ala Glu Tyr
    195 200 205
    Glu Ala Ala Phe Thr Ala Ala Gly Leu Arg Val Glu Tyr Leu Glu Gly
    210 215 220
    Gly Pro Ser Gly Arg Gly Leu Phe Val Gly Val Pro Ala
    225 230 235
    <210> SEQ ID NO 19
    <211> LENGTH: 1281
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 19
    atgcgcgtcc tgctgacctc gttcgcacat cacacgcact actacggcct ggtgcccctg 60
    gcctgggcgc tgctcgccgc cgggcacgag gtgcgggtcg ccagccagcc cgcgctcacg 120
    gacaccatca ccgggtccgg gctcgccgcg gtgccggtcg gcaccgacca cctcatccac 180
    gagtaccggg tgcggatggc gggcgagccg cgcccgaacc atccggcgat cgccttcgac 240
    gaggcccgtc ccgagccgct ggactgggac cacgccctcg gcatcgaggc gatcctcgcc 300
    ccgtacttcc atctgctcgc caacaacgac tcgatggtcg acgacctcgt cgacttcgcc 360
    cggtcctggc agccggacct ggtgctgtgg gagccgacga cctacgcggg cgccgtcgcc 420
    gcccaggtca ccggtgccgc gcacgcccgg gtcctgtggg ggcccgacgt gatgggcagc 480
    gcccgccgca agttcgtcgc gctgcgggac cggcagccgc ccgagcaccg cgaggacccc 540
    accgcggagt ggctgacgtg gacgctcgac cggtacggcg cctccttcga agaggagctg 600
    ctcaccggcc agttcacgat cgacccgacc ccgccgagcc tgcgcctcga cacgggcctg 660
    ccgaccgtcg ggatgcgtta tgttccgtac aacggcacgt cggtcgtgcc ggactggctg 720
    agtgagccgc ccgcgcggcc ccgggtctgc ctgaccctcg gcgtctccgc gcgtgaggtc 780
    ctcggcggcg acggcgtctc gcagggcgac atcctggagg cgctcgccga cctcgacatc 840
    gagctcgtcg ccacgctcga cgcgagtcag cgcgccgaga tccgcaacta cccgaagcac 900
    acccggttca cggacttcgt gccgatgcac gcgctcctgc cgagctgctc ggcgatcatc 960
    caccacggcg gggcgggcac ctacgcgacc gccgtgatca acgcggtgcc gcaggtcatg 1020
    ctcgccgagc tgtgggacgc gccggtcaag gcgcgggccg tcgccgagca gggggcgggg 1080
    ttcttcctgc cgccggccga gctcacgccg caggccgtgc gggacgccgt cgtccgcatc 1140
    ctcgacgacc cctcggtcgc caccgccgcg caccggctgc gcgaggagac cttcggcgac 1200
    cccaccccgg ccgggatcgt ccccgagctg gagcggctcg ccgcgcagca ccgccgcccg 1260
    ccggccgacg cccggcactg a 1281
    <210> SEQ ID NO 20
    <211> LENGTH: 426
    <212> TYPE: PRT
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 20
    Met Arg Val Leu Leu Thr Ser Phe Ala His His Thr His Tyr Tyr Gly
    1 5 10 15
    Leu Val Pro Leu Ala Trp Ala Leu Leu Ala Ala Gly His Glu Val Arg
    20 25 30
    Val Ala Ser Gln Pro Ala Leu Thr Asp Thr Ile Thr Gly Ser Gly Leu
    35 40 45
    Ala Ala Val Pro Val Gly Thr Asp His Leu Ile His Glu Tyr Arg Val
    50 55 60
    Arg Met Ala Gly Glu Pro Arg Pro Asn His Pro Ala Ile Ala Phe Asp
    65 70 75 80
    Glu Ala Arg Pro Glu Pro Leu Asp Trp Asp His Ala Leu Gly Ile Glu
    85 90 95
    Ala Ile Leu Ala Pro Tyr Phe His Leu Leu Ala Asn Asn Asp Ser Met
    100 105 110
    Val Asp Asp Leu Val Asp Phe Ala Arg Ser Trp Gln Pro Asp Leu Val
    115 120 125
    Leu Trp Glu Pro Thr Thr Tyr Ala Gly Ala Val Ala Ala Gln Val Thr
    130 135 140
    Gly Ala Ala His Ala Arg Val Leu Trp Gly Pro Asp Val Met Gly Ser
    145 150 155 160
    Ala Arg Arg Lys Phe Val Ala Leu Arg Asp Arg Gln Pro Pro Glu His
    165 170 175
    Arg Glu Asp Pro Thr Ala Glu Trp Leu Thr Trp Thr Leu Asp Arg Tyr
    180 185 190
    Gly Ala Ser Phe Glu Glu Glu Leu Leu Thr Gly Gln Phe Thr Ile Asp
    195 200 205
    Pro Thr Pro Pro Ser Leu Arg Leu Asp Thr Gly Leu Pro Thr Val Gly
    210 215 220
    Met Arg Tyr Val Pro Tyr Asn Gly Thr Ser Val Val Pro Asp Trp Leu
    225 230 235 240
    Ser Glu Pro Pro Ala Arg Pro Arg Val Cys Leu Thr Leu Gly Val Ser
    245 250 255
    Ala Arg Glu Val Leu Gly Gly Asp Gly Val Ser Gln Gly Asp Ile Leu
    260 265 270
    Glu Ala Leu Ala Asp Leu Asp Ile Glu Leu Val Ala Thr Leu Asp Ala
    275 280 285
    Ser Gln Arg Ala Glu Ile Arg Asn Tyr Pro Lys His Thr Arg Phe Thr
    290 295 300
    Asp Phe Val Pro Met His Ala Leu Leu Pro Ser Cys Ser Ala Ile Ile
    305 310 315 320
    His His Gly Gly Ala Gly Thr Tyr Ala Thr Ala Val Ile Asn Ala Val
    325 330 335
    Pro Gln Val Met Leu Ala Glu Leu Trp Asp Ala Pro Val Lys Ala Arg
    340 345 350
    Ala Val Ala Glu Gln Gly Ala Gly Phe Phe Leu Pro Pro Ala Glu Leu
    355 360 365
    Thr Pro Gln Ala Val Arg Asp Ala Val Val Arg Ile Leu Asp Asp Pro
    370 375 380
    Ser Val Ala Thr Ala Ala His Arg Leu Arg Glu Glu Thr Phe Gly Asp
    385 390 395 400
    Pro Thr Pro Ala Gly Ile Val Pro Glu Leu Glu Arg Leu Ala Ala Gln
    405 410 415
    His Arg Arg Pro Pro Ala Asp Ala Arg His
    420 425
    <210> SEQ ID NO 21
    <211> LENGTH: 1209
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 21
    gtgaccgacg acctgacggg ggccctcacg cagcccccgc tgggccgcac cgtccgcgcg 60
    gtggccgacc gtgaactcgg cacccacctc ctggagaccc gcggcatcca ctggatccac 120
    gccgcgaacg gcgacccgta cgccaccgtg ctgcgcggcc aggcggacga cccgtatccc 180
    gcgtacgagc gggtgcgtgc ccgcggcgcg ctctccttca gcccgacggg cagctgggtc 240
    accgccgatc acgccctggc ggcgagcatc ctctgctcga cggacttcgg ggtctccggc 300
    gccgacggcg tcccggtgcc gcagcaggtc ctctcgtacg gggagggctg tccgctggag 360
    cgcgagcagg tgctgccggc ggccggtgac gtgccggagg gcgggcagcg tgccgtggtc 420
    gaggggatcc accgggagac gctggagggt ctcgcgccgg acccgtcggc gtcgtacgcc 480
    ttcgagctgc tgggcggttt cgtccgcccg gcggtgacgg ccgctgccgc cgccgtgctg 540
    ggtgttcccg cggaccggcg cgcggacttc gcggatctgc tggagcggct ccggccgctg 600
    tccgacagcc tgctggcccc gcagtccctg cggacggtac gggcggcgga cggcgcgctg 660
    gccgagctca cggcgctgct cgccgattcg gacgactccc ccggggccct gctgtcggcg 720
    ctcggggtca ccgcagccgt ccagctcacc gggaacgcgg tgctcgcgct cctcgcgcat 780
    cccgagcagt ggcgggagct gtgcgaccgg cccgggctcg cggcggccgc ggtggaggag 840
    accctccgct acgacccgcc ggtgcagctc gacgcccggg tggtccgcgg ggagacggag 900
    ctggcgggcc ggcggctgcc ggccggggcg catgtcgtcg tcctgaccgc cgcgaccggc 960
    cgggacccgg aggtcttcac ggacccggag cgcttcgacc tcgcgcgccc cgacgccgcc 1020
    gcgcacctcg cgctgcaccc cgccggtccg tacggcccgg tggcgtccct ggtccggctt 1080
    caggcggagg tcgcgctgcg gaccctggcc gggcgtttcc ccgggctgcg gcaggcgggg 1140
    gacgtgctcc gcccccgccg cgcgcctgtc ggccgcgggc cgctgagcgt cccggtcagc 1200
    agctcctga 1209
    <210> SEQ ID NO 22
    <211> LENGTH: 402
    <212> TYPE: PRT
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 22
    Met Thr Asp Asp Leu Thr Gly Ala Leu Thr Gln Pro Pro Leu Gly Arg
    1 5 10 15
    Thr Val Arg Ala Val Ala Asp Arg Glu Leu Gly Thr His Leu Leu Glu
    20 25 30
    Thr Arg Gly Ile His Trp Ile His Ala Ala Asn Gly Asp Pro Tyr Ala
    35 40 45
    Thr Val Leu Arg Gly Gln Ala Asp Asp Pro Tyr Pro Ala Tyr Glu Arg
    50 55 60
    Val Arg Ala Arg Gly Ala Leu Ser Phe Ser Pro Thr Gly Ser Trp Val
    65 70 75 80
    Thr Ala Asp His Ala Leu Ala Ala Ser Ile Leu Cys Ser Thr Asp Phe
    85 90 95
    Gly Val Ser Gly Ala Asp Gly Val Pro Val Pro Gln Gln Val Leu Ser
    100 105 110
    Tyr Gly Glu Gly Cys Pro Leu Glu Arg Glu Gln Val Leu Pro Ala Ala
    115 120 125
    Gly Asp Val Pro Glu Gly Gly Gln Arg Ala Val Val Glu Gly Ile His
    130 135 140
    Arg Glu Thr Leu Glu Gly Leu Ala Pro Asp Pro Ser Ala Ser Tyr Ala
    145 150 155 160
    Phe Glu Leu Leu Gly Gly Phe Val Arg Pro Ala Val Thr Ala Ala Ala
    165 170 175
    Ala Ala Val Leu Gly Val Pro Ala Asp Arg Arg Ala Asp Phe Ala Asp
    180 185 190
    Leu Leu Glu Arg Leu Arg Pro Leu Ser Asp Ser Leu Leu Ala Pro Gln
    195 200 205
    Ser Leu Arg Thr Val Arg Ala Ala Asp Gly Ala Leu Ala Glu Leu Thr
    210 215 220
    Ala Leu Leu Ala Asp Ser Asp Asp Ser Pro Gly Ala Leu Leu Ser Ala
    225 230 235 240
    Leu Gly Val Thr Ala Ala Val Gln Leu Thr Gly Asn Ala Val Leu Ala
    245 250 255
    Leu Leu Ala His Pro Glu Gln Trp Arg Glu Leu Cys Asp Arg Pro Gly
    260 265 270
    Leu Ala Ala Ala Ala Val Glu Glu Thr Leu Arg Tyr Asp Pro Pro Val
    275 280 285
    Gln Leu Asp Ala Arg Val Val Arg Gly Glu Thr Glu Leu Ala Gly Arg
    290 295 300
    Arg Leu Pro Ala Gly Ala His Val Val Val Leu Thr Ala Ala Thr Gly
    305 310 315 320
    Arg Asp Pro Glu Val Phe Thr Asp Pro Glu Arg Phe Asp Leu Ala Arg
    325 330 335
    Pro Asp Ala Ala Ala His Leu Ala Leu His Pro Ala Gly Pro Tyr Gly
    340 345 350
    Pro Val Ala Ser Leu Val Arg Leu Gln Ala Glu Val Ala Leu Arg Thr
    355 360 365
    Leu Ala Gly Arg Phe Pro Gly Leu Arg Gln Ala Gly Asp Val Leu Arg
    370 375 380
    Pro Arg Arg Ala Pro Val Gly Arg Gly Pro Leu Ser Val Pro Val Ser
    385 390 395 400
    Ser Ser
    <210> SEQ ID NO 23
    <211> LENGTH: 2430
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 23
    gtgacaggta agacccgaat accgcgtgtc cgccgcggcc gcaccacgcc cagggccttc 60
    accctggccg tcgtcggcac cctgctggcg ggcaccaccg tggcggccgc cgctcccggc 120
    gccgccgaca cggccaatgt tcagtacacg agccgggcgg cggagctcgt cgcccagatg 180
    acgctcgacg agaagatcag cttcgtccac tgggcgctgg accccgaccg gcagaacgtc 240
    ggctaccttc ccggcgtgcc gcgtctgggc atcccggagc tgcgtgccgc cgacggcccg 300
    aacggcatcc gcctggtggg gcagaccgcc accgcgctgc ccgcgccggt cgccctggcc 360
    agcaccttcg acgacaccat ggccgacagc tacggcaagg tcatgggccg cgacggtcgc 420
    gcgctcaacc aggacatggt cctgggcccg atgatgaaca acatccgggt gccgcacggc 480
    ggccggaact acgagacctt cagcgaggac cccctggtct cctcgcgcac cgcggtcgcc 540
    cagatcaagg gcatccaggg tgcgggtctg atgaccacgg ccaagcactt cgcggccaac 600
    aaccaggaga acaaccgctt ctccgtgaac gccaatgtcg acgagcagac gctccgcgag 660
    atcgagttcc cggcgttcga ggcgtcctcc aaggccggcg cggcctcctt catgtgtgcc 720
    tacaacggcc tcaacgggaa gccgtcctgc ggcaacgacg agctcctcaa caacgtgctg 780
    cgcacgcagt ggggcttcca gggctgggtg atgtccgact ggctcgccac cccgggcacc 840
    gacgccatca ccaagggcct cgaccaggag atgggcgtcg agctccccgg cgacgtcccg 900
    aagggcgagc cctcgccgcc ggccaagttc ttcggcgagg cgctgaagac ggccgtcctg 960
    aacggcacgg tccccgaggc ggccgtgacg cggtcggcgg agcggatcgt cggccagatg 1020
    gagaagttcg gtctgctcct cgccactccg gcgccgcggc ccgagcgcga caaggcgggt 1080
    gcccaggcgg tgtcccgcaa ggtcgccgag aacggcgcgg tgctcctgcg caacgagggc 1140
    caggccctgc cgctcgccgg tgacgccggc aagagcatcg cggtcatcgg cccgacggcc 1200
    gtcgacccca aggtcaccgg cctgggcagc gcccacgtcg tcccggactc ggcggcggcg 1260
    ccactcgaca ccatcaaggc ccgcgcgggt gcgggtgcga cggtgacgta cgagacgggt 1320
    gaggagacct tcgggacgca gatcccggcg gggaacctca gcccggcgtt caaccagggc 1380
    caccagctcg agccgggcaa ggcgggggcg ctgtacgacg gcacgctgac cgtgcccgcc 1440
    gacggcgagt accgcatcgc ggtccgtgcc accggtggtt acgccacggt gcagctcggc 1500
    agccacacca tcgaggccgg tcaggtctac ggcaaggtga gcagcccgct cctcaagctg 1560
    accaagggca cgcacaagct cacgatctcg ggcttcgcga tgagtgccac cccgctctcc 1620
    ctggagctgg gctgggtgac gccggcggcg gccgacgcga cgatcgcgaa ggccgtggag 1680
    tcggcgcgga aggcccgtac ggcggtcgtc ttcgcctacg acgacggcac cgagggcgtc 1740
    gaccgtccga acctgtcgct gccgggtacg caggacaagc tgatctcggc tgtcgcggac 1800
    gccaacccga acacgatcgt ggtcctcaac accggttcgt cggtgctgat gccgtggctg 1860
    tccaagaccc gcgcggtcct ggacatgtgg tacccgggcc aggcgggcgc cgaggccacc 1920
    gccgcgctgc tctacggtga cgtcaacccg agcggcaagc tcacgcagag cttcccggcc 1980
    gccgagaacc agcacgcggt cgccggcgac ccgacaagct acccgggcgt cgacaaccag 2040
    cagacgtacc gcgagggcat ccacgtcggg taccgctggt tcgacaagga gaacgtcaag 2100
    ccgctgttcc cgttcgggca cggcctgtcg tacacctcgt tcacgcagag cgccccgacc 2160
    gtcgtgcgta cgtccacggg tggtctgaag gtcacggtca cggtccgcaa cagcgggaag 2220
    cgcgccggcc aggaggtcgt ccaggcgtac ctcggtgcca gcccgaacgt gacggctccg 2280
    caggcgaaga agaagctcgt gggctacacg aaggtctcgc tcgccgcggg cgaggcgaag 2340
    acggtgacgg tgaacgtcga ccgccgtcag ctgcagaccg gttcgtcctc cgccgacctg 2400
    cggggcagcg ccacggtcaa cgtctggtga 2430
    <210> SEQ ID NO 24
    <211> LENGTH: 809
    <212> TYPE: PRT
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 24
    Met Thr Gly Lys Thr Arg Ile Pro Arg Val Arg Arg Gly Arg Thr Thr
    1 5 10 15
    Pro Arg Ala Phe Thr Leu Ala Val Val Gly Thr Leu Leu Ala Gly Thr
    20 25 30
    Thr Val Ala Ala Ala Ala Pro Gly Ala Ala Asp Thr Ala Asn Val Gln
    35 40 45
    Tyr Thr Ser Arg Ala Ala Glu Leu Val Ala Gln Met Thr Leu Asp Glu
    50 55 60
    Lys Ile Ser Phe Val His Trp Ala Leu Asp Pro Asp Arg Gln Asn Val
    65 70 75 80
    Gly Tyr Leu Pro Gly Val Pro Arg Leu Gly Ile Pro Glu Leu Arg Ala
    85 90 95
    Ala Asp Gly Pro Asn Gly Ile Arg Leu Val Gly Gln Thr Ala Thr Ala
    100 105 110
    Leu Pro Ala Pro Val Ala Leu Ala Ser Thr Phe Asp Asp Thr Met Ala
    115 120 125
    Asp Ser Tyr Gly Lys Val Met Gly Arg Asp Gly Arg Ala Leu Asn Gln
    130 135 140
    Asp Met Val Leu Gly Pro Met Met Asn Asn Ile Arg Val Pro His Gly
    145 150 155 160
    Gly Arg Asn Tyr Glu Thr Phe Ser Glu Asp Pro Leu Val Ser Ser Arg
    165 170 175
    Thr Ala Val Ala Gln Ile Lys Gly Ile Gln Gly Ala Gly Leu Met Thr
    180 185 190
    Thr Ala Lys His Phe Ala Ala Asn Asn Gln Glu Asn Asn Arg Phe Ser
    195 200 205
    Val Asn Ala Asn Val Asp Glu Gln Thr Leu Arg Glu Ile Glu Phe Pro
    210 215 220
    Ala Phe Glu Ala Ser Ser Lys Ala Gly Ala Ala Ser Phe Met Cys Ala
    225 230 235 240
    Tyr Asn Gly Leu Asn Gly Lys Pro Ser Cys Gly Asn Asp Glu Leu Leu
    245 250 255
    Asn Asn Val Leu Arg Thr Gln Trp Gly Phe Gln Gly Trp Val Met Ser
    260 265 270
    Asp Trp Leu Ala Thr Pro Gly Thr Asp Ala Ile Thr Lys Gly Leu Asp
    275 280 285
    Gln Glu Met Gly Val Glu Leu Pro Gly Asp Val Pro Lys Gly Glu Pro
    290 295 300
    Ser Pro Pro Ala Lys Phe Phe Gly Glu Ala Leu Lys Thr Ala Val Leu
    305 310 315 320
    Asn Gly Thr Val Pro Glu Ala Ala Val Thr Arg Ser Ala Glu Arg Ile
    325 330 335
    Val Gly Gln Met Glu Lys Phe Gly Leu Leu Leu Ala Thr Pro Ala Pro
    340 345 350
    Arg Pro Glu Arg Asp Lys Ala Gly Ala Gln Ala Val Ser Arg Lys Val
    355 360 365
    Ala Glu Asn Gly Ala Val Leu Leu Arg Asn Glu Gly Gln Ala Leu Pro
    370 375 380
    Leu Ala Gly Asp Ala Gly Lys Ser Ile Ala Val Ile Gly Pro Thr Ala
    385 390 395 400
    Val Asp Pro Lys Val Thr Gly Leu Gly Ser Ala His Val Val Pro Asp
    405 410 415
    Ser Ala Ala Ala Pro Leu Asp Thr Ile Lys Ala Arg Ala Gly Ala Gly
    420 425 430
    Ala Thr Val Thr Tyr Glu Thr Gly Glu Glu Thr Phe Gly Thr Gln Ile
    435 440 445
    Pro Ala Gly Asn Leu Ser Pro Ala Phe Asn Gln Gly His Gln Leu Glu
    450 455 460
    Pro Gly Lys Ala Gly Ala Leu Tyr Asp Gly Thr Leu Thr Val Pro Ala
    465 470 475 480
    Asp Gly Glu Tyr Arg Ile Ala Val Arg Ala Thr Gly Gly Tyr Ala Thr
    485 490 495
    Val Gln Leu Gly Ser His Thr Ile Glu Ala Gly Gln Val Tyr Gly Lys
    500 505 510
    Val Ser Ser Pro Leu Leu Lys Leu Thr Lys Gly Thr His Lys Leu Thr
    515 520 525
    Ile Ser Gly Phe Ala Met Ser Ala Thr Pro Leu Ser Leu Glu Leu Gly
    530 535 540
    Trp Val Thr Pro Ala Ala Ala Asp Ala Thr Ile Ala Lys Ala Val Glu
    545 550 555 560
    Ser Ala Arg Lys Ala Arg Thr Ala Val Val Phe Ala Tyr Asp Asp Gly
    565 570 575
    Thr Glu Gly Val Asp Arg Pro Asn Leu Ser Leu Pro Gly Thr Gln Asp
    580 585 590
    Lys Leu Ile Ser Ala Val Ala Asp Ala Asn Pro Asn Thr Ile Val Val
    595 600 605
    Leu Asn Thr Gly Ser Ser Val Leu Met Pro Trp Leu Ser Lys Thr Arg
    610 615 620
    Ala Val Leu Asp Met Trp Tyr Pro Gly Gln Ala Gly Ala Glu Ala Thr
    625 630 635 640
    Ala Ala Leu Leu Tyr Gly Asp Val Asn Pro Ser Gly Lys Leu Thr Gln
    645 650 655
    Ser Phe Pro Ala Ala Glu Asn Gln His Ala Val Ala Gly Asp Pro Thr
    660 665 670
    Ser Tyr Pro Gly Val Asp Asn Gln Gln Thr Tyr Arg Glu Gly Ile His
    675 680 685
    Val Gly Tyr Arg Trp Phe Asp Lys Glu Asn Val Lys Pro Leu Phe Pro
    690 695 700
    Phe Gly His Gly Leu Ser Tyr Thr Ser Phe Thr Gln Ser Ala Pro Thr
    705 710 715 720
    Val Val Arg Thr Ser Thr Gly Gly Leu Lys Val Thr Val Thr Val Arg
    725 730 735
    Asn Ser Gly Lys Arg Ala Gly Gln Glu Val Val Gln Ala Tyr Leu Gly
    740 745 750
    Ala Ser Pro Asn Val Thr Ala Pro Gln Ala Lys Lys Lys Leu Val Gly
    755 760 765
    Tyr Thr Lys Val Ser Leu Ala Ala Gly Glu Ala Lys Thr Val Thr Val
    770 775 780
    Asn Val Asp Arg Arg Gln Leu Gln Thr Gly Ser Ser Ser Ala Asp Leu
    785 790 795 800
    Arg Gly Ser Ala Thr Val Asn Val Trp
    805
    <210> SEQ ID NO 25
    <211> LENGTH: 9
    <212> TYPE: PRT
    <213> ORGANISM: Artificial Sequence
    <220> FEATURE:
    <223> OTHER INFORMATION: A consensus sequence.
    <220> FEATURE:
    <221> NAME/KEY: VARIANT
    <222> LOCATION: (4)...(4)
    <223> OTHER INFORMATION: Residue 4 is either V or I.
    <400> SEQUENCE: 25
    Leu Leu Asp Val Ala Cys Gly Thr Gly
    1 5
    <210> SEQ ID NO 26
    <211> LENGTH: 1011
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 26
    atggcaatgc gcgactccat accgaggcga gcggaccgcg acacccttcg ccgcgaatta 60
    ggccagaact tccttcagga cgacagagcc gtgcgcaatc tcgtcacgca tgtcgagggg 120
    gacggtagga acgttctcga aatcggcccc ggaaagggcg cgataaccga ggagttggtg 180
    cgctccttcg acaccgtgac ggtcgtggag atggacccgc actgggccgc gcatgtgcgg 240
    cggaaattcg aaggggagag ggtcaccgta ttccagggtg atttcctcga cttccgcatt 300
    ccgcgcgata tcgacaccgt cgtcggaaac gttcccttcg gcatcacgac ccagattctc 360
    cggagtctcc tggaatcgac gaactggcag tcggcggccc tgatagtgca gtgggaggtc 420
    gcccgcaaac gcgccggtcg cagcggcgga tcgctcctca cgacctcctg ggccccctgg 480
    tacgagttcg cggtccacga ccgcgtccgc gcctcgtcgt tccgtccgat gccccgcgtc 540
    gacggcggcg tcctgacgat caggcgacgc ccccagcccc tgctgcccga gagcgcgagc 600
    cgcgccttcc agaacttcgc cgaagccgtc ttcaccggcc ccggacgggg cctcgcggag 660
    atcctccggc gccacatccc caagcggacc taccgttccc tcgccgaccg ccacggaatt 720
    ccggacggcg gactgccgaa ggacctcacg ctcacccaat ggatcgccct tttccaggcc 780
    tcccagccga gttacgcgcc gggggcgccc ggcacgcgca tgccgggcca gggcggtggc 840
    gccggcggca gggactatga ctcggagacg agcagggccg ccgtgcccgg gagccgcaga 900
    tacggcccca cgcgcggcgg cgaaccctgc gcaccccgcg cacaggtccg gcagaccaag 960
    ggccgccagg gcgcgcgagg ctcgtcgtac ggacgccgca cgggccgtta g 1011
    <210> SEQ ID NO 27
    <211> LENGTH: 336
    <212> TYPE: PRT
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 27
    Met Ala Met Arg Asp Ser Ile Pro Arg Arg Ala Asp Arg Asp Thr Leu
    1 5 10 15
    Arg Arg Glu Leu Gly Gln Asn Phe Leu Gln Asp Asp Arg Ala Val Arg
    20 25 30
    Asn Leu Val Thr His Val Glu Gly Asp Gly Arg Asn Val Leu Glu Ile
    35 40 45
    Gly Pro Gly Lys Gly Ala Ile Thr Glu Glu Leu Val Arg Ser Phe Asp
    50 55 60
    Thr Val Thr Val Val Glu Met Asp Pro His Trp Ala Ala His Val Arg
    65 70 75 80
    Arg Lys Phe Glu Gly Glu Arg Val Thr Val Phe Gln Gly Asp Phe Leu
    85 90 95
    Asp Phe Arg Ile Pro Arg Asp Ile Asp Thr Val Val Gly Asn Val Pro
    100 105 110
    Phe Gly Ile Thr Thr Gln Ile Leu Arg Ser Leu Leu Glu Ser Thr Asn
    115 120 125
    Trp Gln Ser Ala Ala Leu Ile Val Gln Trp Glu Val Ala Arg Lys Arg
    130 135 140
    Ala Gly Arg Ser Gly Gly Ser Leu Leu Thr Thr Ser Trp Ala Pro Trp
    145 150 155 160
    Tyr Glu Phe Ala Val His Asp Arg Val Arg Ala Ser Ser Phe Arg Pro
    165 170 175
    Met Pro Arg Val Asp Gly Gly Val Leu Thr Ile Arg Arg Arg Pro Gln
    180 185 190
    Pro Leu Leu Pro Glu Ser Ala Ser Arg Ala Phe Gln Asn Phe Ala Glu
    195 200 205
    Ala Val Phe Thr Gly Pro Gly Arg Gly Leu Ala Glu Ile Leu Arg Arg
    210 215 220
    His Ile Pro Lys Arg Thr Tyr Arg Ser Leu Ala Asp Arg His Gly Ile
    225 230 235 240
    Pro Asp Gly Gly Leu Pro Lys Asp Leu Thr Leu Thr Gln Trp Ile Ala
    245 250 255
    Leu Phe Gln Ala Ser Gln Pro Ser Tyr Ala Pro Gly Ala Pro Gly Thr
    260 265 270
    Arg Met Pro Gly Gln Gly Gly Gly Ala Gly Gly Arg Asp Tyr Asp Ser
    275 280 285
    Glu Thr Ser Arg Ala Ala Val Pro Gly Ser Arg Arg Tyr Gly Pro Thr
    290 295 300
    Arg Gly Gly Glu Pro Cys Ala Pro Arg Ala Gln Val Arg Gln Thr Lys
    305 310 315 320
    Gly Arg Gln Gly Ala Arg Gly Ser Ser Tyr Gly Arg Arg Thr Gly Arg
    325 330 335
    <210> SEQ ID NO 28
    <400> SEQUENCE: 28
    000
    <210> SEQ ID NO 29
    <400> SEQUENCE: 29
    000
    <210> SEQ ID NO 30
    <211> LENGTH: 13842
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 30
    atgtcttcag ccggaattac caggaccggt gcgagaacac cggtgacagg gcgtggggcg 60
    gcagcgtggg acacggggga agtgcgggtc cgacgggggt tgccccctgc cggccccgat 120
    catgcggagc actccttctc tcgtgctcct accggtgatg tgcgcgccga attgattcgt 180
    ggagagatgt cgacagtgtc caagagtgag tccgaggaat tcgtgtccgt gtcgaacgac 240
    gccggttccg cgcacggcac agcggaaccc gtcgccgtcg tcggcatctc ctgccgggtg 300
    cccggcgccc gggacccgag agagttctgg gaactcctgg cggcaggcgg ccaggccgtc 360
    accgacgtcc ccgcggaccg ctggaacgcc ggcgacttct acgacccgga ccgctccgcc 420
    cccggccgct cgaacagccg gtggggcggg ttcatcgagg acgtcgaccg gttcgacgcc 480
    gccttcttcg gcatctcgcc ccgcgaggcc gcggagatgg acccgcagca gcggctcgcc 540
    ctggagctgg gctgggaggc cctggagcgc gccgggatcg acccgtcctc gctcaccggc 600
    acccgcaccg gcgtcttcgc cggcgccatc tgggacgact acgccaccct gaagcaccgc 660
    cagggcggcg ccgcgatcac cccgcacacc gtcaccggcc tccaccgcgg catcatcgcg 720
    aaccgactct cgtacacgct cgggctccgc ggccccagca tggtcgtcga ctccggccag 780
    tcctcgtcgc tcgtcgccgt ccacctcgcg tgcgagagcc tgcggcgcgg cgagtccgag 840
    ctcgccctcg ccggcggcgt ctcgctcaac ctggtgccgg acagcatcat cggggcgagc 900
    aagttcggcg gcctctcccc cgacggccgc gcctacacct tcgacgcgcg cgccaacggc 960
    tacgtacgcg gcgagggcgg cggtttcgtc gtcctgaagc gcctctcccg ggccgtcgcc 1020
    gacggcgacc cggtgctcgc cgtgatccgg ggcagcgccg tcaacaacgg cggcgccgcc 1080
    cagggcatga cgacccccga cgcgcaggcg caggaggccg tgctccgcga ggcccacgag 1140
    cgggccggga ccgcgccggc cgacgtgcgg tacgtcgagc tgcacggcac cggcaccccc 1200
    gtgggcgacc cgatcgaggc cgctgcgctc ggcgccgccc tcggcaccgg ccgcccggcc 1260
    ggacagccgc tcctggtcgg ctcggtcaag acgaacatcg gccacctgga gggcgcggcc 1320
    ggcatcgccg gcctcatcaa ggccgtcctg gcggtccgcg gtcgcgcgct gcccgccagc 1380
    ctgaactacg agaccccgaa cccggcgatc ccgttcgagg aactgaacct ccgggtgaac 1440
    acggagtacc tgccgtggga gccggagcac gacgggcagc ggatggtcgt cggcgtgtcc 1500
    tcgttcggca tgggcggcac gaacgcgcat gtcgtgctcg aagaggcccc cgggggttgt 1560
    cgaggtgctt cggtcgtgga gtcgacggtc ggcgggtcgg cggtcggcgg cggtgtggtg 1620
    ccgtgggtgg tgtcggcgaa gtccgctgcc gcgctggacg cgcagatcga gcggcttgcc 1680
    gcgttcgcct cgcgggatcg tacggatggt gtcgacgcgg gcgctgtcga tgcgggtgct 1740
    gtcgatgcgg gtgctgtcgc tcgcgtactg gccggcgggc gtgctcagtt cgagcaccgg 1800
    gccgtcgtcg tcggcagcgg gccggacgat ctggcggcag cgctggccgc gcctgagggt 1860
    ctggtccggg gcgtggcttc cggtgtcggg cgagtggcgt tcgtgttccc cgggcagggc 1920
    acgcagtggg ccggcatggg tgccgaactg ctggactctt ccgcggtgtt cgcggcggcc 1980
    atggccgaat gcgaggccgc actctccccg tacgtcgact ggtcgctgga ggccgtcgta 2040
    cggcaggccc ccggtgcgcc cacgctggag cgggtcgatg tcgtgcagcc tgtgacgttc 2100
    gccgtcatgg tctcgctggc tcgcgtgtgg cagcaccacg gggtgacgcc ccaggcggtc 2160
    gtcggccact cgcagggcga gatcgccgcc gcgtacgtcg ccggtgccct gagcctggac 2220
    gacgccgctc gtgtcgtgac cctgcgcagc aagtccatcg ccgcccacct cgccggcaag 2280
    ggcggcatgc tgtccctcgc gctgagcgag gacgccgtcc tggagcgact ggccgggttc 2340
    gacgggctgt ccgtcgccgc tgtgaacggg cccaccgcca ccgtggtctc cggtgacccc 2400
    gtacagatcg aagagcttgc tcgggcgtgt gaggccgatg gggtccgtgc gcgggtcatt 2460
    cccgtcgact acgcgtccca cagccggcag gtcgagatca tcgagagcga gctcgccgag 2520
    gtcctcgccg ggctcagccc gcaggctccg cgcgtgccgt tcttctcgac actcgaaggc 2580
    gcctggatca ccgagcccgt gctcgacggc ggctactggt accgcaacct gcgccatcgt 2640
    gtgggcttcg ccccggccgt cgagaccctg gccaccgacg agggcttcac ccacttcgtc 2700
    gaggtcagcg cccaccccgt cctcaccatg gccctccccg ggaccgtcac cggtctggcg 2760
    accctgcgtc gcgacaacgg cggtcaggac cgcctagtcg cctccctcgc cgaagcatgg 2820
    gccaacggac tcgcggtcga ctggagcccg ctcctcccct ccgcgaccgg ccaccactcc 2880
    gacctcccca cctacgcgtt ccagaccgag cgccactggc tgggcgagat cgaggcgctc 2940
    gccccggcgg gcgagccggc ggtgcagccc gccgtcctcc gcacggaggc ggccgagccg 3000
    gcggagctcg accgggacga gcagctgcgc gtgatcctgg acaaggtccg ggcgcagacg 3060
    gcccaggtgc tggggtacgc gacaggcggg cagatcgagg tcgaccggac cttccgtgag 3120
    gccggttgca cctccctgac cggcgtggac ctgcgcaacc ggatcaacgc cgccttcggc 3180
    gtacggatgg cgccgtccat gatcttcgac ttccccaccc ccgaggctct cgcggagcag 3240
    ctgctcctcg tcgtgcacgg ggaggcggcg gcgaacccgg ccggtgcgga gccggctccg 3300
    gtggcggcgg ccggtgccgt cgacgagccg gtggcgatcg tcggcatggc ctgccgcctg 3360
    cccggtgggg tcgcctcgcc ggaggacctg tggcggctgg tggccggcgg cggggacgcg 3420
    atctcggagt tcccgcagga ccgcggctgg gacgtggagg ggctgtacca cccggatccg 3480
    gagcaccccg gcacgtcgta cgtccgccag ggcggtttca tcgagaacgt cgccggcttc 3540
    gacgcggcct tcttcgggat ctcgccgcgc gaggccctcg ccatggaccc gcagcagcgg 3600
    ctcctcctcg aaacctcctg ggaggccgtc gaggacgccg ggatcgaccc gacctccctg 3660
    cggggacggc aggtcggcgt cttcactggg gcgatgaccc acgagtacgg gccgagcctg 3720
    cgggacggcg gggaaggcct cgacggctac ctgctgaccg gcaacacggc cagcgtgatg 3780
    tcgggccgcg tctcgtacac actcggcctt gagggccccg ccctgacggt ggacacggcc 3840
    tgctcgtcgt cgctggtcgc cctgcacctc gccgtgcagg ccctgcgcaa gggcgaggtc 3900
    gacatggcgc tcgccggcgg cgtggccgtg atgcccacgc ccgggatgtt cgtcgagttc 3960
    agccggcagc gcgggctggc cggggacggc cggtcgaagg cgttcgccgc gtcggcggac 4020
    ggcaccagct ggtccgaggg cgtcggcgtc ctcctcgtcg agcgcctgtc ggacgcccgc 4080
    cgcaacggac accaggtcct cgcggtcgtc cgcggcagcg ccttgaacca ggacggcgcg 4140
    agcaacggcc tcacggctcc gaacgggccc tcgcagcagc gcgtcatccg gcgcgcgctg 4200
    gcggacgccc ggctgacgac ctccgacgtg gacgtcgtcg aggcacacgg cacgggcacg 4260
    cgactcggcg acccgatcga ggcgcaggcc ctgatcgcca cctacggcca gggccgtgac 4320
    gacgaacagc cgctgcgcct cgggtcgttg aagtccaaca tcgggcacac ccaggccgcg 4380
    gccggcgtct ccggtgtcat caagatggtc caggcgatgc gccacggact gctgccgaag 4440
    acgctgcacg tcgacgagcc ctcggaccag atcgactggt cggctggcgc cgtggaactc 4500
    ctcaccgagg ccgtcgactg gccggagaag caggacggcg ggctgcgccg ggccgccgtc 4560
    tcctccttcg ggatcagcgg caccaatgcg catgtggtgc tcgaagaggc cccggtggtt 4620
    gtcgagggtg cttcggtcgt cgagccgtcg gttggcgggt cggcggtcgg cggcggtgtg 4680
    acgccttggg tggtgtcggc gaagtccgct gccgcgctcg acgcgcagat cgagcggctt 4740
    gccgcattcg cctcgcggga tcgtacggat gacgccgacg ccggtgctgt cgacgcgggc 4800
    gctgtcgctc acgtactggc tgacgggcgt gctcagttcg agcaccgggc cgtcgcgctc 4860
    ggcgccgggg cggacgacct cgtacaggcg ctggccgatc cggacgggct gatacgcgga 4920
    acggcttccg gtgtcgggcg agtggcgttc gtgttccccg gtcagggcac gcagtgggct 4980
    ggcatgggtg ccgaactgct ggactcttcc gcggtgttcg cggcggccat ggccgagtgt 5040
    gaggccgcgc tgtccccgta cgtcgactgg tcgctggagg ccgtcgtacg gcaggccccc 5100
    ggtgcgccca cgctggagcg ggtcgatgtc gtgcagcctg tgacgttcgc cgtcatggtc 5160
    tcgctggctc gcgtgtggca gcaccacggt gtgacgcccc aggcggtcgt cggccactcg 5220
    cagggcgaga tcgccgccgc gtacgtcgcc ggagccctgc ccctggacga cgccgcccgc 5280
    gtcgtcaccc tgcgcagcaa gtccatcgcc gcccacctcg ccggcaaggg cggcatgctg 5340
    tccctcgcgc tgaacgagga cgccgtcctg gagcgactga gtgacttcga cgggctgtcc 5400
    gtcgccgccg tcaacgggcc caccgccact gtcgtgtcgg gtgaccccgt acagatcgaa 5460
    gagcttgctc aggcgtgcaa ggcggacgga ttccgcgcgc ggatcattcc cgtcgactac 5520
    gcgtcccaca gccggcaggt cgagatcatc gagagcgagc tcgcccaggt cctcgccggt 5580
    ctcagcccgc aggccccgcg cgtgccgttc ttctcgacgc tcgaaggcac ctggatcacc 5640
    gagcccgtcc tcgacggcac ctactggtac cgcaacctcc gtcaccgcgt cggcttcgcc 5700
    cccgccatcg agaccctggc cgtcgacgag ggcttcacgc acttcgtcga ggtcagcgcc 5760
    caccccgtcc tcaccatgac cctccccgag accgtcaccg gcctcggcac cctccgtcgc 5820
    gaacagggag gccaagagcg tctggtcacc tcgctcgccg aggcgtgggt caacgggctt 5880
    cccgtggcat ggacttcgct cctgcccgcc acggcctccc gccccggtct gcccacctac 5940
    gccttccagg ccgagcgcta ctggctcgag aacactcccg ccgccctggc caccggcgac 6000
    gactggcgct accgcatcga ctggaagcgc ctcccggccg ccgaggggtc cgagcgcacc 6060
    ggcctgtccg gccgctggct cgccgtcacg ccggaggacc actccgcgca ggccgccgcc 6120
    gtgctcaccg cgctggtcga cgccggggcg aaggtcgagg tgctgacggc cggggcggac 6180
    gacgaccgtg aggccctcgc cgcccggctc accgcactga cgaccggtga cggcttcacc 6240
    ggcgtggtct cgctcctcga cggactcgta ccgcaggtcg cctgggtcca ggcgctcggc 6300
    gacgccggaa tcaaggcgcc cctgtggtcc gtcacccagg gcgcggtctc cgtcggacgt 6360
    ctcgacaccc ccgccgaccc cgaccgggcc atgctctggg gcctcggccg cgtcgtcgcc 6420
    cttgagcacc ccgaacgctg ggccggcctc gtcgacctcc ccgcccagcc cgatgccgcc 6480
    gccctcgccc acctcgtcac cgcactctcc ggcgccaccg gcgaggacca gatcgccatc 6540
    cgcaccaccg gactccacgc ccgccgcctc gcccgcgcac ccctccacgg acgtcggccc 6600
    acccgcgact ggcagcccca cggcaccgtc ctcatcaccg gcggcaccgg agccctcggc 6660
    agccacgccg cacgctggat ggcccaccac ggagccgaac acctcctcct cgtcagccgc 6720
    agcggcgaac aagcccccgg agccacccaa ctcaccgccg aactcaccgc atcgggcgcc 6780
    cgcgtcacca tcgccgcctg cgacgtcgcc gacccccacg ccatgcgcac cctcctcgac 6840
    gccatccccg ccgagacgcc cctcaccgcc gtcgtccaca ccgccggcgc gctcgacgac 6900
    ggcatcgtgg acacgctgac cgccgagcag gtccggcggg cccaccgtgc gaaggccgtc 6960
    ggcgcctcgg tgctcgacga gctgacccgg gacctcgacc tcgacgcgtt cgtgctcttc 7020
    tcgtccgtgt cgagcactct gggcatcccc ggtcagggca actacgcccc gcacaacgcc 7080
    tacctcgacg ccctcgcggc tcgccgccgg gccaccggcc ggtccgccgt ctcggtggcc 7140
    tggggaccgt gggacggtgg cggcatggcc gccggtgacg gcgtggccga gcggctgcgc 7200
    aaccacggcg tgcccggcat ggacccggaa ctcgccctgg ccgcactgga gtccgcgctc 7260
    ggccgggacg agaccgcgat caccgtcgcg gacatcgact gggaccgctt ctacctcgcg 7320
    tactcctccg gtcgcccgca gcccctcgtc gaggagctgc ccgaggtgcg gcgcatcatc 7380
    gacgcacggg acagcgccac gtccggacag ggcgggagct ccgcccaggg cgccaacccc 7440
    ctggccgagc ggctggccgc cgcggctccc ggcgagcgta cggagatcct cctcggtctc 7500
    gtacgggcgc aggccgccgc cgtgctccgg atgcgttcgc cggaggacgt cgccgccgac 7560
    cgcgccttca aggacatcgg cttcgactcg ctcgccggtg tcgagctgcg caacaggctg 7620
    acccgggcga ccgggctcca gctgcccgcg acgctcgtct tcgaccaccc gacgccgctg 7680
    gccctcgtgt cgctgctccg cagcgagttc ctcggtgacg aggagacggc ggacgcccgg 7740
    cggtccgcgg cgctgcccgc gactgtcggt gccggtgccg gcgccggcgc cggcaccgat 7800
    gccgacgacg atccgatcgc gatcgtcgcg atgagctgcc gctaccccgg tgacatccgc 7860
    agcccggagg acctgtggcg gatgctgtcc gagggcggcg agggcatcac gccgttcccc 7920
    accgaccgcg gctgggacct cgacggcctg tacgacgccg acccggacgc gctcggcagg 7980
    gcgtacgtcc gcgagggcgg gttcctgcac gacgcggccg agttcgacgc ggagttcttc 8040
    ggcgtctcgc cgcgcgaggc gctggccatg gacccgcagc agcggatgct cctgacgacg 8100
    tcctgggagg ccttcgagcg ggccggcatc gagccggcat cgctgcgcgg cagcagcacc 8160
    ggtgtcttca tcggcctctc ctaccaggac tacgcggccc gcgtcccgaa cgccccgcgt 8220
    ggcgtggagg gttacctgct gaccggcagc acgccgagcg tcgcgtcggg ccgtatcgcg 8280
    tacaccttcg gtctcgaagg gcccgcgacg accgtcgaca ccgcctgctc gtcgtcgctg 8340
    accgccctgc acctggcggt gcgggcgctg cgcagcggcg agtgcacgat ggcgctcgcc 8400
    ggtggcgtgg cgatgatggc gaccccgcac atgttcgtgg agttcagccg tcagcgggcg 8460
    ctcgccccgg acggccgcag caaggccttc tcggcggacg ccgacgggtt cggcgccgcg 8520
    gagggcgtcg gcctgctgct cgtggagcgg ctctcggacg cgcggcgcaa cggtcacccg 8580
    gtgctcgccg tggtccgcgg taccgccgtc aaccaggacg gcgccagcaa cgggctgacc 8640
    gcgcccaacg gaccctcgca gcagcgggtg atccggcagg cgctcgccga cgcccggctg 8700
    gcacccggcg acatcgacgc cgtcgagacg cacggcacgg gaacctcgct gggcgacccc 8760
    atcgaggccc agggcctcca ggccacgtac ggcaaggagc ggcccgcgga acggccgctc 8820
    gccatcggct ccgtgaagtc caacatcgga cacacccagg ccgcggccgg tgcggcgggc 8880
    atcatcaaga tggtcctcgc gatgcgccac ggcaccctgc cgaagaccct ccacgccgac 8940
    gagccgagcc cgcacgtcga ctgggcgaac agcggcctgg ccctcgtcac cgagccgatc 9000
    gactggccgg ccggcaccgg tccgcgccgc gccgccgtct cctccttcgg catcagcggg 9060
    acgaacgcgc acgtcgtgct ggagcaggcg ccggatgctg ctggtgaggt gcttggggcc 9120
    gatgaggtgc ctgaggtgtc tgagacggta gcgatggctg ggacggctgg gacctccgag 9180
    gtcgctgagg gctctgaggc ctccgaggcc cccgcggccc ccggcagccg tgaggcgtcc 9240
    ctccccgggc acctgccctg ggtgctgtcc gccaaggacg agcagtcgct gcgcggccag 9300
    gccgccgccc tgcacgcgtg gctgtccgag cccgccgccg acctgtcgga cgcggacgga 9360
    ccggcccgcc tgcgggacgt cgggtacacg ctcgccacga gccgtaccgc cttcgcgcac 9420
    cgcgccgccg tgaccgccgc cgaccgggac gggttcctgg acgggctggc cacgctggcc 9480
    cagggcggca cctcggccca cgtccacctg gacaccgccc gggacggcac caccgcgttc 9540
    ctcttcaccg gccagggcag tcagcgcccc ggcgccggcc gtgagctgta cgaccggcac 9600
    cccgtcttcg cccgggcgct cgacgagatc tgcgcccacc tcgacggtca cctcgaactg 9660
    cccctgctcg acgtgatgtt cgcggccgag ggcagcgcgg aggccgcgct gctcgacgag 9720
    acgcggtaca cgcagtgcgc gctgttcgcc ctggaggtcg cgctcttccg gctcgtcgag 9780
    agctggggca tgcggccggc cgcactgctc ggtcactcgg tcggcgagat cgccgccgcg 9840
    cacgtcgccg gtgtgttctc gctcgccgac gccgcccgcc tggtcgccgc gcgcggccgg 9900
    ctcatgcagg agctgcccgc cggtggcgcg atgctcgccg tccaggccgc ggaggacgag 9960
    atccgcgtgt ggctggagac ggaggagcgg tacgcgggac gtctggacgt cgccgccgtc 10020
    aacggccccg aggccgccgt cctgtccggc gacgcggacg cggcgcggga ggcggaggcg 10080
    tactggtccg ggctcggccg caggacccgc gcgctgcggg tcagccacgc cttccactcc 10140
    gcgcacatgg acggcatgct cgacgggttc cgcgccgtcc tggagacggt ggagttccgg 10200
    cgcccctccc tgaccgtggt ctcgaacgtc accggcctgg ccgccggccc ggacgacctg 10260
    tgcgaccccg agtactgggt ccggcacgtc cgcggcaccg tccgcttcct cgacggcgtc 10320
    cgtgtcctgc gcgacctcgg cgtgcggacc tgcctggagc tgggccccga cggggtcctc 10380
    accgccatgg cggccgacgg cctcgcggac acccccgcgg attccgctgc cggctccccc 10440
    gtcggctctc ccgccggctc tcccgccgac tccgccgccg gcgcgctccg gccccggccg 10500
    ctgctcgtgg cgctgctgcg ccgcaagcgg tcggagaccg agaccgtcgc ggacgccctc 10560
    ggcagggcgc acgcccacgg caccggaccc gactggcacg cctggttcgc cggctccggg 10620
    gcgcaccgcg tggacctgcc cacgtactcc ttccggcgcg accgctactg gctggacgcc 10680
    ccggcggccg acaccgcggt ggacaccgcc ggcctcggtc tcggcaccgc cgaccacccg 10740
    ctgctcggcg ccgtggtcag ccttccggac cgggacggcc tgctgctcac cggccgcctc 10800
    tccctgcgca cccacccgtg gctcgcggac cacgccgtcc tggggagcgt cctgctcccc 10860
    ggcgccgcga tggtcgaact cgccgcgcac gctgcggagt ccgccggtct gcgtgacgtg 10920
    cgggagctga ccctccttga accgctggta ctgcccgagc acggtggcgt cgagctgcgc 10980
    gtgacggtcg gggcgccggc cggagagccc ggtggcgagt cggccgggga cggcgcacgg 11040
    cccgtctccc tccactcgcg gctcgccgac gcgcccgccg gtaccgcctg gtcctgccac 11100
    gcgaccggtc tgctggccac cgaccggccc gagcttcccg tcgcgcccga ccgtgcggcc 11160
    atgtggccgc cgcagggcgc cgaggaggtg ccgctcgacg gtctctacga gcggctcgac 11220
    gggaacggcc tcgccttcgg tccgctgttc caggggctga acgcggtgtg gcggtacgag 11280
    ggtgaggtct tcgccgacat cgcgctcccc gccaccacga atgcgaccgc gcccgcgacc 11340
    gcgaacggcg gcgggagtgc ggcggcggcc ccctacggca tccaccccgc cctgctcgac 11400
    gcttcgctgc acgccatcgc ggtcggcggt ctcgtcgacg agcccgagct cgtccgcgtc 11460
    cccttccact ggagcggtgt caccgtgcac gcggccggtg ccgcggcggc ccgggtccgt 11520
    ctcgcctccg cggggacgga cgccgtctcg ctgtccctga cggacggcga gggacgcccg 11580
    ctggtctccg tggaacggct cacgctgcgc ccggtcaccg ccgatcaggc ggcggcgagc 11640
    cgcgtcggcg ggctgatgca ccgggtggcc tggcgtccgt acgccctcgc ctcgtccggc 11700
    gaacaggacc cgcacgccac ttcgtacggg ccgaccgccg tcctcggcaa ggacgagctg 11760
    aaggtcgccg ccgccctgga gtccgcgggc gtcgaagtcg ggctctaccc cgacctggcc 11820
    gcgctgtccc aggacgtggc ggccggcgcc ccggcgcccc gtaccgtcct tgcgccgctg 11880
    cccgcgggtc ccgccgacgg cggcgcggag ggtgtacggg gcacggtggc ccggacgctg 11940
    gagctgctcc aggcctggct ggccgacgag cacctcgcgg gcacccgcct gctcctggtc 12000
    acccgcggtg cggtgcggga ccccgagggg tccggcgccg acgatggcgg cgaggacctg 12060
    tcgcacgcgg ccgcctgggg tctcgtacgg accgcgcaga ccgagaaccc cggccgcttc 12120
    ggccttctcg acctggccga cgacgcctcg tcgtaccgga ccctgccgtc ggtgctctcc 12180
    gacgcgggcc tgcgcgacga accgcagctc gccctgcacg acggcaccat caggctggcc 12240
    cgcctggcct ccgtccggcc cgagaccggc accgccgcac cggcgctcgc cccggagggc 12300
    acggtcctgc tgaccggcgg caccggcggc ctgggcggac tggtcgcccg gcacgtggtg 12360
    ggcgagtggg gcgtacgacg cctgctgctg gtgagccggc ggggcacgga cgccccgggc 12420
    gccgacgagc tcgtgcacga gctggaggcc ctgggagccg acgtctcggt ggccgcgtgc 12480
    gacgtcgccg accgcgaagc cctcaccgcc gtactcgacg ccatccccgc cgaacacccg 12540
    ctcaccgcgg tcgtccacac ggcaggcgtc ctctccgacg gcaccctccc gtccatgacg 12600
    acggaggacg tggaacacgt actgcggccc aaggtcgacg ccgcgttcct cctcgacgaa 12660
    ctcacctcga cgcccgcata cgacctggca gcgttcgtca tgttctcctc cgccgccgcc 12720
    gtcttcggtg gcgcggggca gggcgcctac gccgccgcca acgccaccct cgacgccctc 12780
    gcctggcgcc gccgggcagc cggactcccc gccctctccc tcggctgggg cctctgggcc 12840
    gagaccagcg gcatgaccgg cgagctcggc caggcggacc tgcgccggat gagccgcgcg 12900
    ggcatcggcg ggatcagcga cgccgagggc atcgcgctcc tcgacgccgc cctccgcgac 12960
    gaccgccacc cggtcctgct gcccctgcgg ctcgacgccg ccgggctgcg ggacgcggcc 13020
    gggaacgacc cggccggaat cccggcgctc ttccgggacg tcgtcggcgc caggaccgtc 13080
    cgggcccggc cgtccgcggc ctccgcctcg acgacagccg ggacggccgg cacgccgggg 13140
    acggcggacg gcgcggcgga aacggcggcg gtcacgctcg ccgaccgggc cgccaccgtg 13200
    gacgggcccg cacggcagcg cctgctgctc gagttcgtcg tcggcgaggt cgccgaagta 13260
    ctcggccacg cccgcggtca ccggatcgac gccgaacggg gcttcctcga cctcggcttc 13320
    gactccctga ccgccgtcga actccgcaac cggctcaact ccgccggtgg cctcgccctc 13380
    ccggcgaccc tggtcttcga ccacccaagc ccggcggcac tcgcctccca cctggacgcc 13440
    gagctgccgc gcggcgcctc ggaccaggac ggagccggga accggaacgg gaacgagaac 13500
    gggacgacgg cgtcccggag caccgccgag acggacgcgc tgctggcaca actgacccgc 13560
    ctggaaggcg ccttggtgct gacgggcctc tcggacgccc ccgggagcga agaagtcctg 13620
    gagcacctgc ggtccctgcg ctcgatggtc acgggcgaga ccgggaccgg gaccgcgtcc 13680
    ggagccccgg acggcgccgg gtccggcgcc gaggaccggc cctgggcggc cggggacgga 13740
    gccgggggcg ggagtgagga cggcgcggga gtgccggact tcatgaacgc ctcggccgag 13800
    gaactcttcg gcctcctcga ccaggacccc agcacggact ga 13842
    <210> SEQ ID NO 31
    <211> LENGTH: 4613
    <212> TYPE: PRT
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 31
    Met Ser Ser Ala Gly Ile Thr Arg Thr Gly Ala Arg Thr Pro Val Thr
    1 5 10 15
    Gly Arg Gly Ala Ala Ala Trp Asp Thr Gly Glu Val Arg Val Arg Arg
    20 25 30
    Gly Leu Pro Pro Ala Gly Pro Asp His Ala Glu His Ser Phe Ser Arg
    35 40 45
    Ala Pro Thr Gly Asp Val Arg Ala Glu Leu Ile Arg Gly Glu Met Ser
    50 55 60
    Thr Val Ser Lys Ser Glu Ser Glu Glu Phe Val Ser Val Ser Asn Asp
    5 70 75 80
    Ala Gly Ser Ala His Gly Thr Ala Glu Pro Val Ala Val Val Gly Ile
    85 90 95
    Ser Cys Arg Val Pro Gly Ala Arg Asp Pro Arg Glu Phe Trp Glu Leu
    100 105 110
    Leu Ala Ala Gly Gly Gln Ala Val Thr Asp Val Pro Ala Asp Arg Trp
    115 120 125
    Asn Ala Gly Asp Phe Tyr Asp Pro Asp Arg Ser Ala Pro Gly Arg Ser
    130 135 140
    Asn Ser Arg Trp Gly Gly Phe Ile Glu Asp Val Asp Arg Phe Asp Ala
    45 150 155 160
    Ala Phe Phe Gly Ile Ser Pro Arg Glu Ala Ala Glu Met Asp Pro Gln
    165 170 175
    Gln Arg Leu Ala Leu Glu Leu Gly Trp Glu Ala Leu Glu Arg Ala Gly
    180 185 190
    Ile Asp Pro Ser Ser Leu Thr Gly Thr Arg Thr Gly Val Phe Ala Gly
    195 200 205
    Ala Ile Trp Asp Asp Tyr Ala Thr Leu Lys His Arg Gln Gly Gly Ala
    210 215 220
    Ala Ile Thr Pro His Thr Val Thr Gly Leu His Arg Gly Ile Ile Ala
    25 230 235 240
    Asn Arg Leu Ser Tyr Thr Leu Gly Leu Arg Gly Pro Ser Met Val Val
    245 250 255
    Asp Ser Gly Gln Ser Ser Ser Leu Val Ala Val His Leu Ala Cys Glu
    260 265 270
    Ser Leu Arg Arg Gly Glu Ser Glu Leu Ala Leu Ala Gly Gly Val Ser
    275 280 285
    Leu Asn Leu Val Pro Asp Ser Ile Ile Gly Ala Ser Lys Phe Gly Gly
    290 295 300
    Leu Ser Pro Asp Gly Arg Ala Tyr Thr Phe Asp Ala Arg Ala Asn Gly
    305 310 315 320
    Tyr Val Arg Gly Glu Gly Gly Gly Phe Val Val Leu Lys Arg Leu Ser
    325 330 335
    Arg Ala Val Ala Asp Gly Asp Pro Val Leu Ala Val Ile Arg Gly Ser
    340 345 350
    Ala Val Asn Asn Gly Gly Ala Ala Gln Gly Met Thr Thr Pro Asp Ala
    355 360 365
    Gln Ala Gln Glu Ala Val Leu Arg Glu Ala His Glu Arg Ala Gly Thr
    370 375 380
    Ala Pro Ala Asp Val Arg Tyr Val Glu Leu His Gly Thr Gly Thr Pro
    385 390 395 400
    Val Gly Asp Pro Ile Glu Ala Ala Ala Leu Gly Ala Ala Leu Gly Thr
    405 410 415
    Gly Arg Pro Ala Gly Gln Pro Leu Leu Val Gly Ser Val Lys Thr Asn
    420 425 430
    Ile Gly His Leu Glu Gly Ala Ala Gly Ile Ala Gly Leu Ile Lys Ala
    435 440 445
    Val Leu Ala Val Arg Gly Arg Ala Leu Pro Ala Ser Leu Asn Tyr Glu
    450 455 460
    Thr Pro Asn Pro Ala Ile Pro Phe Glu Glu Leu Asn Leu Arg Val Asn
    465 470 475 480
    Thr Glu Tyr Leu Pro Trp Glu Pro Glu His Asp Gly Gln Arg Met Val
    485 490 495
    Val Gly Val Ser Ser Phe Gly Met Gly Gly Thr Asn Ala His Val Val
    500 505 510
    Leu Glu Glu Ala Pro Gly Gly Cys Arg Gly Ala Ser Val Val Glu Ser
    515 520 525
    Thr Val Gly Gly Ser Ala Val Gly Gly Gly Val Val Pro Trp Val Val
    530 535 540
    Ser Ala Lys Ser Ala Ala Ala Leu Asp Ala Gln Ile Glu Arg Leu Ala
    545 550 555 560
    Ala Phe Ala Ser Arg Asp Arg Thr Asp Gly Val Asp Ala Gly Ala Val
    565 570 575
    Asp Ala Gly Ala Val Asp Ala Gly Ala Val Ala Arg Val Leu Ala Gly
    580 585 590
    Gly Arg Ala Gln Phe Glu His Arg Ala Val Val Val Gly Ser Gly Pro
    595 600 605
    Asp Asp Leu Ala Ala Ala Leu Ala Ala Pro Glu Gly Leu Val Arg Gly
    610 615 620
    Val Ala Ser Gly Val Gly Arg Val Ala Phe Val Phe Pro Gly Gln Gly
    625 630 635 640
    Thr Gln Trp Ala Gly Met Gly Ala Glu Leu Leu Asp Ser Ser Ala Val
    645 650 655
    Phe Ala Ala Ala Met Ala Glu Cys Glu Ala Ala Leu Ser Pro Tyr Val
    660 665 670
    Asp Trp Ser Leu Glu Ala Val Val Arg Gln Ala Pro Gly Ala Pro Thr
    675 680 685
    Leu Glu Arg Val Asp Val Val Gln Pro Val Thr Phe Ala Val Met Val
    690 695 700
    Ser Leu Ala Arg Val Trp Gln His His Gly Val Thr Pro Gln Ala Val
    705 710 715 720
    Val Gly His Ser Gln Gly Glu Ile Ala Ala Ala Tyr Val Ala Gly Ala
    725 730 735
    Leu Ser Leu Asp Asp Ala Ala Arg Val Val Thr Leu Arg Ser Lys Ser
    740 745 750
    Ile Ala Ala His Leu Ala Gly Lys Gly Gly Met Leu Ser Leu Ala Leu
    755 760 765
    Ser Glu Asp Ala Val Leu Glu Arg Leu Ala Gly Phe Asp Gly Leu Ser
    770 775 780
    Val Ala Ala Val Asn Gly Pro Thr Ala Thr Val Val Ser Gly Asp Pro
    785 790 795 800
    Val Gln Ile Glu Glu Leu Ala Arg Ala Cys Glu Ala Asp Gly Val Arg
    805 810 815
    Ala Arg Val Ile Pro Val Asp Tyr Ala Ser His Ser Arg Gln Val Glu
    820 825 830
    Ile Ile Glu Ser Glu Leu Ala Glu Val Leu Ala Gly Leu Ser Pro Gln
    835 840 845
    Ala Pro Arg Val Pro Phe Phe Ser Thr Leu Glu Gly Ala Trp Ile Thr
    850 855 860
    Glu Pro Val Leu Asp Gly Gly Tyr Trp Tyr Arg Asn Leu Arg His Arg
    865 870 875 880
    Val Gly Phe Ala Pro Ala Val Glu Thr Leu Ala Thr Asp Glu Gly Phe
    885 890 895
    Thr His Phe Val Glu Val Ser Ala His Pro Val Leu Thr Met Ala Leu
    900 905 910
    Pro Gly Thr Val Thr Gly Leu Ala Thr Leu Arg Arg Asp Asn Gly Gly
    915 920 925
    Gln Asp Arg Leu Val Ala Ser Leu Ala Glu Ala Trp Ala Asn Gly Leu
    930 935 940
    Ala Val Asp Trp Ser Pro Leu Leu Pro Ser Ala Thr Gly His His Ser
    945 950 955 960
    Asp Leu Pro Thr Tyr Ala Phe Gln Thr Glu Arg His Trp Leu Gly Glu
    965 970 975
    Ile Glu Ala Leu Ala Pro Ala Gly Glu Pro Ala Val Gln Pro Ala Val
    980 985 990
    Leu Arg Thr Glu Ala Ala Glu Pro Ala Glu Leu Asp Arg Asp Glu Gln
    995 1000 1005
    Leu Arg Val Ile Leu Asp Lys Val Arg Ala Gln Thr Ala Gln Val Leu
    1010 1015 1020
    Gly Tyr Ala Thr Gly Gly Gln Ile Glu Val Asp Arg Thr Phe Arg Glu
    1025 1030 1035 1040
    Ala Gly Cys Thr Ser Leu Thr Gly Val Asp Leu Arg Asn Arg Ile Asn
    1045 1050 1055
    Ala Ala Phe Gly Val Arg Met Ala Pro Ser Met Ile Phe Asp Phe Pro
    1060 1065 1070
    Thr Pro Glu Ala Leu Ala Glu Gln Leu Leu Leu Val Val His Gly Glu
    1075 1080 1085
    Ala Ala Ala Asn Pro Ala Gly Ala Glu Pro Ala Pro Val Ala Ala Ala
    1090 1095 1100
    Gly Ala Val Asp Glu Pro Val Ala Ile Val Gly Met Ala Cys Arg Leu
    1105 1110 1115 1120
    Pro Gly Gly Val Ala Ser Pro Glu Asp Leu Trp Arg Leu Val Ala Gly
    1125 1130 1135
    Gly Gly Asp Ala Ile Ser Glu Phe Pro Gln Asp Arg Gly Trp Asp Val
    1140 1145 1150
    Glu Gly Leu Tyr His Pro Asp Pro Glu His Pro Gly Thr Ser Tyr Val
    1155 1160 1165
    Arg Gln Gly Gly Phe Ile Glu Asn Val Ala Gly Phe Asp Ala Ala Phe
    1170 1175 1180
    Phe Gly Ile Ser Pro Arg Glu Ala Leu Ala Met Asp Pro Gln Gln Arg
    1185 1190 1195 1200
    Leu Leu Leu Glu Thr Ser Trp Glu Ala Val Glu Asp Ala Gly Ile Asp
    1205 1210 1215
    Pro Thr Ser Leu Arg Gly Arg Gln Val Gly Val Phe Thr Gly Ala Met
    1220 1225 1230
    Thr His Glu Tyr Gly Pro Ser Leu Arg Asp Gly Gly Glu Gly Leu Asp
    1235 1240 1245
    Gly Tyr Leu Leu Thr Gly Asn Thr Ala Ser Val Met Ser Gly Arg Val
    1250 1255 1260
    Ser Tyr Thr Leu Gly Leu Glu Gly Pro Ala Leu Thr Val Asp Thr Ala
    1265 1270 1275 1280
    Cys Ser Ser Ser Leu Val Ala Leu His Leu Ala Val Gln Ala Leu Arg
    1285 1290 1295
    Lys Gly Glu Val Asp Met Ala Leu Ala Gly Gly Val Ala Val Met Pro
    1300 1305 1310
    Thr Pro Gly Met Phe Val Glu Phe Ser Arg Gln Arg Gly Leu Ala Gly
    1315 1320 1325
    Asp Gly Arg Ser Lys Ala Phe Ala Ala Ser Ala Asp Gly Thr Ser Trp
    1330 1335 1340
    Ser Glu Gly Val Gly Val Leu Leu Val Glu Arg Leu Ser Asp Ala Arg
    1345 1350 1355 1360
    Arg Asn Gly His Gln Val Leu Ala Val Val Arg Gly Ser Ala Leu Asn
    1365 1370 1375
    Gln Asp Gly Ala Ser Asn Gly Leu Thr Ala Pro Asn Gly Pro Ser Gln
    1380 1385 1390
    Gln Arg Val Ile Arg Arg Ala Leu Ala Asp Ala Arg Leu Thr Thr Ser
    1395 1400 1405
    Asp Val Asp Val Val Glu Ala His Gly Thr Gly Thr Arg Leu Gly Asp
    1410 1415 1420
    Pro Ile Glu Ala Gln Ala Leu Ile Ala Thr Tyr Gly Gln Gly Arg Asp
    1425 1430 1435 1440
    Asp Glu Gln Pro Leu Arg Leu Gly Ser Leu Lys Ser Asn Ile Gly His
    1445 1450 1455
    Thr Gln Ala Ala Ala Gly Val Ser Gly Val Ile Lys Met Val Gln Ala
    1460 1465 1470
    Met Arg His Gly Leu Leu Pro Lys Thr Leu His Val Asp Glu Pro Ser
    1475 1480 1485
    Asp Gln Ile Asp Trp Ser Ala Gly Ala Val Glu Leu Leu Thr Glu Ala
    1490 1495 1500
    Val Asp Trp Pro Glu Lys Gln Asp Gly Gly Leu Arg Arg Ala Ala Val
    1505 1510 1515 1520
    Ser Ser Phe Gly Ile Ser Gly Thr Asn Ala His Val Val Leu Glu Glu
    1525 1530 1535
    Ala Pro Val Val Val Glu Gly Ala Ser Val Val Glu Pro Ser Val Gly
    1540 1545 1550
    Gly Ser Ala Val Gly Gly Gly Val Thr Pro Trp Val Val Ser Ala Lys
    1555 1560 1565
    Ser Ala Ala Ala Leu Asp Ala Gln Ile Glu Arg Leu Ala Ala Phe Ala
    1570 1575 1580
    Ser Arg Asp Arg Thr Asp Asp Ala Asp Ala Gly Ala Val Asp Ala Gly
    1585 1590 1595 1600
    Ala Val Ala His Val Leu Ala Asp Gly Arg Ala Gln Phe Glu His Arg
    1605 1610 1615
    Ala Val Ala Leu Gly Ala Gly Ala Asp Asp Leu Val Gln Ala Leu Ala
    1620 1625 1630
    Asp Pro Asp Gly Leu Ile Arg Gly Thr Ala Ser Gly Val Gly Arg Val
    1635 1640 1645
    Ala Phe Val Phe Pro Gly Gln Gly Thr Gln Trp Ala Gly Met Gly Ala
    1650 1655 1660
    Glu Leu Leu Asp Ser Ser Ala Val Phe Ala Ala Ala Met Ala Glu Cys
    1665 1670 1675 1680
    Glu Ala Ala Leu Ser Pro Tyr Val Asp Trp Ser Leu Glu Ala Val Val
    1685 1690 1695
    Arg Gln Ala Pro Gly Ala Pro Thr Leu Glu Arg Val Asp Val Val Gln
    1700 1705 1710
    Pro Val Thr Phe Ala Val Met Val Ser Leu Ala Arg Val Trp Gln His
    1715 1720 1725
    His Gly Val Thr Pro Gln Ala Val Val Gly His Ser Gln Gly Glu Ile
    1730 1735 1740
    Ala Ala Ala Tyr Val Ala Gly Ala Leu Pro Leu Asp Asp Ala Ala Arg
    1745 1750 1755 1760
    Val Val Thr Leu Arg Ser Lys Ser Ile Ala Ala His Leu Ala Gly Lys
    1765 1770 1775
    Gly Gly Met Leu Ser Leu Ala Leu Asn Glu Asp Ala Val Leu Glu Arg
    1780 1785 1790
    Leu Ser Asp Phe Asp Gly Leu Ser Val Ala Ala Val Asn Gly Pro Thr
    1795 1800 1805
    Ala Thr Val Val Ser Gly Asp Pro Val Gln Ile Glu Glu Leu Ala Gln
    1810 1815 1820
    Ala Cys Lys Ala Asp Gly Phe Arg Ala Arg Ile Ile Pro Val Asp Tyr
    1825 1830 1835 1840
    Ala Ser His Ser Arg Gln Val Glu Ile Ile Glu Ser Glu Leu Ala Gln
    1845 1850 1855
    Val Leu Ala Gly Leu Ser Pro Gln Ala Pro Arg Val Pro Phe Phe Ser
    1860 1865 1870
    Thr Leu Glu Gly Thr Trp Ile Thr Glu Pro Val Leu Asp Gly Thr Tyr
    1875 1880 1885
    Trp Tyr Arg Asn Leu Arg His Arg Val Gly Phe Ala Pro Ala Ile Glu
    1890 1895 1900
    Thr Leu Ala Val Asp Glu Gly Phe Thr His Phe Val Glu Val Ser Ala
    1905 1910 1915 1920
    His Pro Val Leu Thr Met Thr Leu Pro Glu Thr Val Thr Gly Leu Gly
    1925 1930 1935
    Thr Leu Arg Arg Glu Gln Gly Gly Gln Glu Arg Leu Val Thr Ser Leu
    1940 1945 1950
    Ala Glu Ala Trp Val Asn Gly Leu Pro Val Ala Trp Thr Ser Leu Leu
    1955 1960 1965
    Pro Ala Thr Ala Ser Arg Pro Gly Leu Pro Thr Tyr Ala Phe Gln Ala
    1970 1975 1980
    Glu Arg Tyr Trp Leu Glu Asn Thr Pro Ala Ala Leu Ala Thr Gly Asp
    1985 1990 1995 2000
    Asp Trp Arg Tyr Arg Ile Asp Trp Lys Arg Leu Pro Ala Ala Glu Gly
    2005 2010 2015
    Ser Glu Arg Thr Gly Leu Ser Gly Arg Trp Leu Ala Val Thr Pro Glu
    2020 2025 2030
    Asp His Ser Ala Gln Ala Ala Ala Val Leu Thr Ala Leu Val Asp Ala
    2035 2040 2045
    Gly Ala Lys Val Glu Val Leu Thr Ala Gly Ala Asp Asp Asp Arg Glu
    2050 2055 2060
    Ala Leu Ala Ala Arg Leu Thr Ala Leu Thr Thr Gly Asp Gly Phe Thr
    2065 2070 2075 2080
    Gly Val Val Ser Leu Leu Asp Gly Leu Val Pro Gln Val Ala Trp Val
    2085 2090 2095
    Gln Ala Leu Gly Asp Ala Gly Ile Lys Ala Pro Leu Trp Ser Val Thr
    2100 2105 2110
    Gln Gly Ala Val Ser Val Gly Arg Leu Asp Thr Pro Ala Asp Pro Asp
    2115 2120 2125
    Arg Ala Met Leu Trp Gly Leu Gly Arg Val Val Ala Leu Glu His Pro
    2130 2135 2140
    Glu Arg Trp Ala Gly Leu Val Asp Leu Pro Ala Gln Pro Asp Ala Ala
    2145 2150 2155 2160
    Ala Leu Ala His Leu Val Thr Ala Leu Ser Gly Ala Thr Gly Glu Asp
    2165 2170 2175
    Gln Ile Ala Ile Arg Thr Thr Gly Leu His Ala Arg Arg Leu Ala Arg
    2180 2185 2190
    Ala Pro Leu His Gly Arg Arg Pro Thr Arg Asp Trp Gln Pro His Gly
    2195 2200 2205
    Thr Val Leu Ile Thr Gly Gly Thr Gly Ala Leu Gly Ser His Ala Ala
    2210 2215 2220
    Arg Trp Met Ala His His Gly Ala Glu His Leu Leu Leu Val Ser Arg
    2225 2230 2235 2240
    Ser Gly Glu Gln Ala Pro Gly Ala Thr Gln Leu Thr Ala Glu Leu Thr
    2245 2250 2255
    Ala Ser Gly Ala Arg Val Thr Ile Ala Ala Cys Asp Val Ala Asp Pro
    2260 2265 2270
    His Ala Met Arg Thr Leu Leu Asp Ala Ile Pro Ala Glu Thr Pro Leu
    2275 2280 2285
    Thr Ala Val Val His Thr Ala Gly Ala Leu Asp Asp Gly Ile Val Asp
    2290 2295 2300
    Thr Leu Thr Ala Glu Gln Val Arg Arg Ala His Arg Ala Lys Ala Val
    2305 2310 2315 2320
    Gly Ala Ser Val Leu Asp Glu Leu Thr Arg Asp Leu Asp Leu Asp Ala
    2325 2330 2335
    Phe Val Leu Phe Ser Ser Val Ser Ser Thr Leu Gly Ile Pro Gly Gln
    2340 2345 2350
    Gly Asn Tyr Ala Pro His Asn Ala Tyr Leu Asp Ala Leu Ala Ala Arg
    2355 2360 2365
    Arg Arg Ala Thr Gly Arg Ser Ala Val Ser Val Ala Trp Gly Pro Trp
    2370 2375 2380
    Asp Gly Gly Gly Met Ala Ala Gly Asp Gly Val Ala Glu Arg Leu Arg
    2385 2390 2395 2400
    Asn His Gly Val Pro Gly Met Asp Pro Glu Leu Ala Leu Ala Ala Leu
    2405 2410 2415
    Glu Ser Ala Leu Gly Arg Asp Glu Thr Ala Ile Thr Val Ala Asp Ile
    2420 2425 2430
    Asp Trp Asp Arg Phe Tyr Leu Ala Tyr Ser Ser Gly Arg Pro Gln Pro
    2435 2440 2445
    Leu Val Glu Glu Leu Pro Glu Val Arg Arg Ile Ile Asp Ala Arg Asp
    2450 2455 2460
    Ser Ala Thr Ser Gly Gln Gly Gly Ser Ser Ala Gln Gly Ala Asn Pro
    2465 2470 2475 2480
    Leu Ala Glu Arg Leu Ala Ala Ala Ala Pro Gly Glu Arg Thr Glu Ile
    2485 2490 2495
    Leu Leu Gly Leu Val Arg Ala Gln Ala Ala Ala Val Leu Arg Met Arg
    2500 2505 2510
    Ser Pro Glu Asp Val Ala Ala Asp Arg Ala Phe Lys Asp Ile Gly Phe
    2515 2520 2525
    Asp Ser Leu Ala Gly Val Glu Leu Arg Asn Arg Leu Thr Arg Ala Thr
    2530 2535 2540
    Gly Leu Gln Leu Pro Ala Thr Leu Val Phe Asp His Pro Thr Pro Leu
    2545 2550 2555 2560
    Ala Leu Val Ser Leu Leu Arg Ser Glu Phe Leu Gly Asp Glu Glu Thr
    2565 2570 2575
    Ala Asp Ala Arg Arg Ser Ala Ala Leu Pro Ala Thr Val Gly Ala Gly
    2580 2585 2590
    Ala Gly Ala Gly Ala Gly Thr Asp Ala Asp Asp Asp Pro Ile Ala Ile
    2595 2600 2605
    Val Ala Met Ser Cys Arg Tyr Pro Gly Asp Ile Arg Ser Pro Glu Asp
    2610 2615 2620
    Leu Trp Arg Met Leu Ser Glu Gly Gly Glu Gly Ile Thr Pro Phe Pro
    2625 2630 2635 2640
    Thr Asp Arg Gly Trp Asp Leu Asp Gly Leu Tyr Asp Ala Asp Pro Asp
    2645 2650 2655
    Ala Leu Gly Arg Ala Tyr Val Arg Glu Gly Gly Phe Leu His Asp Ala
    2660 2665 2670
    Ala Glu Phe Asp Ala Glu Phe Phe Gly Val Ser Pro Arg Glu Ala Leu
    2675 2680 2685
    Ala Met Asp Pro Gln Gln Arg Met Leu Leu Thr Thr Ser Trp Glu Ala
    2690 2695 2700
    Phe Glu Arg Ala Gly Ile Glu Pro Ala Ser Leu Arg Gly Ser Ser Thr
    2705 2710 2715 2720
    Gly Val Phe Ile Gly Leu Ser Tyr Gln Asp Tyr Ala Ala Arg Val Pro
    2725 2730 2735
    Asn Ala Pro Arg Gly Val Glu Gly Tyr Leu Leu Thr Gly Ser Thr Pro
    2740 2745 2750
    Ser Val Ala Ser Gly Arg Ile Ala Tyr Thr Phe Gly Leu Glu Gly Pro
    2755 2760 2765
    Ala Thr Thr Val Asp Thr Ala Cys Ser Ser Ser Leu Thr Ala Leu His
    2770 2775 2780
    Leu Ala Val Arg Ala Leu Arg Ser Gly Glu Cys Thr Met Ala Leu Ala
    2785 2790 2795 2800
    Gly Gly Val Ala Met Met Ala Thr Pro His Met Phe Val Glu Phe Ser
    2805 2810 2815
    Arg Gln Arg Ala Leu Ala Pro Asp Gly Arg Ser Lys Ala Phe Ser Ala
    2820 2825 2830
    Asp Ala Asp Gly Phe Gly Ala Ala Glu Gly Val Gly Leu Leu Leu Val
    2835 2840 2845
    Glu Arg Leu Ser Asp Ala Arg Arg Asn Gly His Pro Val Leu Ala Val
    2850 2855 2860
    Val Arg Gly Thr Ala Val Asn Gln Asp Gly Ala Ser Asn Gly Leu Thr
    2865 2870 2875 2880
    Ala Pro Asn Gly Pro Ser Gln Gln Arg Val Ile Arg Gln Ala Leu Ala
    2885 2890 2895
    Asp Ala Arg Leu Ala Pro Gly Asp Ile Asp Ala Val Glu Thr His Gly
    2900 2905 2910
    Thr Gly Thr Ser Leu Gly Asp Pro Ile Glu Ala Gln Gly Leu Gln Ala
    2915 2920 2925
    Thr Tyr Gly Lys Glu Arg Pro Ala Glu Arg Pro Leu Ala Ile Gly Ser
    2930 2935 2940
    Val Lys Ser Asn Ile Gly His Thr Gln Ala Ala Ala Gly Ala Ala Gly
    2945 2950 2955 2960
    Ile Ile Lys Met Val Leu Ala Met Arg His Gly Thr Leu Pro Lys Thr
    2965 2970 2975
    Leu His Ala Asp Glu Pro Ser Pro His Val Asp Trp Ala Asn Ser Gly
    2980 2985 2990
    Leu Ala Leu Val Thr Glu Pro Ile Asp Trp Pro Ala Gly Thr Gly Pro
    2995 3000 3005
    Arg Arg Ala Ala Val Ser Ser Phe Gly Ile Ser Gly Thr Asn Ala His
    3010 3015 3020
    Val Val Leu Glu Gln Ala Pro Asp Ala Ala Gly Glu Val Leu Gly Ala
    3025 3030 3035 3040
    Asp Glu Val Pro Glu Val Ser Glu Thr Val Ala Met Ala Gly Thr Ala
    3045 3050 3055
    Gly Thr Ser Glu Val Ala Glu Gly Ser Glu Ala Ser Glu Ala Pro Ala
    3060 3065 3070
    Ala Pro Gly Ser Arg Glu Ala Ser Leu Pro Gly His Leu Pro Trp Val
    3075 3080 3085
    Leu Ser Ala Lys Asp Glu Gln Ser Leu Arg Gly Gln Ala Ala Ala Leu
    3090 3095 3100
    His Ala Trp Leu Ser Glu Pro Ala Ala Asp Leu Ser Asp Ala Asp Gly
    3105 3110 3115 3120
    Pro Ala Arg Leu Arg Asp Val Gly Tyr Thr Leu Ala Thr Ser Arg Thr
    3125 3130 3135
    Ala Phe Ala His Arg Ala Ala Val Thr Ala Ala Asp Arg Asp Gly Phe
    3140 3145 3150
    Leu Asp Gly Leu Ala Thr Leu Ala Gln Gly Gly Thr Ser Ala His Val
    3155 3160 3165
    His Leu Asp Thr Ala Arg Asp Gly Thr Thr Ala Phe Leu Phe Thr Gly
    3170 3175 3180
    Gln Gly Ser Gln Arg Pro Gly Ala Gly Arg Glu Leu Tyr Asp Arg His
    3185 3190 3195 3200
    Pro Val Phe Ala Arg Ala Leu Asp Glu Ile Cys Ala His Leu Asp Gly
    3205 3210 3215
    His Leu Glu Leu Pro Leu Leu Asp Val Met Phe Ala Ala Glu Gly Ser
    3220 3225 3230
    Ala Glu Ala Ala Leu Leu Asp Glu Thr Arg Tyr Thr Gln Cys Ala Leu
    3235 3240 3245
    Phe Ala Leu Glu Val Ala Leu Phe Arg Leu Val Glu Ser Trp Gly Met
    3250 3255 3260
    Arg Pro Ala Ala Leu Leu Gly His Ser Val Gly Glu Ile Ala Ala Ala
    3265 3270 3275 3280
    His Val Ala Gly Val Phe Ser Leu Ala Asp Ala Ala Arg Leu Val Ala
    3285 3290 3295
    Ala Arg Gly Arg Leu Met Gln Glu Leu Pro Ala Gly Gly Ala Met Leu
    3300 3305 3310
    Ala Val Gln Ala Ala Glu Asp Glu Ile Arg Val Trp Leu Glu Thr Glu
    3315 3320 3325
    Glu Arg Tyr Ala Gly Arg Leu Asp Val Ala Ala Val Asn Gly Pro Glu
    3330 3335 3340
    Ala Ala Val Leu Ser Gly Asp Ala Asp Ala Ala Arg Glu Ala Glu Ala
    3345 3350 3355 3360
    Tyr Trp Ser Gly Leu Gly Arg Arg Thr Arg Ala Leu Arg Val Ser His
    3365 3370 3375
    Ala Phe His Ser Ala His Met Asp Gly Met Leu Asp Gly Phe Arg Ala
    3380 3385 3390
    Val Leu Glu Thr Val Glu Phe Arg Arg Pro Ser Leu Thr Val Val Ser
    3395 3400 3405
    Asn Val Thr Gly Leu Ala Ala Gly Pro Asp Asp Leu Cys Asp Pro Glu
    3410 3415 3420
    Tyr Trp Val Arg His Val Arg Gly Thr Val Arg Phe Leu Asp Gly Val
    3425 3430 3435 3440
    Arg Val Leu Arg Asp Leu Gly Val Arg Thr Cys Leu Glu Leu Gly Pro
    3445 3450 3455
    Asp Gly Val Leu Thr Ala Met Ala Ala Asp Gly Leu Ala Asp Thr Pro
    3460 3465 3470
    Ala Asp Ser Ala Ala Gly Ser Pro Val Gly Ser Pro Ala Gly Ser Pro
    3475 3480 3485
    Ala Asp Ser Ala Ala Gly Ala Leu Arg Pro Arg Pro Leu Leu Val Ala
    3490 3495 3500
    Leu Leu Arg Arg Lys Arg Ser Glu Thr Glu Thr Val Ala Asp Ala Leu
    3505 3510 3515 3520
    Gly Arg Ala His Ala His Gly Thr Gly Pro Asp Trp His Ala Trp Phe
    3525 3530 3535
    Ala Gly Ser Gly Ala His Arg Val Asp Leu Pro Thr Tyr Ser Phe Arg
    3540 3545 3550
    Arg Asp Arg Tyr Trp Leu Asp Ala Pro Ala Ala Asp Thr Ala Val Asp
    3555 3560 3565
    Thr Ala Gly Leu Gly Leu Gly Thr Ala Asp His Pro Leu Leu Gly Ala
    3570 3575 3580
    Val Val Ser Leu Pro Asp Arg Asp Gly Leu Leu Leu Thr Gly Arg Leu
    3585 3590 3595 3600
    Ser Leu Arg Thr His Pro Trp Leu Ala Asp His Ala Val Leu Gly Ser
    3605 3610 3615
    Val Leu Leu Pro Gly Ala Ala Met Val Glu Leu Ala Ala His Ala Ala
    3620 3625 3630
    Glu Ser Ala Gly Leu Arg Asp Val Arg Glu Leu Thr Leu Leu Glu Pro
    3635 3640 3645
    Leu Val Leu Pro Glu His Gly Gly Val Glu Leu Arg Val Thr Val Gly
    3650 3655 3660
    Ala Pro Ala Gly Glu Pro Gly Gly Glu Ser Ala Gly Asp Gly Ala Arg
    3665 3670 3675 3680
    Pro Val Ser Leu His Ser Arg Leu Ala Asp Ala Pro Ala Gly Thr Ala
    3685 3690 3695
    Trp Ser Cys His Ala Thr Gly Leu Leu Ala Thr Asp Arg Pro Glu Leu
    3700 3705 3710
    Pro Val Ala Pro Asp Arg Ala Ala Met Trp Pro Pro Gln Gly Ala Glu
    3715 3720 3725
    Glu Val Pro Leu Asp Gly Leu Tyr Glu Arg Leu Asp Gly Asn Gly Leu
    3730 3735 3740
    Ala Phe Gly Pro Leu Phe Gln Gly Leu Asn Ala Val Trp Arg Tyr Glu
    3745 3750 3755 3760
    Gly Glu Val Phe Ala Asp Ile Ala Leu Pro Ala Thr Thr Asn Ala Thr
    3765 3770 3775
    Ala Pro Ala Thr Ala Asn Gly Gly Gly Ser Ala Ala Ala Ala Pro Tyr
    3780 3785 3790
    Gly Ile His Pro Ala Leu Leu Asp Ala Ser Leu His Ala Ile Ala Val
    3795 3800 3805
    Gly Gly Leu Val Asp Glu Pro Glu Leu Val Arg Val Pro Phe His Trp
    3810 3815 3820
    Ser Gly Val Thr Val His Ala Ala Gly Ala Ala Ala Ala Arg Val Arg
    3825 3830 3835 3840
    Leu Ala Ser Ala Gly Thr Asp Ala Val Ser Leu Ser Leu Thr Asp Gly
    3845 3850 3855
    Glu Gly Arg Pro Leu Val Ser Val Glu Arg Leu Thr Leu Arg Pro Val
    3860 3865 3870
    Thr Ala Asp Gln Ala Ala Ala Ser Arg Val Gly Gly Leu Met His Arg
    3875 3880 3885
    Val Ala Trp Arg Pro Tyr Ala Leu Ala Ser Ser Gly Glu Gln Asp Pro
    3890 3895 3900
    His Ala Thr Ser Tyr Gly Pro Thr Ala Val Leu Gly Lys Asp Glu Leu
    3905 3910 3915 3920
    Lys Val Ala Ala Ala Leu Glu Ser Ala Gly Val Glu Val Gly Leu Tyr
    3925 3930 3935
    Pro Asp Leu Ala Ala Leu Ser Gln Asp Val Ala Ala Gly Ala Pro Ala
    3940 3945 3950
    Pro Arg Thr Val Leu Ala Pro Leu Pro Ala Gly Pro Ala Asp Gly Gly
    3955 3960 3965
    Ala Glu Gly Val Arg Gly Thr Val Ala Arg Thr Leu Glu Leu Leu Gln
    3970 3975 3980
    Ala Trp Leu Ala Asp Glu His Leu Ala Gly Thr Arg Leu Leu Leu Val
    985 3990 3995 4000
    Thr Arg Gly Ala Val Arg Asp Pro Glu Gly Ser Gly Ala Asp Asp Gly
    4005 4010 4015
    Gly Glu Asp Leu Ser His Ala Ala Ala Trp Gly Leu Val Arg Thr Ala
    4020 4025 4030
    Gln Thr Glu Asn Pro Gly Arg Phe Gly Leu Leu Asp Leu Ala Asp Asp
    4035 4040 4045
    Ala Ser Ser Tyr Arg Thr Leu Pro Ser Val Leu Ser Asp Ala Gly Leu
    4050 4055 4060
    Arg Asp Glu Pro Gln Leu Ala Leu His Asp Gly Thr Ile Arg Leu Ala
    4065 4070 4075 4080
    Arg Leu Ala Ser Val Arg Pro Glu Thr Gly Thr Ala Ala Pro Ala Leu
    4085 4090 4095
    Ala Pro Glu Gly Thr Val Leu Leu Thr Gly Gly Thr Gly Gly Leu Gly
    4100 4105 4110
    Gly Leu Val Ala Arg His Val Val Gly Glu Trp Gly Val Arg Arg Leu
    4115 4120 4125
    Leu Leu Val Ser Arg Arg Gly Thr Asp Ala Pro Gly Ala Asp Glu Leu
    4130 4135 4140
    Val His Glu Leu Glu Ala Leu Gly Ala Asp Val Ser Val Ala Ala Cys
    4145 4150 4155 4160
    Asp Val Ala Asp Arg Glu Ala Leu Thr Ala Val Leu Asp Ala Ile Pro
    4165 4170 4175
    Ala Glu His Pro Leu Thr Ala Val Val His Thr Ala Gly Val Leu Ser
    4180 4185 4190
    Asp Gly Thr Leu Pro Ser Met Thr Thr Glu Asp Val Glu His Val Leu
    4195 4200 4205
    Arg Pro Lys Val Asp Ala Ala Phe Leu Leu Asp Glu Leu Thr Ser Thr
    4210 4215 4220
    Pro Ala Tyr Asp Leu Ala Ala Phe Val Met Phe Ser Ser Ala Ala Ala
    4225 4230 4235 4240
    Val Phe Gly Gly Ala Gly Gln Gly Ala Tyr Ala Ala Ala Asn Ala Thr
    4245 4250 4255
    Leu Asp Ala Leu Ala Trp Arg Arg Arg Ala Ala Gly Leu Pro Ala Leu
    4260 4265 4270
    Ser Leu Gly Trp Gly Leu Trp Ala Glu Thr Ser Gly Met Thr Gly Glu
    4275 4280 4285
    Leu Gly Gln Ala Asp Leu Arg Arg Met Ser Arg Ala Gly Ile Gly Gly
    4290 4295 4300
    Ile Ser Asp Ala Glu Gly Ile Ala Leu Leu Asp Ala Ala Leu Arg Asp
    4305 4310 4315 4320
    Asp Arg His Pro Val Leu Leu Pro Leu Arg Leu Asp Ala Ala Gly Leu
    4325 4330 4335
    Arg Asp Ala Ala Gly Asn Asp Pro Ala Gly Ile Pro Ala Leu Phe Arg
    4340 4345 4350
    Asp Val Val Gly Ala Arg Thr Val Arg Ala Arg Pro Ser Ala Ala Ser
    4355 4360 4365
    Ala Ser Thr Thr Ala Gly Thr Ala Gly Thr Pro Gly Thr Ala Asp Gly
    4370 4375 4380
    Ala Ala Glu Thr Ala Ala Val Thr Leu Ala Asp Arg Ala Ala Thr Val
    4385 4390 4395 4400
    Asp Gly Pro Ala Arg Gln Arg Leu Leu Leu Glu Phe Val Val Gly Glu
    4405 4410 4415
    Val Ala Glu Val Leu Gly His Ala Arg Gly His Arg Ile Asp Ala Glu
    4420 4425 4430
    Arg Gly Phe Leu Asp Leu Gly Phe Asp Ser Leu Thr Ala Val Glu Leu
    4435 4440 4445
    Arg Asn Arg Leu Asn Ser Ala Gly Gly Leu Ala Leu Pro Ala Thr Leu
    4450 4455 4460
    Val Phe Asp His Pro Ser Pro Ala Ala Leu Ala Ser His Leu Asp Ala
    4465 4470 4475 4480
    Glu Leu Pro Arg Gly Ala Ser Asp Gln Asp Gly Ala Gly Asn Arg Asn
    4485 4490 4495
    Gly Asn Glu Asn Gly Thr Thr Ala Ser Arg Ser Thr Ala Glu Thr Asp
    4500 4505 4510
    Ala Leu Leu Ala Gln Leu Thr Arg Leu Glu Gly Ala Leu Val Leu Thr
    4515 4520 4525
    Gly Leu Ser Asp Ala Pro Gly Ser Glu Glu Val Leu Glu His Leu Arg
    4530 4535 4540
    Ser Leu Arg Ser Met Val Thr Gly Glu Thr Gly Thr Gly Thr Ala Ser
    4545 4550 4555 4560
    Gly Ala Pro Asp Gly Ala Gly Ser Gly Ala Glu Asp Arg Pro Trp Ala
    4565 4570 4575
    Ala Gly Asp Gly Ala Gly Gly Gly Ser Glu Asp Gly Ala Gly Val Pro
    4580 4585 4590
    Asp Phe Met Asn Ala Ser Ala Glu Glu Leu Phe Gly Leu Leu Asp Gln
    4595 4600 4605
    Asp Pro Ser Thr Asp
    4610
    <210> SEQ ID NO 32
    <211> LENGTH: 11220
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 32
    gtgtccacgg tgaacgaaga gaagtacctc gactacctgc gtcgtgccac ggcggacctc 60
    cacgaggccc gtggccgcct ccgcgagctg gaggcgaagg cgggcgagcc ggtggcgatc 120
    gtcggcatgg cctgccgcct gcccggcggc gtcgcctcgc ccgaggacct gtggcggctg 180
    gtggccggcg gcgaggacgc gatctcggag ttcccccagg accgcggctg ggacgtggag 240
    ggcctgtacg acccgaaccc ggaggccacg ggcaagagtt acgcccgcga ggccggattc 300
    ctgtacgagg cgggcgagtt cgacgccgac ttcttcggga tctcgccgcg cgaggccctc 360
    gccatggacc cgcagcagcg tctcctcctg gaggcctcct gggaggcgtt cgagcacgcc 420
    gggatcccgg cggccaccgc gcgcggcacc tcggtcggcg tcttcaccgg cgtgatgtac 480
    cacgactacg ccacccgtct caccgatgtc ccggagggca tcgagggcta cctgggcacc 540
    ggcaactccg gcagtgtcgc ctcgggccgc gtcgcgtaca cgcttggcct ggaggggccg 600
    gccgtcacgg tcgacaccgc ctgctcgtcc tcgctggtcg ccctgcacct cgccgtgcag 660
    gccctgcgca agggcgaggt cgacatggcg ctcgccggcg gcgtgacggt catgtcgacg 720
    cccagcacct tcgtcgagtt cagccgtcag cgcgggctgg cgccggacgg ccggtcgaag 780
    tccttctcgt cgacggccga cggcaccagc tggtccgagg gcgtcggcgt cctcctcgtc 840
    gagcgcctgt ccgacgcgcg tcgcaagggc catcggatcc tcgccgtggt ccggggcacc 900
    gccgtcaacc aggacggcgc cagcagcggc ctcacggctc cgaacgggcc gtcgcagcag 960
    cgcgtcatcc gacgtgccct ggcggacgcc cggctcacga cctccgacgt ggacgtcgtc 1020
    gaggcccacg gcacgggtac gcgactcggc gacccgatcg aggcgcaggc cgtcatcgcc 1080
    acgtacgggc agggccgtga cggcgaacag ccgctgcgcc tcgggtcgtt gaagtccaac 1140
    atcggacaca cccaggccgc cgccggtgtc tccggcgtga tcaagatggt ccaggcgatg 1200
    cgccacggcg tcctgccgaa gacgctccac gtggagaagc cgacggacca ggtggactgg 1260
    tccgcgggcg cggtcgagct gctcaccgag gccatggact ggccggacaa gggcgacggc 1320
    ggactgcgca gggccgcggt ctcctccttc ggcgtcagcg ggacgaacgc gcacgtcgtg 1380
    ctcgaagagg ccccggcggc cgaggagacc cctgcctccg aggcgacccc ggccgtcgag 1440
    ccgtcggtcg gcgccggcct ggtgccgtgg ctggtgtcgg cgaagactcc ggccgcgctg 1500
    gacgcccaga tcggacgcct cgccgcgttc gcctcgcagg gccgtacgga cgccgccgat 1560
    ccgggcgcgg tcgctcgcgt actggccggc gggcgcgccg agttcgagca ccgggccgtc 1620
    gtgctcggca ccggacagga cgatttcgcg caggcgctga ccgctccgga aggactgata 1680
    cgcggcacgc cctcggacgt gggccgggtg gcgttcgtgt tccccggtca gggcacgcag 1740
    tgggccggga tgggcgccga actcctcgac gtgtcgaagg agttcgcggc ggccatggcc 1800
    gagtgcgaga gcgcgctctc ccgctatgtc gactggtcgc tggaggccgt cgtccggcag 1860
    gcgccgggcg cgcccacgct ggagcgggtc gacgtcgtcc agcccgtgac cttcgctgtc 1920
    atggtttcgc tggcgaaggt ctggcagcac cacggcgtga cgccgcaggc cgtcgtcggc 1980
    cactcgcagg gcgagatcgc cgccgcgtac gtcgccggtg ccctcaccct cgacgacgcc 2040
    gcccgcgtcg tcaccctgcg cagcaagtcc atcgccgccc acctcgccgg caagggcggc 2100
    atgatctccc tcgccctcag cgaggaagcc acccggcagc gcatcgagaa cctccacgga 2160
    ctgtcgatcg ccgccgtcaa cggccccacc gccaccgtgg tttcgggcga ccccacccag 2220
    atccaagagc tcgctcaggc gtgtgaggcc gacggggtcc gcgcacggat catccccgtc 2280
    gactacgcct cccacagcgc ccacgtcgag accatcgaga gcgaactcgc cgaggtcctc 2340
    gccgggctca gcccgcggac acctgaggtg ccgttcttct cgacactcga aggcgcctgg 2400
    atcaccgagc cggtgctcga cggcacctac tggtaccgca acctccgcca ccgcgtcggc 2460
    ttcgcccccg ccgtcgagac cctcgccacc gacgaaggct tcacccactt catcgaggtc 2520
    agcgcccacc ccgtcctcac catgaccctc cccgagaccg tcaccggcct cggcaccctc 2580
    cgccgcgaac agggaggcca ggagcgtctg gtcacctcac tcgccgaagc ctggaccaac 2640
    ggcctcacca tcgactgggc gcccgtcctc cccaccgcaa ccggccacca ccccgagctc 2700
    cccacctacg ccttccagcg ccgtcactac tggctccacg actcccccgc cgtccagggc 2760
    tccgtgcagg actcctggcg ctaccgcatc gactggaagc gcctcgcggt cgccgacgcg 2820
    tccgagcgcg ccgggctgtc cgggcgctgg ctcgtcgtcg tccccgagga ccgttccgcc 2880
    gaggccgccc cggtgctcgc cgcgctgtcc ggcgccggcg ccgaccccgt acagctggac 2940
    gtgtccccgc tgggcgaccg gcagcggctc gccgcgacgc tgggcgaggc cctggcggcg 3000
    gccggtggag ccgtcgacgg cgtcctctcg ctgctcgcgt gggacgagag cgcgcacccc 3060
    ggccaccccg cccccttcac ccggggcacc ggcgccaccc tcaccctggt gcaggcgctg 3120
    gaggacgccg gcgtcgccgc cccgctgtgg tgcgtgaccc acggcgcggt gtccgtcggc 3180
    cgggccgacc acgtcacctc ccccgcccag gccatggtgt ggggcatggg ccgggtcgcc 3240
    gccctggagc accccgagcg gtggggcggc ctgatcgacc tgccctcgga cgccgaccgg 3300
    gcggccctgg accgcatgac cacggtcctc gccggcggta cgggtgagga ccaggtcgcg 3360
    gtacgcgcct ccgggctgct cgcccgccgc ctcgtccgcg cctccctccc ggcgcacggc 3420
    acggcttcgc cgtggtggca ggccgacggc acggtgctcg tcaccggtgc cgaggagcct 3480
    gcggccgccg aggccgcacg ccggctggcc cgcgacggcg ccggacacct cctcctccac 3540
    accaccccct ccggcagcga aggcgccgaa ggcacctccg gtgccgccga ggactccggc 3600
    ctcgccgggc tcgtcgccga actcgcggac ctgggcgcga cggccaccgt cgtgacctgc 3660
    gacctcacgg acgcggaggc ggccgcccgg ctgctcgccg gcgtctccga cgcgcacccg 3720
    ctcagcgccg tcctccacct gccgcccacc gtcgactccg agccgctcgc cgcgaccgac 3780
    gcggacgcgc tcgcccgtgt cgtgaccgcg aaggccaccg ccgcgctcca cctggaccgc 3840
    ctcctgcggg aggccgcggc tgccggaggc cgtccgcccg tcctggtcct cttctcctcg 3900
    gtcgccgcga tctggggcgg cgccggtcag ggcgcgtacg ccgccggtac ggccttcctc 3960
    gacgccctcg ccggtcagca ccgggccgac ggccccaccg tgacctcggt ggcctggagc 4020
    ccctgggagg gcagccgcgt caccgagggt gcgaccgggg agcggctgcg ccgcctcggc 4080
    ctgcgccccc tcgcccccgc gacggcgctc accgccctgg acaccgcgct cggccacggc 4140
    gacaccgccg tcacgatcgc cgacgtcgac tggtcgagct tcgcccccgg cttcaccacg 4200
    gcccggccgg gcaccctcct cgccgatctg cccgaggcgc gccgcgcgct cgacgagcag 4260
    cagtcgacga cggccgccga cgacaccgtc ctgagccgcg agctcggtgc gctcaccggc 4320
    gccgaacagc agcgccgtat gcaggagttg gtccgcgagc acctcgccgt ggtcctcaac 4380
    cacccctccc ccgaggccgt cgacacgggg cgggccttcc gtgacctcgg attcgactcg 4440
    ctgacggcgg tcgagctccg caaccgcctc aagaacgcca ccggcctggc cctcccggcc 4500
    actctggtct tcgactaccc gaccccccgg acgctggcgg agttcctcct cgcggagatc 4560
    ctgggcgagc aggccggtgc cggcgagcag cttccggtgg acggcggggt cgacgacgag 4620
    cccgtcgcga tcgtcggcat ggcgtgccgc ctgccgggcg gtgtcgcctc gccggaggac 4680
    ctgtggcggc tggtggccgg cggcgaggac gcgatctccg gcttcccgca ggaccgcggc 4740
    tgggacgtgg aggggctgta cgacccggac ccggacgcgt ccgggcggac gtactgccgt 4800
    gccggtggct tcctcgacga ggcgggcgag ttcgacgccg acttcttcgg gatctcgccg 4860
    cgcgaggccc tcgccatgga cccgcagcag cggctcctcc tggagacctc ctgggaggcc 4920
    gtcgaggacg ccgggatcga cccgacctcc cttcaggggc agcaggtcgg cgtgttcgcg 4980
    ggcaccaacg gcccccacta cgagccgctg ctccgcaaca ccgccgagga tcttgagggt 5040
    tacgtcggga cgggcaacgc cgccagcatc atgtcgggcc gtgtctcgta caccctcggc 5100
    ctggagggcc cggccgtcac ggtcgacacc gcctgctcct cctcgctggt cgccctgcac 5160
    ctcgccgtgc aggccctgcg caagggcgaa tgcggactgg cgctcgcggg cggtgtgacg 5220
    gtcatgtcga cgcccacgac gttcgtggag ttcagccggc agcgcgggct cgcggaggac 5280
    ggccggtcga aggcgttcgc cgcgtcggcg gacggcttcg gcccggcgga gggcgtcggc 5340
    atgctcctcg tcgagcgcct gtcggacgcc cgccgcaacg gacaccgtgt gctggcggtc 5400
    gtgcgcggca gcgcggtcaa ccaggacggc gcgagcaacg gcctgaccgc cccgaacggg 5460
    ccctcgcagc agcgcgtcat ccggcgcgcg ctcgcggacg cccgactgac gaccgccgac 5520
    gtggacgtcg tcgaggccca cggcacgggc acgcgactcg gcgacccgat cgaggcacag 5580
    gccctcatcg ccacctacgg ccaggggcgc gacaccgaac agccgctgcg cctggggtcg 5640
    ttgaagtcca acatcggaca cacccaggcc gccgccggtg tctccggcat catcaagatg 5700
    gtccaggcga tgcgccacgg cgtcctgccg aagacgctcc acgtggaccg gccgtcggac 5760
    cagatcgact ggtcggcggg cacggtcgag ctgctcaccg aggccatgga ctggccgagg 5820
    aagcaggagg gcgggctgcg ccgcgcggcc gtctcctcct tcggcatcag cggcacgaac 5880
    gcgcacatcg tgctcgaaga agccccggtc gacgaggacg ccccggcgga cgagccgtcg 5940
    gtcggcggtg tggtgccgtg gctcgtgtcc gcgaagactc cggccgcgct ggacgcccag 6000
    atcggacgcc tcgccgcgtt cgcctcgcag ggccgtacgg acgccgccga tccgggcgcg 6060
    gtcgctcgcg tactggccgg cgggcgtgcg cagttcgagc accgggccgt cgcgctcggc 6120
    accggacagg acgacctggc ggccgcactg gccgcgcctg agggtctggt ccggggtgtg 6180
    gcctccggtg tgggtcgagt ggcgttcgtg ttcccgggac agggcacgca gtgggccggg 6240
    atgggtgccg aactcctcga cgtgtcgaag gagttcgcgg cggccatggc cgagtgcgag 6300
    gccgcgctcg ctccgtacgt ggactggtcg ctggaggccg tcgtccgaca ggcccccggc 6360
    gcgcccacgc tggagcgggt cgatgtcgtc cagcccgtga cgttcgccgt catggtctcg 6420
    ctggcgaagg tctggcagca ccacggggtg accccgcaag ccgtcgtcgg ccactcgcag 6480
    ggcgagatcg ccgccgcgta cgtcgccggt gccctgagcc tggacgacgc cgctcgtgtc 6540
    gtgaccctgc gcagcaagtc catcggcgcc cacctcgcgg gccagggcgg catgctgtcc 6600
    ctcgcgctga gcgaggcggc cgttgtggag cgactggccg ggttcgacgg gctgtccgtc 6660
    gccgccgtca acgggcctac cgccaccgtg gtttcgggcg acccgaccca gatccaagag 6720
    ctcgctcagg cgtgtgaggc cgacggggtc cgcgcacgga tcatccccgt cgactacgcc 6780
    tcccacagcg cccacgtcga gaccatcgag agcgaactcg ccgacgtcct ggcggggttg 6840
    tccccccaga caccccaggt ccccttcttc tccaccctcg aaggcgcctg gatcaccgaa 6900
    cccgccctcg acggcggcta ctggtaccgc aacctccgcc atcgtgtggg cttcgccccg 6960
    gccgtcgaaa ccctggccac cgacgaaggc ttcacccact tcgtcgaggt cagcgcccac 7020
    cccgtcctca ccatggcgct gcccgagacc gtcaccggac tcggcaccct ccgccgtgac 7080
    aacggcggac agcaccgcct caccacctcc ctcgccgagg cctgggccaa cggcctcacc 7140
    gtcgactggg cctctctcct ccccaccacg accacccacc ccgatctgcc cacctacgcc 7200
    ttccagaccg agcgctactg gccgcagccc gacctctccg ccgccggtga catcacctcc 7260
    gccggtctcg gggcggccga gcacccgctg ctcggcgcgg ccgtggcgct cgcggactcc 7320
    gacggctgcc tgctcacggg gagcctctcc ctccgtacgc acccctggct ggcggaccac 7380
    gcggtggccg gcaccgtgct gctgccggga acggcgttcg tggagctggc gttccgagcc 7440
    ggggaccagg tcggttgcga tctggtcgag gagctcaccc tcgacgcgcc gctcgtgctg 7500
    ccccgtcgtg gcgcggtccg tgtgcagctg tccgtcggcg cgagcgacga gtccgggcgt 7560
    cgtaccttcg ggctctacgc gcacccggag gacgcgccgg gcgaggcgga gtggacgcgg 7620
    cacgccaccg gtgtgctggc cgcccgtgcg gaccgcaccg cccccgtcgc cgacccggag 7680
    gcctggccgc cgccgggcgc cgagccggtg gacgtggacg gtctgtacga gcgcttcgcg 7740
    gcgaacggct acggctacgg ccccctcttc cagggcgtcc gtggtgtctg gcggcgtggc 7800
    gacgaggtgt tcgccgacgt ggccctgccg gccgaggtcg ccggtgccga gggcgcgcgg 7860
    ttcggccttc acccggcgct gctcgacgcc gccgtgcagg cggccggtgc gggccggggc 7920
    gttcggcgcg ggcacgcggc tgccgttcgc ctggagcggg atctcctgta cgcggtcggc 7980
    gccaccgccc tccgcgtgcg gctggccccc gccggcccgg acacggtgtc cgtgagcgcc 8040
    gccgactcct ccgggcagcc ggtgttcgcc gcggactccc tcacggtgct gcccgtcgac 8100
    cccgcgcagc tggcggcctt cagcgacccg actctggacg cgctgcacct gctggagtgg 8160
    accgcctggg acggtgccgc gcaggccctg cccggcgcgg tcgtgctggg cggcgacgcc 8220
    gacggtctcg ccgcggcgct gcgcgccggt ggcaccgagg tcctgtcctt cccggacctt 8280
    acggacctgg tggaggccgt cgaccggggc gagaccccgg ccccggcgac cgtcctggtg 8340
    gcctgccccg ccgccggccc cgatgggccg gagcatgtcc gcgaggccct gcacgggtcg 8400
    ctcgcgctga tgcaggcctg gctggccgac gagcggttca ccgatgggcg cctggtgctc 8460
    gtgacccgcg acgcggtcgc cgcccgttcc ggcgacggcc tgcggtccac gggacaggcc 8520
    gccgtctggg gcctcggccg gtccgcgcag acggagagcc cgggccggtt cgtcctgctc 8580
    gacctcgccg gggaagcccg gacggccggg gacgccaccg ccggggacgg cctgacgacc 8640
    ggggacgcca ccgtcggcgg cacctctgga gacgccgccc tcggcagcgc cctcgcgacc 8700
    gccctcggct cgggcgagcc gcagctcgcc ctccgggacg gggcgctcct cgtaccccgc 8760
    ctggcgcggg ccgccgcgcc cgccgcggcc gacggcctcg ccgcggccga cggcctcgcc 8820
    gctctgccgc tgcccgccgc tccggccctc tggcgtctgg agcccggtac ggacggcagc 8880
    ctggagagcc tcacggcggc gcccggcgac gccgagaccc tcgccccgga gccgctcggc 8940
    ccgggacagg tccgcatcgc gatccgggcc accggtctca acttccgcga cgtcctgatc 9000
    gccctcggca tgtaccccga tccggcgctg atgggcaccg agggagccgg cgtggtcacc 9060
    gcgaccggcc ccggcgtcac gcacctcgcc cccggcgacc gggtcatggg cctgctctcc 9120
    ggcgcgtacg ccccggtcgt cgtggcggac gcgcggaccg tcgcgcggat gcccgagggg 9180
    tggacgttcg cccagggcgc ctccgtgccg gtggtgttcc tgacggccgt ctacgccctg 9240
    cgcgacctgg cggacgtcaa gcccggcgag cgcctcctgg tccactccgc cgccggtggc 9300
    gtgggcatgg ccgccgtgca gctcgcccgg cactggggcg tggaggtcca cggcacggcg 9360
    agtcacggga agtgggacgc cctgcgcgcg ctcggcctgg acgacgcgca catcgcctcc 9420
    tcccgcaccc tggacttcga gtccgcgttc cgtgccgctt ccggcggggc gggcatggac 9480
    gtcgtactga actcgctcgc ccgcgagttc gtcgacgcct cgctgcgcct gctcgggccg 9540
    ggcggccggt tcgtggagat ggggaagacc gacgtccgcg acgcggagcg ggtcgccgcc 9600
    gaccaccccg gtgtcggcta ccgcgccttc gacctgggcg aggccgggcc ggagcggatc 9660
    ggcgagatgc tcgccgaggt catcgccctc ttcgaggacg gggtgctccg gcacctgccc 9720
    gtcacgacct gggacgtgcg ccgggcccgc gacgccttcc ggcacgtcag ccaggcccgc 9780
    cacacgggca aggtcgtcct cacgatgccg tcgggcctcg acccggaggg tacggtcctg 9840
    ctgaccggcg gcaccggtgc gctggggggc atcgtggccc ggcacgtggt gggcgagtgg 9900
    ggcgtacgac gcctgctgct cgtgagccgg cggggcacgg acgccccggg cgccggcgag 9960
    ctcgtgcacg agctggaggc cctgggagcc gacgtctcgg tggccgcgtg cgacgtcgcc 10020
    gaccgcgaag ccctcaccgc cgtactcgac tcgatccccg ccgaacaccc gctcaccgcg 10080
    gtcgtccaca cggcaggcgt cctctccgac ggcaccctcc cctcgatgac agcggaggat 10140
    gtggaacacg tactgcgtcc caaggtcgac gccgcgttcc tcctcgacga actcacctcg 10200
    acgcccggct acgacctggc agcgttcgtc atgttctcct ccgccgccgc cgtcttcggt 10260
    ggcgcggggc agggcgccta cgccgccgcc aacgccaccc tcgacgccct cgcctggcgc 10320
    cgccggacag ccggactccc cgccctctcc ctcggctggg gcctctgggc cgagaccagc 10380
    ggcatgaccg gcggactcag cgacaccgac cgctcgcggc tggcccgttc cggggcgacg 10440
    cccatggaca gcgagctgac cctgtccctc ctggacgcgg ccatgcgccg cgacgacccg 10500
    gcgctcgtcc cgatcgccct ggacgtcgcc gcgctccgcg cccagcagcg cgacggcatg 10560
    ctggcgccgc tgctcagcgg gctcacccgc ggatcgcggg tcggcggcgc gccggtcaac 10620
    cagcgcaggg cagccgccgg aggcgcgggc gaggcggaca cggacctcgg cgggcggctc 10680
    gccgcgatga caccggacga ccgggtcgcg cacctgcggg acctcgtccg tacgcacgtg 10740
    gcgaccgtcc tgggacacgg caccccgagc cgggtggacc tggagcgggc cttccgcgac 10800
    accggtttcg actcgctcac cgccgtcgaa ctccgcaacc gtctcaacgc cgcgaccggg 10860
    ctgcggctgc cggccacgct ggtcttcgac caccccaccc cgggggagct cgccgggcac 10920
    ctgctcgacg aactcgccac ggccgcgggc gggtcctggg cggaaggcac cgggtccgga 10980
    gacacggcct cggcgaccga tcggcagacc acggcggccc tcgccgaact cgaccggctg 11040
    gaaggcgtgc tcgcctccct cgcgcccgcc gccggcggcc gtccggagct cgccgcccgg 11100
    ctcagggcgc tggccgcggc cctgggggac gacggcgacg acgccaccga cctggacgag 11160
    gcgtccgacg acgacctctt ctccttcatc gacaaggagc tgggcgactc cgacttctga 11220
    <210> SEQ ID NO 33
    <211> LENGTH: 3739
    <212> TYPE: PRT
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 33
    Met Ser Thr Val Asn Glu Glu Lys Tyr Leu Asp Tyr Leu Arg Arg Ala
    1 5 10 15
    Thr Ala Asp Leu His Glu Ala Arg Gly Arg Leu Arg Glu Leu Glu Ala
    20 25 30
    Lys Ala Gly Glu Pro Val Ala Ile Val Gly Met Ala Cys Arg Leu Pro
    35 40 45
    Gly Gly Val Ala Ser Pro Glu Asp Leu Trp Arg Leu Val Ala Gly Gly
    50 55 60
    Glu Asp Ala Ile Ser Glu Phe Pro Gln Asp Arg Gly Trp Asp Val Glu
    65 70 75 80
    Gly Leu Tyr Asp Pro Asn Pro Glu Ala Thr Gly Lys Ser Tyr Ala Arg
    85 90 95
    Glu Ala Gly Phe Leu Tyr Glu Ala Gly Glu Phe Asp Ala Asp Phe Phe
    100 105 110
    Gly Ile Ser Pro Arg Glu Ala Leu Ala Met Asp Pro Gln Gln Arg Leu
    115 120 125
    Leu Leu Glu Ala Ser Trp Glu Ala Phe Glu His Ala Gly Ile Pro Ala
    130 135 140
    Ala Thr Ala Arg Gly Thr Ser Val Gly Val Phe Thr Gly Val Met Tyr
    145 150 155 160
    His Asp Tyr Ala Thr Arg Leu Thr Asp Val Pro Glu Gly Ile Glu Gly
    165 170 175
    Tyr Leu Gly Thr Gly Asn Ser Gly Ser Val Ala Ser Gly Arg Val Ala
    180 185 190
    Tyr Thr Leu Gly Leu Glu Gly Pro Ala Val Thr Val Asp Thr Ala Cys
    195 200 205
    Ser Ser Ser Leu Val Ala Leu His Leu Ala Val Gln Ala Leu Arg Lys
    210 215 220
    Gly Glu Val Asp Met Ala Leu Ala Gly Gly Val Thr Val Met Ser Thr
    225 230 235 240
    Pro Ser Thr Phe Val Glu Phe Ser Arg Gln Arg Gly Leu Ala Pro Asp
    245 250 255
    Gly Arg Ser Lys Ser Phe Ser Ser Thr Ala Asp Gly Thr Ser Trp Ser
    260 265 270
    Glu Gly Val Gly Val Leu Leu Val Glu Arg Leu Ser Asp Ala Arg Arg
    275 280 285
    Lys Gly His Arg Ile Leu Ala Val Val Arg Gly Thr Ala Val Asn Gln
    290 295 300
    Asp Gly Ala Ser Ser Gly Leu Thr Ala Pro Asn Gly Pro Ser Gln Gln
    305 310 315 320
    Arg Val Ile Arg Arg Ala Leu Ala Asp Ala Arg Leu Thr Thr Ser Asp
    325 330 335
    Val Asp Val Val Glu Ala His Gly Thr Gly Thr Arg Leu Gly Asp Pro
    340 345 350
    Ile Glu Ala Gln Ala Val Ile Ala Thr Tyr Gly Gln Gly Arg Asp Gly
    355 360 365
    Glu Gln Pro Leu Arg Leu Gly Ser Leu Lys Ser Asn Ile Gly His Thr
    370 375 380
    Gln Ala Ala Ala Gly Val Ser Gly Val Ile Lys Met Val Gln Ala Met
    385 390 395 400
    Arg His Gly Val Leu Pro Lys Thr Leu His Val Glu Lys Pro Thr Asp
    405 410 415
    Gln Val Asp Trp Ser Ala Gly Ala Val Glu Leu Leu Thr Glu Ala Met
    420 425 430
    Asp Trp Pro Asp Lys Gly Asp Gly Gly Leu Arg Arg Ala Ala Val Ser
    435 440 445
    Ser Phe Gly Val Ser Gly Thr Asn Ala His Val Val Leu Glu Glu Ala
    450 455 460
    Pro Ala Ala Glu Glu Thr Pro Ala Ser Glu Ala Thr Pro Ala Val Glu
    465 470 475 480
    Pro Ser Val Gly Ala Gly Leu Val Pro Trp Leu Val Ser Ala Lys Thr
    485 490 495
    Pro Ala Ala Leu Asp Ala Gln Ile Gly Arg Leu Ala Ala Phe Ala Ser
    500 505 510
    Gln Gly Arg Thr Asp Ala Ala Asp Pro Gly Ala Val Ala Arg Val Leu
    515 520 525
    Ala Gly Gly Arg Ala Glu Phe Glu His Arg Ala Val Val Leu Gly Thr
    530 535 540
    Gly Gln Asp Asp Phe Ala Gln Ala Leu Thr Ala Pro Glu Gly Leu Ile
    545 550 555 560
    Arg Gly Thr Pro Ser Asp Val Gly Arg Val Ala Phe Val Phe Pro Gly
    565 570 575
    Gln Gly Thr Gln Trp Ala Gly Met Gly Ala Glu Leu Leu Asp Val Ser
    580 585 590
    Lys Glu Phe Ala Ala Ala Met Ala Glu Cys Glu Ser Ala Leu Ser Arg
    595 600 605
    Tyr Val Asp Trp Ser Leu Glu Ala Val Val Arg Gln Ala Pro Gly Ala
    610 615 620
    Pro Thr Leu Glu Arg Val Asp Val Val Gln Pro Val Thr Phe Ala Val
    625 630 635 640
    Met Val Ser Leu Ala Lys Val Trp Gln His His Gly Val Thr Pro Gln
    645 650 655
    Ala Val Val Gly His Ser Gln Gly Glu Ile Ala Ala Ala Tyr Val Ala
    660 665 670
    Gly Ala Leu Thr Leu Asp Asp Ala Ala Arg Val Val Thr Leu Arg Ser
    675 680 685
    Lys Ser Ile Ala Ala His Leu Ala Gly Lys Gly Gly Met Ile Ser Leu
    690 695 700
    Ala Leu Ser Glu Glu Ala Thr Arg Gln Arg Ile Glu Asn Leu His Gly
    705 710 715 720
    Leu Ser Ile Ala Ala Val Asn Gly Pro Thr Ala Thr Val Val Ser Gly
    725 730 735
    Asp Pro Thr Gln Ile Gln Glu Leu Ala Gln Ala Cys Glu Ala Asp Gly
    740 745 750
    Val Arg Ala Arg Ile Ile Pro Val Asp Tyr Ala Ser His Ser Ala His
    755 760 765
    Val Glu Thr Ile Glu Ser Glu Leu Ala Glu Val Leu Ala Gly Leu Ser
    770 775 780
    Pro Arg Thr Pro Glu Val Pro Phe Phe Ser Thr Leu Glu Gly Ala Trp
    785 790 795 800
    Ile Thr Glu Pro Val Leu Asp Gly Thr Tyr Trp Tyr Arg Asn Leu Arg
    805 810 815
    His Arg Val Gly Phe Ala Pro Ala Val Glu Thr Leu Ala Thr Asp Glu
    820 825 830
    Gly Phe Thr His Phe Ile Glu Val Ser Ala His Pro Val Leu Thr Met
    835 840 845
    Thr Leu Pro Glu Thr Val Thr Gly Leu Gly Thr Leu Arg Arg Glu Gln
    850 855 860
    Gly Gly Gln Glu Arg Leu Val Thr Ser Leu Ala Glu Ala Trp Thr Asn
    865 870 875 880
    Gly Leu Thr Ile Asp Trp Ala Pro Val Leu Pro Thr Ala Thr Gly His
    885 890 895
    His Pro Glu Leu Pro Thr Tyr Ala Phe Gln Arg Arg His Tyr Trp Leu
    900 905 910
    His Asp Ser Pro Ala Val Gln Gly Ser Val Gln Asp Ser Trp Arg Tyr
    915 920 925
    Arg Ile Asp Trp Lys Arg Leu Ala Val Ala Asp Ala Ser Glu Arg Ala
    930 935 940
    Gly Leu Ser Gly Arg Trp Leu Val Val Val Pro Glu Asp Arg Ser Ala
    945 950 955 960
    Glu Ala Ala Pro Val Leu Ala Ala Leu Ser Gly Ala Gly Ala Asp Pro
    965 970 975
    Val Gln Leu Asp Val Ser Pro Leu Gly Asp Arg Gln Arg Leu Ala Ala
    980 985 990
    Thr Leu Gly Glu Ala Leu Ala Ala Ala Gly Gly Ala Val Asp Gly Val
    995 1000 1005
    Leu Ser Leu Leu Ala Trp Asp Glu Ser Ala His Pro Gly His Pro Ala
    1010 1015 1020
    Pro Phe Thr Arg Gly Thr Gly Ala Thr Leu Thr Leu Val Gln Ala Leu
    1025 1030 1035 1040
    Glu Asp Ala Gly Val Ala Ala Pro Leu Trp Cys Val Thr His Gly Ala
    1045 1050 1055
    Val Ser Val Gly Arg Ala Asp His Val Thr Ser Pro Ala Gln Ala Met
    1060 1065 1070
    Val Trp Gly Met Gly Arg Val Ala Ala Leu Glu His Pro Glu Arg Trp
    1075 1080 1085
    Gly Gly Leu Ile Asp Leu Pro Ser Asp Ala Asp Arg Ala Ala Leu Asp
    1090 1095 1100
    Arg Met Thr Thr Val Leu Ala Gly Gly Thr Gly Glu Asp Gln Val Ala
    1105 1110 1115 1120
    Val Arg Ala Ser Gly Leu Leu Ala Arg Arg Leu Val Arg Ala Ser Leu
    1125 1130 1135
    Pro Ala His Gly Thr Ala Ser Pro Trp Trp Gln Ala Asp Gly Thr Val
    1140 1145 1150
    Leu Val Thr Gly Ala Glu Glu Pro Ala Ala Ala Glu Ala Ala Arg Arg
    1155 1160 1165
    Leu Ala Arg Asp Gly Ala Gly His Leu Leu Leu His Thr Thr Pro Ser
    1170 1175 1180
    Gly Ser Glu Gly Ala Glu Gly Thr Ser Gly Ala Ala Glu Asp Ser Gly
    1185 1190 1195 1200
    Leu Ala Gly Leu Val Ala Glu Leu Ala Asp Leu Gly Ala Thr Ala Thr
    1205 1210 1215
    Val Val Thr Cys Asp Leu Thr Asp Ala Glu Ala Ala Ala Arg Leu Leu
    1220 1225 1230
    Ala Gly Val Ser Asp Ala His Pro Leu Ser Ala Val Leu His Leu Pro
    1235 1240 1245
    Pro Thr Val Asp Ser Glu Pro Leu Ala Ala Thr Asp Ala Asp Ala Leu
    1250 1255 1260
    Ala Arg Val Val Thr Ala Lys Ala Thr Ala Ala Leu His Leu Asp Arg
    1265 1270 1275 1280
    Leu Leu Arg Glu Ala Ala Ala Ala Gly Gly Arg Pro Pro Val Leu Val
    1285 1290 1295
    Leu Phe Ser Ser Val Ala Ala Ile Trp Gly Gly Ala Gly Gln Gly Ala
    1300 1305 1310
    Tyr Ala Ala Gly Thr Ala Phe Leu Asp Ala Leu Ala Gly Gln His Arg
    1315 1320 1325
    Ala Asp Gly Pro Thr Val Thr Ser Val Ala Trp Ser Pro Trp Glu Gly
    1330 1335 1340
    Ser Arg Val Thr Glu Gly Ala Thr Gly Glu Arg Leu Arg Arg Leu Gly
    1345 1350 1355 1360
    Leu Arg Pro Leu Ala Pro Ala Thr Ala Leu Thr Ala Leu Asp Thr Ala
    1365 1370 1375
    Leu Gly His Gly Asp Thr Ala Val Thr Ile Ala Asp Val Asp Trp Ser
    1380 1385 1390
    Ser Phe Ala Pro Gly Phe Thr Thr Ala Arg Pro Gly Thr Leu Leu Ala
    1395 1400 1405
    Asp Leu Pro Glu Ala Arg Arg Ala Leu Asp Glu Gln Gln Ser Thr Thr
    1410 1415 1420
    Ala Ala Asp Asp Thr Val Leu Ser Arg Glu Leu Gly Ala Leu Thr Gly
    1425 1430 1435 1440
    Ala Glu Gln Gln Arg Arg Met Gln Glu Leu Val Arg Glu His Leu Ala
    1445 1450 1455
    Val Val Leu Asn His Pro Ser Pro Glu Ala Val Asp Thr Gly Arg Ala
    1460 1465 1470
    Phe Arg Asp Leu Gly Phe Asp Ser Leu Thr Ala Val Glu Leu Arg Asn
    1475 1480 1485
    Arg Leu Lys Asn Ala Thr Gly Leu Ala Leu Pro Ala Thr Leu Val Phe
    1490 1495 1500
    Asp Tyr Pro Thr Pro Arg Thr Leu Ala Glu Phe Leu Leu Ala Glu Ile
    1505 1510 1515 1520
    Leu Gly Glu Gln Ala Gly Ala Gly Glu Gln Leu Pro Val Asp Gly Gly
    1525 1530 1535
    Val Asp Asp Glu Pro Val Ala Ile Val Gly Met Ala Cys Arg Leu Pro
    1540 1545 1550
    Gly Gly Val Ala Ser Pro Glu Asp Leu Trp Arg Leu Val Ala Gly Gly
    1555 1560 1565
    Glu Asp Ala Ile Ser Gly Phe Pro Gln Asp Arg Gly Trp Asp Val Glu
    1570 1575 1580
    Gly Leu Tyr Asp Pro Asp Pro Asp Ala Ser Gly Arg Thr Tyr Cys Arg
    1585 1590 1595 1600
    Ala Gly Gly Phe Leu Asp Glu Ala Gly Glu Phe Asp Ala Asp Phe Phe
    1605 1610 1615
    Gly Ile Ser Pro Arg Glu Ala Leu Ala Met Asp Pro Gln Gln Arg Leu
    1620 1625 1630
    Leu Leu Glu Thr Ser Trp Glu Ala Val Glu Asp Ala Gly Ile Asp Pro
    1635 1640 1645
    Thr Ser Leu Gln Gly Gln Gln Val Gly Val Phe Ala Gly Thr Asn Gly
    1650 1655 1660
    Pro His Tyr Glu Pro Leu Leu Arg Asn Thr Ala Glu Asp Leu Glu Gly
    1665 1670 1675 1680
    Tyr Val Gly Thr Gly Asn Ala Ala Ser Ile Met Ser Gly Arg Val Ser
    1685 1690 1695
    Tyr Thr Leu Gly Leu Glu Gly Pro Ala Val Thr Val Asp Thr Ala Cys
    1700 1705 1710
    Ser Ser Ser Leu Val Ala Leu His Leu Ala Val Gln Ala Leu Arg Lys
    1715 1720 1725
    Gly Glu Cys Gly Leu Ala Leu Ala Gly Gly Val Thr Val Met Ser Thr
    1730 1735 1740
    Pro Thr Thr Phe Val Glu Phe Ser Arg Gln Arg Gly Leu Ala Glu Asp
    1745 1750 1755 1760
    Gly Arg Ser Lys Ala Phe Ala Ala Ser Ala Asp Gly Phe Gly Pro Ala
    1765 1770 1775
    Glu Gly Val Gly Met Leu Leu Val Glu Arg Leu Ser Asp Ala Arg Arg
    1780 1785 1790
    Asn Gly His Arg Val Leu Ala Val Val Arg Gly Ser Ala Val Asn Gln
    1795 1800 1805
    Asp Gly Ala Ser Asn Gly Leu Thr Ala Pro Asn Gly Pro Ser Gln Gln
    1810 1815 1820
    Arg Val Ile Arg Arg Ala Leu Ala Asp Ala Arg Leu Thr Thr Ala Asp
    1825 1830 1835 1840
    Val Asp Val Val Glu Ala His Gly Thr Gly Thr Arg Leu Gly Asp Pro
    1845 1850 1855
    Ile Glu Ala Gln Ala Leu Ile Ala Thr Tyr Gly Gln Gly Arg Asp Thr
    1860 1865 1870
    Glu Gln Pro Leu Arg Leu Gly Ser Leu Lys Ser Asn Ile Gly His Thr
    1875 1880 1885
    Gln Ala Ala Ala Gly Val Ser Gly Ile Ile Lys Met Val Gln Ala Met
    1890 1895 1900
    Arg His Gly Val Leu Pro Lys Thr Leu His Val Asp Arg Pro Ser Asp
    1905 1910 1915 1920
    Gln Ile Asp Trp Ser Ala Gly Thr Val Glu Leu Leu Thr Glu Ala Met
    1925 1930 1935
    Asp Trp Pro Arg Lys Gln Glu Gly Gly Leu Arg Arg Ala Ala Val Ser
    1940 1945 1950
    Ser Phe Gly Ile Ser Gly Thr Asn Ala His Ile Val Leu Glu Glu Ala
    1955 1960 1965
    Pro Val Asp Glu Asp Ala Pro Ala Asp Glu Pro Ser Val Gly Gly Val
    1970 1975 1980
    Val Pro Trp Leu Val Ser Ala Lys Thr Pro Ala Ala Leu Asp Ala Gln
    1985 1990 1995 2000
    Ile Gly Arg Leu Ala Ala Phe Ala Ser Gln Gly Arg Thr Asp Ala Ala
    2005 2010 2015
    Asp Pro Gly Ala Val Ala Arg Val Leu Ala Gly Gly Arg Ala Gln Phe
    2020 2025 2030
    Glu His Arg Ala Val Ala Leu Gly Thr Gly Gln Asp Asp Leu Ala Ala
    2035 2040 2045
    Ala Leu Ala Ala Pro Glu Gly Leu Val Arg Gly Val Ala Ser Gly Val
    2050 2055 2060
    Gly Arg Val Ala Phe Val Phe Pro Gly Gln Gly Thr Gln Trp Ala Gly
    2065 2070 2075 2080
    Met Gly Ala Glu Leu Leu Asp Val Ser Lys Glu Phe Ala Ala Ala Met
    2085 2090 2095
    Ala Glu Cys Glu Ala Ala Leu Ala Pro Tyr Val Asp Trp Ser Leu Glu
    2100 2105 2110
    Ala Val Val Arg Gln Ala Pro Gly Ala Pro Thr Leu Glu Arg Val Asp
    2115 2120 2125
    Val Val Gln Pro Val Thr Phe Ala Val Met Val Ser Leu Ala Lys Val
    2130 2135 2140
    Trp Gln His His Gly Val Thr Pro Gln Ala Val Val Gly His Ser Gln
    2145 2150 2155 2160
    Gly Glu Ile Ala Ala Ala Tyr Val Ala Gly Ala Leu Ser Leu Asp Asp
    2165 2170 2175
    Ala Ala Arg Val Val Thr Leu Arg Ser Lys Ser Ile Gly Ala His Leu
    2180 2185 2190
    Ala Gly Gln Gly Gly Met Leu Ser Leu Ala Leu Ser Glu Ala Ala Val
    2195 2200 2205
    Val Glu Arg Leu Ala Gly Phe Asp Gly Leu Ser Val Ala Ala Val Asn
    2210 2215 2220
    Gly Pro Thr Ala Thr Val Val Ser Gly Asp Pro Thr Gln Ile Gln Glu
    2225 2230 2235 2240
    Leu Ala Gln Ala Cys Glu Ala Asp Gly Val Arg Ala Arg Ile Ile Pro
    2245 2250 2255
    Val Asp Tyr Ala Ser His Ser Ala His Val Glu Thr Ile Glu Ser Glu
    2260 2265 2270
    Leu Ala Asp Val Leu Ala Gly Leu Ser Pro Gln Thr Pro Gln Val Pro
    2275 2280 2285
    Phe Phe Ser Thr Leu Glu Gly Ala Trp Ile Thr Glu Pro Ala Leu Asp
    2290 2295 2300
    Gly Gly Tyr Trp Tyr Arg Asn Leu Arg His Arg Val Gly Phe Ala Pro
    2305 2310 2315 2320
    Ala Val Glu Thr Leu Ala Thr Asp Glu Gly Phe Thr His Phe Val Glu
    2325 2330 2335
    Val Ser Ala His Pro Val Leu Thr Met Ala Leu Pro Glu Thr Val Thr
    2340 2345 2350
    Gly Leu Gly Thr Leu Arg Arg Asp Asn Gly Gly Gln His Arg Leu Thr
    2355 2360 2365
    Thr Ser Leu Ala Glu Ala Trp Ala Asn Gly Leu Thr Val Asp Trp Ala
    2370 2375 2380
    Ser Leu Leu Pro Thr Thr Thr Thr His Pro Asp Leu Pro Thr Tyr Ala
    2385 2390 2395 2400
    Phe Gln Thr Glu Arg Tyr Trp Pro Gln Pro Asp Leu Ser Ala Ala Gly
    2405 2410 2415
    Asp Ile Thr Ser Ala Gly Leu Gly Ala Ala Glu His Pro Leu Leu Gly
    2420 2425 2430
    Ala Ala Val Ala Leu Ala Asp Ser Asp Gly Cys Leu Leu Thr Gly Ser
    2435 2440 2445
    Leu Ser Leu Arg Thr His Pro Trp Leu Ala Asp His Ala Val Ala Gly
    2450 2455 2460
    Thr Val Leu Leu Pro Gly Thr Ala Phe Val Glu Leu Ala Phe Arg Ala
    2465 2470 2475 2480
    Gly Asp Gln Val Gly Cys Asp Leu Val Glu Glu Leu Thr Leu Asp Ala
    2485 2490 2495
    Pro Leu Val Leu Pro Arg Arg Gly Ala Val Arg Val Gln Leu Ser Val
    2500 2505 2510
    Gly Ala Ser Asp Glu Ser Gly Arg Arg Thr Phe Gly Leu Tyr Ala His
    2515 2520 2525
    Pro Glu Asp Ala Pro Gly Glu Ala Glu Trp Thr Arg His Ala Thr Gly
    2530 2535 2540
    Val Leu Ala Ala Arg Ala Asp Arg Thr Ala Pro Val Ala Asp Pro Glu
    2545 2550 2555 2560
    Ala Trp Pro Pro Pro Gly Ala Glu Pro Val Asp Val Asp Gly Leu Tyr
    2565 2570 2575
    Glu Arg Phe Ala Ala Asn Gly Tyr Gly Tyr Gly Pro Leu Phe Gln Gly
    2580 2585 2590
    Val Arg Gly Val Trp Arg Arg Gly Asp Glu Val Phe Ala Asp Val Ala
    2595 2600 2605
    Leu Pro Ala Glu Val Ala Gly Ala Glu Gly Ala Arg Phe Gly Leu His
    2610 2615 2620
    Pro Ala Leu Leu Asp Ala Ala Val Gln Ala Ala Gly Ala Gly Arg Gly
    2625 2630 2635 2640
    Val Arg Arg Gly His Ala Ala Ala Val Arg Leu Glu Arg Asp Leu Leu
    2645 2650 2655
    Tyr Ala Val Gly Ala Thr Ala Leu Arg Val Arg Leu Ala Pro Ala Gly
    2660 2665 2670
    Pro Asp Thr Val Ser Val Ser Ala Ala Asp Ser Ser Gly Gln Pro Val
    2675 2680 2685
    Phe Ala Ala Asp Ser Leu Thr Val Leu Pro Val Asp Pro Ala Gln Leu
    2690 2695 2700
    Ala Ala Phe Ser Asp Pro Thr Leu Asp Ala Leu His Leu Leu Glu Trp
    2705 2710 2715 2720
    Thr Ala Trp Asp Gly Ala Ala Gln Ala Leu Pro Gly Ala Val Val Leu
    2725 2730 2735
    Gly Gly Asp Ala Asp Gly Leu Ala Ala Ala Leu Arg Ala Gly Gly Thr
    2740 2745 2750
    Glu Val Leu Ser Phe Pro Asp Leu Thr Asp Leu Val Glu Ala Val Asp
    2755 2760 2765
    Arg Gly Glu Thr Pro Ala Pro Ala Thr Val Leu Val Ala Cys Pro Ala
    2770 2775 2780
    Ala Gly Pro Asp Gly Pro Glu His Val Arg Glu Ala Leu His Gly Ser
    2785 2790 2795 2800
    Leu Ala Leu Met Gln Ala Trp Leu Ala Asp Glu Arg Phe Thr Asp Gly
    2805 2810 2815
    Arg Leu Val Leu Val Thr Arg Asp Ala Val Ala Ala Arg Ser Gly Asp
    2820 2825 2830
    Gly Leu Arg Ser Thr Gly Gln Ala Ala Val Trp Gly Leu Gly Arg Ser
    2835 2840 2845
    Ala Gln Thr Glu Ser Pro Gly Arg Phe Val Leu Leu Asp Leu Ala Gly
    2850 2855 2860
    Glu Ala Arg Thr Ala Gly Asp Ala Thr Ala Gly Asp Gly Leu Thr Thr
    2865 2870 2875 2880
    Gly Asp Ala Thr Val Gly Gly Thr Ser Gly Asp Ala Ala Leu Gly Ser
    2885 2890 2895
    Ala Leu Ala Thr Ala Leu Gly Ser Gly Glu Pro Gln Leu Ala Leu Arg
    2900 2905 2910
    Asp Gly Ala Leu Leu Val Pro Arg Leu Ala Arg Ala Ala Ala Pro Ala
    2915 2920 2925
    Ala Ala Asp Gly Leu Ala Ala Ala Asp Gly Leu Ala Ala Leu Pro Leu
    2930 2935 2940
    Pro Ala Ala Pro Ala Leu Trp Arg Leu Glu Pro Gly Thr Asp Gly Ser
    2945 2950 2955 2960
    Leu Glu Ser Leu Thr Ala Ala Pro Gly Asp Ala Glu Thr Leu Ala Pro
    2965 2970 2975
    Glu Pro Leu Gly Pro Gly Gln Val Arg Ile Ala Ile Arg Ala Thr Gly
    2980 2985 2990
    Leu Asn Phe Arg Asp Val Leu Ile Ala Leu Gly Met Tyr Pro Asp Pro
    2995 3000 3005
    Ala Leu Met Gly Thr Glu Gly Ala Gly Val Val Thr Ala Thr Gly Pro
    3010 3015 3020
    Gly Val Thr His Leu Ala Pro Gly Asp Arg Val Met Gly Leu Leu Ser
    3025 3030 3035 3040
    Gly Ala Tyr Ala Pro Val Val Val Ala Asp Ala Arg Thr Val Ala Arg
    3045 3050 3055
    Met Pro Glu Gly Trp Thr Phe Ala Gln Gly Ala Ser Val Pro Val Val
    3060 3065 3070
    Phe Leu Thr Ala Val Tyr Ala Leu Arg Asp Leu Ala Asp Val Lys Pro
    3075 3080 3085
    Gly Glu Arg Leu Leu Val His Ser Ala Ala Gly Gly Val Gly Met Ala
    3090 3095 3100
    Ala Val Gln Leu Ala Arg His Trp Gly Val Glu Val His Gly Thr Ala
    3105 3110 3115 3120
    Ser His Gly Lys Trp Asp Ala Leu Arg Ala Leu Gly Leu Asp Asp Ala
    3125 3130 3135
    His Ile Ala Ser Ser Arg Thr Leu Asp Phe Glu Ser Ala Phe Arg Ala
    3140 3145 3150
    Ala Ser Gly Gly Ala Gly Met Asp Val Val Leu Asn Ser Leu Ala Arg
    3155 3160 3165
    Glu Phe Val Asp Ala Ser Leu Arg Leu Leu Gly Pro Gly Gly Arg Phe
    3170 3175 3180
    Val Glu Met Gly Lys Thr Asp Val Arg Asp Ala Glu Arg Val Ala Ala
    3185 3190 3195 3200
    Asp His Pro Gly Val Gly Tyr Arg Ala Phe Asp Leu Gly Glu Ala Gly
    3205 3210 3215
    Pro Glu Arg Ile Gly Glu Met Leu Ala Glu Val Ile Ala Leu Phe Glu
    3220 3225 3230
    Asp Gly Val Leu Arg His Leu Pro Val Thr Thr Trp Asp Val Arg Arg
    3235 3240 3245
    Ala Arg Asp Ala Phe Arg His Val Ser Gln Ala Arg His Thr Gly Lys
    3250 3255 3260
    Val Val Leu Thr Met Pro Ser Gly Leu Asp Pro Glu Gly Thr Val Leu
    3265 3270 3275 3280
    Leu Thr Gly Gly Thr Gly Ala Leu Gly Gly Ile Val Ala Arg His Val
    3285 3290 3295
    Val Gly Glu Trp Gly Val Arg Arg Leu Leu Leu Val Ser Arg Arg Gly
    3300 3305 3310
    Thr Asp Ala Pro Gly Ala Gly Glu Leu Val His Glu Leu Glu Ala Leu
    3315 3320 3325
    Gly Ala Asp Val Ser Val Ala Ala Cys Asp Val Ala Asp Arg Glu Ala
    3330 3335 3340
    Leu Thr Ala Val Leu Asp Ser Ile Pro Ala Glu His Pro Leu Thr Ala
    3345 3350 3355 3360
    Val Val His Thr Ala Gly Val Leu Ser Asp Gly Thr Leu Pro Ser Met
    3365 3370 3375
    Thr Ala Glu Asp Val Glu His Val Leu Arg Pro Lys Val Asp Ala Ala
    3380 3385 3390
    Phe Leu Leu Asp Glu Leu Thr Ser Thr Pro Gly Tyr Asp Leu Ala Ala
    3395 3400 3405
    Phe Val Met Phe Ser Ser Ala Ala Ala Val Phe Gly Gly Ala Gly Gln
    3410 3415 3420
    Gly Ala Tyr Ala Ala Ala Asn Ala Thr Leu Asp Ala Leu Ala Trp Arg
    3425 3430 3435 3440
    Arg Arg Thr Ala Gly Leu Pro Ala Leu Ser Leu Gly Trp Gly Leu Trp
    3445 3450 3455
    Ala Glu Thr Ser Gly Met Thr Gly Gly Leu Ser Asp Thr Asp Arg Ser
    3460 3465 3470
    Arg Leu Ala Arg Ser Gly Ala Thr Pro Met Asp Ser Glu Leu Thr Leu
    3475 3480 3485
    Ser Leu Leu Asp Ala Ala Met Arg Arg Asp Asp Pro Ala Leu Val Pro
    3490 3495 3500
    Ile Ala Leu Asp Val Ala Ala Leu Arg Ala Gln Gln Arg Asp Gly Met
    3505 3510 3515 3520
    Leu Ala Pro Leu Leu Ser Gly Leu Thr Arg Gly Ser Arg Val Gly Gly
    3525 3530 3535
    Ala Pro Val Asn Gln Arg Arg Ala Ala Ala Gly Gly Ala Gly Glu Ala
    3540 3545 3550
    Asp Thr Asp Leu Gly Gly Arg Leu Ala Ala Met Thr Pro Asp Asp Arg
    3555 3560 3565
    Val Ala His Leu Arg Asp Leu Val Arg Thr His Val Ala Thr Val Leu
    3570 3575 3580
    Gly His Gly Thr Pro Ser Arg Val Asp Leu Glu Arg Ala Phe Arg Asp
    3585 3590 3595 3600
    Thr Gly Phe Asp Ser Leu Thr Ala Val Glu Leu Arg Asn Arg Leu Asn
    3605 3610 3615
    Ala Ala Thr Gly Leu Arg Leu Pro Ala Thr Leu Val Phe Asp His Pro
    3620 3625 3630
    Thr Pro Gly Glu Leu Ala Gly His Leu Leu Asp Glu Leu Ala Thr Ala
    3635 3640 3645
    Ala Gly Gly Ser Trp Ala Glu Gly Thr Gly Ser Gly Asp Thr Ala Ser
    3650 3655 3660
    Ala Thr Asp Arg Gln Thr Thr Ala Ala Leu Ala Glu Leu Asp Arg Leu
    3665 3670 3675 3680
    Glu Gly Val Leu Ala Ser Leu Ala Pro Ala Ala Gly Gly Arg Pro Glu
    3685 3690 3695
    Leu Ala Ala Arg Leu Arg Ala Leu Ala Ala Ala Leu Gly Asp Asp Gly
    3700 3705 3710
    Asp Asp Ala Thr Asp Leu Asp Glu Ala Ser Asp Asp Asp Leu Phe Ser
    3715 3720 3725
    Phe Ile Asp Lys Glu Leu Gly Asp Ser Asp Phe
    3730 3735
    <210> SEQ ID NO 34
    <211> LENGTH: 4689
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 34
    atggcgaaca acgaagacaa gctccgcgac tacctcaagc gcgtcaccgc cgagctgcag 60
    cagaacacca ggcgtctgcg cgagatcgag ggacgcacgc acgagccggt ggcgatcgtg 120
    ggcatggcct gccgcctgcc gggcggtgtc gcctcgcccg aggacctgtg gcagctggtg 180
    gccggggacg gggacgcgat ctcggagttc ccgcaggacc gcggctggga cgtggagggg 240
    ctgtacgacc ccgacccgga cgcgtccggc aggacgtact gccggtccgg cggattcctg 300
    cacgacgccg gcgagttcga cgccgacttc ttcgggatct cgccgcgcga ggccctcgcc 360
    atggacccgc agcagcgact gtccctcacc accgcgtggg aggcgatcga gagcgcgggc 420
    atcgacccga cggccctgaa gggcagcggc ctcggcgtct tcgtcggcgg ctggcacacc 480
    ggctacacct cggggcagac caccgccgtg cagtcgcccg agctggaggg ccacctggtc 540
    agcggcgcgg cgctgggctt cctgtccggc cgtatcgcgt acgtcctcgg tacggacgga 600
    ccggccctga ccgtggacac ggcctgctcg tcctcgctgg tcgccctgca cctcgccgtg 660
    caggccctcc gcaagggcga gtgcgacatg gccctcgccg gtggtgtcac ggtcatgccc 720
    aacgcggacc tgttcgtgca gttcagccgg cagcgcgggc tggccgcgga cggccggtcg 780
    aaggcgttcg ccacctcggc ggacggcttc ggccccgcgg agggcgccgg agtcctgctg 840
    gtggagcgcc tgtcggacgc ccgccgcaac ggacaccgga tcctcgcggt cgtccgcggc 900
    agcgcggtca accaggacgg cgccagcaac ggcctcacgg ctccgcacgg gccctcccag 960
    cagcgcgtca tccgacgggc cctggcggac gcccggctcg cgccgggtga cgtggacgtc 1020
    gtcgaggcgc acggcacggg cacgcggctc ggcgacccga tcgaggcgca ggccctcatc 1080
    gccacctacg gccaggagaa gagcagcgaa cagccgctga ggctgggcgc gttgaagtcg 1140
    aacatcgggc acacgcaggc cgcggccggt gtcgcaggtg tcatcaagat ggtccaggcg 1200
    atgcgccacg gactgctgcc gaagacgctg cacgtcgacg agccctcgga ccagatcgac 1260
    tggtcggcgg gcacggtgga actcctcacc gaggccgtcg actggccgga gaagcaggac 1320
    ggcgggctgc gccgcgcggc tgtctcctcc ttcggcatca gcgggacgaa cgcgcacgtc 1380
    gtcctggagg aggccccggc ggtcgaggac tccccggccg tcgagccgcc ggccggtggc 1440
    ggtgtggtgc cgtggccggt gtccgcgaag actccggccg cgctggacgc ccagatcggg 1500
    cagctcgccg cgtacgcgga cggtcgtacg gacgtggatc cggcggtggc cgcccgcgcc 1560
    ctggtcgaca gccgtacggc gatggagcac cgcgcggtcg cggtcggcga cagccgggag 1620
    gcactgcggg acgccctgcg gatgccggaa ggactggtac gcggcacgtc ctcggacgtg 1680
    ggccgggtgg cgttcgtctt ccccggccag ggcacgcagt gggccggcat gggcgccgaa 1740
    ctccttgaca gctcaccgga gttcgctgcc tcgatggccg aatgcgagac cgcgctctcc 1800
    cgctacgtcg actggtctct tgaagccgtc gtccgacagg aacccggcgc acccacgctc 1860
    gaccgcgtcg acgtcgtcca gcccgtgacc ttcgctgtca tggtctcgct ggcgaaggtc 1920
    tggcagcacc acggcatcac cccccaggcc gtcgtcggcc actcgcaggg cgagatcgcc 1980
    gccgcgtacg tcgccggtgc actcaccctc gacgacgccg cccgcgtcgt caccctgcgc 2040
    agcaagtcca tcgccgccca cctcgccggc aagggcggca tgatctccct cgccctcgac 2100
    gaggcggccg tcctgaagcg actgagcgac ttcgacggac tctccgtcgc cgccgtcaac 2160
    ggccccaccg ccaccgtcgt ctccggcgac ccgacccaga tcgaggaact cgcccgcacc 2220
    tgcgaggccg acggcgtccg tgcgcggatc atcccggtcg actacgcctc ccacagccgg 2280
    caggtcgaga tcatcgagaa ggagctggcc gaggtcctcg ccggactcgc cccgcaggct 2340
    ccgcacgtgc cgttcttctc caccctcgaa ggcacctgga tcaccgagcc ggtgctcgac 2400
    ggcacctact ggtaccgcaa cctgcgccat cgcgtgggct tcgcccccgc cgtggagacc 2460
    ttggcggttg acggcttcac ccacttcatc gaggtcagcg cccaccccgt cctcaccatg 2520
    accctccccg agaccgtcac cggcctcggc accctccgcc gcgaacaggg aggccaggag 2580
    cgtctggtca cctcactcgc cgaagcctgg gccaacggcc tcaccatcga ctgggcgccc 2640
    atcctcccca ccgcaaccgg ccaccacccc gagctcccca cctacgcctt ccagaccgag 2700
    cgcttctggc tgcagagctc cgcgcccacc agcgccgccg acgactggcg ttaccgcgtc 2760
    gagtggaagc cgctgacggc ctccggccag gcggacctgt ccgggcggtg gatcgtcgcc 2820
    gtcgggagcg agccagaagc cgagctgctg ggcgcgctga aggccgcggg agcggaggtc 2880
    gacgtactgg aagccggggc ggacgacgac cgtgaggccc tcgccgcccg gctcaccgca 2940
    ctgacgaccg gcgacggctt caccggcgtg gtctcgctcc tcgacgacct cgtgccacag 3000
    gtcgcctggg tgcaggcact cggcgacgcc ggaatcaagg cgcccctgtg gtccgtcacc 3060
    cagggcgcgg tctccgtcgg acgtctcgac acccccgccg accccgaccg ggccatgctc 3120
    tggggcctcg gccgcgtcgt cgcccttgag caccccgaac gctgggccgg cctcgtcgac 3180
    ctccccgccc agcccgatgc cgccgccctc gcccacctcg tcaccgcact ctccggcgcc 3240
    accggcgagg accagatcgc catccgcacc accggactcc acgcccgccg cctcgcccgc 3300
    gcacccctcc acggacgtcg gcccacccgc gactggcagc cccacggcac cgtcctcatc 3360
    accggcggca ccggagccct cggcagccac gccgcacgct ggatggccca ccacggagcc 3420
    gaacacctcc tcctcgtcag ccgcagcggc gaacaagccc ccggagccac ccaactcacc 3480
    gccgaactca ccgcatcggg cgcccgcgtc accatcgccg cctgcgacgt cgccgacccc 3540
    cacgccatgc gcaccctcct cgacgccatc cccgccgaga cgcccctcac cgccgtcgtc 3600
    cacaccgccg gcgcaccggg cggcgatccg ctggacgtca ccggcccgga ggacatcgcc 3660
    cgcatcctgg gcgcgaagac gagcggcgcc gaggtcctcg acgacctgct ccgcggcact 3720
    ccgctggacg ccttcgtcct ctactcctcg aacgccgggg tctggggcag cggcagccag 3780
    ggcgtctacg cggcggccaa cgcccacctc gacgcgctcg ccgcccggcg ccgcgcccgg 3840
    ggcgagacgg cgacctcggt cgcctggggc ctctgggccg gcgacggcat gggccggggc 3900
    gccgacgacg cgtactggca gcgtcgcggc atccgtccga tgagccccga ccgcgccctg 3960
    gacgaactgg ccaaggccct gagccacgac gagaccttcg tcgccgtggc cgatgtcgac 4020
    tgggagcggt tcgcgcccgc gttcacggtg tcccgtccca gccttctgct cgacggcgtc 4080
    ccggaggccc ggcaggcgct cgccgcaccc gtcggtgccc cggctcccgg cgacgccgcc 4140
    gtggcgccga ccgggcagtc gtcggcgctg gccgcgatca ccgcgctccc cgagcccgag 4200
    cgccggccgg cgctcctcac cctcgtccgt acccacgcgg cggccgtact cggccattcc 4260
    tcccccgacc gggtggcccc cggccgtgcc ttcaccgagc tcggcttcga ctcgctgacg 4320
    gccgtgcagc tccgcaacca gctctccacg gtggtcggca acaggctccc cgccaccacg 4380
    gtcttcgacc acccgacgcc cgccgcactc gccgcgcacc tccacgaggc gtacctcgca 4440
    ccggccgagc cggccccgac ggactgggag gggcgggtgc gccgggccct ggccgaactg 4500
    cccctcgacc ggctgcggga cgcgggggtc ctcgacaccg tcctgcgcct caccggcatc 4560
    gagcccgagc cgggttccgg cggttcggac ggcggcgccg ccgaccctgg tgcggagccg 4620
    gaggcgtcga tcgacgacct ggacgccgag gccctgatcc ggatggctct cggcccccgt 4680
    aacacctga 4689
    <210> SEQ ID NO 35
    <211> LENGTH: 1562
    <212> TYPE: PRT
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 35
    Met Ala Asn Asn Glu Asp Lys Leu Arg Asp Tyr Leu Lys Arg Val Thr
    1 5 10 15
    Ala Glu Leu Gln Gln Asn Thr Arg Arg Leu Arg Glu Ile Glu Gly Arg
    20 25 30
    Thr His Glu Pro Val Ala Ile Val Gly Met Ala Cys Arg Leu Pro Gly
    35 40 45
    Gly Val Ala Ser Pro Glu Asp Leu Trp Gln Leu Val Ala Gly Asp Gly
    50 55 60
    Asp Ala Ile Ser Glu Phe Pro Gln Asp Arg Gly Trp Asp Val Glu Gly
    65 70 75 80
    Leu Tyr Asp Pro Asp Pro Asp Ala Ser Gly Arg Thr Tyr Cys Arg Ser
    85 90 95
    Gly Gly Phe Leu His Asp Ala Gly Glu Phe Asp Ala Asp Phe Phe Gly
    100 105 110
    Ile Ser Pro Arg Glu Ala Leu Ala Met Asp Pro Gln Gln Arg Leu Ser
    115 120 125
    Leu Thr Thr Ala Trp Glu Ala Ile Glu Ser Ala Gly Ile Asp Pro Thr
    130 135 140
    Ala Leu Lys Gly Ser Gly Leu Gly Val Phe Val Gly Gly Trp His Thr
    145 150 155 160
    Gly Tyr Thr Ser Gly Gln Thr Thr Ala Val Gln Ser Pro Glu Leu Glu
    165 170 175
    Gly His Leu Val Ser Gly Ala Ala Leu Gly Phe Leu Ser Gly Arg Ile
    180 185 190
    Ala Tyr Val Leu Gly Thr Asp Gly Pro Ala Leu Thr Val Asp Thr Ala
    195 200 205
    Cys Ser Ser Ser Leu Val Ala Leu His Leu Ala Val Gln Ala Leu Arg
    210 215 220
    Lys Gly Glu Cys Asp Met Ala Leu Ala Gly Gly Val Thr Val Met Pro
    225 230 235 240
    Asn Ala Asp Leu Phe Val Gln Phe Ser Arg Gln Arg Gly Leu Ala Ala
    245 250 255
    Asp Gly Arg Ser Lys Ala Phe Ala Thr Ser Ala Asp Gly Phe Gly Pro
    260 265 270
    Ala Glu Gly Ala Gly Val Leu Leu Val Glu Arg Leu Ser Asp Ala Arg
    275 280 285
    Arg Asn Gly His Arg Ile Leu Ala Val Val Arg Gly Ser Ala Val Asn
    290 295 300
    Gln Asp Gly Ala Ser Asn Gly Leu Thr Ala Pro His Gly Pro Ser Gln
    305 310 315 320
    Gln Arg Val Ile Arg Arg Ala Leu Ala Asp Ala Arg Leu Ala Pro Gly
    325 330 335
    Asp Val Asp Val Val Glu Ala His Gly Thr Gly Thr Arg Leu Gly Asp
    340 345 350
    Pro Ile Glu Ala Gln Ala Leu Ile Ala Thr Tyr Gly Gln Glu Lys Ser
    355 360 365
    Ser Glu Gln Pro Leu Arg Leu Gly Ala Leu Lys Ser Asn Ile Gly His
    370 375 380
    Thr Gln Ala Ala Ala Gly Val Ala Gly Val Ile Lys Met Val Gln Ala
    385 390 395 400
    Met Arg His Gly Leu Leu Pro Lys Thr Leu His Val Asp Glu Pro Ser
    405 410 415
    Asp Gln Ile Asp Trp Ser Ala Gly Thr Val Glu Leu Leu Thr Glu Ala
    420 425 430
    Val Asp Trp Pro Glu Lys Gln Asp Gly Gly Leu Arg Arg Ala Ala Val
    435 440 445
    Ser Ser Phe Gly Ile Ser Gly Thr Asn Ala His Val Val Leu Glu Glu
    450 455 460
    Ala Pro Ala Val Glu Asp Ser Pro Ala Val Glu Pro Pro Ala Gly Gly
    465 470 475 480
    Gly Val Val Pro Trp Pro Val Ser Ala Lys Thr Pro Ala Ala Leu Asp
    485 490 495
    Ala Gln Ile Gly Gln Leu Ala Ala Tyr Ala Asp Gly Arg Thr Asp Val
    500 505 510
    Asp Pro Ala Val Ala Ala Arg Ala Leu Val Asp Ser Arg Thr Ala Met
    515 520 525
    Glu His Arg Ala Val Ala Val Gly Asp Ser Arg Glu Ala Leu Arg Asp
    530 535 540
    Ala Leu Arg Met Pro Glu Gly Leu Val Arg Gly Thr Ser Ser Asp Val
    545 550 555 560
    Gly Arg Val Ala Phe Val Phe Pro Gly Gln Gly Thr Gln Trp Ala Gly
    565 570 575
    Met Gly Ala Glu Leu Leu Asp Ser Ser Pro Glu Phe Ala Ala Ser Met
    580 585 590
    Ala Glu Cys Glu Thr Ala Leu Ser Arg Tyr Val Asp Trp Ser Leu Glu
    595 600 605
    Ala Val Val Arg Gln Glu Pro Gly Ala Pro Thr Leu Asp Arg Val Asp
    610 615 620
    Val Val Gln Pro Val Thr Phe Ala Val Met Val Ser Leu Ala Lys Val
    625 630 635 640
    Trp Gln His His Gly Ile Thr Pro Gln Ala Val Val Gly His Ser Gln
    645 650 655
    Gly Glu Ile Ala Ala Ala Tyr Val Ala Gly Ala Leu Thr Leu Asp Asp
    660 665 670
    Ala Ala Arg Val Val Thr Leu Arg Ser Lys Ser Ile Ala Ala His Leu
    675 680 685
    Ala Gly Lys Gly Gly Met Ile Ser Leu Ala Leu Asp Glu Ala Ala Val
    690 695 700
    Leu Lys Arg Leu Ser Asp Phe Asp Gly Leu Ser Val Ala Ala Val Asn
    705 710 715 720
    Gly Pro Thr Ala Thr Val Val Ser Gly Asp Pro Thr Gln Ile Glu Glu
    725 730 735
    Leu Ala Arg Thr Cys Glu Ala Asp Gly Val Arg Ala Arg Ile Ile Pro
    740 745 750
    Val Asp Tyr Ala Ser His Ser Arg Gln Val Glu Ile Ile Glu Lys Glu
    755 760 765
    Leu Ala Glu Val Leu Ala Gly Leu Ala Pro Gln Ala Pro His Val Pro
    770 775 780
    Phe Phe Ser Thr Leu Glu Gly Thr Trp Ile Thr Glu Pro Val Leu Asp
    785 790 795 800
    Gly Thr Tyr Trp Tyr Arg Asn Leu Arg His Arg Val Gly Phe Ala Pro
    805 810 815
    Ala Val Glu Thr Leu Ala Val Asp Gly Phe Thr His Phe Ile Glu Val
    820 825 830
    Ser Ala His Pro Val Leu Thr Met Thr Leu Pro Glu Thr Val Thr Gly
    835 840 845
    Leu Gly Thr Leu Arg Arg Glu Gln Gly Gly Gln Glu Arg Leu Val Thr
    850 855 860
    Ser Leu Ala Glu Ala Trp Ala Asn Gly Leu Thr Ile Asp Trp Ala Pro
    865 870 875 880
    Ile Leu Pro Thr Ala Thr Gly His His Pro Glu Leu Pro Thr Tyr Ala
    885 890 895
    Phe Gln Thr Glu Arg Phe Trp Leu Gln Ser Ser Ala Pro Thr Ser Ala
    900 905 910
    Ala Asp Asp Trp Arg Tyr Arg Val Glu Trp Lys Pro Leu Thr Ala Ser
    915 920 925
    Gly Gln Ala Asp Leu Ser Gly Arg Trp Ile Val Ala Val Gly Ser Glu
    930 935 940
    Pro Glu Ala Glu Leu Leu Gly Ala Leu Lys Ala Ala Gly Ala Glu Val
    945 950 955 960
    Asp Val Leu Glu Ala Gly Ala Asp Asp Asp Arg Glu Ala Leu Ala Ala
    965 970 975
    Arg Leu Thr Ala Leu Thr Thr Gly Asp Gly Phe Thr Gly Val Val Ser
    980 985 990
    Leu Leu Asp Asp Leu Val Pro Gln Val Ala Trp Val Gln Ala Leu Gly
    995 1000 1005
    Asp Ala Gly Ile Lys Ala Pro Leu Trp Ser Val Thr Gln Gly Ala Val
    1010 1015 1020
    Ser Val Gly Arg Leu Asp Thr Pro Ala Asp Pro Asp Arg Ala Met Leu
    1025 1030 1035 1040
    Trp Gly Leu Gly Arg Val Val Ala Leu Glu His Pro Glu Arg Trp Ala
    1045 1050 1055
    Gly Leu Val Asp Leu Pro Ala Gln Pro Asp Ala Ala Ala Leu Ala His
    1060 1065 1070
    Leu Val Thr Ala Leu Ser Gly Ala Thr Gly Glu Asp Gln Ile Ala Ile
    1075 1080 1085
    Arg Thr Thr Gly Leu His Ala Arg Arg Leu Ala Arg Ala Pro Leu His
    1090 1095 1100
    Gly Arg Arg Pro Thr Arg Asp Trp Gln Pro His Gly Thr Val Leu Ile
    1105 1110 1115 1120
    Thr Gly Gly Thr Gly Ala Leu Gly Ser His Ala Ala Arg Trp Met Ala
    1125 1130 1135
    His His Gly Ala Glu His Leu Leu Leu Val Ser Arg Ser Gly Glu Gln
    1140 1145 1150
    Ala Pro Gly Ala Thr Gln Leu Thr Ala Glu Leu Thr Ala Ser Gly Ala
    1155 1160 1165
    Arg Val Thr Ile Ala Ala Cys Asp Val Ala Asp Pro His Ala Met Arg
    1170 1175 1180
    Thr Leu Leu Asp Ala Ile Pro Ala Glu Thr Pro Leu Thr Ala Val Val
    1185 1190 1195 1200
    His Thr Ala Gly Ala Pro Gly Gly Asp Pro Leu Asp Val Thr Gly Pro
    1205 1210 1215
    Glu Asp Ile Ala Arg Ile Leu Gly Ala Lys Thr Ser Gly Ala Glu Val
    1220 1225 1230
    Leu Asp Asp Leu Leu Arg Gly Thr Pro Leu Asp Ala Phe Val Leu Tyr
    1235 1240 1245
    Ser Ser Asn Ala Gly Val Trp Gly Ser Gly Ser Gln Gly Val Tyr Ala
    1250 1255 1260
    Ala Ala Asn Ala His Leu Asp Ala Leu Ala Ala Arg Arg Arg Ala Arg
    1265 1270 1275 1280
    Gly Glu Thr Ala Thr Ser Val Ala Trp Gly Leu Trp Ala Gly Asp Gly
    1285 1290 1295
    Met Gly Arg Gly Ala Asp Asp Ala Tyr Trp Gln Arg Arg Gly Ile Arg
    1300 1305 1310
    Pro Met Ser Pro Asp Arg Ala Leu Asp Glu Leu Ala Lys Ala Leu Ser
    1315 1320 1325
    His Asp Glu Thr Phe Val Ala Val Ala Asp Val Asp Trp Glu Arg Phe
    1330 1335 1340
    Ala Pro Ala Phe Thr Val Ser Arg Pro Ser Leu Leu Leu Asp Gly Val
    1345 1350 1355 1360
    Pro Glu Ala Arg Gln Ala Leu Ala Ala Pro Val Gly Ala Pro Ala Pro
    1365 1370 1375
    Gly Asp Ala Ala Val Ala Pro Thr Gly Gln Ser Ser Ala Leu Ala Ala
    1380 1385 1390
    Ile Thr Ala Leu Pro Glu Pro Glu Arg Arg Pro Ala Leu Leu Thr Leu
    1395 1400 1405
    Val Arg Thr His Ala Ala Ala Val Leu Gly His Ser Ser Pro Asp Arg
    1410 1415 1420
    Val Ala Pro Gly Arg Ala Phe Thr Glu Leu Gly Phe Asp Ser Leu Thr
    1425 1430 1435 1440
    Ala Val Gln Leu Arg Asn Gln Leu Ser Thr Val Val Gly Asn Arg Leu
    1445 1450 1455
    Pro Ala Thr Thr Val Phe Asp His Pro Thr Pro Ala Ala Leu Ala Ala
    1460 1465 1470
    His Leu His Glu Ala Tyr Leu Ala Pro Ala Glu Pro Ala Pro Thr Asp
    1475 1480 1485
    Trp Glu Gly Arg Val Arg Arg Ala Leu Ala Glu Leu Pro Leu Asp Arg
    1490 1495 1500
    Leu Arg Asp Ala Gly Val Leu Asp Thr Val Leu Arg Leu Thr Gly Ile
    1505 1510 1515 1520
    Glu Pro Glu Pro Gly Ser Gly Gly Ser Asp Gly Gly Ala Ala Asp Pro
    1525 1530 1535
    Gly Ala Glu Pro Glu Ala Ser Ile Asp Asp Leu Asp Ala Glu Ala Leu
    1540 1545 1550
    Ile Arg Met Ala Leu Gly Pro Arg Asn Thr
    1555 1560
    <210> SEQ ID NO 36
    <211> LENGTH: 4041
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 36
    atgacgagtt ccaacgaaca gttggtggac gctctgcgcg cctctctcaa ggagaacgaa 60
    gaactccgga aagagagccg tcgccgggcc gaccgtcggc aggagcccat ggcgatcgtc 120
    ggcatgagct gccggttcgc gggcggaatc cggtcccccg aggacctctg ggacgccgtc 180
    gccgcgggca aggacctggt ctccgaggta ccggaggagc gcggctggga catcgactcc 240
    ctctacgacc cggtgcccgg gcgcaagggc acgacgtacg tccgcaacgc cgcgttcctc 300
    gacgacgccg ccggattcga cgcggccttc ttcgggatct cgccgcgcga ggccctcgcc 360
    atggacccgc agcagcggca gctcctcgaa gcctcctggg aggtcttcga gcgggccggc 420
    atcgaccccg cgtcggtccg cggcaccgac gtcggcgtgt acgtgggctg tggctaccag 480
    gactacgcgc cggacatccg ggtcgccccc gaaggcaccg gcggttacgt cgtcaccggc 540
    aactcctccg ccgtggcctc cgggcgcatc gcgtactccc tcggcctgga gggacccgcc 600
    gtgaccgtgg acacggcgtg ctcctcttcg ctcgtcgccc tgcacctcgc cctgaagggc 660
    ctgcggaacg gcgactgctc gacggcactc gtgggcggcg tggccgtcct cgcgacgccg 720
    ggcgcgttca tcgagttcag cagccagcag gccatggccg ccgacggccg gaccaagggc 780
    ttcgcctcgg cggcggacgg cctcgcctgg ggcgagggcg tcgccgtact cctcctcgaa 840
    cggctctccg acgcgcggcg caagggccac cgggtcctgg ccgtcgtgcg cggcagcgcc 900
    atcaaccagg acggcgcgag caacggcctc acggctccgc acgggccctc ccagcagcac 960
    ctgatccgcc aggccctggc cgacgcgcgg ctcacgtcga gcgacgtgga cgtcgtggag 1020
    ggccacggca cggggacccg tctcggcgac ccgatcgagg cgcaggcgct gctcgccacg 1080
    tacgggcagg ggcgcgcccc ggggcagccg ctgcggctgg ggacgctgaa gtcgaacatc 1140
    gggcacacgc aggccgcttc gggtgtcgcc ggtgtcatca agatggtgca ggcgctgcgc 1200
    cacggggtgc tgccgaagac cctgcacgtg gacgagccga cggaccaggt cgactggtcg 1260
    gccggttcgg tcgagctgct caccgaggcc gtggactggc cggagcggcc gggccggctc 1320
    cgccgggcgg gcgtctccgc gttcggcgtg ggcgggacga acgcgcacgt cgtcctggag 1380
    gaggccccgg cggtcgagga gtcccctgcc gtcgagccgc cggccggtgg cggcgtggtg 1440
    ccgtggccgg tgtccgcgaa gacctcggcc gcactggacg cccagatcgg gcagctcgcc 1500
    gcatacgcgg aagaccgcac ggacgtggat ccggcggtgg ccgcccgcgc cctggtcgac 1560
    agccgtacgg cgatggagca ccgcgcggtc gcggtcggcg acagccggga ggcactgcgg 1620
    gacgccctgc ggatgccgga aggactggta cggggcacgg tcaccgatcc gggccgggtg 1680
    gcgttcgtct tccccggcca gggcacgcag tgggccggca tgggcgccga actcctcgac 1740
    agctcacccg aattcgccgc cgccatggcc gaatgcgaga ccgcactctc cccgtacgtc 1800
    gactggtctc tcgaagccgt cgtccgacag gctcccagcg caccgacact cgaccgcgtc 1860
    gacgtcgtcc agcccgtcac cttcgccgtc atggtctccc tcgccaaggt ctggcagcac 1920
    cacggcatca cccccgaggc cgtcatcggc cactcccagg gcgagatcgc cgccgcgtac 1980
    gtcgccggtg ccctcaccct cgacgacgcc gctcgtgtcg tgaccctccg cagcaagtcc 2040
    atcgccgccc acctcgccgg caagggcggc atgatctccc tcgccctcag cgaggaagcc 2100
    acccggcagc gcatcgagaa cctccacgga ctgtcgatcg ccgccgtcaa cgggcctacc 2160
    gccaccgtgg tttcgggcga ccccacccag atccaagaac ttgctcaggc gtgtgaggcc 2220
    gacggcatcc gcgcacggat catccccgtc gactacgcct cccacagcgc ccacgtcgag 2280
    accatcgaga acgaactcgc cgacgtcctg gcggggttgt ccccccagac accccaggtc 2340
    cccttcttct ccaccctcga aggcacctgg atcaccgaac ccgccctcga cggcggctac 2400
    tggtaccgca acctccgcca tcgtgtgggc ttcgccccgg ccgtcgagac cctcgccacc 2460
    gacgaaggct tcacccactt catcgaggtc agcgcccacc ccgtcctcac catgaccctc 2520
    cccgacaagg tcaccggcct ggccaccctc cgacgcgagg acggcggaca gcaccgcctc 2580
    accacctccc ttgccgaggc ctgggccaac ggcctcgccc tcgactgggc ctccctcctg 2640
    cccgccacgg gcgccctcag ccccgccgtc cccgacctcc cgacgtacgc cttccagcac 2700
    cgctcgtact ggatcagccc cgcgggtccc ggcgaggcgc ccgcgcacac cgcttccggg 2760
    cgcgaggccg tcgccgagac ggggctcgcg tggggcccgg gtgccgagga cctcgacgag 2820
    gagggccggc gcagcgccgt actcgcgatg gtgatgcggc aggcggcctc cgtgctccgg 2880
    tgcgactcgc ccgaagaggt ccccgtcgac cgcccgctgc gggagatcgg cttcgactcg 2940
    ctgaccgccg tcgacttccg caaccgcgtc aaccggctga ccggtctcca gctgccgccc 3000
    accgtcgtgt tccagcaccc gacgcccgtc gcgctcgccg agcgcatcag cgacgagctg 3060
    gccgagcgga actgggccgt cgccgagccg tcggatcacg agcaggcgga ggaggagaag 3120
    gccgccgctc cggcgggggc ccgctccggg gccgacaccg gcgccggcgc cgggatgttc 3180
    cgcgccctgt tccggcaggc cgtggaggac gaccggtacg gcgagttcct cgacgtcctc 3240
    gccgaagcct ccgcgttccg cccgcagttc gcctcgcccg aggcctgctc ggagcggctc 3300
    gacccggtgc tgctcgccgg cggtccgacg gaccgggcgg aaggccgtgc cgttctcgtc 3360
    ggctgcaccg gcaccgcggc gaacggcggc ccgcacgagt tcctgcggct cagcacctcc 3420
    ttccaggagg agcgggactt cctcgccgta cctctccccg gctacggcac gggtacgggc 3480
    accggcacgg ccctcctccc ggccgatctc gacaccgcgc tcgacgccca ggcccgggcg 3540
    atcctccggg ccgccgggga cgccccggtc gtcctgctcg ggcactccgg cggcgccctg 3600
    ctcgcgcacg agctggcctt ccgcctggag cgggcgcacg gcgcgccgcc ggccgggatc 3660
    gtcctggtcg acccctatcc gccgggccat caggagccca tcgaggtgtg gagcaggcag 3720
    ctgggcgagg gcctgttcgc gggcgagctg gagccgatgt ccgatgcgcg gctgctggcc 3780
    atgggccggt acgcgcggtt cctcgccggc ccgcggccgg gccgcagcag cgcgcccgtg 3840
    cttctggtcc gtgcctccga accgctgggc gactggcagg aggagcgggg cgactggcgt 3900
    gcccactggg accttccgca caccgtcgcg gacgtgccgg gcgaccactt cacgatgatg 3960
    cgggaccacg cgccggccgt cgccgaggcc gtcctctcct ggctcgacgc catcgagggc 4020
    atcgaggggg cgggcaagtg a 4041
    <210> SEQ ID NO 37
    <211> LENGTH: 1346
    <212> TYPE: PRT
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 37
    Met Thr Ser Ser Asn Glu Gln Leu Val Asp Ala Leu Arg Ala Ser Leu
    1 5 10 15
    Lys Glu Asn Glu Glu Leu Arg Lys Glu Ser Arg Arg Arg Ala Asp Arg
    20 25 30
    Arg Gln Glu Pro Met Ala Ile Val Gly Met Ser Cys Arg Phe Ala Gly
    35 40 45
    Gly Ile Arg Ser Pro Glu Asp Leu Trp Asp Ala Val Ala Ala Gly Lys
    50 55 60
    Asp Leu Val Ser Glu Val Pro Glu Glu Arg Gly Trp Asp Ile Asp Ser
    65 70 75 80
    Leu Tyr Asp Pro Val Pro Gly Arg Lys Gly Thr Thr Tyr Val Arg Asn
    85 90 95
    Ala Ala Phe Leu Asp Asp Ala Ala Gly Phe Asp Ala Ala Phe Phe Gly
    100 105 110
    Ile Ser Pro Arg Glu Ala Leu Ala Met Asp Pro Gln Gln Arg Gln Leu
    115 120 125
    Leu Glu Ala Ser Trp Glu Val Phe Glu Arg Ala Gly Ile Asp Pro Ala
    130 135 140
    Ser Val Arg Gly Thr Asp Val Gly Val Tyr Val Gly Cys Gly Tyr Gln
    145 150 155 160
    Asp Tyr Ala Pro Asp Ile Arg Val Ala Pro Glu Gly Thr Gly Gly Tyr
    165 170 175
    Val Val Thr Gly Asn Ser Ser Ala Val Ala Ser Gly Arg Ile Ala Tyr
    180 185 190
    Ser Leu Gly Leu Glu Gly Pro Ala Val Thr Val Asp Thr Ala Cys Ser
    195 200 205
    Ser Ser Leu Val Ala Leu His Leu Ala Leu Lys Gly Leu Arg Asn Gly
    210 215 220
    Asp Cys Ser Thr Ala Leu Val Gly Gly Val Ala Val Leu Ala Thr Pro
    225 230 235 240
    Gly Ala Phe Ile Glu Phe Ser Ser Gln Gln Ala Met Ala Ala Asp Gly
    245 250 255
    Arg Thr Lys Gly Phe Ala Ser Ala Ala Asp Gly Leu Ala Trp Gly Glu
    260 265 270
    Gly Val Ala Val Leu Leu Leu Glu Arg Leu Ser Asp Ala Arg Arg Lys
    275 280 285
    Gly His Arg Val Leu Ala Val Val Arg Gly Ser Ala Ile Asn Gln Asp
    290 295 300
    Gly Ala Ser Asn Gly Leu Thr Ala Pro His Gly Pro Ser Gln Gln His
    305 310 315 320
    Leu Ile Arg Gln Ala Leu Ala Asp Ala Arg Leu Thr Ser Ser Asp Val
    325 330 335
    Asp Val Val Glu Gly His Gly Thr Gly Thr Arg Leu Gly Asp Pro Ile
    340 345 350
    Glu Ala Gln Ala Leu Leu Ala Thr Tyr Gly Gln Gly Arg Ala Pro Gly
    355 360 365
    Gln Pro Leu Arg Leu Gly Thr Leu Lys Ser Asn Ile Gly His Thr Gln
    370 375 380
    Ala Ala Ser Gly Val Ala Gly Val Ile Lys Met Val Gln Ala Leu Arg
    385 390 395 400
    His Gly Val Leu Pro Lys Thr Leu His Val Asp Glu Pro Thr Asp Gln
    405 410 415
    Val Asp Trp Ser Ala Gly Ser Val Glu Leu Leu Thr Glu Ala Val Asp
    420 425 430
    Trp Pro Glu Arg Pro Gly Arg Leu Arg Arg Ala Gly Val Ser Ala Phe
    435 440 445
    Gly Val Gly Gly Thr Asn Ala His Val Val Leu Glu Glu Ala Pro Ala
    450 455 460
    Val Glu Glu Ser Pro Ala Val Glu Pro Pro Ala Gly Gly Gly Val Val
    465 470 475 480
    Pro Trp Pro Val Ser Ala Lys Thr Ser Ala Ala Leu Asp Ala Gln Ile
    485 490 495
    Gly Gln Leu Ala Ala Tyr Ala Glu Asp Arg Thr Asp Val Asp Pro Ala
    500 505 510
    Val Ala Ala Arg Ala Leu Val Asp Ser Arg Thr Ala Met Glu His Arg
    515 520 525
    Ala Val Ala Val Gly Asp Ser Arg Glu Ala Leu Arg Asp Ala Leu Arg
    530 535 540
    Met Pro Glu Gly Leu Val Arg Gly Thr Val Thr Asp Pro Gly Arg Val
    545 550 555 560
    Ala Phe Val Phe Pro Gly Gln Gly Thr Gln Trp Ala Gly Met Gly Ala
    565 570 575
    Glu Leu Leu Asp Ser Ser Pro Glu Phe Ala Ala Ala Met Ala Glu Cys
    580 585 590
    Glu Thr Ala Leu Ser Pro Tyr Val Asp Trp Ser Leu Glu Ala Val Val
    595 600 605
    Arg Gln Ala Pro Ser Ala Pro Thr Leu Asp Arg Val Asp Val Val Gln
    610 615 620
    Pro Val Thr Phe Ala Val Met Val Ser Leu Ala Lys Val Trp Gln His
    625 630 635 640
    His Gly Ile Thr Pro Glu Ala Val Ile Gly His Ser Gln Gly Glu Ile
    645 650 655
    Ala Ala Ala Tyr Val Ala Gly Ala Leu Thr Leu Asp Asp Ala Ala Arg
    660 665 670
    Val Val Thr Leu Arg Ser Lys Ser Ile Ala Ala His Leu Ala Gly Lys
    675 680 685
    Gly Gly Met Ile Ser Leu Ala Leu Ser Glu Glu Ala Thr Arg Gln Arg
    690 695 700
    Ile Glu Asn Leu His Gly Leu Ser Ile Ala Ala Val Asn Gly Pro Thr
    705 710 715 720
    Ala Thr Val Val Ser Gly Asp Pro Thr Gln Ile Gln Glu Leu Ala Gln
    725 730 735
    Ala Cys Glu Ala Asp Gly Ile Arg Ala Arg Ile Ile Pro Val Asp Tyr
    740 745 750
    Ala Ser His Ser Ala His Val Glu Thr Ile Glu Asn Glu Leu Ala Asp
    755 760 765
    Val Leu Ala Gly Leu Ser Pro Gln Thr Pro Gln Val Pro Phe Phe Ser
    770 775 780
    Thr Leu Glu Gly Thr Trp Ile Thr Glu Pro Ala Leu Asp Gly Gly Tyr
    785 790 795 800
    Trp Tyr Arg Asn Leu Arg His Arg Val Gly Phe Ala Pro Ala Val Glu
    805 810 815
    Thr Leu Ala Thr Asp Glu Gly Phe Thr His Phe Ile Glu Val Ser Ala
    820 825 830
    His Pro Val Leu Thr Met Thr Leu Pro Asp Lys Val Thr Gly Leu Ala
    835 840 845
    Thr Leu Arg Arg Glu Asp Gly Gly Gln His Arg Leu Thr Thr Ser Leu
    850 855 860
    Ala Glu Ala Trp Ala Asn Gly Leu Ala Leu Asp Trp Ala Ser Leu Leu
    865 870 875 880
    Pro Ala Thr Gly Ala Leu Ser Pro Ala Val Pro Asp Leu Pro Thr Tyr
    885 890 895
    Ala Phe Gln His Arg Ser Tyr Trp Ile Ser Pro Ala Gly Pro Gly Glu
    900 905 910
    Ala Pro Ala His Thr Ala Ser Gly Arg Glu Ala Val Ala Glu Thr Gly
    915 920 925
    Leu Ala Trp Gly Pro Gly Ala Glu Asp Leu Asp Glu Glu Gly Arg Arg
    930 935 940
    Ser Ala Val Leu Ala Met Val Met Arg Gln Ala Ala Ser Val Leu Arg
    945 950 955 960
    Cys Asp Ser Pro Glu Glu Val Pro Val Asp Arg Pro Leu Arg Glu Ile
    965 970 975
    Gly Phe Asp Ser Leu Thr Ala Val Asp Phe Arg Asn Arg Val Asn Arg
    980 985 990
    Leu Thr Gly Leu Gln Leu Pro Pro Thr Val Val Phe Gln His Pro Thr
    995 1000 1005
    Pro Val Ala Leu Ala Glu Arg Ile Ser Asp Glu Leu Ala Glu Arg Asn
    1010 1015 1020
    Trp Ala Val Ala Glu Pro Ser Asp His Glu Gln Ala Glu Glu Glu Lys
    1025 1030 1035 1040
    Ala Ala Ala Pro Ala Gly Ala Arg Ser Gly Ala Asp Thr Gly Ala Gly
    1045 1050 1055
    Ala Gly Met Phe Arg Ala Leu Phe Arg Gln Ala Val Glu Asp Asp Arg
    1060 1065 1070
    Tyr Gly Glu Phe Leu Asp Val Leu Ala Glu Ala Ser Ala Phe Arg Pro
    1075 1080 1085
    Gln Phe Ala Ser Pro Glu Ala Cys Ser Glu Arg Leu Asp Pro Val Leu
    1090 1095 1100
    Leu Ala Gly Gly Pro Thr Asp Arg Ala Glu Gly Arg Ala Val Leu Val
    1105 1110 1115 1120
    Gly Cys Thr Gly Thr Ala Ala Asn Gly Gly Pro His Glu Phe Leu Arg
    1125 1130 1135
    Leu Ser Thr Ser Phe Gln Glu Glu Arg Asp Phe Leu Ala Val Pro Leu
    1140 1145 1150
    Pro Gly Tyr Gly Thr Gly Thr Gly Thr Gly Thr Ala Leu Leu Pro Ala
    1155 1160 1165
    Asp Leu Asp Thr Ala Leu Asp Ala Gln Ala Arg Ala Ile Leu Arg Ala
    1170 1175 1180
    Ala Gly Asp Ala Pro Val Val Leu Leu Gly His Ser Gly Gly Ala Leu
    1185 1190 1195 1200
    Leu Ala His Glu Leu Ala Phe Arg Leu Glu Arg Ala His Gly Ala Pro
    1205 1210 1215
    Pro Ala Gly Ile Val Leu Val Asp Pro Tyr Pro Pro Gly His Gln Glu
    1220 1225 1230
    Pro Ile Glu Val Trp Ser Arg Gln Leu Gly Glu Gly Leu Phe Ala Gly
    1235 1240 1245
    Glu Leu Glu Pro Met Ser Asp Ala Arg Leu Leu Ala Met Gly Arg Tyr
    1250 1255 1260
    Ala Arg Phe Leu Ala Gly Pro Arg Pro Gly Arg Ser Ser Ala Pro Val
    1265 1270 1275 1280
    Leu Leu Val Arg Ala Ser Glu Pro Leu Gly Asp Trp Gln Glu Glu Arg
    1285 1290 1295
    Gly Asp Trp Arg Ala His Trp Asp Leu Pro His Thr Val Ala Asp Val
    1300 1305 1310
    Pro Gly Asp His Phe Thr Met Met Arg Asp His Ala Pro Ala Val Ala
    1315 1320 1325
    Glu Ala Val Leu Ser Trp Leu Asp Ala Ile Glu Gly Ile Glu Gly Ala
    1330 1335 1340
    Gly Lys
    1345
    <210> SEQ ID NO 38
    <211> LENGTH: 1251
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 38
    gtgcgccgta cccagcaggg aacgaccgct tctcccccgg tactcgacct cggggccctg 60
    gggcaggatt tcgcggccga tccgtatccg acgtacgcga gactgcgtgc cgagggtccg 120
    gcccaccggg tgcgcacccc cgagggggac gaggtgtggc tggtcgtcgg ctacgaccgg 180
    gcgcgggcgg tcctcgccga tccccggttc agcaaggact ggcgcaactc cacgactccc 240
    ctgaccgagg ccgaggccgc gctcaaccac aacatgctgg agtccgaccc gccgcggcac 300
    acccggctgc gcaagctggt ggcccgtgag ttcaccatgc gccgggtcga gttgctgcgg 360
    ccccgggtcc aggagatcgt cgacgggctc gtggacgcca tgctggcggc gcccgacggc 420
    cgcgccgatc tgatggagtc cctggcctgg ccgctgccga tcaccgtgat ctccgaactc 480
    ctcggcgtgc ccgagccgga ccgcgccgcc ttccgcgtct ggaccgacgc cttcgtcttc 540
    ccggacgatc ccgcccaggc ccagaccgcc atggccgaga tgagcggcta tctctcccgg 600
    ctcatcgact ccaagcgcgg gcaggacggc gaggacctgc tcagcgcgct cgtgcggacc 660
    agcgacgagg acggctcccg gctgacctcc gaggagctgc tcggtatggc ccacatcctg 720
    ctcgtcgcgg ggcacgagac cacggtcaat ctgatcgcca acggcatgta cgcgctgctc 780
    tcgcaccccg accagctggc cgccctgcgg gccgacatga cgctcttgga cggcgcggtg 840
    gaggagatgt tgcgctacga gggcccggtg gaatccgcga cctaccgctt cccggtcgag 900
    cccgtcgacc tggacggcac ggtcatcccg gccggtgaca cggtcctcgt cgtcctggcc 960
    gacgcccacc gcacccccga gcgcttcccg gacccgcacc gcttcgacat ccgccgggac 1020
    accgccggcc atctcgcctt cggccacggc atccacttct gcatcggcgc ccccttggcc 1080
    cggttggagg cccggatcgc cgtccgcgcc cttctcgaac gctgcccgga cctcgccctg 1140
    gacgtctccc ccggcgaact cgtgtggtat ccgaacccga tgattcgcgg gctcaaggcc 1200
    ctgccgatcc gctggcggcg aggacgggag gcgggccgcc gtaccggttg a 1251
    <210> SEQ ID NO 39
    <211> LENGTH: 416
    <212> TYPE: PRT
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 39
    Met Arg Arg Thr Gln Gln Gly Thr Thr Ala Ser Pro Pro Val Leu Asp
    1 5 10 15
    Leu Gly Ala Leu Gly Gln Asp Phe Ala Ala Asp Pro Tyr Pro Thr Tyr
    20 25 30
    Ala Arg Leu Arg Ala Glu Gly Pro Ala His Arg Val Arg Thr Pro Glu
    35 40 45
    Gly Asp Glu Val Trp Leu Val Val Gly Tyr Asp Arg Ala Arg Ala Val
    50 55 60
    Leu Ala Asp Pro Arg Phe Ser Lys Asp Trp Arg Asn Ser Thr Thr Pro
    65 70 75 80
    Leu Thr Glu Ala Glu Ala Ala Leu Asn His Asn Met Leu Glu Ser Asp
    85 90 95
    Pro Pro Arg His Thr Arg Leu Arg Lys Leu Val Ala Arg Glu Phe Thr
    100 105 110
    Met Arg Arg Val Glu Leu Leu Arg Pro Arg Val Gln Glu Ile Val Asp
    115 120 125
    Gly Leu Val Asp Ala Met Leu Ala Ala Pro Asp Gly Arg Ala Asp Leu
    130 135 140
    Met Glu Ser Leu Ala Trp Pro Leu Pro Ile Thr Val Ile Ser Glu Leu
    145 150 155 160
    Leu Gly Val Pro Glu Pro Asp Arg Ala Ala Phe Arg Val Trp Thr Asp
    165 170 175
    Ala Phe Val Phe Pro Asp Asp Pro Ala Gln Ala Gln Thr Ala Met Ala
    180 185 190
    Glu Met Ser Gly Tyr Leu Ser Arg Leu Ile Asp Ser Lys Arg Gly Gln
    195 200 205
    Asp Gly Glu Asp Leu Leu Ser Ala Leu Val Arg Thr Ser Asp Glu Asp
    210 215 220
    Gly Ser Arg Leu Thr Ser Glu Glu Leu Leu Gly Met Ala His Ile Leu
    225 230 235 240
    Leu Val Ala Gly His Glu Thr Thr Val Asn Leu Ile Ala Asn Gly Met
    245 250 255
    Tyr Ala Leu Leu Ser His Pro Asp Gln Leu Ala Ala Leu Arg Ala Asp
    260 265 270
    Met Thr Leu Leu Asp Gly Ala Val Glu Glu Met Leu Arg Tyr Glu Gly
    275 280 285
    Pro Val Glu Ser Ala Thr Tyr Arg Phe Pro Val Glu Pro Val Asp Leu
    290 295 300
    Asp Gly Thr Val Ile Pro Ala Gly Asp Thr Val Leu Val Val Leu Ala
    305 310 315 320
    Asp Ala His Arg Thr Pro Glu Arg Phe Pro Asp Pro His Arg Phe Asp
    325 330 335
    Ile Arg Arg Asp Thr Ala Gly His Leu Ala Phe Gly His Gly Ile His
    340 345 350
    Phe Cys Ile Gly Ala Pro Leu Ala Arg Leu Glu Ala Arg Ile Ala Val
    355 360 365
    Arg Ala Leu Leu Glu Arg Cys Pro Asp Leu Ala Leu Asp Val Ser Pro
    370 375 380
    Gly Glu Leu Val Trp Tyr Pro Asn Pro Met Ile Arg Gly Leu Lys Ala
    385 390 395 400
    Leu Pro Ile Arg Trp Arg Arg Gly Arg Glu Ala Gly Arg Arg Thr Gly
    405 410 415
    <210> SEQ ID NO 40
    <211> LENGTH: 2787
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 40
    atgaatctgg tggaacgcga cggggagata gcccatctca gggccgttct tgacgcatcc 60
    gccgcaggtg acgggacgct cttactcgtc tccggaccgg ccggcagcgg gaagacggag 120
    ctgctgcggt cgctccgccg gctggccgcc gagcgggaga cccccgtctg gtcggtccgg 180
    gcgctgccgg gtgaccgcga catccccctg ggcgtcctct gccagttact ccgcagcgcc 240
    gaacaacacg gtgccgacac ctccgccgtc cgcgacctgc tggacgccgc ctcgcggcgg 300
    gccggaaacc tcacctcccc cgccgacgcg ccgctccgcg tcgacgagac acaccgcctg 360
    cacgactggc tgctctccgt ctcccgccgc accccgttcc tcgtcgccgt cgacgacctg 420
    acccacgccg acaccgcgtc cctgaggttc ctcctgtact gcgccgccca ccacgaccag 480
    ggcggcatcg gcttcgtcat gaccgagcgg gcctcgcagc gcgccggata ccgggtgttc 540
    cgcgccgagc tgctccgcca gccgcactgc cgcaacatgt ggctctccgg gcttcccccc 600
    agcggggtac gccagttact cgcccactac tacggccccg aggccgccga gcggcgggcc 660
    cccgcgtacc acgcgacgac cggcgggaac ccgctgctcc tgcgggcgct gacccaggac 720
    cggcaggcct cccacaccac cctcggcgcg gccggcggcg acgagcccgt ccacggcgac 780
    gccttcgccc aggccgtcct cgactgcctg caccgcagcg ccgagggcac actggagacc 840
    gcccgctggc tcgcggtcct cgaacagtcc gacccgctcc tggtggagcg gctcacggga 900
    acgaccgccg ccgccgtcga gcgccacatc caggagctcg ccgccatcgg cctcctggac 960
    gaggacggca ccctgggaca gcccgcgatc cgcgaggccg ccctccagga cctgccggcc 1020
    ggcgagcgca ccgaactgca ccggcgcgcc gcggagcagc tgcaccggga cggcgccgac 1080
    gaggacaccg tggcccgcca cctgctggtc ggcggcgccc ccgacgctcc ctgggcgctg 1140
    cccctgctcg aacggggcgc gcagcaggcc ctgttcgacg accgactcga cgacgccttc 1200
    cggatcctcg agttcgccgt gcggtcgagc accgacaaca cccagctggc ccgcctcgcc 1260
    ccacacctgg tcgcggcctc ctggcggatg aacccgcaca tgacgacccg ggccctcgca 1320
    ctcttcgacc ggctcctgag cggtgaactg ccgcccagcc acccggtcat ggccctgatc 1380
    cgctgcctcg tctggtacgg gcggctgccc gaggccgccg acgcgctgtc ccggctgcgg 1440
    cccagctccg acaacgatgc cttggagctg tcgctcaccc ggatgtggct cgcggcgctg 1500
    tgcccgccgc tcctggagtc cctgccggcc acgccggagc cggagcgggg tcccgtcccc 1560
    gtacggctcg cgccgcggac gaccgcgctc caggcccagg ccggcgtctt ccagcggggc 1620
    ccggacaacg cctcggtcgc gcaggccgaa cagatcctgc agggctgccg gctgtcggag 1680
    gagacgtacg aggccctgga gacggccctc ttggtcctcg tccacgccga ccggctcgac 1740
    cgggcgctgt tctggtcgga cgccctgctc gccgaggccg tggagcggcg gtcgctcggc 1800
    tgggaggcgg tcttcgccgc gacccgggcg atgatcgcga tccgctgcgg cgacctcccg 1860
    acggcgcggg agcgggccga gctggcgctc tcccacgcgg cgccggagag ctggggcctc 1920
    gccgtgggca tgcccctctc cgcgctgctg ctcgcctgca cggaggccgg cgagtacgaa 1980
    caggcggagc gggtcctgcg gcagccggtg ccggacgcga tgttcgactc gcggcacggc 2040
    atggagtaca tgcacgcccg gggccgctac tggctggcga cgggccggct gcacgcggcg 2100
    ctgggcgagt tcatgctctg cggggagatc ctgggcagct ggaacctcga ccagccctcg 2160
    atcgtgccct ggcggacctc cgccgccgag gtgtacctgc ggctcggcaa ccgccagaag 2220
    gccagggcgc tggccgaggc ccagctcgcc ctggtgcggc ccgggcgctc ccgcacccgg 2280
    ggtctcaccc tgcgggtcct ggcggcggcg gtggacggcc agcaggcgga gcggctgcac 2340
    gccgaggcgg tcgacatgct gcacgacagc ggcgaccggc tcgaacacgc ccgcgcgctc 2400
    gccgggatga gccgccacca gcaggcccag ggggacaact accgggcgag gatgacggcg 2460
    cggctcgccg gcgacatggc gtgggcctgc ggcgcgtacc cgctggccga ggagatcgtg 2520
    ccgggccgcg gcggccgccg ggcgaaggcg gtgagcacgg agctggaact gccgggcggc 2580
    ccggacgtcg gcctgctctc ggaggccgaa cgccgggtgg cggccctggc agcccgagga 2640
    ttgacgaacc gccagatagc gcgccggctc tgcgtcaccg cgagcacggt cgaacagcac 2700
    ctgacgcgcg tctaccgcaa actgaacgtg acccgccgag cagacctccc gatcagcctc 2760
    gcccaggaca agtccgtcac ggcctga 2787
    <210> SEQ ID NO 41
    <211> LENGTH: 928
    <212> TYPE: PRT
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 41
    Met Asn Leu Val Glu Arg Asp Gly Glu Ile Ala His Leu Arg Ala Val
    1 5 10 15
    Leu Asp Ala Ser Ala Ala Gly Asp Gly Thr Leu Leu Leu Val Ser Gly
    20 25 30
    Pro Ala Gly Ser Gly Lys Thr Glu Leu Leu Arg Ser Leu Arg Arg Leu
    35 40 45
    Ala Ala Glu Arg Glu Thr Pro Val Trp Ser Val Arg Ala Leu Pro Gly
    50 55 60
    Asp Arg Asp Ile Pro Leu Gly Val Leu Cys Gln Leu Leu Arg Ser Ala
    65 70 75 80
    Glu Gln His Gly Ala Asp Thr Ser Ala Val Arg Asp Leu Leu Asp Ala
    85 90 95
    Ala Ser Arg Arg Ala Gly Asn Leu Thr Ser Pro Ala Asp Ala Pro Leu
    100 105 110
    Arg Val Asp Glu Thr His Arg Leu His Asp Trp Leu Leu Ser Val Ser
    115 120 125
    Arg Arg Thr Pro Phe Leu Val Ala Val Asp Asp Leu Thr His Ala Asp
    130 135 140
    Thr Ala Ser Leu Arg Phe Leu Leu Tyr Cys Ala Ala His His Asp Gln
    145 150 155 160
    Gly Gly Ile Gly Phe Val Met Thr Glu Arg Ala Ser Gln Arg Ala Gly
    165 170 175
    Tyr Arg Val Phe Arg Ala Glu Leu Leu Arg Gln Pro His Cys Arg Asn
    180 185 190
    Met Trp Leu Ser Gly Leu Pro Pro Ser Gly Val Arg Gln Leu Leu Ala
    195 200 205
    His Tyr Tyr Gly Pro Glu Ala Ala Glu Arg Arg Ala Pro Ala Tyr His
    210 215 220
    Ala Thr Thr Gly Gly Asn Pro Leu Leu Leu Arg Ala Leu Thr Gln Asp
    225 230 235 240
    Arg Gln Ala Ser His Thr Thr Leu Gly Ala Ala Gly Gly Asp Glu Pro
    245 250 255
    Val His Gly Asp Ala Phe Ala Gln Ala Val Leu Asp Cys Leu His Arg
    260 265 270
    Ser Ala Glu Gly Thr Leu Glu Thr Ala Arg Trp Leu Ala Val Leu Glu
    275 280 285
    Gln Ser Asp Pro Leu Leu Val Glu Arg Leu Thr Gly Thr Thr Ala Ala
    290 295 300
    Ala Val Glu Arg His Ile Gln Glu Leu Ala Ala Ile Gly Leu Leu Asp
    305 310 315 320
    Glu Asp Gly Thr Leu Gly Gln Pro Ala Ile Arg Glu Ala Ala Leu Gln
    325 330 335
    Asp Leu Pro Ala Gly Glu Arg Thr Glu Leu His Arg Arg Ala Ala Glu
    340 345 350
    Gln Leu His Arg Asp Gly Ala Asp Glu Asp Thr Val Ala Arg His Leu
    355 360 365
    Leu Val Gly Gly Ala Pro Asp Ala Pro Trp Ala Leu Pro Leu Leu Glu
    370 375 380
    Arg Gly Ala Gln Gln Ala Leu Phe Asp Asp Arg Leu Asp Asp Ala Phe
    385 390 395 400
    Arg Ile Leu Glu Phe Ala Val Arg Ser Ser Thr Asp Asn Thr Gln Leu
    405 410 415
    Ala Arg Leu Ala Pro His Leu Val Ala Ala Ser Trp Arg Met Asn Pro
    420 425 430
    His Met Thr Thr Arg Ala Leu Ala Leu Phe Asp Arg Leu Leu Ser Gly
    435 440 445
    Glu Leu Pro Pro Ser His Pro Val Met Ala Leu Ile Arg Cys Leu Val
    450 455 460
    Trp Tyr Gly Arg Leu Pro Glu Ala Ala Asp Ala Leu Ser Arg Leu Arg
    465 470 475 480
    Pro Ser Ser Asp Asn Asp Ala Leu Glu Leu Ser Leu Thr Arg Met Trp
    485 490 495
    Leu Ala Ala Leu Cys Pro Pro Leu Leu Glu Ser Leu Pro Ala Thr Pro
    500 505 510
    Glu Pro Glu Arg Gly Pro Val Pro Val Arg Leu Ala Pro Arg Thr Thr
    515 520 525
    Ala Leu Gln Ala Gln Ala Gly Val Phe Gln Arg Gly Pro Asp Asn Ala
    530 535 540
    Ser Val Ala Gln Ala Glu Gln Ile Leu Gln Gly Cys Arg Leu Ser Glu
    545 550 555 560
    Glu Thr Tyr Glu Ala Leu Glu Thr Ala Leu Leu Val Leu Val His Ala
    565 570 575
    Asp Arg Leu Asp Arg Ala Leu Phe Trp Ser Asp Ala Leu Leu Ala Glu
    580 585 590
    Ala Val Glu Arg Arg Ser Leu Gly Trp Glu Ala Val Phe Ala Ala Thr
    595 600 605
    Arg Ala Met Ile Ala Ile Arg Cys Gly Asp Leu Pro Thr Ala Arg Glu
    610 615 620
    Arg Ala Glu Leu Ala Leu Ser His Ala Ala Pro Glu Ser Trp Gly Leu
    625 630 635 640
    Ala Val Gly Met Pro Leu Ser Ala Leu Leu Leu Ala Cys Thr Glu Ala
    645 650 655
    Gly Glu Tyr Glu Gln Ala Glu Arg Val Leu Arg Gln Pro Val Pro Asp
    660 665 670
    Ala Met Phe Asp Ser Arg His Gly Met Glu Tyr Met His Ala Arg Gly
    675 680 685
    Arg Tyr Trp Leu Ala Thr Gly Arg Leu His Ala Ala Leu Gly Glu Phe
    690 695 700
    Met Leu Cys Gly Glu Ile Leu Gly Ser Trp Asn Leu Asp Gln Pro Ser
    705 710 715 720
    Ile Val Pro Trp Arg Thr Ser Ala Ala Glu Val Tyr Leu Arg Leu Gly
    725 730 735
    Asn Arg Gln Lys Ala Arg Ala Leu Ala Glu Ala Gln Leu Ala Leu Val
    740 745 750
    Arg Pro Gly Arg Ser Arg Thr Arg Gly Leu Thr Leu Arg Val Leu Ala
    755 760 765
    Ala Ala Val Asp Gly Gln Gln Ala Glu Arg Leu His Ala Glu Ala Val
    770 775 780
    Asp Met Leu His Asp Ser Gly Asp Arg Leu Glu His Ala Arg Ala Leu
    785 790 795 800
    Ala Gly Met Ser Arg His Gln Gln Ala Gln Gly Asp Asn Tyr Arg Ala
    805 810 815
    Arg Met Thr Ala Arg Leu Ala Gly Asp Met Ala Trp Ala Cys Gly Ala
    820 825 830
    Tyr Pro Leu Ala Glu Glu Ile Val Pro Gly Arg Gly Gly Arg Arg Ala
    835 840 845
    Lys Ala Val Ser Thr Glu Leu Glu Leu Pro Gly Gly Pro Asp Val Gly
    850 855 860
    Leu Leu Ser Glu Ala Glu Arg Arg Val Ala Ala Leu Ala Ala Arg Gly
    865 870 875 880
    Leu Thr Asn Arg Gln Ile Ala Arg Arg Leu Cys Val Thr Ala Ser Thr
    885 890 895
    Val Glu Gln His Leu Thr Arg Val Tyr Arg Lys Leu Asn Val Thr Arg
    900 905 910
    Arg Ala Asp Leu Pro Ile Ser Leu Ala Gln Asp Lys Ser Val Thr Ala
    915 920 925
    <210> SEQ ID NO 42
    <211> LENGTH: 846
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 42
    gtgaccgaca gacctctgaa cgtggacagc ggactgtgga tccggcgctt ccaccccgcg 60
    ccgaacagcg cggtgcggct ggtctgcctg ccgcacgccg gcggctccgc cagctacttc 120
    ttccgcttct cggaggagct gcacccctcc gtcgaggccc tgtcggtgca gtatccgggc 180
    cgccaggacc ggcgtgccga gccgtgtctg gagagcgtcg aggagctcgc cgagcatgtg 240
    gtcgcggcca ccgaaccctg gtggcaggag ggccggctgg ccttcttcgg gcacagcctc 300
    ggcgcctccg tcgccttcga gacggcccgc atcctggaac agcggcacgg ggtacggccc 360
    gagggcctgt acgtctccgg tcggcgcgcc ccgtcgctgg cgccggaccg gctcgtccac 420
    cagctggacg accgggcgtt cctggccgag atccggcggc tcagcggcac cgacgagcgg 480
    ttcctccagg acgacgagct gctgcggctg gtgctgcccg cgctgcgcag cgactacaag 540
    gcggcggaga cgtacctgca ccggccgtcc gccaagctca cctgcccggt gatggccctg 600
    gccggcgacc gtgacccgaa ggcgccgctg aacgaggtgg ccgagtggcg tcggcacacc 660
    agcgggccgt tctgcctccg ggcgtactcc ggcggccact tctacctcaa cgaccagtgg 720
    cacgagatct gcaacgacat ctccgaccac ctgctcgtca cccgcggcgc gcccgatgcc 780
    cgcgtcgtgc agcccccgac cagccttatc gaaggagcgg cgaagagatg gcagaaccca 840
    cggtga 846
    <210> SEQ ID NO 43
    <211> LENGTH: 281
    <212> TYPE: PRT
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 43
    Met Thr Asp Arg Pro Leu Asn Val Asp Ser Gly Leu Trp Ile Arg Arg
    1 5 10 15
    Phe His Pro Ala Pro Asn Ser Ala Val Arg Leu Val Cys Leu Pro His
    20 25 30
    Ala Gly Gly Ser Ala Ser Tyr Phe Phe Arg Phe Ser Glu Glu Leu His
    35 40 45
    Pro Ser Val Glu Ala Leu Ser Val Gln Tyr Pro Gly Arg Gln Asp Arg
    50 55 60
    Arg Ala Glu Pro Cys Leu Glu Ser Val Glu Glu Leu Ala Glu His Val
    65 70 75 80
    Val Ala Ala Thr Glu Pro Trp Trp Gln Glu Gly Arg Leu Ala Phe Phe
    85 90 95
    Gly His Ser Leu Gly Ala Ser Val Ala Phe Glu Thr Ala Arg Ile Leu
    100 105 110
    Glu Gln Arg His Gly Val Arg Pro Glu Gly Leu Tyr Val Ser Gly Arg
    115 120 125
    Arg Ala Pro Ser Leu Ala Pro Asp Arg Leu Val His Gln Leu Asp Asp
    130 135 140
    Arg Ala Phe Leu Ala Glu Ile Arg Arg Leu Ser Gly Thr Asp Glu Arg
    145 150 155 160
    Phe Leu Gln Asp Asp Glu Leu Leu Arg Leu Val Leu Pro Ala Leu Arg
    165 170 175
    Ser Asp Tyr Lys Ala Ala Glu Thr Tyr Leu His Arg Pro Ser Ala Lys
    180 185 190
    Leu Thr Cys Pro Val Met Ala Leu Ala Gly Asp Arg Asp Pro Lys Ala
    195 200 205
    Pro Leu Asn Glu Val Ala Glu Trp Arg Arg His Thr Ser Gly Pro Phe
    210 215 220
    Cys Leu Arg Ala Tyr Ser Gly Gly His Phe Tyr Leu Asn Asp Gln Trp
    225 230 235 240
    His Glu Ile Cys Asn Asp Ile Ser Asp His Leu Leu Val Thr Arg Gly
    245 250 255
    Ala Pro Asp Ala Arg Val Val Gln Pro Pro Thr Ser Leu Ile Glu Gly
    260 265 270
    Ala Ala Lys Arg Trp Gln Asn Pro Arg
    275 280
    <210> SEQ ID NO 44
    <211> LENGTH: 15872
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 44
    ttaattaagg aggaccatca tgaacgaggc catcgccgtc gtcggcatgt cctgccgcct 60
    gccgaaggcc tcgaacccgg ccgccttctg ggagctgctg cggaacgggg agagcgccgt 120
    caccgacgtg ccctccggcc ggtggacgtc ggtgctcggg ggagcggacg ccgaggagcc 180
    ggcggagtcc ggtgtccgcc ggggcggctt cctcgactcc ctcgacctct tcgacgcggc 240
    cttcttcgga atctcgcccc gtgaggccgc cgccatggac ccgcagcagc gactggtcct 300
    cgaactcgcc tgggaggcgc tggaggacgc cggaatcgtc cccggcaccc tcgccggaag 360
    ccgcaccgcc gtcttcgtcg gcaccctgcg ggacgactac acgagcctcc tctaccagca 420
    cggcgagcag gccatcaccc agcacaccat ggcgggcgtg aaccggggcg tcatcgccaa 480
    ccgcgtctcg taccacctcg gcctgcaggg cccgagcctc accgtcgacg ccgcgcagtc 540
    gtcctcgctc gtcgccgtgc acctggcctg cgagtccctg cgcgccgggg agtccacgac 600
    ggcgctcgtc gccggcgtga acctcaacat cctcgcggag agcgccgtga cggaggagcg 660
    cttcggtgga ctctccccgg acggcaccgc ctacaccttc gacgcgcggg ccaacggatt 720
    cgtccggggc gagggcggcg gagtcgtcgt actcaagccg ctctcccgcg ccctcgccga 780
    cggcgaccgt gtccacggcg tcatccgcgc cagcgccgtc aacaacgacg gagccacccc 840
    gggtctcacc gtgcccagca gggccgccca ggagaaggtg ctgcgcgagg cgtaccggaa 900
    ggcggccctg gacccgtccg ccgtccagta cgtcgaactc cacggcaccg gaacccccgt 960
    cggcgacccc atcgaggccg ccgcgctcgg cgccgtcctc ggctcggcgc gccccgcgga 1020
    cgaacccctg ctcgtcggct cggccaagac gaacgtcggg cacctcgaag gcgccgccgg 1080
    catcgtcggc ctcatcaaga cgctcctcgc gctcggccgg cgccggatcc cggcgagcct 1140
    caacttccgt acgccccacc cggacatccc gctcgacacc ctcgggctcg acgtgcccga 1200
    cggcctgcgg gagtggccgc acccggaccg cgaactcctc gccggcgtca gctcgttcgg 1260
    catgggcggc accaacgccc acgtcgtcct cagcgaaggc cccgcccagg gcggcgagca 1320
    gcccggcatc gatgaggaga cccccgtcga cagcggggcc gcactgccct tcgtcgtcac 1380
    cggccgcggc ggcgaggccc tgcgcgccca ggcccggcgc ctgcacgagg ccgtcgaagc 1440
    ggacccggag ctcgcgcccg ccgcactcgc ccggtcgctg gtcaccaccc gtacggtctt 1500
    cacgcaccgg tcggtcgtcc tcgccccgga ccgcgcccgc ctcctcgacg gcctcggcgc 1560
    cctcgccgcc gggacgcccg cgcccggcgt ggtcaccggc acccccgccc ccgggcgcct 1620
    cgccgtcctg ttcagcggcc agggtgccca acgtacgggc atgggcatgg agttgtacgc 1680
    cgcccacccc gccttcgcga cggccttcga cgccgtcgcc gccgaactgg accccctcct 1740
    cgaccggccc ctcgccgaac tcgtcgcggc gggcgacacc ctcgaccgca ccgtccacac 1800
    acagcccgcg ctcttcgccg tggaggtcgc cctccaccgc ctcgtcgagt cctggggcgt 1860
    cacgcccgac ctgctcgccg gccactccgt cggcgagatc agcgccgccc acgtcgccgg 1920
    ggtcctgtcg ctgcgcgacg ccgcccgcct cgtcgcggcg cgcggccgcc tcatgcaggc 1980
    gctccccgag ggcggcgcga tggtcgcggt cgaggcgagc gaggaggaag tgcttccgca 2040
    cctcgcggga cgcgagcggg agctctccct cgcggccgtg aacggccccc gcgcggtcgt 2100
    cctcgcgggc gccgagcgcg ccgtcctcga cgtcgccgag ctgctgcgcg aacagggccg 2160
    ccggacgaag cggctcagcg tctcgcacgc cttccactcg ccgctcatgg agccgatgct 2220
    cgacgacttc cgccgggtcg tcgaagagct ggacttccag gagccccgcg tcgacgtcgt 2280
    gtccacggtg acgggcctgc ctgtcacagc gggccaatgg accgatcccg agtactgggt 2340
    ggaccaggtc cgcaggcccg tacgcttcct cgacgccgta cgcaccctgg aggaatcggg 2400
    cgccgacacc ttcctggagc tcggtcccga cggggtctgc tccgcgatgg cggcggactc 2460
    cgtacgcgac caggaggccg ccacggcggt ctccgccctg cgcaagggcc gcccggagcc 2520
    ccagtcgctg ctcgccgcac tcaccaccgt cttcgtccgg ggccacgacg tcgactggac 2580
    cgccgcgcac gggagcaccg gcacggtcag ggtgcccctg ccgacctacg ccttccagcg 2640
    cgaacgccac tggttcgacg gcgccgcgcg aacggcggcg ccgctcacgg cgggccgatc 2700
    gggcaccggt gcgggcaccg gcccggccgc gggtgtgacg tcgggcgagg gcgagggcga 2760
    gggcgagggc gcgggtgcgg gtggcggtga tcggccggct cgccacgaga cgaccgagcg 2820
    cgtgcgcgca cacgtcgccg ccgtcctcga gtacgacgac ccgacccgcg tcgaactcgg 2880
    cctcaccttc aaggagctgg gcttcgactc cctcatgtcc gtcgagctgc ggaacgcgct 2940
    cgtcgacgac acgggactgc gcctgcccag cggactgctc ttcgaccacc cgacgccgcg 3000
    cgccctcgcc gcccacctgg gcgacctgct caccggcggc agcggcgaga ccggatcggc 3060
    cgacgggata ccgcccgcga ccccggcgga caccaccgcc gagcccatcg cgatcatcgg 3120
    catggcctgc cgctaccccg gcggcgtcac ctcccccgag gacctgtggc ggctcgtcgc 3180
    cgaggggcgc gacgccgtct cggggctgcc caccgaccgc ggctgggacg aggacctctt 3240
    cgacgccgac cccgaccgca gcggcaagag ctcggtccgc gagggcggat tcctgcacga 3300
    cgccgccctg ttcgacgccg gcttcttcgg gatatcgccc cgcgaggccc tcggcatgga 3360
    cccgcagcag cggctgctcc tggagacggc atgggaggcc gtggagcgcg cagggctcga 3420
    ccccgaaggc ctcaagggca gccggacggc cgtcttcgtc ggcgccaccg ccctggacta 3480
    cggcccgcgc atgcacgacg gcgccgaggg cgtcgagggc cacctcctga ccgggaccac 3540
    gcccagcgtg atgtcgggcc gcatcgccta ccagctcggc ctcaccggtc ctgcggtcac 3600
    cgtcgacacg gcctgctcgt cctcgctcgt cgcgctgcac ctggccgtcc gttcgctgcg 3660
    gcagggcgag tcgagcctcg cgctcgccgg cggagcgacc gtcatgtcga caccgggcat 3720
    gttcgtcgag ttctcgcggc agcgcggcct cgccgccgac ggccgctcca aggccttctc 3780
    cgactccgcc gacggcacct cctgggccga gggcgtcggc ctcctcgtcg tcgagcggct 3840
    ctcggacgcc gagcgcaacg gccaccccgt gctcgccgtg atccggggca gcgcggtcaa 3900
    ccaggacggc gcctccaacg ggctcaccgc ccccaacggc ccgtcccagc agcgcgtcat 3960
    ccgacaggcc ctggccgacg ccgggctcac cccggccgac gtcgacgccg tcgaggcgca 4020
    cggtacgggt acccggctcg gcgaccccat cgaggccgag gcgatcctcg gcacctacgg 4080
    ccgggaccgg ggcgagggcg ctccgctcca gctcggctcg ctgaagtcga acatcggcca 4140
    cgcgcaggcc gccgcgggcg tgggcgggct catcaagatg gtcctcgcga tgcgccacgg 4200
    cgtcctgccc aggacgctcc acgtggaccg gcccaccacc cgcgtcgact gggaggccgg 4260
    cggcgtcgag ctcctcaccg aggagcggga gtggccggag acgggccgcc cgcgccgcgc 4320
    ggcgatctcc tccttcggca tcagcggcac caacgcccac atcgtggtcg aacaggcccc 4380
    ggaagccggg gaggcggcgg tcaccaccac cgccccggaa gcaggggaag ccggggaagc 4440
    ggcggacacc accgccacca cgacgccggc cgcggtcggc gtccccgaac ccgtacgcgc 4500
    ccccgtcgtg gtctccgcgc gggacgccgc cgccctgcgc gcccaggccg ttcggctgcg 4560
    gaccttcctc gacggccgac cggacgtcac cgtcgccgac ctcggacgct cgctggccgc 4620
    ccgtaccgcc ttcgagcaca aggccgccct caccaccgcc accagggacg agctgctcgc 4680
    cgggctcgac gccctcggcc gcggggagca agccacgggc ctggtcaccg gcgaaccggc 4740
    cagggccgga cgcacggcct tcctgttcac cggccaggga gcgcagcgcg tcgccatggg 4800
    cgaggaactg cgcgccgcgc accccgtgtt cgccgccgcc ctcgacaccg tgtacgcggc 4860
    cctcgaccgt cacctcgacc ggccgctgcg ggagatcgtc gccgccgggg aggagctgga 4920
    cctcaccgcg tacacccagc ccgccctctt cgccttcgag gtggcgctgt tccgcctcct 4980
    cgaacaccac ggcctcgtcc ccgacctgct caccggccac tccgtcggcg agatcgccgc 5040
    cgcgcacgtc gccggtgtcc tctccctcga cgacgccgca cgtctcgtca ccgcccgcgg 5100
    ccggctcatg cagtcggccc gcgagggcgg cgcgatgatc gccgtgcagg cgggcgaggc 5160
    cgaggtcgtc gagtccctga agggctacga gggcagggtc gccgtcgccg ccgtcaacgg 5220
    acccaccgcc gtggtcgtct ccggcgacgc ggacgccgcc gaggagatcc gcgccgtatg 5280
    ggcgggacgc ggccggcgca cccgcaggct gcgcgtcagc cacgccttcc actccccgca 5340
    catggacgac gtcctcgacg agttcctccg ggtcgccgag ggcctgacct tcgaggagcc 5400
    gcggatcccc gtcgtctcca cggtcaccgg cgcgctcgtc acgtccggcg agctcacctc 5460
    gcccgcgtac tgggtcgacc agatccggcg gcccgtgcgc ttcctggacg ccgtccgcac 5520
    cctggccgcc caggacgcga ccgtcctcgt cgagatcggc cccgacgccg tcctcacggc 5580
    actcgccgag gaggctctcg cgcccggcac ggacgccccg gacgcccggg acgtcacggt 5640
    cgtcccgctg ctgcgcgcgg ggcgccccga gcccgagacc ctcgccgccg gtctcgcgac 5700
    cgcccatgtc cacggcgcac ccttggaccg ggcgtcgttc ttcccggacg ggcgccgcac 5760
    ggacctgccc acgtacgcct tccggcgcga gcactactgg ctgacgcccg aggcccgtac 5820
    ggacgcccgc gcactcggct tcgacccggc gcggcacccg ctgctgacga ccacggtcga 5880
    ggtcgccggc ggcgacggcg tcctgctgac cggccgtctc tccctgaccg accagccctg 5940
    gctggccgac cacatggtca acggcgccgt cctgttgccg gccaccgcct tcctggagct 6000
    cgccctcgcg gcgggcgacc acgtcggggc ggtccgggtg gaggaactca ccctcgaagc 6060
    gccgctcgtc ctgcccgagc ggggcgccgt ccgcatccag gtcggcgtga gcggcgacgg 6120
    cgagtcgccg gccgggcgca ccttcggtgt gtacagcacc cccgactccg gcgacaccgg 6180
    tgacgacgcg ccccgggagt ggacccgcca tgtctccggc gtactcggcg aaggggaccc 6240
    ggccacggag tcggaccacc ccggcaccga cggggacggt tcagcggcct ggccgcctgc 6300
    ggcggcgacc gccacacccc tcgacggcgt ctacgaccgg ctcgcggagc tcggctacgg 6360
    atacggtccg gccttccagg gcctgacggg gctgtggcgc gacggcgccg acacgctcgc 6420
    cgagatccgg ctgcccgcgg cgcagcacga gagcgcgggg ctcttcggcg tacacccggc 6480
    gctgctcgac gcggcgctcc acccgatcgt cctggagggc aactcagctg ccggtgcctg 6540
    tgacgccgat accgacgcga ccgaccggat ccggctgccg ttcgcgtggg cgggggtgac 6600
    cctccacgcc gaaggggcca ccgcgctccg cgtacggatc acacccaccg gcccggacac 6660
    ggtcacgctc cgcctcaccg acaccaccgg tgcgcccgtg gccaccgtgg agtccctgac 6720
    cctgcgcgcg gtggcgaagg accggctggg caccaccgcc gggcgcgtcg acgacgccct 6780
    gttcacggtc gtgtggacgg agaccggcac accggaaccc gcagggcgcg gagccgtgga 6840
    ggtcgaggaa ctcgtcgacc tcgccggcct cggcgacctc gtggagctcg gcgccgcgga 6900
    cgtcgtcctc cgggccgacc gctggacgct cgacggggac ccgtccgccg ccgcgcgcac 6960
    agccgtccgg cgcaccctcg ccatcgtcca ggagttcctg tccgagccgc gcttcgacgg 7020
    ctcgcgactg gtgtgcgtca ccaggggcgc ggtcgccgca ctccccggcg aggacgtcac 7080
    ctccctcgcc accggccccc tctggggcct cgtccgctcc gcccagtccg agaacccggg 7140
    acgcctgttc ctcctggacc tgggtgaagg cgaaggcgag cgcgacggag ccgaggagct 7200
    gatccgcgcg gccacggccg gggacgagcc gcagctcgcg gcacgggacg gccgactgct 7260
    cgcgccgagg ctggcccgta ccgccgccct ttcgagtgag gacaccgccg gcggcgccga 7320
    ccgtttcggc cccgacggca ccgtcctcgt caccgggggc accggaggcc tcggagcgct 7380
    cctcgcccgc cacctcgtgg agcgtcacgg ggtgcgccgg ctgctgctgg tgagccgccg 7440
    cggggccgac gcccccggcg cggccgacct gggcgaggac ctcgcgggcc tcggcgcgga 7500
    ggtggcgttc gccgccgccg acgccgccga ccgcgagagc ctggcgcggg cgatcgccac 7560
    cgtgcccgcc gagcatccgc tgacggccgt cgtgcacacg gcgggagtcg tcgacgacgc 7620
    gacggtggag gcgctcacac cggaacggct ggacgcggta ctgcgcccga aggtcgacgc 7680
    cgcgtggaac ctgcacgagc tcaccaagga cctgcggctc gacgccttcg tcctcttctc 7740
    ctccgtctcc ggcatcgtcg gcaccgccgg ccaggccaac tacgcggcgg ccaacacggg 7800
    cctcgacgcc ctcgccgccc accgcgccgc cacgggcctg gccgccacgt cgctggcctg 7860
    gggcctctgg gacggcacgc acggcatggg cggcacgctc ggcgccgccg acctcgcccg 7920
    ctggagccgg gccggaatca ccccgctcac cccgctgcag ggcctcgcgc tcttcgacgc 7980
    cgcggtcgcc agggacgacg ccctcctcgt acccgccggg ctccgtccca ccgcccaccg 8040
    gggcacggac ggacagcctc ctgcgctgtg gcgcggcctc gtccgggcgc gcccgcgccg 8100
    tgccgcgcgg acggccgccg aggcggcgga cacgaccggc ggctggctga gcgggctcgc 8160
    cgcacagtcc cccgaggagc ggcgcagcac agccgtcacg ctcgtgacgg gtgtcgtcgc 8220
    ggacgtcctc gggcacgccg actccgccgc ggtcggggcg gagcggtcct tcaaggacct 8280
    cggcttcgac tccctggccg gggtggagct ccgcaaccgg ctgaacgccg ccaccggcct 8340
    gcggctcccc gcgaccacgg tcttcgacca tccctcgccg gccgcgctcg cgtcccatct 8400
    cctcgcccag gtgcccgggt tgaaggaggg gacggcggcg accgcgaccg tcgtggccga 8460
    gcggggcgct tccttcggtg accgtgcgac cgacgacgat ccgatcgcga tcgtgggcat 8520
    ggcatgccgc tatccgggtg gtgtgtcgtc gccggaggac ctgtggcggc tggtggccga 8580
    ggggacggac gcgatcagcg agttccccgt caaccgcggc tgggacctgg agagcctcta 8640
    cgacccggat cccgagtcga agggcaccac gtactgccgg gagggcgggt tcctggaagg 8700
    cgccggtgac ttcgacgccg ccttcttcgg catctcgccg cgcgaggccc tggtgatgga 8760
    cccgcagcag cggctgctgc tggaggtgtc ctgggaggcg ctggaacgcg cgggcatcga 8820
    cccgtcctcg ctgcgcggca gccgcggtgg tgtctacgtg ggcgccgcgc acggctcgta 8880
    cgcctccgat ccccggctgg tgcccgaggg ctcggagggc tatctgctga ccggcagcgc 8940
    cgacgcggtg atgtccggcc gcatctccta cgcgctcggt ctcgaaggac cgtccatgac 9000
    ggtggagacg gcctgctcct cctcgctggt ggcgctgcat ctggcggtac gggcgctgcg 9060
    gcacggcgag tgcgggctcg cgctggcggg cggggtggcg gtgatggccg atccggcggc 9120
    gttcgtggag ttctcccggc agaaggggct ggccgccgac ggccgctgca aggcgttctc 9180
    ggccgccgcc gacggcaccg gctgggccga gggcgtcggc gtgctcgtcc tggagcggct 9240
    gtcggacgcg cgccgcgcgg ggcacacggt cctcggcctg gtcaccggca ccgcggtcaa 9300
    ccaggacggt gcctccaacg ggctgaccgc gcccaacggc ccagcccagc aacgcgtcat 9360
    cgccgaggcg ctcgccgacg ccgggctgtc cccggaggac gtggacgcgg tcgaggcgca 9420
    cggcaccggc acccggctcg gcgaccccat cgaggccggg gcgctgctcg ccgcctccgg 9480
    acggaaccgt tccggcgacc acccgctgtg gctcggctcg ctgaagtcca acatcgggca 9540
    tgcccaggcc gccgccggtg tcggcggcgt catcaagatg ctccaggcgc tgcggcacgg 9600
    cttgctgccc cgcaccctcc acgccgacga gccgaccccg catgccgact ggagctccgg 9660
    ccgggtacgg ctgctcacct ccgaggtgcc gtggcagcgg accggccggc cccggcggac 9720
    cggggtgtcc gccttcggcg tcggcggcac caatgcccat gtcgtcctcg aagaggcacc 9780
    cgccccgccc gcgccggaac cggccgggga ggcccccggc ggctcccgcg ccgcagaagg 9840
    ggcggaaggg cccctggcct gggtggtctc cggacgcgac gagccggccc tgcggtccca 9900
    ggcccggcgg ctccgcgacc acctctcccg cacccccggg gcccgcccgc gtgacatcgc 9960
    cttctccctc gccgccacgc gcgcagcctt tgaccaccgc gccgtgctga tcggctcgga 10020
    cggggccgaa ctcgccgccg ccctggacgc gttggccgaa ggacgcgacg gtccggcggt 10080
    ggtgcgcgga gtccgcgacc gggacggcag gatggccttc ctcttcaccg ggcagggcag 10140
    ccagcgcgcc gggatggccc acgacctgca tgccgcccat accttcttcg cgtccgccct 10200
    cgacgaggtg acggaccgtc tcgacccgct gctcggccgg ccgctcggcg cgctgctgga 10260
    cgcccgaccc ggctcgcccg aagcggcact cctggaccgg accgagtaca cccagccggc 10320
    gctcttcgcc gtcgaggtgg cgctccaccg gctgctggag cactggggga tgcgccccga 10380
    cctgctgctg gggcactcgg tgggcgaact ggcggccgcc cacgtcgcgg gtgtgctcga 10440
    tctcgacgac gcctgcgcgc tggtggccgc ccgcggcagg ctgatgcagc gcctgccgcc 10500
    cggcggcgcg atggtctccg tgcgggccgg cgaggacgag gtccgcgcac tgctggccgg 10560
    ccgcgaggac gccgtctgcg tcgccgcggt gaacggcccc cggtcggtgg tgatctccgg 10620
    cgcggaggaa gcggtggccg aggcggcggc gcagctcgcc ggacgaggcc gccgcaccag 10680
    gcggctccgc gtcgcgcacg ccttccactc acccctgatg gacggcatgc tcgccggatt 10740
    ccgggaggtc gccgccggcc tgcgctaccg ggaaccggag ctgacggtcg tctccacggt 10800
    cacggggcgg cccgcccgcc ccggtgaact caccggcccc gactactggg tggcccaggt 10860
    ccgtgagccc gtgcgcttcg cggacgcggt ccgcacggca caccgcctcg gagcccgcac 10920
    cttcctggag accggcccgg acggcgtgct gtgcggcatg gcagaggagt gcctggagga 10980
    cgacaccgtg gccctgctgc cggcgatcca caagcccggc accgcgccgc acggtccggc 11040
    ggctcccggc gcgctgcggg cggccgccgc cgcgtacggc cggggcgccc gggtggactg 11100
    ggccgggatg cacgccgacg gccccgaggg gccggcccgc cgcgtcgaac tgcccgtcca 11160
    cgccttccgg caccgccgct actggctcgc cccgggccgc gcggcggaca ccgacgactg 11220
    gatgtaccgg atcggctggg accggctgcc ggctgtgacc ggcggggccc ggaccgccgg 11280
    ccgctggctg gtgatccacc ccgacagccc gcgctgccgg gagctgtccg gccacgccga 11340
    acgcgcgctg cgcgccgcgg gcgcgagccc cgtaccgctg cccgtggacg ctccggccgc 11400
    cgaccgggcg tccttcgcgg cactgctgcg ctccgccacc ggacctgaca cacgaggtga 11460
    cacagccgcg cccgtggccg gtgtgctgtc gctgctgtcc gaggaggatc ggccccatcg 11520
    ccagcacgcc ccggtacccg ccggggtcct ggcgacgctg tccctgatgc aggctatgga 11580
    ggaggaggcg gtggaggctc gcgtgtggtg cgtctcccgc gccgcggtcg ccgccgccga 11640
    ccgggaacgg cccgtcggcg cgggcgccgc cctgtggggg ctggggcggg tggccgccct 11700
    ggaacgcccc acccggtggg gcggtctcgt ggacctgccc gcctcgcccg gtgcggcgca 11760
    ctgggcggcc gccgtggaac ggctcgccgg tcccgaggac cagatcgccg tgcgcgcgtc 11820
    cggcagttgg ggccggcgcc tcaccaggct gccgcgcgac ggcggcggcc ggacggccgc 11880
    acccgcgtac cggccgcgcg gcacggtgct cgtcaccggt ggcaccggcg cgctcggcgg 11940
    gcatctcgcc cgctggctcg ccgcggcggg cgccgaacac ctggcgctca ccagccgccg 12000
    gggcccggac gcgcccggcg ccgccggact cgaggccgaa ctcctcctcc tgggcgccaa 12060
    ggtgacgttc gccgcctgcg acaccgccga ccgcgacggc ctcgcccggg tcctgcgggc 12120
    gataccggag gacaccccgc tcaccgcggt gttccacgcc gcgggcgtac cgcaggtcac 12180
    gccgctgtcc cgtacctcgc ccgagcactt cgccgacgtg tacgcgggca aggcggcggg 12240
    cgccgcgcac ctggacgaac tgacccgcga actcggcgcc ggactcgacg cgttcgtcct 12300
    ctactcctcc ggcgccggcg tctggggcag cgccggccag ggtgcctacg ccgccgccaa 12360
    cgccgccctg gacgcgctcg cccggcgccg tgcggcggac ggactccccg ccacctccat 12420
    cgcctggggc gtgtggggcg gcggcggtat gggggccgac gaggcgggcg cggagtatct 12480
    gggccggcgc ggtatgcgcc ccatggcacc ggtctccgcg ctccgggcga tggccaccgc 12540
    catcgcctcc ggggaaccct gccccaccgt cacccacacc gactgggagc gcttcggcga 12600
    gggcttcacc gccttccggc ccagccctct gatcgcgggg ctcggcacgc cgggcggcgg 12660
    ccgggcggcg gagacccccg aggaggggaa cgccaccgct gcggcggacc tcaccgccct 12720
    gccgcccgcc gaactccgca ccgcgctgcg cgagctggtg cgagcccgga ccgccgcggc 12780
    gctcggcctc gacgacccgg ccgaggtcgc cgagggcgaa cggttccccg ccatgggctt 12840
    cgactccctg gccaccgtac ggctgcgccg cggactcgcc tcggccacgg gcctcgacct 12900
    gccccccgat ctgctcttcg accgggacac cccggccgcg ctcgccgccc acctggccga 12960
    actgctcgcc accgcacggg accacggacc cggcggcccc gggaccggtg ccgcgccggc 13020
    cgatgccgga agcggcctgc cggccctcta ccgggaggcc gtccgcaccg gccgggccgc 13080
    ggaaatggcc gaactgctcg ccgccgcttc ccggttccgc cccgccttcg ggacggcgga 13140
    ccggcagccg gtggccctcg tgccgctggc cgacggcgcg gaggacaccg ggctcccgct 13200
    gctcgtgggc tgcgccggga cggcggtggc ctccggcccg gtggagttca ccgccttcgc 13260
    cggagcgctg gcggacctcc cggcggcggc cccgatggcc gcgctgccgc agcccggctt 13320
    tctgccggga gaacgagtcc cggccacccc ggaggcattg ttcgaggccc aggcggaagc 13380
    gctgctgcgc tacgcggccg gccggccctt cgtgctgctg gggcactccg ccggcgccaa 13440
    catggcccac gccctgaccc gtcatctgga ggcgaacggt ggcggccccg cagggctggt 13500
    gctcatggac atctacaccc ccgccgaccc cggcgcgatg ggcgtctggc ggaacgacat 13560
    gttccagtgg gtctggcggc gctcggacat ccccccggac gaccaccgcc tcacggccat 13620
    gggcgcctac caccggctgc ttctcgactg gtcgcccacc cccgtccgcg cccccgtact 13680
    gcatctgcgc gccgcggaac ccatgggcga ctggccaccc ggggacaccg gctggcagtc 13740
    ccactgggac ggcgcgcaca ccaccgccgg catccccgga aaccacttca cgatgatgac 13800
    cgaacacgcc tccgccgccg cccggctcgt gcacggctgg ctcgcggaac ggaccccgtc 13860
    cgggcagggc gggtcaccgt cccgcgcggc ggggagagag gagaggccgt gaacacggca 13920
    gccggcccga ccggcaccgc cgccggcggc accaccgccc cggcggcggc acacgacctg 13980
    tcccgcgccg gacgcaggct ccaactcacc cgggccgcac agtggttcgc cggcaaccag 14040
    ggagacccct acgggatgat cctgcgcgcc ggcaccgccg acccggcacc gtacgaggaa 14100
    gagatccccg ggtaccgagc tcgaattctt aattaaggag gtcgtagatg agtaacaaga 14160
    acaacgatga gctgcagcgg caggcctcgg aaaacaccct ggggctgaac ccggtcatcg 14220
    gtatccgccg caaagacctg ttgagctcgg cacgcaccgt gctgcgccag gccgtgcgcc 14280
    aaccgctgca cagcgccaag catgtggccc actttggcct ggagctgaag aacgtgctgc 14340
    tgggcaagtc cagccttgcc ccggaaagcg acgaccgtcg cttcaatgac ccggcatgga 14400
    gcaacaaccc actttaccgc cgctacctgc aaacctatct ggcctggcgc aaggagctgc 14460
    aggactggat cggcaacagc gacctgtcgc cccaggacat cagccgcggc cagttcgtca 14520
    tcaacctgat gaccgaagcc atggctccga ccaacaccct gtccaacccg gcagcagtca 14580
    aacgcttctt cgaaaccggc ggcaagagcc tgctcgatgg cctgtccaac ctggccaagg 14640
    acctggtcaa caacggtggc atgcccagcc aggtgaacat ggacgccttc gaggtgggca 14700
    agaacctggg caccagtgaa ggcgccgtgg tgtaccgcaa cgatgtgctg gagctgatcc 14760
    agtacaagcc catcaccgag caggtgcatg cccgcccgct gctggtggtg ccgccgcaga 14820
    tcaacaagtt ctacgtattc gacctgagcc cggaaaagag cctggcacgc tactgcctgc 14880
    gctcgcagca gcagaccttc atcatcagct ggcgcaaccc gaccaaagcc cagcgcgaat 14940
    ggggcctgtc cacctacatc gacgcgctca aggaggcggt cgacgcggtg ctggcgatta 15000
    ccggcagcaa ggacctgaac atgctcggtg cctgctccgg cggcatcacc tgcacggcat 15060
    tggtcggcca ctatgccgcc ctcggcgaaa acaaggtcaa tgccctgacc ctgctggtca 15120
    gcgtgctgga caccaccatg gacaaccagg tcgccctgtt cgtcgacgag cagactttgg 15180
    aggccgccaa gcgccactcc taccaggccg gtgtgctcga aggcagcgag atggccaagg 15240
    tgttcgcctg gatgcgcccc aacgacctga tctggaacta ctgggtcaac aactacctgc 15300
    tcggcaacga gccgccggtg ttcgacatcc tgttctggaa caacgacacc acgcgcctgc 15360
    cggccgcctt ccacggcgac ctgatcgaaa tgttcaagag caacccgctg acccgcccgg 15420
    acgccctgga ggtttgcggc actccgatcg acctgaaaca ggtcaaatgc gacatctaca 15480
    gccttgccgg caccaacgac cacatcaccc cgtggcagtc atgctaccgc tcggcgcacc 15540
    tgttcggcgg caagatcgag ttcgtgctgt ccaacagcgg ccacatccag agcatcctca 15600
    acccgccagg caaccccaag gcgcgcttca tgaccggtgc cgatcgcccg ggtgacccgg 15660
    tggcctggca ggaaaacgcc accaagcatg ccgactcctg gtggctgcac tggcaaagct 15720
    ggctgggcga gcgtgccggc gagctggaaa aggcgccgac ccgcctgggc aaccgtgcct 15780
    atgccgctgg cgaggcatcc ccgggcacct acgttcacga gcgttgagct gcagcgccgt 15840
    ggccacctgc gggacgccac ggtgttgaat tc 15872
    <210> SEQ ID NO 45
    <211> LENGTH: 5215
    <212> TYPE: PRT
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 45
    Met Asn Glu Ala Ile Ala Val Val Gly Met Ser Cys Arg Leu Pro Lys
    1 5 10 15
    Ala Ser Asn Pro Ala Ala Phe Trp Glu Leu Leu Arg Asn Gly Glu Ser
    20 25 30
    Ala Val Thr Asp Val Pro Ser Gly Arg Trp Thr Ser Val Leu Gly Gly
    35 40 45
    Ala Asp Ala Glu Glu Pro Ala Glu Ser Gly Val Arg Arg Gly Gly Phe
    50 55 60
    Leu Asp Ser Leu Asp Leu Phe Asp Ala Ala Phe Phe Gly Ile Ser Pro
    65 70 75 80
    Arg Glu Ala Ala Ala Met Asp Pro Gln Gln Arg Leu Val Leu Glu Leu
    85 90 95
    Ala Trp Glu Ala Leu Glu Asp Ala Gly Ile Val Pro Gly Thr Leu Ala
    100 105 110
    Gly Ser Arg Thr Ala Val Phe Val Gly Thr Leu Arg Asp Asp Tyr Thr
    115 120 125
    Ser Leu Leu Tyr Gln His Gly Glu Gln Ala Ile Thr Gln His Thr Met
    130 135 140
    Ala Gly Val Asn Arg Gly Val Ile Ala Asn Arg Val Ser Tyr His Leu
    145 150 155 160
    Gly Leu Gln Gly Pro Ser Leu Thr Val Asp Ala Ala Gln Ser Ser Ser
    165 170 175
    Leu Val Ala Val His Leu Ala Cys Glu Ser Leu Arg Ala Gly Glu Ser
    180 185 190
    Thr Thr Ala Leu Val Ala Gly Val Asn Leu Asn Ile Leu Ala Glu Ser
    195 200 205
    Ala Val Thr Glu Glu Arg Phe Gly Gly Leu Ser Pro Asp Gly Thr Ala
    210 215 220
    Tyr Thr Phe Asp Ala Arg Ala Asn Gly Phe Val Arg Gly Glu Gly Gly
    225 230 235 240
    Gly Val Val Val Leu Lys Pro Leu Ser Arg Ala Leu Ala Asp Gly Asp
    245 250 255
    Arg Val His Gly Val Ile Arg Ala Ser Ala Val Asn Asn Asp Gly Ala
    260 265 270
    Thr Pro Gly Leu Thr Val Pro Ser Arg Ala Ala Gln Glu Lys Val Leu
    275 280 285
    Arg Glu Ala Tyr Arg Lys Ala Ala Leu Asp Pro Ser Ala Val Gln Tyr
    290 295 300
    Val Glu Leu His Gly Thr Gly Thr Pro Val Gly Asp Pro Ile Glu Ala
    305 310 315 320
    Ala Ala Leu Gly Ala Val Leu Gly Ser Ala Arg Pro Ala Asp Glu Pro
    325 330 335
    Leu Leu Val Gly Ser Ala Lys Thr Asn Val Gly His Leu Glu Gly Ala
    340 345 350
    Ala Gly Ile Val Gly Leu Ile Lys Thr Leu Leu Ala Leu Gly Arg Arg
    355 360 365
    Arg Ile Pro Ala Ser Leu Asn Phe Arg Thr Pro His Pro Asp Ile Pro
    370 375 380
    Leu Asp Thr Leu Gly Leu Asp Val Pro Asp Gly Leu Arg Glu Trp Pro
    385 390 395 400
    His Pro Asp Arg Glu Leu Leu Ala Gly Val Ser Ser Phe Gly Met Gly
    405 410 415
    Gly Thr Asn Ala His Val Val Leu Ser Glu Gly Pro Ala Gln Gly Gly
    420 425 430
    Glu Gln Pro Gly Ile Asp Glu Glu Thr Pro Val Asp Ser Gly Ala Ala
    435 440 445
    Leu Pro Phe Val Val Thr Gly Arg Gly Gly Glu Ala Leu Arg Ala Gln
    450 455 460
    Ala Arg Arg Leu His Glu Ala Val Glu Ala Asp Pro Glu Leu Ala Pro
    465 470 475 480
    Ala Ala Leu Ala Arg Ser Leu Val Thr Thr Arg Thr Val Phe Thr His
    485 490 495
    Arg Ser Val Val Leu Ala Pro Asp Arg Ala Arg Leu Leu Asp Gly Leu
    500 505 510
    Gly Ala Leu Ala Ala Gly Thr Pro Ala Pro Gly Val Val Thr Gly Thr
    515 520 525
    Pro Ala Pro Gly Arg Leu Ala Val Leu Phe Ser Gly Gln Gly Ala Gln
    530 535 540
    Arg Thr Gly Met Gly Met Glu Leu Tyr Ala Ala His Pro Ala Phe Ala
    545 550 555 560
    Thr Ala Phe Asp Ala Val Ala Ala Glu Leu Asp Pro Leu Leu Asp Arg
    565 570 575
    Pro Leu Ala Glu Leu Val Ala Ala Gly Asp Thr Leu Asp Arg Thr Val
    580 585 590
    His Thr Gln Pro Ala Leu Phe Ala Val Glu Val Ala Leu His Arg Leu
    595 600 605
    Val Glu Ser Trp Gly Val Thr Pro Asp Leu Leu Ala Gly His Ser Val
    610 615 620
    Gly Glu Ile Ser Ala Ala His Val Ala Gly Val Leu Ser Leu Arg Asp
    625 630 635 640
    Ala Ala Arg Leu Val Ala Ala Arg Gly Arg Leu Met Gln Ala Leu Pro
    645 650 655
    Glu Gly Gly Ala Met Val Ala Val Glu Ala Ser Glu Glu Glu Val Leu
    660 665 670
    Pro His Leu Ala Gly Arg Glu Arg Glu Leu Ser Leu Ala Ala Val Asn
    675 680 685
    Gly Pro Arg Ala Val Val Leu Ala Gly Ala Glu Arg Ala Val Leu Asp
    690 695 700
    Val Ala Glu Leu Leu Arg Glu Gln Gly Arg Arg Thr Lys Arg Leu Ser
    705 710 715 720
    Val Ser His Ala Phe His Ser Pro Leu Met Glu Pro Met Leu Asp Asp
    725 730 735
    Phe Arg Arg Val Val Glu Glu Leu Asp Phe Gln Glu Pro Arg Val Asp
    740 745 750
    Val Val Ser Thr Val Thr Gly Leu Pro Val Thr Ala Gly Gln Trp Thr
    755 760 765
    Asp Pro Glu Tyr Trp Val Asp Gln Val Arg Arg Pro Val Arg Phe Leu
    770 775 780
    Asp Ala Val Arg Thr Leu Glu Glu Ser Gly Ala Asp Thr Phe Leu Glu
    785 790 795 800
    Leu Gly Pro Asp Gly Val Cys Ser Ala Met Ala Ala Asp Ser Val Arg
    805 810 815
    Asp Gln Glu Ala Ala Thr Ala Val Ser Ala Leu Arg Lys Gly Arg Pro
    820 825 830
    Glu Pro Gln Ser Leu Leu Ala Ala Leu Thr Thr Val Phe Val Arg Gly
    835 840 845
    His Asp Val Asp Trp Thr Ala Ala His Gly Ser Thr Gly Thr Val Arg
    850 855 860
    Val Pro Leu Pro Thr Tyr Ala Phe Gln Arg Glu Arg His Trp Phe Asp
    865 870 875 880
    Gly Ala Ala Arg Thr Ala Ala Pro Leu Thr Ala Gly Arg Ser Gly Thr
    885 890 895
    Gly Ala Gly Thr Gly Pro Ala Ala Gly Val Thr Ser Gly Glu Gly Glu
    900 905 910
    Gly Glu Gly Glu Gly Ala Gly Ala Gly Gly Gly Asp Arg Pro Ala Arg
    915 920 925
    His Glu Thr Thr Glu Arg Val Arg Ala His Val Ala Ala Val Leu Glu
    930 935 940
    Tyr Asp Asp Pro Thr Arg Val Glu Leu Gly Leu Thr Phe Lys Glu Leu
    945 950 955 960
    Gly Phe Asp Ser Leu Met Ser Val Glu Leu Arg Asn Ala Leu Val Asp
    965 970 975
    Asp Thr Gly Leu Arg Leu Pro Ser Gly Leu Leu Phe Asp His Pro Thr
    980 985 990
    Pro Arg Ala Leu Ala Ala His Leu Gly Asp Leu Leu Thr Gly Gly Ser
    995 1000 1005
    Gly Glu Thr Gly Ser Ala Asp Gly Ile Pro Pro Ala Thr Pro Ala Asp
    1010 1015 1020
    Thr Thr Ala Glu Pro Ile Ala Ile Ile Gly Met Ala Cys Arg Tyr Pro
    1025 1030 1035 1040
    Gly Gly Val Thr Ser Pro Glu Asp Leu Trp Arg Leu Val Ala Glu Gly
    1045 1050 1055
    Arg Asp Ala Val Ser Gly Leu Pro Thr Asp Arg Gly Trp Asp Glu Asp
    1060 1065 1070
    Leu Phe Asp Ala Asp Pro Asp Arg Ser Gly Lys Ser Ser Val Arg Glu
    1075 1080 1085
    Gly Gly Phe Leu His Asp Ala Ala Leu Phe Asp Ala Gly Phe Phe Gly
    1090 1095 1100
    Ile Ser Pro Arg Glu Ala Leu Gly Met Asp Pro Gln Gln Arg Leu Leu
    1105 1110 1115 1120
    Leu Glu Thr Ala Trp Glu Ala Val Glu Arg Ala Gly Leu Asp Pro Glu
    1125 1130 1135
    Gly Leu Lys Gly Ser Arg Thr Ala Val Phe Val Gly Ala Thr Ala Leu
    1140 1145 1150
    Asp Tyr Gly Pro Arg Met His Asp Gly Ala Glu Gly Val Glu Gly His
    1155 1160 1165
    Leu Leu Thr Gly Thr Thr Pro Ser Val Met Ser Gly Arg Ile Ala Tyr
    1170 1175 1180
    Gln Leu Gly Leu Thr Gly Pro Ala Val Thr Val Asp Thr Ala Cys Ser
    1185 1190 1195 1200
    Ser Ser Leu Val Ala Leu His Leu Ala Val Arg Ser Leu Arg Gln Gly
    1205 1210 1215
    Glu Ser Ser Leu Ala Leu Ala Gly Gly Ala Thr Val Met Ser Thr Pro
    1220 1225 1230
    Gly Met Phe Val Glu Phe Ser Arg Gln Arg Gly Leu Ala Ala Asp Gly
    1235 1240 1245
    Arg Ser Lys Ala Phe Ser Asp Ser Ala Asp Gly Thr Ser Trp Ala Glu
    1250 1255 1260
    Gly Val Gly Leu Leu Val Val Glu Arg Leu Ser Asp Ala Glu Arg Asn
    1265 1270 1275 1280
    Gly His Pro Val Leu Ala Val Ile Arg Gly Ser Ala Val Asn Gln Asp
    1285 1290 1295
    Gly Ala Ser Asn Gly Leu Thr Ala Pro Asn Gly Pro Ser Gln Gln Arg
    1300 1305 1310
    Val Ile Arg Gln Ala Leu Ala Asp Ala Gly Leu Thr Pro Ala Asp Val
    1315 1320 1325
    Asp Ala Val Glu Ala His Gly Thr Gly Thr Arg Leu Gly Asp Pro Ile
    1330 1335 1340
    Glu Ala Glu Ala Ile Leu Gly Thr Tyr Gly Arg Asp Arg Gly Glu Gly
    1345 1350 1355 1360
    Ala Pro Leu Gln Leu Gly Ser Leu Lys Ser Asn Ile Gly His Ala Gln
    1365 1370 1375
    Ala Ala Ala Gly Val Gly Gly Leu Ile Lys Met Val Leu Ala Met Arg
    1380 1385 1390
    His Gly Val Leu Pro Arg Thr Leu His Val Asp Arg Pro Thr Thr Arg
    1395 1400 1405
    Val Asp Trp Glu Ala Gly Gly Val Glu Leu Leu Thr Glu Glu Arg Glu
    1410 1415 1420
    Trp Pro Glu Thr Gly Arg Pro Arg Arg Ala Ala Ile Ser Ser Phe Gly
    1425 1430 1435 1440
    Ile Ser Gly Thr Asn Ala His Ile Val Val Glu Gln Ala Pro Glu Ala
    1445 1450 1455
    Gly Glu Ala Ala Val Thr Thr Thr Ala Pro Glu Ala Gly Glu Ala Gly
    1460 1465 1470
    Glu Ala Ala Asp Thr Thr Ala Thr Thr Thr Pro Ala Ala Val Gly Val
    1475 1480 1485
    Pro Glu Pro Val Arg Ala Pro Val Val Val Ser Ala Arg Asp Ala Ala
    1490 1495 1500
    Ala Leu Arg Ala Gln Ala Val Arg Leu Arg Thr Phe Leu Asp Gly Arg
    1505 1510 1515 1520
    Pro Asp Val Thr Val Ala Asp Leu Gly Arg Ser Leu Ala Ala Arg Thr
    1525 1530 1535
    Ala Phe Glu His Lys Ala Ala Leu Thr Thr Ala Thr Arg Asp Glu Leu
    1540 1545 1550
    Leu Ala Gly Leu Asp Ala Leu Gly Arg Gly Glu Gln Ala Thr Gly Leu
    1555 1560 1565
    Val Thr Gly Glu Pro Ala Arg Ala Gly Arg Thr Ala Phe Leu Phe Thr
    1570 1575 1580
    Gly Gln Gly Ala Gln Arg Val Ala Met Gly Glu Glu Leu Arg Ala Ala
    1585 1590 1595 1600
    His Pro Val Phe Ala Ala Ala Leu Asp Thr Val Tyr Ala Ala Leu Asp
    1605 1610 1615
    Arg His Leu Asp Arg Pro Leu Arg Glu Ile Val Ala Ala Gly Glu Glu
    1620 1625 1630
    Leu Asp Leu Thr Ala Tyr Thr Gln Pro Ala Leu Phe Ala Phe Glu Val
    1635 1640 1645
    Ala Leu Phe Arg Leu Leu Glu His His Gly Leu Val Pro Asp Leu Leu
    1650 1655 1660
    Thr Gly His Ser Val Gly Glu Ile Ala Ala Ala His Val Ala Gly Val
    1665 1670 1675 1680
    Leu Ser Leu Asp Asp Ala Ala Arg Leu Val Thr Ala Arg Gly Arg Leu
    1685 1690 1695
    Met Gln Ser Ala Arg Glu Gly Gly Ala Met Ile Ala Val Gln Ala Gly
    1700 1705 1710
    Glu Ala Glu Val Val Glu Ser Leu Lys Gly Tyr Glu Gly Arg Val Ala
    1715 1720 1725
    Val Ala Ala Val Asn Gly Pro Thr Ala Val Val Val Ser Gly Asp Ala
    1730 1735 1740
    Asp Ala Ala Glu Glu Ile Arg Ala Val Trp Ala Gly Arg Gly Arg Arg
    1745 1750 1755 1760
    Thr Arg Arg Leu Arg Val Ser His Ala Phe His Ser Pro His Met Asp
    1765 1770 1775
    Asp Val Leu Asp Glu Phe Leu Arg Val Ala Glu Gly Leu Thr Phe Glu
    1780 1785 1790
    Glu Pro Arg Ile Pro Val Val Ser Thr Val Thr Gly Ala Leu Val Thr
    1795 1800 1805
    Ser Gly Glu Leu Thr Ser Pro Ala Tyr Trp Val Asp Gln Ile Arg Arg
    1810 1815 1820
    Pro Val Arg Phe Leu Asp Ala Val Arg Thr Leu Ala Ala Gln Asp Ala
    1825 1830 1835 1840
    Thr Val Leu Val Glu Ile Gly Pro Asp Ala Val Leu Thr Ala Leu Ala
    1845 1850 1855
    Glu Glu Ala Leu Ala Pro Gly Thr Asp Ala Pro Asp Ala Arg Asp Val
    1860 1865 1870
    Thr Val Val Pro Leu Leu Arg Ala Gly Arg Pro Glu Pro Glu Thr Leu
    1875 1880 1885
    Ala Ala Gly Leu Ala Thr Ala His Val His Gly Ala Pro Leu Asp Arg
    1890 1895 1900
    Ala Ser Phe Phe Pro Asp Gly Arg Arg Thr Asp Leu Pro Thr Tyr Ala
    1905 1910 1915 1920
    Phe Arg Arg Glu His Tyr Trp Leu Thr Pro Glu Ala Arg Thr Asp Ala
    1925 1930 1935
    Arg Ala Leu Gly Phe Asp Pro Ala Arg His Pro Leu Leu Thr Thr Thr
    1940 1945 1950
    Val Glu Val Ala Gly Gly Asp Gly Val Leu Leu Thr Gly Arg Leu Ser
    1955 1960 1965
    Leu Thr Asp Gln Pro Trp Leu Ala Asp His Met Val Asn Gly Ala Val
    1970 1975 1980
    Leu Leu Pro Ala Thr Ala Phe Leu Glu Leu Ala Leu Ala Ala Gly Asp
    1985 1990 1995 2000
    His Val Gly Ala Val Arg Val Glu Glu Leu Thr Leu Glu Ala Pro Leu
    2005 2010 2015
    Val Leu Pro Glu Arg Gly Ala Val Arg Ile Gln Val Gly Val Ser Gly
    2020 2025 2030
    Asp Gly Glu Ser Pro Ala Gly Arg Thr Phe Gly Val Tyr Ser Thr Pro
    2035 2040 2045
    Asp Ser Gly Asp Thr Gly Asp Asp Ala Pro Arg Glu Trp Thr Arg His
    2050 2055 2060
    Val Ser Gly Val Leu Gly Glu Gly Asp Pro Ala Thr Glu Ser Asp His
    2065 2070 2075 2080
    Pro Gly Thr Asp Gly Asp Gly Ser Ala Ala Trp Pro Pro Ala Ala Ala
    2085 2090 2095
    Thr Ala Thr Pro Leu Asp Gly Val Tyr Asp Arg Leu Ala Glu Leu Gly
    2100 2105 2110
    Tyr Gly Tyr Gly Pro Ala Phe Gln Gly Leu Thr Gly Leu Trp Arg Asp
    2115 2120 2125
    Gly Ala Asp Thr Leu Ala Glu Ile Arg Leu Pro Ala Ala Gln His Glu
    2130 2135 2140
    Ser Ala Gly Leu Phe Gly Val His Pro Ala Leu Leu Asp Ala Ala Leu
    2145 2150 2155 2160
    His Pro Ile Val Leu Glu Gly Asn Ser Ala Ala Gly Ala Cys Asp Ala
    2165 2170 2175
    Asp Thr Asp Ala Thr Asp Arg Ile Arg Leu Pro Phe Ala Trp Ala Gly
    2180 2185 2190
    Val Thr Leu His Ala Glu Gly Ala Thr Ala Leu Arg Val Arg Ile Thr
    2195 2200 2205
    Pro Thr Gly Pro Asp Thr Val Thr Leu Arg Leu Thr Asp Thr Thr Gly
    2210 2215 2220
    Ala Pro Val Ala Thr Val Glu Ser Leu Thr Leu Arg Ala Val Ala Lys
    2225 2230 2235 2240
    Asp Arg Leu Gly Thr Thr Ala Gly Arg Val Asp Asp Ala Leu Phe Thr
    2245 2250 2255
    Val Val Trp Thr Glu Thr Gly Thr Pro Glu Pro Ala Gly Arg Gly Ala
    2260 2265 2270
    Val Glu Val Glu Glu Leu Val Asp Leu Ala Gly Leu Gly Asp Leu Val
    2275 2280 2285
    Glu Leu Gly Ala Ala Asp Val Val Leu Arg Ala Asp Arg Trp Thr Leu
    2290 2295 2300
    Asp Gly Asp Pro Ser Ala Ala Ala Arg Thr Ala Val Arg Arg Thr Leu
    2305 2310 2315 2320
    Ala Ile Val Gln Glu Phe Leu Ser Glu Pro Arg Phe Asp Gly Ser Arg
    2325 2330 2335
    Leu Val Cys Val Thr Arg Gly Ala Val Ala Ala Leu Pro Gly Glu Asp
    2340 2345 2350
    Val Thr Ser Leu Ala Thr Gly Pro Leu Trp Gly Leu Val Arg Ser Ala
    2355 2360 2365
    Gln Ser Glu Asn Pro Gly Arg Leu Phe Leu Leu Asp Leu Gly Glu Gly
    2370 2375 2380
    Glu Gly Glu Arg Asp Gly Ala Glu Glu Leu Ile Arg Ala Ala Thr Ala
    2385 2390 2395 2400
    Gly Asp Glu Pro Gln Leu Ala Ala Arg Asp Gly Arg Leu Leu Ala Pro
    2405 2410 2415
    Arg Leu Ala Arg Thr Ala Ala Leu Ser Ser Glu Asp Thr Ala Gly Gly
    2420 2425 2430
    Ala Asp Arg Phe Gly Pro Asp Gly Thr Val Leu Val Thr Gly Gly Thr
    2435 2440 2445
    Gly Gly Leu Gly Ala Leu Leu Ala Arg His Leu Val Glu Arg His Gly
    2450 2455 2460
    Val Arg Arg Leu Leu Leu Val Ser Arg Arg Gly Ala Asp Ala Pro Gly
    2465 2470 2475 2480
    Ala Ala Asp Leu Gly Glu Asp Leu Ala Gly Leu Gly Ala Glu Val Ala
    2485 2490 2495
    Phe Ala Ala Ala Asp Ala Ala Asp Arg Glu Ser Leu Ala Arg Ala Ile
    2500 2505 2510
    Ala Thr Val Pro Ala Glu His Pro Leu Thr Ala Val Val His Thr Ala
    2515 2520 2525
    Gly Val Val Asp Asp Ala Thr Val Glu Ala Leu Thr Pro Glu Arg Leu
    2530 2535 2540
    Asp Ala Val Leu Arg Pro Lys Val Asp Ala Ala Trp Asn Leu His Glu
    2545 2550 2555 2560
    Leu Thr Lys Asp Leu Arg Leu Asp Ala Phe Val Leu Phe Ser Ser Val
    2565 2570 2575
    Ser Gly Ile Val Gly Thr Ala Gly Gln Ala Asn Tyr Ala Ala Ala Asn
    2580 2585 2590
    Thr Gly Leu Asp Ala Leu Ala Ala His Arg Ala Ala Thr Gly Leu Ala
    2595 2600 2605
    Ala Thr Ser Leu Ala Trp Gly Leu Trp Asp Gly Thr His Gly Met Gly
    2610 2615 2620
    Gly Thr Leu Gly Ala Ala Asp Leu Ala Arg Trp Ser Arg Ala Gly Ile
    2625 2630 2635 2640
    Thr Pro Leu Thr Pro Leu Gln Gly Leu Ala Leu Phe Asp Ala Ala Val
    2645 2650 2655
    Ala Arg Asp Asp Ala Leu Leu Val Pro Ala Gly Leu Arg Pro Thr Ala
    2660 2665 2670
    His Arg Gly Thr Asp Gly Gln Pro Pro Ala Leu Trp Arg Gly Leu Val
    2675 2680 2685
    Arg Ala Arg Pro Arg Arg Ala Ala Arg Thr Ala Ala Glu Ala Ala Asp
    2690 2695 2700
    Thr Thr Gly Gly Trp Leu Ser Gly Leu Ala Ala Gln Ser Pro Glu Glu
    2705 2710 2715 2720
    Arg Arg Ser Thr Ala Val Thr Leu Val Thr Gly Val Val Ala Asp Val
    2725 2730 2735
    Leu Gly His Ala Asp Ser Ala Ala Val Gly Ala Glu Arg Ser Phe Lys
    2740 2745 2750
    Asp Leu Gly Phe Asp Ser Leu Ala Gly Val Glu Leu Arg Asn Arg Leu
    2755 2760 2765
    Asn Ala Ala Thr Gly Leu Arg Leu Pro Ala Thr Thr Val Phe Asp His
    2770 2775 2780
    Pro Ser Pro Ala Ala Leu Ala Ser His Leu Leu Ala Gln Val Pro Gly
    2785 2790 2795 2800
    Leu Lys Glu Gly Thr Ala Ala Thr Ala Thr Val Val Ala Glu Arg Gly
    2805 2810 2815
    Ala Ser Phe Gly Asp Arg Ala Thr Asp Asp Asp Pro Ile Ala Ile Val
    2820 2825 2830
    Gly Met Ala Cys Arg Tyr Pro Gly Gly Val Ser Ser Pro Glu Asp Leu
    2835 2840 2845
    Trp Arg Leu Val Ala Glu Gly Thr Asp Ala Ile Ser Glu Phe Pro Val
    2850 2855 2860
    Asn Arg Gly Trp Asp Leu Glu Ser Leu Tyr Asp Pro Asp Pro Glu Ser
    2865 2870 2875 2880
    Lys Gly Thr Thr Tyr Cys Arg Glu Gly Gly Phe Leu Glu Gly Ala Gly
    2885 2890 2895
    Asp Phe Asp Ala Ala Phe Phe Gly Ile Ser Pro Arg Glu Ala Leu Val
    2900 2905 2910
    Met Asp Pro Gln Gln Arg Leu Leu Leu Glu Val Ser Trp Glu Ala Leu
    2915 2920 2925
    Glu Arg Ala Gly Ile Asp Pro Ser Ser Leu Arg Gly Ser Arg Gly Gly
    2930 2935 2940
    Val Tyr Val Gly Ala Ala His Gly Ser Tyr Ala Ser Asp Pro Arg Leu
    2945 2950 2955 2960
    Val Pro Glu Gly Ser Glu Gly Tyr Leu Leu Thr Gly Ser Ala Asp Ala
    2965 2970 2975
    Val Met Ser Gly Arg Ile Ser Tyr Ala Leu Gly Leu Glu Gly Pro Ser
    2980 2985 2990
    Met Thr Val Glu Thr Ala Cys Ser Ser Ser Leu Val Ala Leu His Leu
    2995 3000 3005
    Ala Val Arg Ala Leu Arg His Gly Glu Cys Gly Leu Ala Leu Ala Gly
    3010 3015 3020
    Gly Val Ala Val Met Ala Asp Pro Ala Ala Phe Val Glu Phe Ser Arg
    3025 3030 3035 3040
    Gln Lys Gly Leu Ala Ala Asp Gly Arg Cys Lys Ala Phe Ser Ala Ala
    3045 3050 3055
    Ala Asp Gly Thr Gly Trp Ala Glu Gly Val Gly Val Leu Val Leu Glu
    3060 3065 3070
    Arg Leu Ser Asp Ala Arg Arg Ala Gly His Thr Val Leu Gly Leu Val
    3075 3080 3085
    Thr Gly Thr Ala Val Asn Gln Asp Gly Ala Ser Asn Gly Leu Thr Ala
    3090 3095 3100
    Pro Asn Gly Pro Ala Gln Gln Arg Val Ile Ala Glu Ala Leu Ala Asp
    3105 3110 3115 3120
    Ala Gly Leu Ser Pro Glu Asp Val Asp Ala Val Glu Ala His Gly Thr
    3125 3130 3135
    Gly Thr Arg Leu Gly Asp Pro Ile Glu Ala Gly Ala Leu Leu Ala Ala
    3140 3145 3150
    Ser Gly Arg Asn Arg Ser Gly Asp His Pro Leu Trp Leu Gly Ser Leu
    3155 3160 3165
    Lys Ser Asn Ile Gly His Ala Gln Ala Ala Ala Gly Val Gly Gly Val
    3170 3175 3180
    Ile Lys Met Leu Gln Ala Leu Arg His Gly Leu Leu Pro Arg Thr Leu
    3185 3190 3195 3200
    His Ala Asp Glu Pro Thr Pro His Ala Asp Trp Ser Ser Gly Arg Val
    3205 3210 3215
    Arg Leu Leu Thr Ser Glu Val Pro Trp Gln Arg Thr Gly Arg Pro Arg
    3220 3225 3230
    Arg Thr Gly Val Ser Ala Phe Gly Val Gly Gly Thr Asn Ala His Val
    3235 3240 3245
    Val Leu Glu Glu Ala Pro Ala Pro Pro Ala Pro Glu Pro Ala Gly Glu
    3250 3255 3260
    Ala Pro Gly Gly Ser Arg Ala Ala Glu Gly Ala Glu Gly Pro Leu Ala
    3265 3270 3275 3280
    Trp Val Val Ser Gly Arg Asp Glu Pro Ala Leu Arg Ser Gln Ala Arg
    3285 3290 3295
    Arg Leu Arg Asp His Leu Ser Arg Thr Pro Gly Ala Arg Pro Arg Asp
    3300 3305 3310
    Ile Ala Phe Ser Leu Ala Ala Thr Arg Ala Ala Phe Asp His Arg Ala
    3315 3320 3325
    Val Leu Ile Gly Ser Asp Gly Ala Glu Leu Ala Ala Ala Leu Asp Ala
    3330 3335 3340
    Leu Ala Glu Gly Arg Asp Gly Pro Ala Val Val Arg Gly Val Arg Asp
    3345 3350 3355 3360
    Arg Asp Gly Arg Met Ala Phe Leu Phe Thr Gly Gln Gly Ser Gln Arg
    3365 3370 3375
    Ala Gly Met Ala His Asp Leu His Ala Ala His Thr Phe Phe Ala Ser
    3380 3385 3390
    Ala Leu Asp Glu Val Thr Asp Arg Leu Asp Pro Leu Leu Gly Arg Pro
    3395 3400 3405
    Leu Gly Ala Leu Leu Asp Ala Arg Pro Gly Ser Pro Glu Ala Ala Leu
    3410 3415 3420
    Leu Asp Arg Thr Glu Tyr Thr Gln Pro Ala Leu Phe Ala Val Glu Val
    3425 3430 3435 3440
    Ala Leu His Arg Leu Leu Glu His Trp Gly Met Arg Pro Asp Leu Leu
    3445 3450 3455
    Leu Gly His Ser Val Gly Glu Leu Ala Ala Ala His Val Ala Gly Val
    3460 3465 3470
    Leu Asp Leu Asp Asp Ala Cys Ala Leu Val Ala Ala Arg Gly Arg Leu
    3475 3480 3485
    Met Gln Arg Leu Pro Pro Gly Gly Ala Met Val Ser Val Arg Ala Gly
    3490 3495 3500
    Glu Asp Glu Val Arg Ala Leu Leu Ala Gly Arg Glu Asp Ala Val Cys
    3505 3510 3515 3520
    Val Ala Ala Val Asn Gly Pro Arg Ser Val Val Ile Ser Gly Ala Glu
    3525 3530 3535
    Glu Ala Val Ala Glu Ala Ala Ala Gln Leu Ala Gly Arg Gly Arg Arg
    3540 3545 3550
    Thr Arg Arg Leu Arg Val Ala His Ala Phe His Ser Pro Leu Met Asp
    3555 3560 3565
    Gly Met Leu Ala Gly Phe Arg Glu Val Ala Ala Gly Leu Arg Tyr Arg
    3570 3575 3580
    Glu Pro Glu Leu Thr Val Val Ser Thr Val Thr Gly Arg Pro Ala Arg
    3585 3590 3595 3600
    Pro Gly Glu Leu Thr Gly Pro Asp Tyr Trp Val Ala Gln Val Arg Glu
    3605 3610 3615
    Pro Val Arg Phe Ala Asp Ala Val Arg Thr Ala His Arg Leu Gly Ala
    3620 3625 3630
    Arg Thr Phe Leu Glu Thr Gly Pro Asp Gly Val Leu Cys Gly Met Ala
    3635 3640 3645
    Glu Glu Cys Leu Glu Asp Asp Thr Val Ala Leu Leu Pro Ala Ile His
    3650 3655 3660
    Lys Pro Gly Thr Ala Pro His Gly Pro Ala Ala Pro Gly Ala Leu Arg
    3665 3670 3675 3680
    Ala Ala Ala Ala Ala Tyr Gly Arg Gly Ala Arg Val Asp Trp Ala Gly
    3685 3690 3695
    Met His Ala Asp Gly Pro Glu Gly Pro Ala Arg Arg Val Glu Leu Pro
    3700 3705 3710
    Val His Ala Phe Arg His Arg Arg Tyr Trp Leu Ala Pro Gly Arg Ala
    3715 3720 3725
    Ala Asp Thr Asp Asp Trp Met Tyr Arg Ile Gly Trp Asp Arg Leu Pro
    3730 3735 3740
    Ala Val Thr Gly Gly Ala Arg Thr Ala Gly Arg Trp Leu Val Ile His
    3745 3750 3755 3760
    Pro Asp Ser Pro Arg Cys Arg Glu Leu Ser Gly His Ala Glu Arg Ala
    3765 3770 3775
    Leu Arg Ala Ala Gly Ala Ser Pro Val Pro Leu Pro Val Asp Ala Pro
    3780 3785 3790
    Ala Ala Asp Arg Ala Ser Phe Ala Ala Leu Leu Arg Ser Ala Thr Gly
    3795 3800 3805
    Pro Asp Thr Arg Gly Asp Thr Ala Ala Pro Val Ala Gly Val Leu Ser
    3810 3815 3820
    Leu Leu Ser Glu Glu Asp Arg Pro His Arg Gln His Ala Pro Val Pro
    3825 3830 3835 3840
    Ala Gly Val Leu Ala Thr Leu Ser Leu Met Gln Ala Met Glu Glu Glu
    3845 3850 3855
    Ala Val Glu Ala Arg Val Trp Cys Val Ser Arg Ala Ala Val Ala Ala
    3860 3865 3870
    Ala Asp Arg Glu Arg Pro Val Gly Ala Gly Ala Ala Leu Trp Gly Leu
    3875 3880 3885
    Gly Arg Val Ala Ala Leu Glu Arg Pro Thr Arg Trp Gly Gly Leu Val
    3890 3895 3900
    Asp Leu Pro Ala Ser Pro Gly Ala Ala His Trp Ala Ala Ala Val Glu
    3905 3910 3915 3920
    Arg Leu Ala Gly Pro Glu Asp Gln Ile Ala Val Arg Ala Ser Gly Ser
    3925 3930 3935
    Trp Gly Arg Arg Leu Thr Arg Leu Pro Arg Asp Gly Gly Gly Arg Thr
    3940 3945 3950
    Ala Ala Pro Ala Tyr Arg Pro Arg Gly Thr Val Leu Val Thr Gly Gly
    3955 3960 3965
    Thr Gly Ala Leu Gly Gly His Leu Ala Arg Trp Leu Ala Ala Ala Gly
    3970 3975 3980
    Ala Glu His Leu Ala Leu Thr Ser Arg Arg Gly Pro Asp Ala Pro Gly
    3985 3990 3995 4000
    Ala Ala Gly Leu Glu Ala Glu Leu Leu Leu Leu Gly Ala Lys Val Thr
    4005 4010 4015
    Phe Ala Ala Cys Asp Thr Ala Asp Arg Asp Gly Leu Ala Arg Val Leu
    4020 4025 4030
    Arg Ala Ile Pro Glu Asp Thr Pro Leu Thr Ala Val Phe His Ala Ala
    4035 4040 4045
    Gly Val Pro Gln Val Thr Pro Leu Ser Arg Thr Ser Pro Glu His Phe
    4050 4055 4060
    Ala Asp Val Tyr Ala Gly Lys Ala Ala Gly Ala Ala His Leu Asp Glu
    4065 4070 4075 4080
    Leu Thr Arg Glu Leu Gly Ala Gly Leu Asp Ala Phe Val Leu Tyr Ser
    4085 4090 4095
    Ser Gly Ala Gly Val Trp Gly Ser Ala Gly Gln Gly Ala Tyr Ala Ala
    4100 4105 4110
    Ala Asn Ala Ala Leu Asp Ala Leu Ala Arg Arg Arg Ala Ala Asp Gly
    4115 4120 4125
    Leu Pro Ala Thr Ser Ile Ala Trp Gly Val Trp Gly Gly Gly Gly Met
    4130 4135 4140
    Gly Ala Asp Glu Ala Gly Ala Glu Tyr Leu Gly Arg Arg Gly Met Arg
    4145 4150 4155 4160
    Pro Met Ala Pro Val Ser Ala Leu Arg Ala Met Ala Thr Ala Ile Ala
    4165 4170 4175
    Ser Gly Glu Pro Cys Pro Thr Val Thr His Thr Asp Trp Glu Arg Phe
    4180 4185 4190
    Gly Glu Gly Phe Thr Ala Phe Arg Pro Ser Pro Leu Ile Ala Gly Leu
    4195 4200 4205
    Gly Thr Pro Gly Gly Gly Arg Ala Ala Glu Thr Pro Glu Glu Gly Asn
    4210 4215 4220
    Ala Thr Ala Ala Ala Asp Leu Thr Ala Leu Pro Pro Ala Glu Leu Arg
    4225 4230 4235 4240
    Thr Ala Leu Arg Glu Leu Val Arg Ala Arg Thr Ala Ala Ala Leu Gly
    4245 4250 4255
    Leu Asp Asp Pro Ala Glu Val Ala Glu Gly Glu Arg Phe Pro Ala Met
    4260 4265 4270
    Gly Phe Asp Ser Leu Ala Thr Val Arg Leu Arg Arg Gly Leu Ala Ser
    4275 4280 4285
    Ala Thr Gly Leu Asp Leu Pro Pro Asp Leu Leu Phe Asp Arg Asp Thr
    4290 4295 4300
    Pro Ala Ala Leu Ala Ala His Leu Ala Glu Leu Leu Ala Thr Ala Arg
    4305 4310 4315 4320
    Asp His Gly Pro Gly Gly Pro Gly Thr Gly Ala Ala Pro Ala Asp Ala
    4325 4330 4335
    Gly Ser Gly Leu Pro Ala Leu Tyr Arg Glu Ala Val Arg Thr Gly Arg
    4340 4345 4350
    Ala Ala Glu Met Ala Glu Leu Leu Ala Ala Ala Ser Arg Phe Arg Pro
    4355 4360 4365
    Ala Phe Gly Thr Ala Asp Arg Gln Pro Val Ala Leu Val Pro Leu Ala
    4370 4375 4380
    Asp Gly Ala Glu Asp Thr Gly Leu Pro Leu Leu Val Gly Cys Ala Gly
    4385 4390 4395 4400
    Thr Ala Val Ala Ser Gly Pro Val Glu Phe Thr Ala Phe Ala Gly Ala
    4405 4410 4415
    Leu Ala Asp Leu Pro Ala Ala Ala Pro Met Ala Ala Leu Pro Gln Pro
    4420 4425 4430
    Gly Phe Leu Pro Gly Glu Arg Val Pro Ala Thr Pro Glu Ala Leu Phe
    4435 4440 4445
    Glu Ala Gln Ala Glu Ala Leu Leu Arg Tyr Ala Ala Gly Arg Pro Phe
    4450 4455 4460
    Val Leu Leu Gly His Ser Ala Gly Ala Asn Met Ala His Ala Leu Thr
    4465 4470 4475 4480
    Arg His Leu Glu Ala Asn Gly Gly Gly Pro Ala Gly Leu Val Leu Met
    4485 4490 4495
    Asp Ile Tyr Thr Pro Ala Asp Pro Gly Ala Met Gly Val Trp Arg Asn
    4500 4505 4510
    Asp Met Phe Gln Trp Val Trp Arg Arg Ser Asp Ile Pro Pro Asp Asp
    4515 4520 4525
    His Arg Leu Thr Ala Met Gly Ala Tyr His Arg Leu Leu Leu Asp Trp
    4530 4535 4540
    Ser Pro Thr Pro Val Arg Ala Pro Val Leu His Leu Arg Ala Ala Glu
    4545 4550 4555 4560
    Pro Met Gly Asp Trp Pro Pro Gly Asp Thr Gly Trp Gln Ser His Trp
    4565 4570 4575
    Asp Gly Ala His Thr Thr Ala Gly Ile Pro Gly Asn His Phe Thr Met
    4580 4585 4590
    Met Thr Glu His Ala Ser Ala Ala Ala Arg Leu Val His Gly Trp Leu
    4595 4600 4605
    Ala Glu Arg Thr Pro Ser Gly Gln Gly Gly Ser Pro Ser Arg Ala Ala
    4610 4615 4620
    Gly Arg Glu Glu Arg Pro Met Ile Leu Arg Ala Gly Thr Ala Asp Pro
    4625 4630 4635 4640
    Ala Pro Tyr Glu Glu Glu Ile Pro Gly Tyr Arg Ala Arg Ile Leu Asn
    4645 4650 4655
    Met Ser Asn Lys Asn Asn Asp Glu Leu Gln Arg Gln Ala Ser Glu Asn
    4660 4665 4670
    Thr Leu Gly Leu Asn Pro Val Ile Gly Ile Arg Arg Lys Asp Leu Leu
    4675 4680 4685
    Ser Ser Ala Arg Thr Val Leu Arg Gln Ala Val Arg Gln Pro Leu His
    4690 4695 4700
    Ser Ala Lys His Val Ala His Phe Gly Leu Glu Leu Lys Asn Val Leu
    4705 4710 4715 4720
    Leu Gly Lys Ser Ser Leu Ala Pro Glu Ser Asp Asp Arg Arg Phe Asn
    4725 4730 4735
    Asp Pro Ala Trp Ser Asn Asn Pro Leu Tyr Arg Arg Tyr Leu Gln Thr
    4740 4745 4750
    Tyr Leu Ala Trp Arg Lys Glu Leu Gln Asp Trp Ile Gly Asn Ser Asp
    4755 4760 4765
    Leu Ser Pro Gln Asp Ile Ser Arg Gly Gln Phe Val Ile Asn Leu Met
    4770 4775 4780
    Thr Glu Ala Met Ala Pro Thr Asn Thr Leu Ser Asn Pro Ala Ala Val
    4785 4790 4795 4800
    Lys Arg Phe Phe Glu Thr Gly Gly Lys Ser Leu Leu Asp Gly Leu Ser
    4805 4810 4815
    Asn Leu Ala Lys Asp Leu Val Asn Asn Gly Gly Met Pro Ser Gln Val
    4820 4825 4830
    Asn Met Asp Ala Phe Glu Val Gly Lys Asn Leu Gly Thr Ser Glu Gly
    4835 4840 4845
    Ala Val Val Tyr Arg Asn Asp Val Leu Glu Leu Ile Gln Tyr Lys Pro
    4850 4855 4860
    Ile Thr Glu Gln Val His Ala Arg Pro Leu Leu Val Val Pro Pro Gln
    4865 4870 4875 4880
    Ile Asn Lys Phe Tyr Val Phe Asp Leu Ser Pro Glu Lys Ser Leu Ala
    4885 4890 4895
    Arg Tyr Cys Leu Arg Ser Gln Gln Gln Thr Phe Ile Ile Ser Trp Arg
    4900 4905 4910
    Asn Pro Thr Lys Ala Gln Arg Glu Trp Gly Leu Ser Thr Tyr Ile Asp
    4915 4920 4925
    Ala Leu Lys Glu Ala Val Asp Ala Val Leu Ala Ile Thr Gly Ser Lys
    4930 4935 4940
    Asp Leu Asn Met Leu Gly Ala Cys Ser Gly Gly Ile Thr Cys Thr Ala
    4945 4950 4955 4960
    Leu Val Gly His Tyr Ala Ala Leu Gly Glu Asn Lys Val Asn Ala Leu
    4965 4970 4975
    Thr Leu Leu Val Ser Val Leu Asp Thr Thr Met Asp Asn Gln Val Ala
    4980 4985 4990
    Leu Phe Val Asp Glu Gln Thr Leu Glu Ala Ala Lys Arg His Ser Tyr
    4995 5000 5005
    Gln Ala Gly Val Leu Glu Gly Ser Glu Met Ala Lys Val Phe Ala Trp
    5010 5015 5020
    Met Arg Pro Asn Asp Leu Ile Trp Asn Tyr Trp Val Asn Asn Tyr Leu
    5025 5030 5035 5040
    Leu Gly Asn Glu Pro Pro Val Phe Asp Ile Leu Phe Trp Asn Asn Asp
    5045 5050 5055
    Thr Thr Arg Leu Pro Ala Ala Phe His Gly Asp Leu Ile Glu Met Phe
    5060 5065 5070
    Lys Ser Asn Pro Leu Thr Arg Pro Asp Ala Leu Glu Val Cys Gly Thr
    5075 5080 5085
    Pro Ile Asp Leu Lys Gln Val Lys Cys Asp Ile Tyr Ser Leu Ala Gly
    5090 5095 5100
    Thr Asn Asp His Ile Thr Pro Trp Gln Ser Cys Tyr Arg Ser Ala His
    5105 5110 5115 5120
    Leu Phe Gly Gly Lys Ile Glu Phe Val Leu Ser Asn Ser Gly His Ile
    5125 5130 5135
    Gln Ser Ile Leu Asn Pro Pro Gly Asn Pro Lys Ala Arg Phe Met Thr
    5140 5145 5150
    Gly Ala Asp Arg Pro Gly Asp Pro Val Ala Trp Gln Glu Asn Ala Thr
    5155 5160 5165
    Lys His Ala Asp Ser Trp Trp Leu His Trp Gln Ser Trp Leu Gly Glu
    5170 5175 5180
    Arg Ala Gly Glu Leu Glu Lys Ala Pro Thr Arg Leu Gly Asn Arg Ala
    5185 5190 5195 5200
    Tyr Ala Ala Gly Glu Ala Ser Pro Gly Thr Tyr Val His Glu Arg
    5205 5210 5215
    <210> SEQ ID NO 46
    <211> LENGTH: 13613
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 46
    ggatccggcg cttccacccc gcgccgaaca gcgcggtgcg gctggtctgc ctgccgcacg 60
    ccggcggctc cgccagctac ttcttccgct tctcggagga gctgcacccc tccgtcgagg 120
    ccctgtcggt gcagtatccg ggccgccagg accggcgtgc cgagccgtgt ctggagagcg 180
    tcgaggagct cgccgagcat gtggtcgcgg ccaccgaacc ctggtggcag gagggccggc 240
    tggccttctt cgggcacagc ctcggcgcct ccgtcgcctt cgagacggcc cgcatcctgg 300
    aacagcggca cggggtacgg cccgagggcc tgtacgtctc cggtcggcgc gccccgtcgc 360
    tggcgccgga ccggctcgtc caccagctgg acgaccgggc gttcctggcc gagatccggc 420
    ggctcagcgg caccgacgag cggttcctcc aggacgacga gctgctgcgg ctggtgctgc 480
    ccgcgctgcg cagcgactac aaggcggcgg agacgtacct gcaccggccg tccgccaagc 540
    tcacctgccc ggtgatggcc ctggccggcg accgtgaccc gaaggcgccg ctgaacgagg 600
    tggccgagtg gcgtcggcac accagcgggc cgttctgcct ccgggcgtac tccggcggcc 660
    acttctacct caacgaccag tggcacgaga tctgcaacga catctccgac cacctgctcg 720
    tcacccgcgg cgcgcccgat gcccgcgtcg tgcagccccc gaccagcctt atcgaaggag 780
    cggcgaagag atggcagaac ccacggtgac cgacgacctg acgggggccc tcacgcagcc 840
    cccgctgggc cgcaccgtcc gcgcggtggc cgaccgtgaa ctcggcaccc acctcctgga 900
    gacccgcggc atccactgga tccacgccgc gaacggcgac ccgtacgcca ccgtgctgcg 960
    cggccaggcg gacgacccgt atcccgcgta cgagcgggtg cgtgcccgcg gcgcgctctc 1020
    cttcagcccg acgggcagct gggtcaccgc cgatcacgcc ctggcggcga gcatcctctg 1080
    ctcgacggac ttcggggtct ccggcgccga cggcgtcccg gtgccgcagc aggtcctctc 1140
    gtacggggag ggctgtccgc tggagcgcga gcaggtgctg ccggcggccg gtgacgtgcc 1200
    ggagggcggg cagcgtgccg tggtcgaggg gatccaccgg gagacgctgg agggtctcgc 1260
    gccggacccg tcggcgtcgt acgccttcga gctgctgggc ggtttcgtcc gcccggcggt 1320
    gacggccgct gccgccgccg tgctgggtgt tcccgcggac cggcgcgcgg acttcgcgga 1380
    tctgctggag cggctccggc cgctgtccga cagcctgctg gccccgcagt ccctgcggac 1440
    ggtacgggcg gcggacggcg cgctggccga gctcacggcg ctgctcgccg attcggacga 1500
    ctcccccggg gccctgctgt cggcgctcgg ggtcaccgca gccgtccagc tcaccgggaa 1560
    cgcggtgctc gcgctcctcg cgcatcccga gcagtggcgg gagctgtgcg accggcccgg 1620
    gctcgcggcg gccgcggtgg aggagaccct ccgctacgac ccgccggtgc agctcgacgc 1680
    ccgggtggtc cgcggggaga cggagctggc gggccggcgg ctgccggccg gggcgcatgt 1740
    cgtcgtcctg accgccgcga ccggccggga cccggaggtc ttcacggacc cggagcgctt 1800
    cgacctcgcg cgccccgacg ccgccgcgca cctcgcgctg caccccgccg gtccgtacgg 1860
    cccggtggcg tccctggtcc ggcttcaggc ggaggtcgcg ctgcggaccc tggccgggcg 1920
    tttccccggg ctgcggcagg cgggggacgt gctccgcccc cgccgcgcgc ctgtcggccg 1980
    cgggccgctg agcgtcccgg tcagcagctc ctgagacacc ggggccccgg tccgcccggc 2040
    cccccttcgg acggaccgga cggctcggac cacggggacg gctcagaccg tcccgtgtgt 2100
    ccccgtccgg ctcccgtccg ccccatcccg cccctccacc ggcaaggaag gacacgacgc 2160
    catgcgcgtc ctgctgacct cgttcgcaca tcacacgcac tactacggcc tggtgcccct 2220
    ggcctgggcg ctgctcgccg ccgggcacga ggtgcgggtc gccagccagc ccgcgctcac 2280
    ggacaccatc accgggtccg ggctcgccgc ggtgccggtc ggcaccgacc acctcatcca 2340
    cgagtaccgg gtgcggatgg cgggcgagcc gcgcccgaac catccggcga tcgccttcga 2400
    cgaggcccgt cccgagccgc tggactggga ccacgccctc ggcatcgagg cgatcctcgc 2460
    cccgtacttc catctgctcg ccaacaacga ctcgatggtc gacgacctcg tcgacttcgc 2520
    ccggtcctgg cagccggacc tggtgctgtg ggagccgacg acctacgcgg gcgccgtcgc 2580
    cgcccaggtc accggtgccg cgcacgcccg ggtcctgtgg gggcccgacg tgatgggcag 2640
    cgcccgccgc aagttcgtcg cgctgcggga ccggcagccg cccgagcacc gcgaggaccc 2700
    caccgcggag tggctgacgt ggacgctcga ccggtacggc gcctccttcg aagaggagct 2760
    gctcaccggc cagttcacga tcgacccgac cccgccgagc ctgcgcctcg acacgggcct 2820
    gccgaccgtc gggatgcgtt atgttccgta caacggcacg tcggtcgtgc cggactggct 2880
    gagtgagccg cccgcgcggc cccgggtctg cctgaccctc ggcgtctccg cgcgtgaggt 2940
    cctcggcggc gacggcgtct cgcagggcga catcctggag gcgctcgccg acctcgacat 3000
    cgagctcgtc gccacgctcg acgcgagtca gcgcgccgag atccgcaact acccgaagca 3060
    cacccggttc acggacttcg tgccgatgca cgcgctcctg ccgagctgct cggcgatcat 3120
    ccaccacggc ggggcgggca cctacgcgac cgccgtgatc aacgcggtgc cgcaggtcat 3180
    gctcgccgag ctgtgggacg cgccggtcaa ggcgcgggcc gtcgccgagc agggggcggg 3240
    gttcttcctg ccgccggccg agctcacgcc gcaggccgtg cgggacgccg tcgtccgcat 3300
    cctcgacgac ccctcggtcg ccaccgccgc gcaccggctg cgcgaggaga ccttcggcga 3360
    ccccaccccg gccgggatcg tccccgagct ggagcggctc gccgcgcagc accgccgccc 3420
    gccggccgac gcccggcact gagccgcacc cctcgcccca ggcctcaccc ctgtatctgc 3480
    gccgggggac gcccccggcc caccctccga aagaccgaaa gcaggagcac cgtgtacgaa 3540
    gtcgaccacg ccgacgtcta cgacctcttc tacctgggtc gcggcaagga ctacgccgcc 3600
    gaggcctccg acatcgccga cctggtgcgc tcccgtaccc ccgaggcctc ctcgctcctg 3660
    gacgtggcct gcggtacggg cacgcatctg gagcacttca ccaaggagtt cggcgacacc 3720
    gccggcctgg agctgtccga ggacatgctc acccacgccc gcaagcggct gcccgacgcc 3780
    acgctccacc agggcgacat gcgggacttc cggctcggcc ggaagttctc cgccgtggtc 3840
    agcatgttca gctccgtcgg ctacctgaag acgaccgagg aactcggcgc ggccgtcgcc 3900
    tcgttcgcgg agcacctgga gcccggtggc gtcgtcgtcg tcgagccgtg gtggttcccg 3960
    gagaccttcg ccgacggctg ggtcagcgcc gacgtcgtcc gccgtgacgg gcgcaccgtg 4020
    gcccgtgtct cgcactcggt gcgggagggg aacgcgacgc gcatggaggt ccacttcacc 4080
    gtggccgacc cgggcaaggg cgtgcggcac ttctccgacg tccatctcat caccctgttc 4140
    caccaggccg agtacgaggc cgcgttcacg gccgccgggc tgcgcgtcga gtacctggag 4200
    ggcggcccgt cgggccgtgg cctcttcgtc ggcgtccccg cctgagcacc gcccaagacc 4260
    ccccggggcg ggacgtcccg ggtgcaccaa gcaaagagag agaaacgaac cgtgacaggt 4320
    aagacccgaa taccgcgtgt ccgccgcggc cgcaccacgc ccagggcctt caccctggcc 4380
    gtcgtcggca ccctgctggc gggcaccacc gtggcggccg ccgctcccgg cgccgccgac 4440
    acggccaatg ttcagtacac gagccgggcg gcggagctcg tcgcccagat gacgctcgac 4500
    gagaagatca gcttcgtcca ctgggcgctg gaccccgacc ggcagaacgt cggctacctt 4560
    cccggcgtgc cgcgtctggg catcccggag ctgcgtgccg ccgacggccc gaacggcatc 4620
    cgcctggtgg ggcagaccgc caccgcgctg cccgcgccgg tcgccctggc cagcaccttc 4680
    gacgacacca tggccgacag ctacggcaag gtcatgggcc gcgacggtcg cgcgctcaac 4740
    caggacatgg tcctgggccc gatgatgaac aacatccggg tgccgcacgg cggccggaac 4800
    tacgagacct tcagcgagga ccccctggtc tcctcgcgca ccgcggtcgc ccagatcaag 4860
    ggcatccagg gtgcgggtct gatgaccacg gccaagcact tcgcggccaa caaccaggag 4920
    aacaaccgct tctccgtgaa cgccaatgtc gacgagcaga cgctccgcga gatcgagttc 4980
    ccggcgttcg aggcgtcctc caaggccggc gcggcctcct tcatgtgtgc ctacaacggc 5040
    ctcaacggga agccgtcctg cggcaacgac gagctcctca acaacgtgct gcgcacgcag 5100
    tggggcttcc agggctgggt gatgtccgac tggctcgcca ccccgggcac cgacgccatc 5160
    accaagggcc tcgaccagga gatgggcgtc gagctccccg gcgacgtccc gaagggcgag 5220
    ccctcgccgc cggccaagtt cttcggcgag gcgctgaaga cggccgtcct gaacggcacg 5280
    gtccccgagg cggccgtgac gcggtcggcg gagcggatcg tcggccagat ggagaagttc 5340
    ggtctgctcc tcgccactcc ggcgccgcgg cccgagcgcg acaaggcggg tgcccaggcg 5400
    gtgtcccgca aggtcgccga gaacggcgcg gtgctcctgc gcaacgaggg ccaggccctg 5460
    ccgctcgccg gtgacgccgg caagagcatc gcggtcatcg gcccgacggc cgtcgacccc 5520
    aaggtcaccg gcctgggcag cgcccacgtc gtcccggact cggcggcggc gccactcgac 5580
    accatcaagg cccgcgcggg tgcgggtgcg acggtgacgt acgagacggg tgaggagacc 5640
    ttcgggacgc agatcccggc ggggaacctc agcccggcgt tcaaccaggg ccaccagctc 5700
    gagccgggca aggcgggggc gctgtacgac ggcacgctga ccgtgcccgc cgacggcgag 5760
    taccgcatcg cggtccgtgc caccggtggt tacgccacgg tgcagctcgg cagccacacc 5820
    atcgaggccg gtcaggtcta cggcaaggtg agcagcccgc tcctcaagct gaccaagggc 5880
    acgcacaagc tcacgatctc gggcttcgcg atgagtgcca ccccgctctc cctggagctg 5940
    ggctgggtga cgccggcggc ggccgacgcg acgatcgcga aggccgtgga gtcggcgcgg 6000
    aaggcccgta cggcggtcgt cttcgcctac gacgacggca ccgagggcgt cgaccgtccg 6060
    aacctgtcgc tgccgggtac gcaggacaag ctgatctcgg ctgtcgcgga cgccaacccg 6120
    aacacgatcg tggtcctcaa caccggttcg tcggtgctga tgccgtggct gtccaagacc 6180
    cgcgcggtcc tggacatgtg gtacccgggc caggcgggcg ccgaggccac cgccgcgctg 6240
    ctctacggtg acgtcaaccc gagcggcaag ctcacgcaga gcttcccggc cgccgagaac 6300
    cagcacgcgg tcgccggcga cccgacaagc tacccgggcg tcgacaacca gcagacgtac 6360
    cgcgagggca tccacgtcgg gtaccgctgg ttcgacaagg agaacgtcaa gccgctgttc 6420
    ccgttcgggc acggcctgtc gtacacctcg ttcacgcaga gcgccccgac cgtcgtgcgt 6480
    acgtccacgg gtggtctgaa ggtcacggtc acggtccgca acagcgggaa gcgcgccggc 6540
    caggaggtcg tccaggcgta cctcggtgcc agcccgaacg tgacggctcc gcaggcgaag 6600
    aagaagctcg tgggctacac gaaggtctcg ctcgccgcgg gcgaggcgaa gacggtgacg 6660
    gtgaacgtcg accgccgtca gctgcagacc ggttcgtcct ccgccgacct gcggggcagc 6720
    gccacggtca acgtctggtg acgtgacgcc gtgaaagcgg cggtgcccgc cacccgggag 6780
    ggtggcgggc accgcttttt cggcctgctg ggtctaccgg accacctgac taggcctggt 6840
    cgacccgctc ggcccattcg cgcacggcgt cgatcacccg cagcgcctgc gggcgctcca 6900
    ggtgcgggcc gatcggcagg ctgaggacct gccgcgcgaa gctctcggcc cgcgggagcg 6960
    agccttccgg cggtgcctcg cccgcgtagg cgggcgagag gtgcacgggt accgggtagt 7020
    gcgtgagggt gtcgatgccg cgggcgtcga ggtggctgcg cagctcgtcg cggcgctcgg 7080
    tgcgcacggt gaagaggtgc cagaccgggt cggtgtcggg cgcggtcacc ggcaggccga 7140
    tgccgggcag tccggcgagc ccggagaggt actccgcggc cagcgccgac ctgcggccgt 7200
    tccagctgtc caggtgggcg agccggatcc gcagcacggc ggcctgcatc tcgtccaggc 7260
    gggagttggt gcccttcgtc tcgtggctgt acttctgccg cgagccgtag ttgcggagca 7320
    tccggagccg ttcggcgagc tcggggtcgc cggtgacgac ggcgccgccg tcgccgaagc 7380
    agccgaggtt cttgcccggg tagaagctga acgcggccac cgacgacccg gcgccgatcc 7440
    gccggccccg gtagcgggcg ccgtgggcct gcgcggcgtc ctcgacgatg tgcaggccgt 7500
    gccggtccgc gagctcgcgg agggcgtcca tgtcggcggg gtgcccgtag aggtggacgg 7560
    ggaggagcgc ccgggtgcgg ggggtgatcg ccttctcgac gagcagcggg tccagggtgg 7620
    ggtggtcctc gtgcggctcg acgggcacgg gggtcgcgcc ggtggcggac accgcgagcc 7680
    agctggcgat gtacgtgtgc gaggggacga tcacctcgtc cccgggtccg atgccgaggc 7740
    cgcggagggc gagctggagg gcgtccatcc cgctgttcac gccgacggcg tggtccgtct 7800
    cgcagtacgc ggcgaactcc gcctcgaatc cttcgagttc gggtccgagg aggtagcgcc 7860
    ccgagtcgag gacgcgggcg atcgcggcgt cggtctccgc gcggagctcc tcgtaggcgg 7920
    ccttgaggtc gaggaagggg acgcgggggg tctcggcgcg gctgctcacg cggacacctc 7980
    cacggcggtg gcgggcagct gcggggcggt cgccttgagc ggctcccacc agccgcggtt 8040
    ctcccggtac cagcggacgg tccgcgcgag gccgtccgcg aaggagacct gcgggcggta 8100
    gccgagctcg cgctcgatct cgccgccgtc gagggagtag cgcaggtcgt ggcccttgcg 8160
    gtcggcgacc ttccggaccg aggaccagtc ggcgccgagc gagtccagga ggatgccggt 8220
    gagttcgcgg ttggtcagct ccaggccgcc gccgatgtgg tagatctcgc cggcccggcc 8280
    gcccgcgagg acgagcgcga tgccccggca gtggtcgtcg gtgtgcaccc actcgcggac 8340
    gttcgcgccg tcgccgtaca gcgggagcgt cccgccgtcg aggaggttcg tcacgaagag 8400
    ggggatgagc ttctcggggt gctggtacgg cccgtagttg ttgcagcagc gggtgatccg 8460
    tacgtcgagg ccgtacgtcc ggtggtaggc gcgggcaacg aggtcggagc cggccttgga 8520
    cgccgcgtag ggcgagttgg gctccagcgg gctgctctcg gtccaggagc cggagtcgat 8580
    cgacccgtac acctcgtcgg tggagacgtg cacgacccgg ccgacgccgg cgtcgacggc 8640
    gcactggagc agcgtctgcg tgccctgcac gttggtctcg gtgaacacgg acgcgcccgc 8700
    gatggagcgg tccacgtggc tctcggccgc gaagtggacg atggcgtcca cgccgcgcag 8760
    ttcccgggcg aggaggccgg cgtcgcggat gtcgccgtgg acgaagcgca gtcgcgggtc 8820
    cgcgtccacc ggggcgaggt tggcgcggtt gcccgcgtag gtgaggctgt ccaggacgat 8880
    cacctcatcg gcgggcacgt cggggtacgc cccggcgagg agctgccgca cgaagtgcga 8940
    gccgatgaag cccgcacctc cggtcaccag aagccgcact gccgtcttcc tttcggtcgc 9000
    gctgtaggtc gcggtgtggg tcgcactgtc ggtggcggtg cgggtcgcgg tgtgggtcgc 9060
    actgtcggtg gcgctgtcgg tcgtgggaac gcgtcggccg cgaggtgccc tcacggggct 9120
    ccctcgcggc cggcgatctc catcagatag ctgccgtact cggtgcggga gaggccttct 9180
    cccaggccgt gacaggcctc ggcgtcgatg aagcccatgc ggaaggcgat ctcctcaagg 9240
    cccgcgatcc agacgccctg ccgctcctcc aggacctgga cgtactgggc ggcccgcagg 9300
    agcgagtcgt gggtgccggt gtccagccag gcgaagccgc ggcccaggtt gacgagttcg 9360
    gcccggcccc gctccaggta gacgcggttg acgtcggtga tctccagctc gccgcgcggc 9420
    gagggccgga tgttcttggc gatgtcgacg acgtcgttgt cgtagaggta gaggccggtg 9480
    acggcgaggt tggagcgcgg cttgacgggc ttctcgacga ggtcggtcag ccggcccgtc 9540
    gcgtccacct cggcgacgcc gtaccgctcg gggtccttga ccgggtagcc gaagagcacg 9600
    cagccgtcga ggcgcgcgat gctgtcccgc aggagcgtgt agaggccggg cccgtggaag 9660
    atgttgtcgc ccaggatcag ggcgcaggtg tcgtcgccga tgtgctcggc tccgacgaga 9720
    agtgcgtccg cgattcctgc gggctctttc tggaccgcat agtcgagttc tattcccagg 9780
    tgcctgccgt ttccgagaag cgactggaag agttcgatgt gctggggggt cgagatgatt 9840
    tgaatctcgc gaataccgcc gagcatgaga accgacagcg gatagtagat catcggtttg 9900
    ttgtagaccg gaagaatctg cttcgaaatg accgaggtcg ccggatgcag ccgagttccg 9960
    ctcccgccgg ccaggactat tcccttcatt ctcggaaact agcagcaggg cgccggtgat 10020
    aacggtcggc gtggcgagtt aggggggcgc taggggctgc gcagggggag tgtcaccacc 10080
    cctttggggg gtgggaaaac accgagggcc cggccggacg gccgggccct caggtggggg 10140
    gatcgtgggg gggggatcgg ggggatcggg gcgggtgcgg gtcagcgcag gaagccgcgg 10200
    gcctcctccc agccgtccgc ggcgtcgcgc tccagctggt tcaggcgggc ggtgacgacc 10260
    tgatcgaagc cgtccatgaa gtactcgtcg ccgtcgacgg ccgccacctc gccgccgcgc 10320
    tcgacgaagt ccctgacgac ctcggtgagg gaggtgtcgg gggtcacgcg gcccgcgatg 10380
    tagcgggtcg cgccgtccag gtcggggaag ccggcctcgc ggtacaggta cacgtcgccg 10440
    aggagatcga cctgcaccgc gacctgcggg tgcgcggtgg gccgcatggt ggcgggcttg 10500
    atccgcagca gttcggcgtc ggccccggtg cgcaggctgt tcagggcgta gccgtagtcg 10560
    atgtggagtc cgggggtgcg ctcgcggacc cgctcctcga aggcgttgag ggcctcctgg 10620
    agctcggccc gctcctcctg cggcagcttg ccgtcgtcac ggccgctgta gtcctcgcga 10680
    atgttgacga agtcgatcgt cctgccctgc ccggcgtcgt tgaggtcggc gatgaagtcg 10740
    accaggtcga gcaggcggga ggcacggccc gggagcacga tgtaggcgaa gccgaggttg 10800
    atcggcgact cgcgctcggc gcgcagctgc tggaagcggc gcaggttctc gcggacgcgg 10860
    cggaaggcgg ccttcttgcc ggtggtctgc tcgtactcct cgtcgttgag gccgtagagc 10920
    gaggtgcgga tggcgtgcag gccccagagg ccgggctggc gctccagggt gcgctcggtg 10980
    agcgcgaagg agttcgtgta gacggtgggc cgcaggccgt ggtcggtggc gtgcgcggcc 11040
    aggctcccga ggccggggtt ggtgagcggc tccaggccgc cggagaagta catcgccgag 11100
    gggttgcccg cgggtatctc gtcgatgacc gaccggaaca tggcgttgcc ggcgtcgagg 11160
    gcggacgggt cgtagcgggc gccggtcaca cggacgcaga agtggcagcg gaacatgcag 11220
    gtcgggccgg ggtagaggcc gacgctgtac gggaagacgg gcttcctggc gagcgccgcg 11280
    tcgaagacgc cgcgctgttc gagcgggagc agggtgttct tccagtacgc cccggcgggg 11340
    ccggtctcga ccgcggtgcg gagctccggg acctgcccga acagggcgag gaggcgccgg 11400
    aaggcgtccc ggtcgacgcc caggtcgtgg cgggcctcct ccagcggggt gaaggggctg 11460
    ttgccgtagc gcacggcgag ccggacgagg tggcgggcgg tcgttccggc ctcgtcgggc 11520
    ggcacgaggc cgccggcggc gagggtctgg ccgacggcgt ggaccgccgc ccccagatcg 11580
    gctccggggt gcgcgcagcg ttcggccggg gcggtggcgg aaagggcggg ggcggtcatc 11640
    gggagcgtcc aatcgtgggc gtggatgtct ggggggccgc gagcggggcg ggggccgtgt 11700
    cgcggtggcg cgcggtcagt tcgcggccgc gggtcgcgca gagacgcagc aggtcggcga 11760
    cccggcggat gtcgtcgtcg ccgatggcgg tgccggtcgg cagggacagc acgcgcgcgg 11820
    cgaggcgttc ggtgtgcggc agcggggcgt gcggctgccc gcggtacggc tccagctcgt 11880
    ggcagcccgg cgagaagtag gcgcgggtgt gcacgccttc ggccttcagg acctccatga 11940
    cgaggtcgcg gtggatgccg gtggtggcct cgtcgatctc gacgatcacg tactggtggt 12000
    tgttgaggcc gtggcggtcg tggtcggcga cgaggacgcc ggggaggtcc gcgaggtgct 12060
    cgcggtaggc ggcgtggttg cgccggttcc ggtcgatgac ctcgggaaac gcgtcgaggg 12120
    aggtgaggcc catggcggcg gcggcctcgc tcatcttggc gttggtcccg ccggcggggc 12180
    tgccgccggg caggtcgaag ccgaagttgt ggagggcgcg gatccgggcg gcgaggtcgg 12240
    cgtcgtcggt gacgacggcg ccgccctcga aggcgttgac ggccttggtg gcgtggaagc 12300
    tgaagacctc ggcgtcgccg aggctgccgg cgggccggcc gtcgaccgcg cagccgaggg 12360
    cgtgcgcggc gtcgaagtac agccgcaggc cgtgctcgtc ggcgaccttc cgcagctggt 12420
    cggcggcgca ggggcggccc cagaggtgga cgccgacgac ggccgaggtg cggggtgtga 12480
    ccgcggcggc cacctggtcc gggtcgaggt tgccggtgtc cgggtcgatg tcggcgaaga 12540
    ccggggtgag gccgatccag cgcagtgcgt gcggggtggc ggcgaacgtc atcgacggca 12600
    tgatcacttc gccggtgagg ccggcggcgt gcgcgaggag ctggagcccg gccgtggcgt 12660
    tgcaggtggc cacggcatgc cggaccccgg cgagcccggc gacgcgctcc tcgaactcgc 12720
    ggacgagcgg gccgccgttg gacagccact ggctgtcgag ggcccggtcg agccgctcgt 12780
    acagcctggc gcggtcgatg cggttgggcc gccccacgag gagcggctgg tcgaaagcgg 12840
    cggggccgcc gaagaatgcg aggtcggata aggcgctttt cacggatgtt ccctccgggc 12900
    caccgtcacg aaatgattcg ccgatccggg aatcccgaac gaggtcgccg cgctccaccg 12960
    tgacgtacga cgagatggtc gattgtggtg gtcgatttcg gggggactct aatccgcgcg 13020
    gaacgggacc gacaagagca cgctatgcgc tctcgatgtg cttcggatca catccgcctc 13080
    cggggtattc catcggcggc ccgaatgtga tgatccttga caggatccgg gaatcagccg 13140
    agccgccggg agggccgggg cgcgctccgc ggaagagtac gtgtgagaag tcccgttcct 13200
    cttcccgttt ccgttccgct tccggcccgg tctggagttc tccgtgcgcc gtacccagca 13260
    gggaacgacc gcttctcccc cggtactcga cctcggggcc ctggggcagg atttcgcggc 13320
    cgatccgtat ccgacgtacg cgagactgcg tgccgagggt ccggcccacc gggtgcgcac 13380
    ccccgagggg gacgaggtgt ggctggtcgt cggctacgac cgggcgcggg cggtcctcgc 13440
    cgatccccgg ttcagcaaga ctggcgcaac tccacgactc ccctgaccga agccgaagcc 13500
    gcgctcaacc acaacatgct gagttccgaa cccgccgcgg cacacccggc tgcgccagct 13560
    ggtggcccgt gagttcacca tgcgccggtg cgagttgctg ccgccccggg tcc 13613
    <210> SEQ ID NO 47
    <211> LENGTH: 3782
    <212> TYPE: PRT
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 47
    Met Thr Asp Asp Leu Thr Gly Ala Leu Thr Gln Pro Pro Leu Gly Arg
    1 5 10 15
    Thr Val Arg Ala Val Ala Asp Arg Glu Leu Gly Thr His Leu Leu Glu
    20 25 30
    Thr Arg Gly Ile His Trp Ile His Ala Ala Asn Gly Asp Pro Tyr Ala
    35 40 45
    Thr Val Leu Arg Gly Gln Ala Asp Asp Pro Tyr Pro Ala Tyr Glu Arg
    50 55 60
    Val Arg Ala Arg Gly Ala Leu Ser Phe Ser Pro Thr Gly Ser Trp Val
    65 70 75 80
    Thr Ala Asp His Ala Leu Ala Ala Ser Ile Leu Cys Ser Thr Asp Phe
    85 90 95
    Gly Val Ser Gly Ala Asp Gly Val Pro Val Pro Gln Gln Val Leu Ser
    100 105 110
    Tyr Gly Glu Gly Cys Pro Leu Glu Arg Glu Gln Val Leu Pro Ala Ala
    115 120 125
    Gly Asp Val Pro Glu Gly Gly Gln Arg Ala Val Val Glu Gly Ile His
    130 135 140
    Arg Glu Thr Leu Glu Gly Leu Ala Pro Asp Pro Ser Ala Ser Tyr Ala
    145 150 155 160
    Phe Glu Leu Leu Gly Gly Phe Val Arg Pro Ala Val Thr Ala Ala Ala
    165 170 175
    Ala Ala Val Leu Gly Val Pro Ala Asp Arg Arg Ala Asp Phe Ala Asp
    180 185 190
    Leu Leu Glu Arg Leu Arg Pro Leu Ser Asp Ser Leu Leu Ala Pro Gln
    195 200 205
    Ser Leu Arg Thr Val Arg Ala Ala Asp Gly Ala Leu Ala Glu Leu Thr
    210 215 220
    Ala Leu Leu Ala Asp Ser Asp Asp Ser Pro Gly Ala Leu Leu Ser Ala
    225 230 235 240
    Leu Gly Val Thr Ala Ala Val Gln Leu Thr Gly Asn Ala Val Leu Ala
    245 250 255
    Leu Leu Ala His Pro Glu Gln Trp Arg Glu Leu Cys Asp Arg Pro Gly
    260 265 270
    Leu Ala Ala Ala Ala Val Glu Glu Thr Leu Arg Tyr Asp Pro Pro Val
    275 280 285
    Gln Leu Asp Ala Arg Val Val Arg Gly Glu Thr Glu Leu Ala Gly Arg
    290 295 300
    Arg Leu Pro Ala Gly Ala His Val Val Val Leu Thr Ala Ala Thr Gly
    305 310 315 320
    Arg Asp Pro Glu Val Phe Thr Asp Pro Glu Arg Phe Asp Leu Ala Arg
    325 330 335
    Pro Asp Ala Ala Ala His Leu Ala Leu His Pro Ala Gly Pro Tyr Gly
    340 345 350
    Pro Val Ala Ser Leu Val Arg Leu Gln Ala Glu Val Ala Leu Arg Thr
    355 360 365
    Leu Ala Gly Arg Phe Pro Gly Leu Arg Gln Ala Gly Asp Val Leu Arg
    370 375 380
    Pro Arg Arg Ala Pro Val Gly Arg Gly Pro Leu Ser Val Pro Val Ser
    385 390 395 400
    Ser Ser Met Arg Val Leu Leu Thr Ser Phe Ala His His Thr His Tyr
    405 410 415
    Tyr Gly Leu Val Pro Leu Ala Trp Ala Leu Leu Ala Ala Gly His Glu
    420 425 430
    Val Arg Val Ala Ser Gln Pro Ala Leu Thr Asp Thr Ile Thr Gly Ser
    435 440 445
    Gly Leu Ala Ala Val Pro Val Gly Thr Asp His Leu Ile His Glu Tyr
    450 455 460
    Arg Val Arg Met Ala Gly Glu Pro Arg Pro Asn His Pro Ala Ile Ala
    465 470 475 480
    Phe Asp Glu Ala Arg Pro Glu Pro Leu Asp Trp Asp His Ala Leu Gly
    485 490 495
    Ile Glu Ala Ile Leu Ala Pro Tyr Phe His Leu Leu Ala Asn Asn Asp
    500 505 510
    Ser Met Val Asp Asp Leu Val Asp Phe Ala Arg Ser Trp Gln Pro Asp
    515 520 525
    Leu Val Leu Trp Glu Pro Thr Thr Tyr Ala Gly Ala Val Ala Ala Gln
    530 535 540
    Val Thr Gly Ala Ala His Ala Arg Val Leu Trp Gly Pro Asp Val Met
    545 550 555 560
    Gly Ser Ala Arg Arg Lys Phe Val Ala Leu Arg Asp Arg Gln Pro Pro
    565 570 575
    Glu His Arg Glu Asp Pro Thr Ala Glu Trp Leu Thr Trp Thr Leu Asp
    580 585 590
    Arg Tyr Gly Ala Ser Phe Glu Glu Glu Leu Leu Thr Gly Gln Phe Thr
    595 600 605
    Ile Asp Pro Thr Pro Pro Ser Leu Arg Leu Asp Thr Gly Leu Pro Thr
    610 615 620
    Val Gly Met Arg Tyr Val Pro Tyr Asn Gly Thr Ser Val Val Pro Asp
    625 630 635 640
    Trp Leu Ser Glu Pro Pro Ala Arg Pro Arg Val Cys Leu Thr Leu Gly
    645 650 655
    Val Ser Ala Arg Glu Val Leu Gly Gly Asp Gly Val Ser Gln Gly Asp
    660 665 670
    Ile Leu Glu Ala Leu Ala Asp Leu Asp Ile Glu Leu Val Ala Thr Leu
    675 680 685
    Asp Ala Ser Gln Arg Ala Glu Ile Arg Asn Tyr Pro Lys His Thr Arg
    690 695 700
    Phe Thr Asp Phe Val Pro Met His Ala Leu Leu Pro Ser Cys Ser Ala
    705 710 715 720
    Ile Ile His His Gly Gly Ala Gly Thr Tyr Ala Thr Ala Val Ile Asn
    725 730 735
    Ala Val Pro Gln Val Met Leu Ala Glu Leu Trp Asp Ala Pro Val Lys
    740 745 750
    Ala Arg Ala Val Ala Glu Gln Gly Ala Gly Phe Phe Leu Pro Pro Ala
    755 760 765
    Glu Leu Thr Pro Gln Ala Val Arg Asp Ala Val Val Arg Ile Leu Asp
    770 775 780
    Asp Pro Ser Val Ala Thr Ala Ala His Arg Leu Arg Glu Glu Thr Phe
    785 790 795 800
    Gly Asp Pro Thr Pro Ala Gly Ile Val Pro Glu Leu Glu Arg Leu Ala
    805 810 815
    Ala Gln His Arg Arg Pro Pro Ala Asp Ala Arg His Met Tyr Glu Val
    820 825 830
    Asp His Ala Asp Val Tyr Asp Leu Phe Tyr Leu Gly Arg Gly Lys Asp
    835 840 845
    Tyr Ala Ala Glu Ala Ser Asp Ile Ala Asp Leu Val Arg Ser Arg Thr
    850 855 860
    Pro Glu Ala Ser Ser Leu Leu Asp Val Ala Cys Gly Thr Gly Thr His
    865 870 875 880
    Leu Glu His Phe Thr Lys Glu Phe Gly Asp Thr Ala Gly Leu Glu Leu
    885 890 895
    Ser Glu Asp Met Leu Thr His Ala Arg Lys Arg Leu Pro Asp Ala Thr
    900 905 910
    Leu His Gln Gly Asp Met Arg Asp Phe Arg Leu Gly Arg Lys Phe Ser
    915 920 925
    Ala Val Val Ser Met Phe Ser Ser Val Gly Tyr Leu Lys Thr Thr Glu
    930 935 940
    Glu Leu Gly Ala Ala Val Ala Ser Phe Ala Glu His Leu Glu Pro Gly
    945 950 955 960
    Gly Val Val Val Val Glu Pro Trp Trp Phe Pro Glu Thr Phe Ala Asp
    965 970 975
    Gly Trp Val Ser Ala Asp Val Val Arg Arg Asp Gly Arg Thr Val Ala
    980 985 990
    Arg Val Ser His Ser Val Arg Glu Gly Asn Ala Thr Arg Met Glu Val
    995 1000 1005
    His Phe Thr Val Ala Asp Pro Gly Lys Gly Val Arg His Phe Ser Asp
    1010 1015 1020
    Val His Leu Ile Thr Leu Phe His Gln Ala Glu Tyr Glu Ala Ala Phe
    1025 1030 1035 1040
    Thr Ala Ala Gly Leu Arg Val Glu Tyr Leu Glu Gly Gly Pro Ser Gly
    1045 1050 1055
    Arg Gly Leu Phe Val Gly Val Pro Ala Met Thr Gly Lys Thr Arg Ile
    1060 1065 1070
    Pro Arg Val Arg Arg Gly Arg Thr Thr Pro Arg Ala Phe Thr Leu Ala
    1075 1080 1085
    Val Val Gly Thr Leu Leu Ala Gly Thr Thr Val Ala Ala Ala Ala Pro
    1090 1095 1100
    Gly Ala Ala Asp Thr Ala Asn Val Gln Tyr Thr Ser Arg Ala Ala Glu
    1105 1110 1115 1120
    Leu Val Ala Gln Met Thr Leu Asp Glu Lys Ile Ser Phe Val His Trp
    1125 1130 1135
    Ala Leu Asp Pro Asp Arg Gln Asn Val Gly Tyr Leu Pro Gly Val Pro
    1140 1145 1150
    Arg Leu Gly Ile Pro Glu Leu Arg Ala Ala Asp Gly Pro Asn Gly Ile
    1155 1160 1165
    Arg Leu Val Gly Gln Thr Ala Thr Ala Leu Pro Ala Pro Val Ala Leu
    1170 1175 1180
    Ala Ser Thr Phe Asp Asp Thr Met Ala Asp Ser Tyr Gly Lys Val Met
    1185 1190 1195 1200
    Gly Arg Asp Gly Arg Ala Leu Asn Gln Asp Met Val Leu Gly Pro Met
    1205 1210 1215
    Met Asn Asn Ile Arg Val Pro His Gly Gly Arg Asn Tyr Glu Thr Phe
    1220 1225 1230
    Ser Glu Asp Pro Leu Val Ser Ser Arg Thr Ala Val Ala Gln Ile Lys
    1235 1240 1245
    Gly Ile Gln Gly Ala Gly Leu Met Thr Thr Ala Lys His Phe Ala Ala
    1250 1255 1260
    Asn Asn Gln Glu Asn Asn Arg Phe Ser Val Asn Ala Asn Val Asp Glu
    1265 1270 1275 1280
    Gln Thr Leu Arg Glu Ile Glu Phe Pro Ala Phe Glu Ala Ser Ser Lys
    1285 1290 1295
    Ala Gly Ala Ala Ser Phe Met Cys Ala Tyr Asn Gly Leu Asn Gly Lys
    1300 1305 1310
    Pro Ser Cys Gly Asn Asp Glu Leu Leu Asn Asn Val Leu Arg Thr Gln
    1315 1320 1325
    Trp Gly Phe Gln Gly Trp Val Met Ser Asp Trp Leu Ala Thr Pro Gly
    1330 1335 1340
    Thr Asp Ala Ile Thr Lys Gly Leu Asp Gln Glu Met Gly Val Glu Leu
    1345 1350 1355 1360
    Pro Gly Asp Val Pro Lys Gly Glu Pro Ser Pro Pro Ala Lys Phe Phe
    1365 1370 1375
    Gly Glu Ala Leu Lys Thr Ala Val Leu Asn Gly Thr Val Pro Glu Ala
    1380 1385 1390
    Ala Val Thr Arg Ser Ala Glu Arg Ile Val Gly Gln Met Glu Lys Phe
    1395 1400 1405
    Gly Leu Leu Leu Ala Thr Pro Ala Pro Arg Pro Glu Arg Asp Lys Ala
    1410 1415 1420
    Gly Ala Gln Ala Val Ser Arg Lys Val Ala Glu Asn Gly Ala Val Leu
    1425 1430 1435 1440
    Leu Arg Asn Glu Gly Gln Ala Leu Pro Leu Ala Gly Asp Ala Gly Lys
    1445 1450 1455
    Ser Ile Ala Val Ile Gly Pro Thr Ala Val Asp Pro Lys Val Thr Gly
    1460 1465 1470
    Leu Gly Ser Ala His Val Val Pro Asp Ser Ala Ala Ala Pro Leu Asp
    1475 1480 1485
    Thr Ile Lys Ala Arg Ala Gly Ala Gly Ala Thr Val Thr Tyr Glu Thr
    1490 1495 1500
    Gly Glu Glu Thr Phe Gly Thr Gln Ile Pro Ala Gly Asn Leu Ser Pro
    1505 1510 1515 1520
    Ala Phe Asn Gln Gly His Gln Leu Glu Pro Gly Lys Ala Gly Ala Leu
    1525 1530 1535
    Tyr Asp Gly Thr Leu Thr Val Pro Ala Asp Gly Glu Tyr Arg Ile Ala
    1540 1545 1550
    Val Arg Ala Thr Gly Gly Tyr Ala Thr Val Gln Leu Gly Ser His Thr
    1555 1560 1565
    Ile Glu Ala Gly Gln Val Tyr Gly Lys Val Ser Ser Pro Leu Leu Lys
    1570 1575 1580
    Leu Thr Lys Gly Thr His Lys Leu Thr Ile Ser Gly Phe Ala Met Ser
    1585 1590 1595 1600
    Ala Thr Pro Leu Ser Leu Glu Leu Gly Trp Val Thr Pro Ala Ala Ala
    1605 1610 1615
    Asp Ala Thr Ile Ala Lys Ala Val Glu Ser Ala Arg Lys Ala Arg Thr
    1620 1625 1630
    Ala Val Val Phe Ala Tyr Asp Asp Gly Thr Glu Gly Val Asp Arg Pro
    1635 1640 1645
    Asn Leu Ser Leu Pro Gly Thr Gln Asp Lys Leu Ile Ser Ala Val Ala
    1650 1655 1660
    Asp Ala Asn Pro Asn Thr Ile Val Val Leu Asn Thr Gly Ser Ser Val
    1665 1670 1675 1680
    Leu Met Pro Trp Leu Ser Lys Thr Arg Ala Val Leu Asp Met Trp Tyr
    1685 1690 1695
    Pro Gly Gln Ala Gly Ala Glu Ala Thr Ala Ala Leu Leu Tyr Gly Asp
    1700 1705 1710
    Val Asn Pro Ser Gly Lys Leu Thr Gln Ser Phe Pro Ala Ala Glu Asn
    1715 1720 1725
    Gln His Ala Val Ala Gly Asp Pro Thr Ser Tyr Pro Gly Val Asp Asn
    1730 1735 1740
    Gln Gln Thr Tyr Arg Glu Gly Ile His Val Gly Tyr Arg Trp Phe Asp
    1745 1750 1755 1760
    Lys Glu Asn Val Lys Pro Leu Phe Pro Phe Gly His Gly Leu Ser Tyr
    1765 1770 1775
    Thr Ser Phe Thr Gln Ser Ala Pro Thr Val Val Arg Thr Ser Thr Gly
    1780 1785 1790
    Gly Leu Lys Val Thr Val Thr Val Arg Asn Ser Gly Lys Arg Ala Gly
    1795 1800 1805
    Gln Glu Val Val Gln Ala Tyr Leu Gly Ala Ser Pro Asn Val Thr Ala
    1810 1815 1820
    Pro Gln Ala Lys Lys Lys Leu Val Gly Tyr Thr Lys Val Ser Leu Ala
    1825 1830 1835 1840
    Ala Gly Glu Ala Lys Thr Val Thr Val Asn Val Asp Arg Arg Gln Leu
    1845 1850 1855
    Gln Thr Gly Ser Ser Ser Ala Asp Leu Arg Gly Ser Ala Thr Val Asn
    1860 1865 1870
    Val Trp Met Ser Ser Arg Ala Glu Thr Pro Arg Val Pro Phe Leu Asp
    1875 1880 1885
    Leu Lys Ala Ala Tyr Glu Glu Leu Arg Ala Glu Thr Asp Ala Ala Ile
    1890 1895 1900
    Ala Arg Val Leu Asp Ser Gly Arg Tyr Leu Leu Gly Pro Glu Leu Glu
    1905 1910 1915 1920
    Gly Phe Glu Ala Glu Phe Ala Ala Tyr Cys Glu Thr Asp His Ala Val
    1925 1930 1935
    Gly Val Asn Ser Gly Met Asp Ala Leu Gln Leu Ala Leu Arg Gly Leu
    1940 1945 1950
    Gly Ile Gly Pro Gly Asp Glu Val Ile Val Pro Ser His Thr Tyr Ile
    1955 1960 1965
    Ala Ser Trp Leu Ala Val Ser Ala Thr Gly Ala Thr Pro Val Pro Val
    1970 1975 1980
    Glu Pro His Glu Asp His Pro Thr Leu Asp Pro Leu Leu Val Glu Lys
    1985 1990 1995 2000
    Ala Ile Thr Pro Arg Thr Arg Ala Leu Leu Pro Val His Leu Tyr Gly
    2005 2010 2015
    His Pro Ala Asp Met Asp Ala Leu Arg Glu Leu Ala Asp Arg His Gly
    2020 2025 2030
    Leu His Ile Val Glu Asp Ala Ala Gln Ala His Gly Ala Arg Tyr Arg
    2035 2040 2045
    Gly Arg Arg Ile Gly Ala Gly Ser Ser Val Ala Ala Phe Ser Phe Tyr
    2050 2055 2060
    Pro Gly Lys Asn Leu Gly Cys Phe Gly Asp Gly Gly Ala Val Val Thr
    2065 2070 2075 2080
    Gly Asp Pro Glu Leu Ala Glu Arg Leu Arg Met Leu Arg Asn Tyr Gly
    2085 2090 2095
    Ser Arg Gln Lys Tyr Ser His Glu Thr Lys Gly Thr Asn Ser Arg Leu
    2100 2105 2110
    Asp Glu Met Gln Ala Ala Val Leu Arg Ile Arg Leu Ala His Leu Asp
    2115 2120 2125
    Ser Trp Asn Gly Arg Arg Ser Ala Leu Ala Ala Glu Tyr Leu Ser Gly
    2130 2135 2140
    Leu Ala Gly Leu Pro Gly Ile Gly Leu Pro Val Thr Ala Pro Asp Thr
    2145 2150 2155 2160
    Asp Pro Val Trp His Leu Phe Thr Val Arg Thr Glu Arg Arg Asp Glu
    2165 2170 2175
    Leu Arg Ser His Leu Asp Ala Arg Gly Ile Asp Thr Leu Thr His Tyr
    2180 2185 2190
    Pro Val Pro Val His Leu Ser Pro Ala Tyr Ala Gly Glu Ala Pro Pro
    2195 2200 2205
    Glu Gly Ser Leu Pro Arg Ala Glu Ser Phe Ala Arg Gln Val Leu Ser
    2210 2215 2220
    Leu Pro Ile Gly Pro His Leu Glu Arg Pro Gln Ala Leu Arg Val Ile
    2225 2230 2235 2240
    Asp Ala Val Arg Glu Trp Ala Glu Arg Val Asp Gln Ala Met Arg Leu
    2245 2250 2255
    Leu Val Thr Gly Gly Ala Gly Phe Ile Gly Ser His Phe Val Arg Gln
    2260 2265 2270
    Leu Leu Ala Gly Ala Tyr Pro Asp Val Pro Ala Asp Glu Val Ile Val
    2275 2280 2285
    Leu Asp Ser Leu Thr Tyr Ala Gly Asn Arg Ala Asn Leu Ala Pro Val
    2290 2295 2300
    Asp Ala Asp Pro Arg Leu Arg Phe Val His Gly Asp Ile Arg Asp Ala
    2305 2310 2315 2320
    Gly Leu Leu Ala Arg Glu Leu Arg Gly Val Asp Ala Ile Val His Phe
    2325 2330 2335
    Ala Ala Glu Ser His Val Asp Arg Ser Ile Ala Gly Ala Ser Val Phe
    2340 2345 2350
    Thr Glu Thr Asn Val Gln Gly Thr Gln Thr Leu Leu Gln Cys Ala Val
    2355 2360 2365
    Asp Ala Gly Val Gly Arg Val Val His Val Ser Thr Asp Glu Val Tyr
    2370 2375 2380
    Gly Ser Ile Asp Ser Gly Ser Trp Thr Glu Ser Ser Pro Leu Glu Pro
    2385 2390 2395 2400
    Asn Ser Pro Tyr Ala Ala Ser Lys Ala Gly Ser Asp Leu Val Ala Arg
    2405 2410 2415
    Ala Tyr His Arg Thr Tyr Gly Leu Asp Val Arg Ile Thr Arg Cys Cys
    2420 2425 2430
    Asn Asn Tyr Gly Pro Tyr Gln His Pro Glu Lys Leu Ile Pro Leu Phe
    2435 2440 2445
    Val Thr Asn Leu Leu Asp Gly Gly Thr Leu Pro Leu Tyr Gly Asp Gly
    2450 2455 2460
    Ala Asn Val Arg Glu Trp Val His Thr Asp Asp His Cys Arg Gly Ile
    2465 2470 2475 2480
    Ala Leu Val Leu Ala Gly Gly Arg Ala Gly Glu Ile Tyr His Ile Gly
    2485 2490 2495
    Gly Gly Leu Glu Leu Thr Asn Arg Glu Leu Thr Gly Ile Leu Leu Asp
    2500 2505 2510
    Ser Leu Gly Ala Asp Trp Ser Ser Val Arg Lys Val Ala Asp Arg Lys
    2515 2520 2525
    Gly His Asp Leu Arg Tyr Ser Leu Asp Gly Gly Glu Ile Glu Arg Glu
    2530 2535 2540
    Leu Gly Tyr Arg Pro Gln Val Ser Phe Ala Asp Gly Leu Ala Arg Thr
    2545 2550 2555 2560
    Val Arg Trp Tyr Arg Glu Asn Arg Gly Trp Trp Glu Pro Leu Lys Ala
    2565 2570 2575
    Thr Ala Pro Gln Leu Pro Ala Thr Ala Val Glu Val Ser Ala Met Lys
    2580 2585 2590
    Gly Ile Val Leu Ala Gly Gly Ser Gly Thr Arg Leu His Pro Ala Thr
    2595 2600 2605
    Ser Val Ile Ser Lys Gln Ile Leu Pro Val Tyr Asn Lys Pro Met Ile
    2610 2615 2620
    Tyr Tyr Pro Leu Ser Val Leu Met Leu Gly Gly Ile Arg Glu Ile Gln
    2625 2630 2635 2640
    Ile Ile Ser Thr Pro Gln His Ile Glu Leu Phe Gln Ser Leu Leu Gly
    2645 2650 2655
    Asn Gly Arg His Leu Gly Ile Glu Leu Asp Tyr Ala Val Gln Lys Glu
    2660 2665 2670
    Pro Ala Gly Ile Ala Asp Ala Leu Leu Val Gly Ala Glu His Ile Gly
    2675 2680 2685
    Asp Asp Thr Cys Ala Leu Ile Leu Gly Asp Asn Ile Phe His Gly Pro
    2690 2695 2700
    Gly Leu Tyr Thr Leu Leu Arg Asp Ser Ile Ala Arg Leu Asp Gly Cys
    2705 2710 2715 2720
    Val Leu Phe Gly Tyr Pro Val Lys Asp Pro Glu Arg Tyr Gly Val Ala
    2725 2730 2735
    Glu Val Asp Ala Thr Gly Arg Leu Thr Asp Leu Val Glu Lys Pro Val
    2740 2745 2750
    Lys Pro Arg Ser Asn Leu Ala Val Thr Gly Leu Tyr Leu Tyr Asp Asn
    2755 2760 2765
    Asp Val Val Asp Ile Ala Lys Asn Ile Arg Pro Ser Pro Arg Gly Glu
    2770 2775 2780
    Leu Glu Ile Thr Asp Val Asn Arg Val Tyr Leu Glu Arg Gly Arg Ala
    2785 2790 2795 2800
    Glu Leu Val Asn Leu Gly Arg Gly Phe Ala Trp Leu Asp Thr Gly Thr
    2805 2810 2815
    His Asp Ser Leu Leu Arg Ala Ala Gln Tyr Val Gln Val Leu Glu Glu
    2820 2825 2830
    Arg Gln Gly Val Trp Ile Ala Gly Leu Glu Glu Ile Ala Phe Arg Met
    2835 2840 2845
    Gly Phe Ile Asp Ala Glu Ala Cys His Gly Leu Gly Glu Gly Leu Ser
    2850 2855 2860
    Arg Thr Glu Tyr Gly Ser Tyr Leu Met Glu Ile Ala Gly Arg Glu Gly
    2865 2870 2875 2880
    Ala Pro Met Thr Ala Pro Ala Leu Ser Ala Thr Ala Pro Ala Glu Arg
    2885 2890 2895
    Cys Ala His Pro Gly Ala Asp Leu Gly Ala Ala Val His Ala Val Gly
    2900 2905 2910
    Gln Thr Leu Ala Ala Gly Gly Leu Val Pro Pro Asp Glu Ala Gly Thr
    2915 2920 2925
    Thr Ala Arg His Leu Val Arg Leu Ala Val Arg Tyr Gly Asn Ser Pro
    2930 2935 2940
    Phe Thr Pro Leu Glu Glu Ala Arg His Asp Leu Gly Val Asp Arg Asp
    2945 2950 2955 2960
    Ala Phe Arg Arg Leu Leu Ala Leu Phe Gly Gln Val Pro Glu Leu Arg
    2965 2970 2975
    Thr Ala Val Glu Thr Gly Pro Ala Gly Ala Tyr Trp Lys Asn Thr Leu
    2980 2985 2990
    Leu Pro Leu Glu Gln Arg Gly Val Phe Asp Ala Ala Leu Ala Arg Lys
    2995 3000 3005
    Pro Val Phe Pro Tyr Ser Val Gly Leu Tyr Pro Gly Pro Thr Cys Met
    3010 3015 3020
    Phe Arg Cys His Phe Cys Val Arg Val Thr Gly Ala Arg Tyr Asp Pro
    3025 3030 3035 3040
    Ser Ala Leu Asp Ala Gly Asn Ala Met Phe Arg Ser Val Ile Asp Glu
    3045 3050 3055
    Ile Pro Ala Gly Asn Pro Ser Ala Met Tyr Phe Ser Gly Gly Leu Glu
    3060 3065 3070
    Pro Leu Thr Asn Pro Gly Leu Gly Ser Leu Ala Ala His Ala Thr Asp
    3075 3080 3085
    His Gly Leu Arg Pro Thr Val Tyr Thr Asn Ser Phe Ala Leu Thr Glu
    3090 3095 3100
    Arg Thr Leu Glu Arg Gln Pro Gly Leu Trp Gly Leu His Ala Ile Arg
    3105 3110 3115 3120
    Thr Ser Leu Tyr Gly Leu Asn Asp Glu Glu Tyr Glu Gln Thr Thr Gly
    3125 3130 3135
    Lys Lys Ala Ala Phe Arg Arg Val Arg Glu Asn Leu Arg Arg Phe Gln
    3140 3145 3150
    Gln Leu Arg Ala Glu Arg Glu Ser Pro Ile Asn Leu Gly Phe Ala Tyr
    3155 3160 3165
    Ile Val Leu Pro Gly Arg Ala Ser Arg Leu Leu Asp Leu Val Asp Phe
    3170 3175 3180
    Ile Ala Asp Leu Asn Asp Ala Gly Gln Gly Arg Thr Ile Asp Phe Val
    3185 3190 3195 3200
    Asn Ile Arg Glu Asp Tyr Ser Gly Arg Asp Asp Gly Lys Leu Pro Gln
    3205 3210 3215
    Glu Glu Arg Ala Glu Leu Gln Glu Ala Leu Asn Ala Phe Glu Glu Arg
    3220 3225 3230
    Val Arg Glu Arg Thr Pro Gly Leu His Ile Asp Tyr Gly Tyr Ala Leu
    3235 3240 3245
    Asn Ser Leu Arg Thr Gly Ala Asp Ala Glu Leu Leu Arg Ile Lys Pro
    3250 3255 3260
    Ala Thr Met Arg Pro Thr Ala His Pro Gln Val Ala Val Gln Val Asp
    3265 3270 3275 3280
    Leu Leu Gly Asp Val Tyr Leu Tyr Arg Glu Ala Gly Phe Pro Asp Leu
    3285 3290 3295
    Asp Gly Ala Thr Arg Tyr Ile Ala Gly Arg Val Thr Pro Asp Thr Ser
    3300 3305 3310
    Leu Thr Glu Val Val Arg Asp Phe Val Glu Arg Gly Gly Glu Val Ala
    3315 3320 3325
    Ala Val Asp Gly Asp Glu Tyr Phe Met Asp Gly Phe Asp Gln Val Val
    3330 3335 3340
    Thr Ala Arg Leu Asn Gln Leu Glu Arg Asp Ala Ala Asp Gly Trp Glu
    3345 3350 3355 3360
    Glu Ala Arg Gly Phe Leu Arg Met Lys Ser Ala Leu Ser Asp Leu Ala
    3365 3370 3375
    Phe Phe Gly Gly Pro Ala Ala Phe Asp Gln Pro Leu Leu Val Gly Arg
    3380 3385 3390
    Pro Asn Arg Ile Asp Arg Ala Arg Leu Tyr Glu Arg Leu Asp Arg Ala
    3395 3400 3405
    Leu Asp Ser Gln Trp Leu Ser Asn Gly Gly Pro Leu Val Arg Glu Phe
    3410 3415 3420
    Glu Glu Arg Val Ala Gly Leu Ala Gly Val Arg His Ala Val Ala Thr
    3425 3430 3435 3440
    Cys Asn Ala Thr Ala Gly Leu Gln Leu Leu Ala His Ala Ala Gly Leu
    3445 3450 3455
    Thr Gly Glu Val Ile Met Pro Ser Met Thr Phe Ala Ala Thr Pro His
    3460 3465 3470
    Ala Leu Arg Trp Ile Gly Leu Thr Pro Val Phe Ala Asp Ile Asp Pro
    3475 3480 3485
    Asp Thr Gly Asn Leu Asp Pro Asp Gln Val Ala Ala Ala Val Thr Pro
    3490 3495 3500
    Arg Thr Ser Ala Val Val Gly Val His Leu Trp Gly Arg Pro Cys Ala
    3505 3510 3515 3520
    Ala Asp Gln Leu Arg Lys Val Ala Asp Glu His Gly Leu Arg Leu Tyr
    3525 3530 3535
    Phe Asp Ala Ala His Ala Leu Gly Cys Ala Val Asp Gly Arg Pro Ala
    3540 3545 3550
    Gly Ser Leu Gly Asp Ala Glu Val Phe Ser Phe His Ala Thr Lys Ala
    3555 3560 3565
    Val Asn Ala Phe Glu Gly Gly Ala Val Val Thr Asp Asp Ala Asp Leu
    3570 3575 3580
    Ala Ala Arg Ile Arg Ala Leu His Asn Phe Gly Phe Asp Leu Pro Gly
    3585 3590 3595 3600
    Gly Ser Pro Ala Gly Gly Thr Asn Ala Lys Met Ser Glu Ala Ala Ala
    3605 3610 3615
    Ala Met Gly Leu Thr Ser Leu Asp Ala Phe Pro Glu Val Ile Asp Arg
    3620 3625 3630
    Asn Arg Arg Asn His Ala Ala Tyr Arg Glu His Leu Ala Asp Leu Pro
    3635 3640 3645
    Gly Val Leu Val Ala Asp His Asp Arg His Gly Leu Asn Asn His Gln
    3650 3655 3660
    Tyr Val Ile Val Glu Ile Asp Glu Ala Thr Thr Gly Ile His Arg Asp
    3665 3670 3675 3680
    Leu Val Met Glu Val Leu Lys Ala Glu Gly Val His Thr Arg Ala Tyr
    3685 3690 3695
    Phe Ser Pro Gly Cys His Glu Leu Glu Pro Tyr Arg Gly Gln Pro His
    3700 3705 3710
    Ala Pro Leu Pro His Thr Glu Arg Leu Ala Ala Arg Val Leu Ser Leu
    3715 3720 3725
    Pro Thr Gly Thr Ala Ile Gly Asp Asp Asp Ile Arg Arg Val Ala Asp
    3730 3735 3740
    Leu Leu Arg Leu Cys Ala Thr Arg Gly Arg Glu Leu Thr Ala Arg His
    3745 3750 3755 3760
    Arg Asp Thr Ala Pro Ala Pro Leu Ala Ala Pro Gln Thr Ser Thr Pro
    3765 3770 3775
    Thr Ile Gly Arg Ser Arg
    3780
    <210> SEQ ID NO 48
    <211> LENGTH: 36778
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 48
    ggatccgacc gtgggtgtga atctccgggt gctcgcctcg tcctgccccg ttacctgtcc 60
    gcctcccgct ccagaccagc gggaggcgga caggggcatg cccgccgggc ggctaacggc 120
    ccgtgcggcg tccgtacgac gagcctcgcg cgccctggcg gcccttggtc tgccggacct 180
    gtgcgcgggg tgcgcagggt tcgccgccgc gcgtggggcc gtatctgcgg ctcccgggca 240
    cggcggccct gctcgtctcc gagtcatagt ccctgccgcc ggcgccaccg ccctggcccg 300
    gcatgcgcgt gccgggcgcc cccggcgcgt aactcggctg ggaggcctgg aaaagggcga 360
    tccattgggt gagcgtgagg tccttcggca gtccgccgtc cggaattccg tggcggtcgg 420
    cgagggaacg gtaggtccgc ttggggatgt ggcgccggag gatctccgcg aggccccgtc 480
    cggggccggt gaagacggct tcggcgaagt tctggaaggc gcggctcgcg ctctcgggca 540
    gcaggggctg ggggcgtcgc ctgatcgtca ggacgccgcc gtcgacgcgg ggcatcggac 600
    ggaacgacga ggcgcggacg cggtcgtgga ccgcgaactc gtaccagggg gcccaggagg 660
    tcgtgaggag cgatccgccg ctgcgaccgg cgcgtttgcg ggcgacctcc cactgcacta 720
    tcagggccgc cgactgccag ttcgtcgatt ccaggagact ccggagaatc tgggtcgtga 780
    tgccgaaggg aacgtttccg acgacggtgt cgatatcgcg cggaatgcgg aagtcgagga 840
    aatcaccctg gaatacggtg accctctccc cttcgaattt ccgccgcaca tgcgcggccc 900
    agtgcgggtc catctccacg accgtcacgg tgtcgaagga gcgcaccaac tcctcggtta 960
    tcgcgccctt tccggggccg atttcgagaa cgttcctacc gtccccctcg acatgcgtga 1020
    cgagattgcg cacggctctg tcgtcctgaa ggaagttctg gcctaattcg cggcgaaggg 1080
    tgtcgcggtc cgctcgcctc ggtatggagt cgcgcattgc catgaacgat cccctccctg 1140
    gatgccgtgg tcaatggact tggcacggac catacctcac ggtccgtcgg acgaccggag 1200
    aagaagttca cgcacgggcg ttccggagta cgggagttgt gaacggccgc gacgaagtcg 1260
    gtcgcggctc ggcgggcggt gacgagcgag gtccggagga acgcgacgaa gcagccgaac 1320
    cccaagtgag gtgcgacgga gtgacattgg gggcatacgg agggttgtcg tacggagcgc 1380
    actcaacgag gctccaggag ggaggggttg aacccgccgc cgactggcct tcgccgcccg 1440
    cgcggccgga gtatgtcatg tcgggggtga aatcaagcca ttcccccggg atcggctgtt 1500
    acccatccct ttacctggcg tggatttccc aacccttggt atagagcggg agacgacgcg 1560
    acaccatgga gaccacgcac accacgagcg ccaccccccg gccatcccga caaggggggt 1620
    ccggctcgcc tcccgacacc catggcctgg ggtacacgcc aggtataggg ggaacgtagg 1680
    gggagcatag ggggggtgcc ctggggttgg gtgaaagcgc ggcttccgga gacggagccg 1740
    gatgtcttca gccggaatta ccaggaccgg tgcgagaaca ccggtgacag ggcgtggggc 1800
    ggcagcgtgg gacacggggg aagtgcgggt ccgacggggg ttgccccctg ccggccccga 1860
    tcatgcggag cactccttct ctcgtgctcc taccggtgat gtgcgcgccg aattgattcg 1920
    tggagagatg tcgacagtgt ccaagagtga gtccgaggaa ttcgtgtccg tgtcgaacga 1980
    cgccggttcc gcgcacggca cagcggaacc cgtcgccgtc gtcggcatct cctgccgggt 2040
    gcccggcgcc cgggacccga gagagttctg ggaactcctg gcggcaggcg gccaggccgt 2100
    caccgacgtc cccgcggacc gctggaacgc cggcgacttc tacgacccgg accgctccgc 2160
    ccccggccgc tcgaacagcc ggtggggcgg gttcatcgag gacgtcgacc ggttcgacgc 2220
    cgccttcttc ggcatctcgc cccgcgaggc cgcggagatg gacccgcagc agcggctcgc 2280
    cctggagctg ggctgggagg ccctggagcg cgccgggatc gacccgtcct cgctcaccgg 2340
    cacccgcacc ggcgtcttcg ccggcgccat ctgggacgac tacgccaccc tgaagcaccg 2400
    ccagggcggc gccgcgatca ccccgcacac cgtcaccggc ctccaccgcg gcatcatcgc 2460
    gaaccgactc tcgtacacgc tcgggctccg cggccccagc atggtcgtcg actccggcca 2520
    gtcctcgtcg ctcgtcgccg tccacctcgc gtgcgagagc ctgcggcgcg gcgagtccga 2580
    gctcgccctc gccggcggcg tctcgctcaa cctggtgccg gacagcatca tcggggcgag 2640
    caagttcggc ggcctctccc ccgacggccg cgcctacacc ttcgacgcgc gcgccaacgg 2700
    ctacgtacgc ggcgagggcg gcggtttcgt cgtcctgaag cgcctctccc gggccgtcgc 2760
    cgacggcgac ccggtgctcg ccgtgatccg gggcagcgcc gtcaacaacg gcggcgccgc 2820
    ccagggcatg acgacccccg acgcgcaggc gcaggaggcc gtgctccgcg aggcccacga 2880
    gcgggccggg accgcgccgg ccgacgtgcg gtacgtcgag ctgcacggca ccggcacccc 2940
    cgtgggcgac ccgatcgagg ccgctgcgct cggcgccgcc ctcggcaccg gccgcccggc 3000
    cggacagccg ctcctggtcg gctcggtcaa gacgaacatc ggccacctgg agggcgcggc 3060
    cggcatcgcc ggcctcatca aggccgtcct ggcggtccgc ggtcgcgcgc tgcccgccag 3120
    cctgaactac gagaccccga acccggcgat cccgttcgag gaactgaacc tccgggtgaa 3180
    cacggagtac ctgccgtggg agccggagca cgacgggcag cggatggtcg tcggcgtgtc 3240
    ctcgttcggc atgggcggca cgaacgcgca tgtcgtgctc gaagaggccc ccgggggttg 3300
    tcgaggtgct tcggtcgtgg agtcgacggt cggcgggtcg gcggtcggcg gcggtgtggt 3360
    gccgtgggtg gtgtcggcga agtccgctgc cgcgctggac gcgcagatcg agcggcttgc 3420
    cgcgttcgcc tcgcgggatc gtacggatgg tgtcgacgcg ggcgctgtcg atgcgggtgc 3480
    tgtcgatgcg ggtgctgtcg ctcgcgtact ggccggcggg cgtgctcagt tcgagcaccg 3540
    ggccgtcgtc gtcggcagcg ggccggacga tctggcggca gcgctggccg cgcctgaggg 3600
    tctggtccgg ggcgtggctt ccggtgtcgg gcgagtggcg ttcgtgttcc ccgggcaggg 3660
    cacgcagtgg gccggcatgg gtgccgaact gctggactct tccgcggtgt tcgcggcggc 3720
    catggccgaa tgcgaggccg cactctcccc gtacgtcgac tggtcgctgg aggccgtcgt 3780
    acggcaggcc cccggtgcgc ccacgctgga gcgggtcgat gtcgtgcagc ctgtgacgtt 3840
    cgccgtcatg gtctcgctgg ctcgcgtgtg gcagcaccac ggggtgacgc cccaggcggt 3900
    cgtcggccac tcgcagggcg agatcgccgc cgcgtacgtc gccggtgccc tgagcctgga 3960
    cgacgccgct cgtgtcgtga ccctgcgcag caagtccatc gccgcccacc tcgccggcaa 4020
    gggcggcatg ctgtccctcg cgctgagcga ggacgccgtc ctggagcgac tggccgggtt 4080
    cgacgggctg tccgtcgccg ctgtgaacgg gcccaccgcc accgtggtct ccggtgaccc 4140
    cgtacagatc gaagagcttg ctcgggcgtg tgaggccgat ggggtccgtg cgcgggtcat 4200
    tcccgtcgac tacgcgtccc acagccggca ggtcgagatc atcgagagcg agctcgccga 4260
    ggtcctcgcc gggctcagcc cgcaggctcc gcgcgtgccg ttcttctcga cactcgaagg 4320
    cgcctggatc accgagcccg tgctcgacgg cggctactgg taccgcaacc tgcgccatcg 4380
    tgtgggcttc gccccggccg tcgagaccct ggccaccgac gagggcttca cccacttcgt 4440
    cgaggtcagc gcccaccccg tcctcaccat ggccctcccc gggaccgtca ccggtctggc 4500
    gaccctgcgt cgcgacaacg gcggtcagga ccgcctagtc gcctccctcg ccgaagcatg 4560
    ggccaacgga ctcgcggtcg actggagccc gctcctcccc tccgcgaccg gccaccactc 4620
    cgacctcccc acctacgcgt tccagaccga gcgccactgg ctgggcgaga tcgaggcgct 4680
    cgccccggcg ggcgagccgg cggtgcagcc cgccgtcctc cgcacggagg cggccgagcc 4740
    ggcggagctc gaccgggacg agcagctgcg cgtgatcctg gacaaggtcc gggcgcagac 4800
    ggcccaggtg ctggggtacg cgacaggcgg gcagatcgag gtcgaccgga ccttccgtga 4860
    ggccggttgc acctccctga ccggcgtgga cctgcgcaac cggatcaacg ccgccttcgg 4920
    cgtacggatg gcgccgtcca tgatcttcga cttccccacc cccgaggctc tcgcggagca 4980
    gctgctcctc gtcgtgcacg gggaggcggc ggcgaacccg gccggtgcgg agccggctcc 5040
    ggtggcggcg gccggtgccg tcgacgagcc ggtggcgatc gtcggcatgg cctgccgcct 5100
    gcccggtggg gtcgcctcgc cggaggacct gtggcggctg gtggccggcg gcggggacgc 5160
    gatctcggag ttcccgcagg accgcggctg ggacgtggag gggctgtacc acccggatcc 5220
    ggagcacccc ggcacgtcgt acgtccgcca gggcggtttc atcgagaacg tcgccggctt 5280
    cgacgcggcc ttcttcggga tctcgccgcg cgaggccctc gccatggacc cgcagcagcg 5340
    gctcctcctc gaaacctcct gggaggccgt cgaggacgcc gggatcgacc cgacctccct 5400
    gcggggacgg caggtcggcg tcttcactgg ggcgatgacc cacgagtacg ggccgagcct 5460
    gcgggacggc ggggaaggcc tcgacggcta cctgctgacc ggcaacacgg ccagcgtgat 5520
    gtcgggccgc gtctcgtaca cactcggcct tgagggcccc gccctgacgg tggacacggc 5580
    ctgctcgtcg tcgctggtcg ccctgcacct cgccgtgcag gccctgcgca agggcgaggt 5640
    cgacatggcg ctcgccggcg gcgtggccgt gatgcccacg cccgggatgt tcgtcgagtt 5700
    cagccggcag cgcgggctgg ccggggacgg ccggtcgaag gcgttcgccg cgtcggcgga 5760
    cggcaccagc tggtccgagg gcgtcggcgt cctcctcgtc gagcgcctgt cggacgcccg 5820
    ccgcaacgga caccaggtcc tcgcggtcgt ccgcggcagc gccttgaacc aggacggcgc 5880
    gagcaacggc ctcacggctc cgaacgggcc ctcgcagcag cgcgtcatcc ggcgcgcgct 5940
    ggcggacgcc cggctgacga cctccgacgt ggacgtcgtc gaggcacacg gcacgggcac 6000
    gcgactcggc gacccgatcg aggcgcaggc cctgatcgcc acctacggcc agggccgtga 6060
    cgacgaacag ccgctgcgcc tcgggtcgtt gaagtccaac atcgggcaca cccaggccgc 6120
    ggccggcgtc tccggtgtca tcaagatggt ccaggcgatg cgccacggac tgctgccgaa 6180
    gacgctgcac gtcgacgagc cctcggacca gatcgactgg tcggctggcg ccgtggaact 6240
    cctcaccgag gccgtcgact ggccggagaa gcaggacggc gggctgcgcc gggccgccgt 6300
    ctcctccttc gggatcagcg gcaccaatgc gcatgtggtg ctcgaagagg ccccggtggt 6360
    tgtcgagggt gcttcggtcg tcgagccgtc ggttggcggg tcggcggtcg gcggcggtgt 6420
    gacgccttgg gtggtgtcgg cgaagtccgc tgccgcgctc gacgcgcaga tcgagcggct 6480
    tgccgcattc gcctcgcggg atcgtacgga tgacgccgac gccggtgctg tcgacgcggg 6540
    cgctgtcgct cacgtactgg ctgacgggcg tgctcagttc gagcaccggg ccgtcgcgct 6600
    cggcgccggg gcggacgacc tcgtacaggc gctggccgat ccggacgggc tgatacgcgg 6660
    aacggcttcc ggtgtcgggc gagtggcgtt cgtgttcccc ggtcagggca cgcagtgggc 6720
    tggcatgggt gccgaactgc tggactcttc cgcggtgttc gcggcggcca tggccgagtg 6780
    tgaggccgcg ctgtccccgt acgtcgactg gtcgctggag gccgtcgtac ggcaggcccc 6840
    cggtgcgccc acgctggagc gggtcgatgt cgtgcagcct gtgacgttcg ccgtcatggt 6900
    ctcgctggct cgcgtgtggc agcaccacgg tgtgacgccc caggcggtcg tcggccactc 6960
    gcagggcgag atcgccgccg cgtacgtcgc cggagccctg cccctggacg acgccgcccg 7020
    cgtcgtcacc ctgcgcagca agtccatcgc cgcccacctc gccggcaagg gcggcatgct 7080
    gtccctcgcg ctgaacgagg acgccgtcct ggagcgactg agtgacttcg acgggctgtc 7140
    cgtcgccgcc gtcaacgggc ccaccgccac tgtcgtgtcg ggtgaccccg tacagatcga 7200
    agagcttgct caggcgtgca aggcggacgg attccgcgcg cggatcattc ccgtcgacta 7260
    cgcgtcccac agccggcagg tcgagatcat cgagagcgag ctcgcccagg tcctcgccgg 7320
    tctcagcccg caggccccgc gcgtgccgtt cttctcgacg ctcgaaggca cctggatcac 7380
    cgagcccgtc ctcgacggca cctactggta ccgcaacctc cgtcaccgcg tcggcttcgc 7440
    ccccgccatc gagaccctgg ccgtcgacga gggcttcacg cacttcgtcg aggtcagcgc 7500
    ccaccccgtc ctcaccatga ccctccccga gaccgtcacc ggcctcggca ccctccgtcg 7560
    cgaacaggga ggccaagagc gtctggtcac ctcgctcgcc gaggcgtggg tcaacgggct 7620
    tcccgtggca tggacttcgc tcctgcccgc cacggcctcc cgccccggtc tgcccaccta 7680
    cgccttccag gccgagcgct actggctcga gaacactccc gccgccctgg ccaccggcga 7740
    cgactggcgc taccgcatcg actggaagcg cctcccggcc gccgaggggt ccgagcgcac 7800
    cggcctgtcc ggccgctggc tcgccgtcac gccggaggac cactccgcgc aggccgccgc 7860
    cgtgctcacc gcgctggtcg acgccggggc gaaggtcgag gtgctgacgg ccggggcgga 7920
    cgacgaccgt gaggccctcg ccgcccggct caccgcactg acgaccggtg acggcttcac 7980
    cggcgtggtc tcgctcctcg acggactcgt accgcaggtc gcctgggtcc aggcgctcgg 8040
    cgacgccgga atcaaggcgc ccctgtggtc cgtcacccag ggcgcggtct ccgtcggacg 8100
    tctcgacacc cccgccgacc ccgaccgggc catgctctgg ggcctcggcc gcgtcgtcgc 8160
    ccttgagcac cccgaacgct gggccggcct cgtcgacctc cccgcccagc ccgatgccgc 8220
    cgccctcgcc cacctcgtca ccgcactctc cggcgccacc ggcgaggacc agatcgccat 8280
    ccgcaccacc ggactccacg cccgccgcct cgcccgcgca cccctccacg gacgtcggcc 8340
    cacccgcgac tggcagcccc acggcaccgt cctcatcacc ggcggcaccg gagccctcgg 8400
    cagccacgcc gcacgctgga tggcccacca cggagccgaa cacctcctcc tcgtcagccg 8460
    cagcggcgaa caagcccccg gagccaccca actcaccgcc gaactcaccg catcgggcgc 8520
    ccgcgtcacc atcgccgcct gcgacgtcgc cgacccccac gccatgcgca ccctcctcga 8580
    cgccatcccc gccgagacgc ccctcaccgc cgtcgtccac accgccggcg cgctcgacga 8640
    cggcatcgtg gacacgctga ccgccgagca ggtccggcgg gcccaccgtg cgaaggccgt 8700
    cggcgcctcg gtgctcgacg agctgacccg ggacctcgac ctcgacgcgt tcgtgctctt 8760
    ctcgtccgtg tcgagcactc tgggcatccc cggtcagggc aactacgccc cgcacaacgc 8820
    ctacctcgac gccctcgcgg ctcgccgccg ggccaccggc cggtccgccg tctcggtggc 8880
    ctggggaccg tgggacggtg gcggcatggc cgccggtgac ggcgtggccg agcggctgcg 8940
    caaccacggc gtgcccggca tggacccgga actcgccctg gccgcactgg agtccgcgct 9000
    cggccgggac gagaccgcga tcaccgtcgc ggacatcgac tgggaccgct tctacctcgc 9060
    gtactcctcc ggtcgcccgc agcccctcgt cgaggagctg cccgaggtgc ggcgcatcat 9120
    cgacgcacgg gacagcgcca cgtccggaca gggcgggagc tccgcccagg gcgccaaccc 9180
    cctggccgag cggctggccg ccgcggctcc cggcgagcgt acggagatcc tcctcggtct 9240
    cgtacgggcg caggccgccg ccgtgctccg gatgcgttcg ccggaggacg tcgccgccga 9300
    ccgcgccttc aaggacatcg gcttcgactc gctcgccggt gtcgagctgc gcaacaggct 9360
    gacccgggcg accgggctcc agctgcccgc gacgctcgtc ttcgaccacc cgacgccgct 9420
    ggccctcgtg tcgctgctcc gcagcgagtt cctcggtgac gaggagacgg cggacgcccg 9480
    gcggtccgcg gcgctgcccg cgactgtcgg tgccggtgcc ggcgccggcg ccggcaccga 9540
    tgccgacgac gatccgatcg cgatcgtcgc gatgagctgc cgctaccccg gtgacatccg 9600
    cagcccggag gacctgtggc ggatgctgtc cgagggcggc gagggcatca cgccgttccc 9660
    caccgaccgc ggctgggacc tcgacggcct gtacgacgcc gacccggacg cgctcggcag 9720
    ggcgtacgtc cgcgagggcg ggttcctgca cgacgcggcc gagttcgacg cggagttctt 9780
    cggcgtctcg ccgcgcgagg cgctggccat ggacccgcag cagcggatgc tcctgacgac 9840
    gtcctgggag gccttcgagc gggccggcat cgagccggca tcgctgcgcg gcagcagcac 9900
    cggtgtcttc atcggcctct cctaccagga ctacgcggcc cgcgtcccga acgccccgcg 9960
    tggcgtggag ggttacctgc tgaccggcag cacgccgagc gtcgcgtcgg gccgtatcgc 10020
    gtacaccttc ggtctcgaag ggcccgcgac gaccgtcgac accgcctgct cgtcgtcgct 10080
    gaccgccctg cacctggcgg tgcgggcgct gcgcagcggc gagtgcacga tggcgctcgc 10140
    cggtggcgtg gcgatgatgg cgaccccgca catgttcgtg gagttcagcc gtcagcgggc 10200
    gctcgccccg gacggccgca gcaaggcctt ctcggcggac gccgacgggt tcggcgccgc 10260
    ggagggcgtc ggcctgctgc tcgtggagcg gctctcggac gcgcggcgca acggtcaccc 10320
    ggtgctcgcc gtggtccgcg gtaccgccgt caaccaggac ggcgccagca acgggctgac 10380
    cgcgcccaac ggaccctcgc agcagcgggt gatccggcag gcgctcgccg acgcccggct 10440
    ggcacccggc gacatcgacg ccgtcgagac gcacggcacg ggaacctcgc tgggcgaccc 10500
    catcgaggcc cagggcctcc aggccacgta cggcaaggag cggcccgcgg aacggccgct 10560
    cgccatcggc tccgtgaagt ccaacatcgg acacacccag gccgcggccg gtgcggcggg 10620
    catcatcaag atggtcctcg cgatgcgcca cggcaccctg ccgaagaccc tccacgccga 10680
    cgagccgagc ccgcacgtcg actgggcgaa cagcggcctg gccctcgtca ccgagccgat 10740
    cgactggccg gccggcaccg gtccgcgccg cgccgccgtc tcctccttcg gcatcagcgg 10800
    gacgaacgcg cacgtcgtgc tggagcaggc gccggatgct gctggtgagg tgcttggggc 10860
    cgatgaggtg cctgaggtgt ctgagacggt agcgatggct gggacggctg ggacctccga 10920
    ggtcgctgag ggctctgagg cctccgaggc ccccgcggcc cccggcagcc gtgaggcgtc 10980
    cctccccggg cacctgccct gggtgctgtc cgccaaggac gagcagtcgc tgcgcggcca 11040
    ggccgccgcc ctgcacgcgt ggctgtccga gcccgccgcc gacctgtcgg acgcggacgg 11100
    accggcccgc ctgcgggacg tcgggtacac gctcgccacg agccgtaccg ccttcgcgca 11160
    ccgcgccgcc gtgaccgccg ccgaccggga cgggttcctg gacgggctgg ccacgctggc 11220
    ccagggcggc acctcggccc acgtccacct ggacaccgcc cgggacggca ccaccgcgtt 11280
    cctcttcacc ggccagggca gtcagcgccc cggcgccggc cgtgagctgt acgaccggca 11340
    ccccgtcttc gcccgggcgc tcgacgagat ctgcgcccac ctcgacggtc acctcgaact 11400
    gcccctgctc gacgtgatgt tcgcggccga gggcagcgcg gaggccgcgc tgctcgacga 11460
    gacgcggtac acgcagtgcg cgctgttcgc cctggaggtc gcgctcttcc ggctcgtcga 11520
    gagctggggc atgcggccgg ccgcactgct cggtcactcg gtcggcgaga tcgccgccgc 11580
    gcacgtcgcc ggtgtgttct cgctcgccga cgccgcccgc ctggtcgccg cgcgcggccg 11640
    gctcatgcag gagctgcccg ccggtggcgc gatgctcgcc gtccaggccg cggaggacga 11700
    gatccgcgtg tggctggaga cggaggagcg gtacgcggga cgtctggacg tcgccgccgt 11760
    caacggcccc gaggccgccg tcctgtccgg cgacgcggac gcggcgcggg aggcggaggc 11820
    gtactggtcc gggctcggcc gcaggacccg cgcgctgcgg gtcagccacg ccttccactc 11880
    cgcgcacatg gacggcatgc tcgacgggtt ccgcgccgtc ctggagacgg tggagttccg 11940
    gcgcccctcc ctgaccgtgg tctcgaacgt caccggcctg gccgccggcc cggacgacct 12000
    gtgcgacccc gagtactggg tccggcacgt ccgcggcacc gtccgcttcc tcgacggcgt 12060
    ccgtgtcctg cgcgacctcg gcgtgcggac ctgcctggag ctgggccccg acggggtcct 12120
    caccgccatg gcggccgacg gcctcgcgga cacccccgcg gattccgctg ccggctcccc 12180
    cgtcggctct cccgccggct ctcccgccga ctccgccgcc ggcgcgctcc ggccccggcc 12240
    gctgctcgtg gcgctgctgc gccgcaagcg gtcggagacc gagaccgtcg cggacgccct 12300
    cggcagggcg cacgcccacg gcaccggacc cgactggcac gcctggttcg ccggctccgg 12360
    ggcgcaccgc gtggacctgc ccacgtactc cttccggcgc gaccgctact ggctggacgc 12420
    cccggcggcc gacaccgcgg tggacaccgc cggcctcggt ctcggcaccg ccgaccaccc 12480
    gctgctcggc gccgtggtca gccttccgga ccgggacggc ctgctgctca ccggccgcct 12540
    ctccctgcgc acccacccgt ggctcgcgga ccacgccgtc ctggggagcg tcctgctccc 12600
    cggcgccgcg atggtcgaac tcgccgcgca cgctgcggag tccgccggtc tgcgtgacgt 12660
    gcgggagctg accctccttg aaccgctggt actgcccgag cacggtggcg tcgagctgcg 12720
    cgtgacggtc ggggcgccgg ccggagagcc cggtggcgag tcggccgggg acggcgcacg 12780
    gcccgtctcc ctccactcgc ggctcgccga cgcgcccgcc ggtaccgcct ggtcctgcca 12840
    cgcgaccggt ctgctggcca ccgaccggcc cgagcttccc gtcgcgcccg accgtgcggc 12900
    catgtggccg ccgcagggcg ccgaggaggt gccgctcgac ggtctctacg agcggctcga 12960
    cgggaacggc ctcgccttcg gtccgctgtt ccaggggctg aacgcggtgt ggcggtacga 13020
    gggtgaggtc ttcgccgaca tcgcgctccc cgccaccacg aatgcgaccg cgcccgcgac 13080
    cgcgaacggc ggcgggagtg cggcggcggc cccctacggc atccaccccg ccctgctcga 13140
    cgcttcgctg cacgccatcg cggtcggcgg tctcgtcgac gagcccgagc tcgtccgcgt 13200
    ccccttccac tggagcggtg tcaccgtgca cgcggccggt gccgcggcgg cccgggtccg 13260
    tctcgcctcc gcggggacgg acgccgtctc gctgtccctg acggacggcg agggacgccc 13320
    gctggtctcc gtggaacggc tcacgctgcg cccggtcacc gccgatcagg cggcggcgag 13380
    ccgcgtcggc gggctgatgc accgggtggc ctggcgtccg tacgccctcg cctcgtccgg 13440
    cgaacaggac ccgcacgcca cttcgtacgg gccgaccgcc gtcctcggca aggacgagct 13500
    gaaggtcgcc gccgccctgg agtccgcggg cgtcgaagtc gggctctacc ccgacctggc 13560
    cgcgctgtcc caggacgtgg cggccggcgc cccggcgccc cgtaccgtcc ttgcgccgct 13620
    gcccgcgggt cccgccgacg gcggcgcgga gggtgtacgg ggcacggtgg cccggacgct 13680
    ggagctgctc caggcctggc tggccgacga gcacctcgcg ggcacccgcc tgctcctggt 13740
    cacccgcggt gcggtgcggg accccgaggg gtccggcgcc gacgatggcg gcgaggacct 13800
    gtcgcacgcg gccgcctggg gtctcgtacg gaccgcgcag accgagaacc ccggccgctt 13860
    cggccttctc gacctggccg acgacgcctc gtcgtaccgg accctgccgt cggtgctctc 13920
    cgacgcgggc ctgcgcgacg aaccgcagct cgccctgcac gacggcacca tcaggctggc 13980
    ccgcctggcc tccgtccggc ccgagaccgg caccgccgca ccggcgctcg ccccggaggg 14040
    cacggtcctg ctgaccggcg gcaccggcgg cctgggcgga ctggtcgccc ggcacgtggt 14100
    gggcgagtgg ggcgtacgac gcctgctgct ggtgagccgg cggggcacgg acgccccggg 14160
    cgccgacgag ctcgtgcacg agctggaggc cctgggagcc gacgtctcgg tggccgcgtg 14220
    cgacgtcgcc gaccgcgaag ccctcaccgc cgtactcgac gccatccccg ccgaacaccc 14280
    gctcaccgcg gtcgtccaca cggcaggcgt cctctccgac ggcaccctcc cgtccatgac 14340
    gacggaggac gtggaacacg tactgcggcc caaggtcgac gccgcgttcc tcctcgacga 14400
    actcacctcg acgcccgcat acgacctggc agcgttcgtc atgttctcct ccgccgccgc 14460
    cgtcttcggt ggcgcggggc agggcgccta cgccgccgcc aacgccaccc tcgacgccct 14520
    cgcctggcgc cgccgggcag ccggactccc cgccctctcc ctcggctggg gcctctgggc 14580
    cgagaccagc ggcatgaccg gcgagctcgg ccaggcggac ctgcgccgga tgagccgcgc 14640
    gggcatcggc gggatcagcg acgccgaggg catcgcgctc ctcgacgccg ccctccgcga 14700
    cgaccgccac ccggtcctgc tgcccctgcg gctcgacgcc gccgggctgc gggacgcggc 14760
    cgggaacgac ccggccggaa tcccggcgct cttccgggac gtcgtcggcg ccaggaccgt 14820
    ccgggcccgg ccgtccgcgg cctccgcctc gacgacagcc gggacggccg gcacgccggg 14880
    gacggcggac ggcgcggcgg aaacggcggc ggtcacgctc gccgaccggg ccgccaccgt 14940
    ggacgggccc gcacggcagc gcctgctgct cgagttcgtc gtcggcgagg tcgccgaagt 15000
    actcggccac gcccgcggtc accggatcga cgccgaacgg ggcttcctcg acctcggctt 15060
    cgactccctg accgccgtcg aactccgcaa ccggctcaac tccgccggtg gcctcgccct 15120
    cccggcgacc ctggtcttcg accacccaag cccggcggca ctcgcctccc acctggacgc 15180
    cgagctgccg cgcggcgcct cggaccagga cggagccggg aaccggaacg ggaacgagaa 15240
    cgggacgacg gcgtcccgga gcaccgccga gacggacgcg ctgctggcac aactgacccg 15300
    cctggaaggc gccttggtgc tgacgggcct ctcggacgcc cccgggagcg aagaagtcct 15360
    ggagcacctg cggtccctgc gctcgatggt cacgggcgag accgggaccg ggaccgcgtc 15420
    cggagccccg gacggcgccg ggtccggcgc cgaggaccgg ccctgggcgg ccggggacgg 15480
    agccgggggc gggagtgagg acggcgcggg agtgccggac ttcatgaacg cctcggccga 15540
    ggaactcttc ggcctcctcg accaggaccc cagcacggac tgatccctgc cgcacggtcg 15600
    cctcccgccc cggaccccgt cccgggcacc tcgactcgaa tcacttcatg cgcgcctcgg 15660
    gcgcctccag gaactcaagg ggacagcgtg tccacggtga acgaagagaa gtacctcgac 15720
    tacctgcgtc gtgccacggc ggacctccac gaggcccgtg gccgcctccg cgagctggag 15780
    gcgaaggcgg gcgagccggt ggcgatcgtc ggcatggcct gccgcctgcc cggcggcgtc 15840
    gcctcgcccg aggacctgtg gcggctggtg gccggcggcg aggacgcgat ctcggagttc 15900
    ccccaggacc gcggctggga cgtggagggc ctgtacgacc cgaacccgga ggccacgggc 15960
    aagagttacg cccgcgaggc cggattcctg tacgaggcgg gcgagttcga cgccgacttc 16020
    ttcgggatct cgccgcgcga ggccctcgcc atggacccgc agcagcgtct cctcctggag 16080
    gcctcctggg aggcgttcga gcacgccggg atcccggcgg ccaccgcgcg cggcacctcg 16140
    gtcggcgtct tcaccggcgt gatgtaccac gactacgcca cccgtctcac cgatgtcccg 16200
    gagggcatcg agggctacct gggcaccggc aactccggca gtgtcgcctc gggccgcgtc 16260
    gcgtacacgc ttggcctgga ggggccggcc gtcacggtcg acaccgcctg ctcgtcctcg 16320
    ctggtcgccc tgcacctcgc cgtgcaggcc ctgcgcaagg gcgaggtcga catggcgctc 16380
    gccggcggcg tgacggtcat gtcgacgccc agcaccttcg tcgagttcag ccgtcagcgc 16440
    gggctggcgc cggacggccg gtcgaagtcc ttctcgtcga cggccgacgg caccagctgg 16500
    tccgagggcg tcggcgtcct cctcgtcgag cgcctgtccg acgcgcgtcg caagggccat 16560
    cggatcctcg ccgtggtccg gggcaccgcc gtcaaccagg acggcgccag cagcggcctc 16620
    acggctccga acgggccgtc gcagcagcgc gtcatccgac gtgccctggc ggacgcccgg 16680
    ctcacgacct ccgacgtgga cgtcgtcgag gcccacggca cgggtacgcg actcggcgac 16740
    ccgatcgagg cgcaggccgt catcgccacg tacgggcagg gccgtgacgg cgaacagccg 16800
    ctgcgcctcg ggtcgttgaa gtccaacatc ggacacaccc aggccgccgc cggtgtctcc 16860
    ggcgtgatca agatggtcca ggcgatgcgc cacggcgtcc tgccgaagac gctccacgtg 16920
    gagaagccga cggaccaggt ggactggtcc gcgggcgcgg tcgagctgct caccgaggcc 16980
    atggactggc cggacaaggg cgacggcgga ctgcgcaggg ccgcggtctc ctccttcggc 17040
    gtcagcggga cgaacgcgca cgtcgtgctc gaagaggccc cggcggccga ggagacccct 17100
    gcctccgagg cgaccccggc cgtcgagccg tcggtcggcg ccggcctggt gccgtggctg 17160
    gtgtcggcga agactccggc cgcgctggac gcccagatcg gacgcctcgc cgcgttcgcc 17220
    tcgcagggcc gtacggacgc cgccgatccg ggcgcggtcg ctcgcgtact ggccggcggg 17280
    cgcgccgagt tcgagcaccg ggccgtcgtg ctcggcaccg gacaggacga tttcgcgcag 17340
    gcgctgaccg ctccggaagg actgatacgc ggcacgccct cggacgtggg ccgggtggcg 17400
    ttcgtgttcc ccggtcaggg cacgcagtgg gccgggatgg gcgccgaact cctcgacgtg 17460
    tcgaaggagt tcgcggcggc catggccgag tgcgagagcg cgctctcccg ctatgtcgac 17520
    tggtcgctgg aggccgtcgt ccggcaggcg ccgggcgcgc ccacgctgga gcgggtcgac 17580
    gtcgtccagc ccgtgacctt cgctgtcatg gtttcgctgg cgaaggtctg gcagcaccac 17640
    ggcgtgacgc cgcaggccgt cgtcggccac tcgcagggcg agatcgccgc cgcgtacgtc 17700
    gccggtgccc tcaccctcga cgacgccgcc cgcgtcgtca ccctgcgcag caagtccatc 17760
    gccgcccacc tcgccggcaa gggcggcatg atctccctcg ccctcagcga ggaagccacc 17820
    cggcagcgca tcgagaacct ccacggactg tcgatcgccg ccgtcaacgg ccccaccgcc 17880
    accgtggttt cgggcgaccc cacccagatc caagagctcg ctcaggcgtg tgaggccgac 17940
    ggggtccgcg cacggatcat ccccgtcgac tacgcctccc acagcgccca cgtcgagacc 18000
    atcgagagcg aactcgccga ggtcctcgcc gggctcagcc cgcggacacc tgaggtgccg 18060
    ttcttctcga cactcgaagg cgcctggatc accgagccgg tgctcgacgg cacctactgg 18120
    taccgcaacc tccgccaccg cgtcggcttc gcccccgccg tcgagaccct cgccaccgac 18180
    gaaggcttca cccacttcat cgaggtcagc gcccaccccg tcctcaccat gaccctcccc 18240
    gagaccgtca ccggcctcgg caccctccgc cgcgaacagg gaggccagga gcgtctggtc 18300
    acctcactcg ccgaagcctg gaccaacggc ctcaccatcg actgggcgcc cgtcctcccc 18360
    accgcaaccg gccaccaccc cgagctcccc acctacgcct tccagcgccg tcactactgg 18420
    ctccacgact cccccgccgt ccagggctcc gtgcaggact cctggcgcta ccgcatcgac 18480
    tggaagcgcc tcgcggtcgc cgacgcgtcc gagcgcgccg ggctgtccgg gcgctggctc 18540
    gtcgtcgtcc ccgaggaccg ttccgccgag gccgccccgg tgctcgccgc gctgtccggc 18600
    gccggcgccg accccgtaca gctggacgtg tccccgctgg gcgaccggca gcggctcgcc 18660
    gcgacgctgg gcgaggccct ggcggcggcc ggtggagccg tcgacggcgt cctctcgctg 18720
    ctcgcgtggg acgagagcgc gcaccccggc caccccgccc ccttcacccg gggcaccggc 18780
    gccaccctca ccctggtgca ggcgctggag gacgccggcg tcgccgcccc gctgtggtgc 18840
    gtgacccacg gcgcggtgtc cgtcggccgg gccgaccacg tcacctcccc cgcccaggcc 18900
    atggtgtggg gcatgggccg ggtcgccgcc ctggagcacc ccgagcggtg gggcggcctg 18960
    atcgacctgc cctcggacgc cgaccgggcg gccctggacc gcatgaccac ggtcctcgcc 19020
    ggcggtacgg gtgaggacca ggtcgcggta cgcgcctccg ggctgctcgc ccgccgcctc 19080
    gtccgcgcct ccctcccggc gcacggcacg gcttcgccgt ggtggcaggc cgacggcacg 19140
    gtgctcgtca ccggtgccga ggagcctgcg gccgccgagg ccgcacgccg gctggcccgc 19200
    gacggcgccg gacacctcct cctccacacc accccctccg gcagcgaagg cgccgaaggc 19260
    acctccggtg ccgccgagga ctccggcctc gccgggctcg tcgccgaact cgcggacctg 19320
    ggcgcgacgg ccaccgtcgt gacctgcgac ctcacggacg cggaggcggc cgcccggctg 19380
    ctcgccggcg tctccgacgc gcacccgctc agcgccgtcc tccacctgcc gcccaccgtc 19440
    gactccgagc cgctcgccgc gaccgacgcg gacgcgctcg cccgtgtcgt gaccgcgaag 19500
    gccaccgccg cgctccacct ggaccgcctc ctgcgggagg ccgcggctgc cggaggccgt 19560
    ccgcccgtcc tggtcctctt ctcctcggtc gccgcgatct ggggcggcgc cggtcagggc 19620
    gcgtacgccg ccggtacggc cttcctcgac gccctcgccg gtcagcaccg ggccgacggc 19680
    cccaccgtga cctcggtggc ctggagcccc tgggagggca gccgcgtcac cgagggtgcg 19740
    accggggagc ggctgcgccg cctcggcctg cgccccctcg cccccgcgac ggcgctcacc 19800
    gccctggaca ccgcgctcgg ccacggcgac accgccgtca cgatcgccga cgtcgactgg 19860
    tcgagcttcg cccccggctt caccacggcc cggccgggca ccctcctcgc cgatctgccc 19920
    gaggcgcgcc gcgcgctcga cgagcagcag tcgacgacgg ccgccgacga caccgtcctg 19980
    agccgcgagc tcggtgcgct caccggcgcc gaacagcagc gccgtatgca ggagttggtc 20040
    cgcgagcacc tcgccgtggt cctcaaccac ccctcccccg aggccgtcga cacggggcgg 20100
    gccttccgtg acctcggatt cgactcgctg acggcggtcg agctccgcaa ccgcctcaag 20160
    aacgccaccg gcctggccct cccggccact ctggtcttcg actacccgac cccccggacg 20220
    ctggcggagt tcctcctcgc ggagatcctg ggcgagcagg ccggtgccgg cgagcagctt 20280
    ccggtggacg gcggggtcga cgacgagccc gtcgcgatcg tcggcatggc gtgccgcctg 20340
    ccgggcggtg tcgcctcgcc ggaggacctg tggcggctgg tggccggcgg cgaggacgcg 20400
    atctccggct tcccgcagga ccgcggctgg gacgtggagg ggctgtacga cccggacccg 20460
    gacgcgtccg ggcggacgta ctgccgtgcc ggtggcttcc tcgacgaggc gggcgagttc 20520
    gacgccgact tcttcgggat ctcgccgcgc gaggccctcg ccatggaccc gcagcagcgg 20580
    ctcctcctgg agacctcctg ggaggccgtc gaggacgccg ggatcgaccc gacctccctt 20640
    caggggcagc aggtcggcgt gttcgcgggc accaacggcc cccactacga gccgctgctc 20700
    cgcaacaccg ccgaggatct tgagggttac gtcgggacgg gcaacgccgc cagcatcatg 20760
    tcgggccgtg tctcgtacac cctcggcctg gagggcccgg ccgtcacggt cgacaccgcc 20820
    tgctcctcct cgctggtcgc cctgcacctc gccgtgcagg ccctgcgcaa gggcgaatgc 20880
    ggactggcgc tcgcgggcgg tgtgacggtc atgtcgacgc ccacgacgtt cgtggagttc 20940
    agccggcagc gcgggctcgc ggaggacggc cggtcgaagg cgttcgccgc gtcggcggac 21000
    ggcttcggcc cggcggaggg cgtcggcatg ctcctcgtcg agcgcctgtc ggacgcccgc 21060
    cgcaacggac accgtgtgct ggcggtcgtg cgcggcagcg cggtcaacca ggacggcgcg 21120
    agcaacggcc tgaccgcccc gaacgggccc tcgcagcagc gcgtcatccg gcgcgcgctc 21180
    gcggacgccc gactgacgac cgccgacgtg gacgtcgtcg aggcccacgg cacgggcacg 21240
    cgactcggcg acccgatcga ggcacaggcc ctcatcgcca cctacggcca ggggcgcgac 21300
    accgaacagc cgctgcgcct ggggtcgttg aagtccaaca tcggacacac ccaggccgcc 21360
    gccggtgtct ccggcatcat caagatggtc caggcgatgc gccacggcgt cctgccgaag 21420
    acgctccacg tggaccggcc gtcggaccag atcgactggt cggcgggcac ggtcgagctg 21480
    ctcaccgagg ccatggactg gccgaggaag caggagggcg ggctgcgccg cgcggccgtc 21540
    tcctccttcg gcatcagcgg cacgaacgcg cacatcgtgc tcgaagaagc cccggtcgac 21600
    gaggacgccc cggcggacga gccgtcggtc ggcggtgtgg tgccgtggct cgtgtccgcg 21660
    aagactccgg ccgcgctgga cgcccagatc ggacgcctcg ccgcgttcgc ctcgcagggc 21720
    cgtacggacg ccgccgatcc gggcgcggtc gctcgcgtac tggccggcgg gcgtgcgcag 21780
    ttcgagcacc gggccgtcgc gctcggcacc ggacaggacg acctggcggc cgcactggcc 21840
    gcgcctgagg gtctggtccg gggtgtggcc tccggtgtgg gtcgagtggc gttcgtgttc 21900
    ccgggacagg gcacgcagtg ggccgggatg ggtgccgaac tcctcgacgt gtcgaaggag 21960
    ttcgcggcgg ccatggccga gtgcgaggcc gcgctcgctc cgtacgtgga ctggtcgctg 22020
    gaggccgtcg tccgacaggc ccccggcgcg cccacgctgg agcgggtcga tgtcgtccag 22080
    cccgtgacgt tcgccgtcat ggtctcgctg gcgaaggtct ggcagcacca cggggtgacc 22140
    ccgcaagccg tcgtcggcca ctcgcagggc gagatcgccg ccgcgtacgt cgccggtgcc 22200
    ctgagcctgg acgacgccgc tcgtgtcgtg accctgcgca gcaagtccat cggcgcccac 22260
    ctcgcgggcc agggcggcat gctgtccctc gcgctgagcg aggcggccgt tgtggagcga 22320
    ctggccgggt tcgacgggct gtccgtcgcc gccgtcaacg ggcctaccgc caccgtggtt 22380
    tcgggcgacc cgacccagat ccaagagctc gctcaggcgt gtgaggccga cggggtccgc 22440
    gcacggatca tccccgtcga ctacgcctcc cacagcgccc acgtcgagac catcgagagc 22500
    gaactcgccg acgtcctggc ggggttgtcc ccccagacac cccaggtccc cttcttctcc 22560
    accctcgaag gcgcctggat caccgaaccc gccctcgacg gcggctactg gtaccgcaac 22620
    ctccgccatc gtgtgggctt cgccccggcc gtcgaaaccc tggccaccga cgaaggcttc 22680
    acccacttcg tcgaggtcag cgcccacccc gtcctcacca tggcgctgcc cgagaccgtc 22740
    accggactcg gcaccctccg ccgtgacaac ggcggacagc accgcctcac cacctccctc 22800
    gccgaggcct gggccaacgg cctcaccgtc gactgggcct ctctcctccc caccacgacc 22860
    acccaccccg atctgcccac ctacgccttc cagaccgagc gctactggcc gcagcccgac 22920
    ctctccgccg ccggtgacat cacctccgcc ggtctcgggg cggccgagca cccgctgctc 22980
    ggcgcggccg tggcgctcgc ggactccgac ggctgcctgc tcacggggag cctctccctc 23040
    cgtacgcacc cctggctggc ggaccacgcg gtggccggca ccgtgctgct gccgggaacg 23100
    gcgttcgtgg agctggcgtt ccgagccggg gaccaggtcg gttgcgatct ggtcgaggag 23160
    ctcaccctcg acgcgccgct cgtgctgccc cgtcgtggcg cggtccgtgt gcagctgtcc 23220
    gtcggcgcga gcgacgagtc cgggcgtcgt accttcgggc tctacgcgca cccggaggac 23280
    gcgccgggcg aggcggagtg gacgcggcac gccaccggtg tgctggccgc ccgtgcggac 23340
    cgcaccgccc ccgtcgccga cccggaggcc tggccgccgc cgggcgccga gccggtggac 23400
    gtggacggtc tgtacgagcg cttcgcggcg aacggctacg gctacggccc cctcttccag 23460
    ggcgtccgtg gtgtctggcg gcgtggcgac gaggtgttcg ccgacgtggc cctgccggcc 23520
    gaggtcgccg gtgccgaggg cgcgcggttc ggccttcacc cggcgctgct cgacgccgcc 23580
    gtgcaggcgg ccggtgcggg ccggggcgtt cggcgcgggc acgcggctgc cgttcgcctg 23640
    gagcgggatc tcctgtacgc ggtcggcgcc accgccctcc gcgtgcggct ggcccccgcc 23700
    ggcccggaca cggtgtccgt gagcgccgcc gactcctccg ggcagccggt gttcgccgcg 23760
    gactccctca cggtgctgcc cgtcgacccc gcgcagctgg cggccttcag cgacccgact 23820
    ctggacgcgc tgcacctgct ggagtggacc gcctgggacg gtgccgcgca ggccctgccc 23880
    ggcgcggtcg tgctgggcgg cgacgccgac ggtctcgccg cggcgctgcg cgccggtggc 23940
    accgaggtcc tgtccttccc ggaccttacg gacctggtgg aggccgtcga ccggggcgag 24000
    accccggccc cggcgaccgt cctggtggcc tgccccgccg ccggccccga tgggccggag 24060
    catgtccgcg aggccctgca cgggtcgctc gcgctgatgc aggcctggct ggccgacgag 24120
    cggttcaccg atgggcgcct ggtgctcgtg acccgcgacg cggtcgccgc ccgttccggc 24180
    gacggcctgc ggtccacggg acaggccgcc gtctggggcc tcggccggtc cgcgcagacg 24240
    gagagcccgg gccggttcgt cctgctcgac ctcgccgggg aagcccggac ggccggggac 24300
    gccaccgccg gggacggcct gacgaccggg gacgccaccg tcggcggcac ctctggagac 24360
    gccgccctcg gcagcgccct cgcgaccgcc ctcggctcgg gcgagccgca gctcgccctc 24420
    cgggacgggg cgctcctcgt accccgcctg gcgcgggccg ccgcgcccgc cgcggccgac 24480
    ggcctcgccg cggccgacgg cctcgccgct ctgccgctgc ccgccgctcc ggccctctgg 24540
    cgtctggagc ccggtacgga cggcagcctg gagagcctca cggcggcgcc cggcgacgcc 24600
    gagaccctcg ccccggagcc gctcggcccg ggacaggtcc gcatcgcgat ccgggccacc 24660
    ggtctcaact tccgcgacgt cctgatcgcc ctcggcatgt accccgatcc ggcgctgatg 24720
    ggcaccgagg gagccggcgt ggtcaccgcg accggccccg gcgtcacgca cctcgccccc 24780
    ggcgaccggg tcatgggcct gctctccggc gcgtacgccc cggtcgtcgt ggcggacgcg 24840
    cggaccgtcg cgcggatgcc cgaggggtgg acgttcgccc agggcgcctc cgtgccggtg 24900
    gtgttcctga cggccgtcta cgccctgcgc gacctggcgg acgtcaagcc cggcgagcgc 24960
    ctcctggtcc actccgccgc cggtggcgtg ggcatggccg ccgtgcagct cgcccggcac 25020
    tggggcgtgg aggtccacgg cacggcgagt cacgggaagt gggacgccct gcgcgcgctc 25080
    ggcctggacg acgcgcacat cgcctcctcc cgcaccctgg acttcgagtc cgcgttccgt 25140
    gccgcttccg gcggggcggg catggacgtc gtactgaact cgctcgcccg cgagttcgtc 25200
    gacgcctcgc tgcgcctgct cgggccgggc ggccggttcg tggagatggg gaagaccgac 25260
    gtccgcgacg cggagcgggt cgccgccgac caccccggtg tcggctaccg cgccttcgac 25320
    ctgggcgagg ccgggccgga gcggatcggc gagatgctcg ccgaggtcat cgccctcttc 25380
    gaggacgggg tgctccggca cctgcccgtc acgacctggg acgtgcgccg ggcccgcgac 25440
    gccttccggc acgtcagcca ggcccgccac acgggcaagg tcgtcctcac gatgccgtcg 25500
    ggcctcgacc cggagggtac ggtcctgctg accggcggca ccggtgcgct ggggggcatc 25560
    gtggcccggc acgtggtggg cgagtggggc gtacgacgcc tgctgctcgt gagccggcgg 25620
    ggcacggacg ccccgggcgc cggcgagctc gtgcacgagc tggaggccct gggagccgac 25680
    gtctcggtgg ccgcgtgcga cgtcgccgac cgcgaagccc tcaccgccgt actcgactcg 25740
    atccccgccg aacacccgct caccgcggtc gtccacacgg caggcgtcct ctccgacggc 25800
    accctcccct cgatgacagc ggaggatgtg gaacacgtac tgcgtcccaa ggtcgacgcc 25860
    gcgttcctcc tcgacgaact cacctcgacg cccggctacg acctggcagc gttcgtcatg 25920
    ttctcctccg ccgccgccgt cttcggtggc gcggggcagg gcgcctacgc cgccgccaac 25980
    gccaccctcg acgccctcgc ctggcgccgc cggacagccg gactccccgc cctctccctc 26040
    ggctggggcc tctgggccga gaccagcggc atgaccggcg gactcagcga caccgaccgc 26100
    tcgcggctgg cccgttccgg ggcgacgccc atggacagcg agctgaccct gtccctcctg 26160
    gacgcggcca tgcgccgcga cgacccggcg ctcgtcccga tcgccctgga cgtcgccgcg 26220
    ctccgcgccc agcagcgcga cggcatgctg gcgccgctgc tcagcgggct cacccgcgga 26280
    tcgcgggtcg gcggcgcgcc ggtcaaccag cgcagggcag ccgccggagg cgcgggcgag 26340
    gcggacacgg acctcggcgg gcggctcgcc gcgatgacac cggacgaccg ggtcgcgcac 26400
    ctgcgggacc tcgtccgtac gcacgtggcg accgtcctgg gacacggcac cccgagccgg 26460
    gtggacctgg agcgggcctt ccgcgacacc ggtttcgact cgctcaccgc cgtcgaactc 26520
    cgcaaccgtc tcaacgccgc gaccgggctg cggctgccgg ccacgctggt cttcgaccac 26580
    cccaccccgg gggagctcgc cgggcacctg ctcgacgaac tcgccacggc cgcgggcggg 26640
    tcctgggcgg aaggcaccgg gtccggagac acggcctcgg cgaccgatcg gcagaccacg 26700
    gcggccctcg ccgaactcga ccggctggaa ggcgtgctcg cctccctcgc gcccgccgcc 26760
    ggcggccgtc cggagctcgc cgcccggctc agggcgctgg ccgcggccct gggggacgac 26820
    ggcgacgacg ccaccgacct ggacgaggcg tccgacgacg acctcttctc cttcatcgac 26880
    aaggagctgg gcgactccga cttctgacct gcccgacacc accggcacca ccggcaccac 26940
    cagcccccct cacacacgga acacggaacg gacaggcgag aacgggagcc atggcgaaca 27000
    acgaagacaa gctccgcgac tacctcaagc gcgtcaccgc cgagctgcag cagaacacca 27060
    ggcgtctgcg cgagatcgag ggacgcacgc acgagccggt ggcgatcgtg ggcatggcct 27120
    gccgcctgcc gggcggtgtc gcctcgcccg aggacctgtg gcagctggtg gccggggacg 27180
    gggacgcgat ctcggagttc ccgcaggacc gcggctggga cgtggagggg ctgtacgacc 27240
    ccgacccgga cgcgtccggc aggacgtact gccggtccgg cggattcctg cacgacgccg 27300
    gcgagttcga cgccgacttc ttcgggatct cgccgcgcga ggccctcgcc atggacccgc 27360
    agcagcgact gtccctcacc accgcgtggg aggcgatcga gagcgcgggc atcgacccga 27420
    cggccctgaa gggcagcggc ctcggcgtct tcgtcggcgg ctggcacacc ggctacacct 27480
    cggggcagac caccgccgtg cagtcgcccg agctggaggg ccacctggtc agcggcgcgg 27540
    cgctgggctt cctgtccggc cgtatcgcgt acgtcctcgg tacggacgga ccggccctga 27600
    ccgtggacac ggcctgctcg tcctcgctgg tcgccctgca cctcgccgtg caggccctcc 27660
    gcaagggcga gtgcgacatg gccctcgccg gtggtgtcac ggtcatgccc aacgcggacc 27720
    tgttcgtgca gttcagccgg cagcgcgggc tggccgcgga cggccggtcg aaggcgttcg 27780
    ccacctcggc ggacggcttc ggccccgcgg agggcgccgg agtcctgctg gtggagcgcc 27840
    tgtcggacgc ccgccgcaac ggacaccgga tcctcgcggt cgtccgcggc agcgcggtca 27900
    accaggacgg cgccagcaac ggcctcacgg ctccgcacgg gccctcccag cagcgcgtca 27960
    tccgacgggc cctggcggac gcccggctcg cgccgggtga cgtggacgtc gtcgaggcgc 28020
    acggcacggg cacgcggctc ggcgacccga tcgaggcgca ggccctcatc gccacctacg 28080
    gccaggagaa gagcagcgaa cagccgctga ggctgggcgc gttgaagtcg aacatcgggc 28140
    acacgcaggc cgcggccggt gtcgcaggtg tcatcaagat ggtccaggcg atgcgccacg 28200
    gactgctgcc gaagacgctg cacgtcgacg agccctcgga ccagatcgac tggtcggcgg 28260
    gcacggtgga actcctcacc gaggccgtcg actggccgga gaagcaggac ggcgggctgc 28320
    gccgcgcggc tgtctcctcc ttcggcatca gcgggacgaa cgcgcacgtc gtcctggagg 28380
    aggccccggc ggtcgaggac tccccggccg tcgagccgcc ggccggtggc ggtgtggtgc 28440
    cgtggccggt gtccgcgaag actccggccg cgctggacgc ccagatcggg cagctcgccg 28500
    cgtacgcgga cggtcgtacg gacgtggatc cggcggtggc cgcccgcgcc ctggtcgaca 28560
    gccgtacggc gatggagcac cgcgcggtcg cggtcggcga cagccgggag gcactgcggg 28620
    acgccctgcg gatgccggaa ggactggtac gcggcacgtc ctcggacgtg ggccgggtgg 28680
    cgttcgtctt ccccggccag ggcacgcagt gggccggcat gggcgccgaa ctccttgaca 28740
    gctcaccgga gttcgctgcc tcgatggccg aatgcgagac cgcgctctcc cgctacgtcg 28800
    actggtctct tgaagccgtc gtccgacagg aacccggcgc acccacgctc gaccgcgtcg 28860
    acgtcgtcca gcccgtgacc ttcgctgtca tggtctcgct ggcgaaggtc tggcagcacc 28920
    acggcatcac cccccaggcc gtcgtcggcc actcgcaggg cgagatcgcc gccgcgtacg 28980
    tcgccggtgc actcaccctc gacgacgccg cccgcgtcgt caccctgcgc agcaagtcca 29040
    tcgccgccca cctcgccggc aagggcggca tgatctccct cgccctcgac gaggcggccg 29100
    tcctgaagcg actgagcgac ttcgacggac tctccgtcgc cgccgtcaac ggccccaccg 29160
    ccaccgtcgt ctccggcgac ccgacccaga tcgaggaact cgcccgcacc tgcgaggccg 29220
    acggcgtccg tgcgcggatc atcccggtcg actacgcctc ccacagccgg caggtcgaga 29280
    tcatcgagaa ggagctggcc gaggtcctcg ccggactcgc cccgcaggct ccgcacgtgc 29340
    cgttcttctc caccctcgaa ggcacctgga tcaccgagcc ggtgctcgac ggcacctact 29400
    ggtaccgcaa cctgcgccat cgcgtgggct tcgcccccgc cgtggagacc ttggcggttg 29460
    acggcttcac ccacttcatc gaggtcagcg cccaccccgt cctcaccatg accctccccg 29520
    agaccgtcac cggcctcggc accctccgcc gcgaacaggg aggccaggag cgtctggtca 29580
    cctcactcgc cgaagcctgg gccaacggcc tcaccatcga ctgggcgccc atcctcccca 29640
    ccgcaaccgg ccaccacccc gagctcccca cctacgcctt ccagaccgag cgcttctggc 29700
    tgcagagctc cgcgcccacc agcgccgccg acgactggcg ttaccgcgtc gagtggaagc 29760
    cgctgacggc ctccggccag gcggacctgt ccgggcggtg gatcgtcgcc gtcgggagcg 29820
    agccagaagc cgagctgctg ggcgcgctga aggccgcggg agcggaggtc gacgtactgg 29880
    aagccggggc ggacgacgac cgtgaggccc tcgccgcccg gctcaccgca ctgacgaccg 29940
    gcgacggctt caccggcgtg gtctcgctcc tcgacgacct cgtgccacag gtcgcctggg 30000
    tgcaggcact cggcgacgcc ggaatcaagg cgcccctgtg gtccgtcacc cagggcgcgg 30060
    tctccgtcgg acgtctcgac acccccgccg accccgaccg ggccatgctc tggggcctcg 30120
    gccgcgtcgt cgcccttgag caccccgaac gctgggccgg cctcgtcgac ctccccgccc 30180
    agcccgatgc cgccgccctc gcccacctcg tcaccgcact ctccggcgcc accggcgagg 30240
    accagatcgc catccgcacc accggactcc acgcccgccg cctcgcccgc gcacccctcc 30300
    acggacgtcg gcccacccgc gactggcagc cccacggcac cgtcctcatc accggcggca 30360
    ccggagccct cggcagccac gccgcacgct ggatggccca ccacggagcc gaacacctcc 30420
    tcctcgtcag ccgcagcggc gaacaagccc ccggagccac ccaactcacc gccgaactca 30480
    ccgcatcggg cgcccgcgtc accatcgccg cctgcgacgt cgccgacccc cacgccatgc 30540
    gcaccctcct cgacgccatc cccgccgaga cgcccctcac cgccgtcgtc cacaccgccg 30600
    gcgcaccggg cggcgatccg ctggacgtca ccggcccgga ggacatcgcc cgcatcctgg 30660
    gcgcgaagac gagcggcgcc gaggtcctcg acgacctgct ccgcggcact ccgctggacg 30720
    ccttcgtcct ctactcctcg aacgccgggg tctggggcag cggcagccag ggcgtctacg 30780
    cggcggccaa cgcccacctc gacgcgctcg ccgcccggcg ccgcgcccgg ggcgagacgg 30840
    cgacctcggt cgcctggggc ctctgggccg gcgacggcat gggccggggc gccgacgacg 30900
    cgtactggca gcgtcgcggc atccgtccga tgagccccga ccgcgccctg gacgaactgg 30960
    ccaaggccct gagccacgac gagaccttcg tcgccgtggc cgatgtcgac tgggagcggt 31020
    tcgcgcccgc gttcacggtg tcccgtccca gccttctgct cgacggcgtc ccggaggccc 31080
    ggcaggcgct cgccgcaccc gtcggtgccc cggctcccgg cgacgccgcc gtggcgccga 31140
    ccgggcagtc gtcggcgctg gccgcgatca ccgcgctccc cgagcccgag cgccggccgg 31200
    cgctcctcac cctcgtccgt acccacgcgg cggccgtact cggccattcc tcccccgacc 31260
    gggtggcccc cggccgtgcc ttcaccgagc tcggcttcga ctcgctgacg gccgtgcagc 31320
    tccgcaacca gctctccacg gtggtcggca acaggctccc cgccaccacg gtcttcgacc 31380
    acccgacgcc cgccgcactc gccgcgcacc tccacgaggc gtacctcgca ccggccgagc 31440
    cggccccgac ggactgggag gggcgggtgc gccgggccct ggccgaactg cccctcgacc 31500
    ggctgcggga cgcgggggtc ctcgacaccg tcctgcgcct caccggcatc gagcccgagc 31560
    cgggttccgg cggttcggac ggcggcgccg ccgaccctgg tgcggagccg gaggcgtcga 31620
    tcgacgacct ggacgccgag gccctgatcc ggatggctct cggcccccgt aacacctgac 31680
    ccgaccgcgg tcctgcccca cgcgccgcac cccgcgcatc ccgcgcacca cccgccccca 31740
    cacgcccaca accccatcca cgagcggaag accacaccca gatgacgagt tccaacgaac 31800
    agttggtgga cgctctgcgc gcctctctca aggagaacga agaactccgg aaagagagcc 31860
    gtcgccgggc cgaccgtcgg caggagccca tggcgatcgt cggcatgagc tgccggttcg 31920
    cgggcggaat ccggtccccc gaggacctct gggacgccgt cgccgcgggc aaggacctgg 31980
    tctccgaggt accggaggag cgcggctggg acatcgactc cctctacgac ccggtgcccg 32040
    ggcgcaaggg cacgacgtac gtccgcaacg ccgcgttcct cgacgacgcc gccggattcg 32100
    acgcggcctt cttcgggatc tcgccgcgcg aggccctcgc catggacccg cagcagcggc 32160
    agctcctcga agcctcctgg gaggtcttcg agcgggccgg catcgacccc gcgtcggtcc 32220
    gcggcaccga cgtcggcgtg tacgtgggct gtggctacca ggactacgcg ccggacatcc 32280
    gggtcgcccc cgaaggcacc ggcggttacg tcgtcaccgg caactcctcc gccgtggcct 32340
    ccgggcgcat cgcgtactcc ctcggcctgg agggacccgc cgtgaccgtg gacacggcgt 32400
    gctcctcttc gctcgtcgcc ctgcacctcg ccctgaaggg cctgcggaac ggcgactgct 32460
    cgacggcact cgtgggcggc gtggccgtcc tcgcgacgcc gggcgcgttc atcgagttca 32520
    gcagccagca ggccatggcc gccgacggcc ggaccaaggg cttcgcctcg gcggcggacg 32580
    gcctcgcctg gggcgagggc gtcgccgtac tcctcctcga acggctctcc gacgcgcggc 32640
    gcaagggcca ccgggtcctg gccgtcgtgc gcggcagcgc catcaaccag gacggcgcga 32700
    gcaacggcct cacggctccg cacgggccct cccagcagca cctgatccgc caggccctgg 32760
    ccgacgcgcg gctcacgtcg agcgacgtgg acgtcgtgga gggccacggc acggggaccc 32820
    gtctcggcga cccgatcgag gcgcaggcgc tgctcgccac gtacgggcag gggcgcgccc 32880
    cggggcagcc gctgcggctg gggacgctga agtcgaacat cgggcacacg caggccgctt 32940
    cgggtgtcgc cggtgtcatc aagatggtgc aggcgctgcg ccacggggtg ctgccgaaga 33000
    ccctgcacgt ggacgagccg acggaccagg tcgactggtc ggccggttcg gtcgagctgc 33060
    tcaccgaggc cgtggactgg ccggagcggc cgggccggct ccgccgggcg ggcgtctccg 33120
    cgttcggcgt gggcgggacg aacgcgcacg tcgtcctgga ggaggccccg gcggtcgagg 33180
    agtcccctgc cgtcgagccg ccggccggtg gcggcgtggt gccgtggccg gtgtccgcga 33240
    agacctcggc cgcactggac gcccagatcg ggcagctcgc cgcatacgcg gaagaccgca 33300
    cggacgtgga tccggcggtg gccgcccgcg ccctggtcga cagccgtacg gcgatggagc 33360
    accgcgcggt cgcggtcggc gacagccggg aggcactgcg ggacgccctg cggatgccgg 33420
    aaggactggt acggggcacg gtcaccgatc cgggccgggt ggcgttcgtc ttccccggcc 33480
    agggcacgca gtgggccggc atgggcgccg aactcctcga cagctcaccc gaattcgccg 33540
    ccgccatggc cgaatgcgag accgcactct ccccgtacgt cgactggtct ctcgaagccg 33600
    tcgtccgaca ggctcccagc gcaccgacac tcgaccgcgt cgacgtcgtc cagcccgtca 33660
    ccttcgccgt catggtctcc ctcgccaagg tctggcagca ccacggcatc acccccgagg 33720
    ccgtcatcgg ccactcccag ggcgagatcg ccgccgcgta cgtcgccggt gccctcaccc 33780
    tcgacgacgc cgctcgtgtc gtgaccctcc gcagcaagtc catcgccgcc cacctcgccg 33840
    gcaagggcgg catgatctcc ctcgccctca gcgaggaagc cacccggcag cgcatcgaga 33900
    acctccacgg actgtcgatc gccgccgtca acgggcctac cgccaccgtg gtttcgggcg 33960
    accccaccca gatccaagaa cttgctcagg cgtgtgaggc cgacggcatc cgcgcacgga 34020
    tcatccccgt cgactacgcc tcccacagcg cccacgtcga gaccatcgag aacgaactcg 34080
    ccgacgtcct ggcggggttg tccccccaga caccccaggt ccccttcttc tccaccctcg 34140
    aaggcacctg gatcaccgaa cccgccctcg acggcggcta ctggtaccgc aacctccgcc 34200
    atcgtgtggg cttcgccccg gccgtcgaga ccctcgccac cgacgaaggc ttcacccact 34260
    tcatcgaggt cagcgcccac cccgtcctca ccatgaccct ccccgacaag gtcaccggcc 34320
    tggccaccct ccgacgcgag gacggcggac agcaccgcct caccacctcc cttgccgagg 34380
    cctgggccaa cggcctcgcc ctcgactggg cctccctcct gcccgccacg ggcgccctca 34440
    gccccgccgt ccccgacctc ccgacgtacg ccttccagca ccgctcgtac tggatcagcc 34500
    ccgcgggtcc cggcgaggcg cccgcgcaca ccgcttccgg gcgcgaggcc gtcgccgaga 34560
    cggggctcgc gtggggcccg ggtgccgagg acctcgacga ggagggccgg cgcagcgccg 34620
    tactcgcgat ggtgatgcgg caggcggcct ccgtgctccg gtgcgactcg cccgaagagg 34680
    tccccgtcga ccgcccgctg cgggagatcg gcttcgactc gctgaccgcc gtcgacttcc 34740
    gcaaccgcgt caaccggctg accggtctcc agctgccgcc caccgtcgtg ttccagcacc 34800
    cgacgcccgt cgcgctcgcc gagcgcatca gcgacgagct ggccgagcgg aactgggccg 34860
    tcgccgagcc gtcggatcac gagcaggcgg aggaggagaa ggccgccgct ccggcggggg 34920
    cccgctccgg ggccgacacc ggcgccggcg ccgggatgtt ccgcgccctg ttccggcagg 34980
    ccgtggagga cgaccggtac ggcgagttcc tcgacgtcct cgccgaagcc tccgcgttcc 35040
    gcccgcagtt cgcctcgccc gaggcctgct cggagcggct cgacccggtg ctgctcgccg 35100
    gcggtccgac ggaccgggcg gaaggccgtg ccgttctcgt cggctgcacc ggcaccgcgg 35160
    cgaacggcgg cccgcacgag ttcctgcggc tcagcacctc cttccaggag gagcgggact 35220
    tcctcgccgt acctctcccc ggctacggca cgggtacggg caccggcacg gccctcctcc 35280
    cggccgatct cgacaccgcg ctcgacgccc aggcccgggc gatcctccgg gccgccgggg 35340
    acgccccggt cgtcctgctc gggcactccg gcggcgccct gctcgcgcac gagctggcct 35400
    tccgcctgga gcgggcgcac ggcgcgccgc cggccgggat cgtcctggtc gacccctatc 35460
    cgccgggcca tcaggagccc atcgaggtgt ggagcaggca gctgggcgag ggcctgttcg 35520
    cgggcgagct ggagccgatg tccgatgcgc ggctgctggc catgggccgg tacgcgcggt 35580
    tcctcgccgg cccgcggccg ggccgcagca gcgcgcccgt gcttctggtc cgtgcctccg 35640
    aaccgctggg cgactggcag gaggagcggg gcgactggcg tgcccactgg gaccttccgc 35700
    acaccgtcgc ggacgtgccg ggcgaccact tcacgatgat gcgggaccac gcgccggccg 35760
    tcgccgaggc cgtcctctcc tggctcgacg ccatcgaggg catcgagggg gcgggcaagt 35820
    gaccgacaga cctctgaacg tggacagcgg actgtggatc cggcgcttcc accccgcgcc 35880
    gaacagcgcg gtgcggctgg tctgcctgcc gcacgccggc ggctccgcca gctacttctt 35940
    ccgcttctcg gaggagctgc acccctccgt cgaggccctg tcggtgcagt atccgggccg 36000
    ccaggaccgg cgtgccgagc cgtgtctgga gagcgtcgag gagctcgccg agcatgtggt 36060
    cgcggccacc gaaccctggt ggcaggaggg ccggctggcc ttcttcgggc acagcctcgg 36120
    cgcctccgtc gccttcgaga cggcccgcat cctggaacag cggcacgggg tacggcccga 36180
    gggcctgtac gtctccggtc ggcgcgcccc gtcgctggcg ccggaccggc tcgtccacca 36240
    gctggacgac cgggcgttcc tggccgagat ccggcggctc agcggcaccg acgagcggtt 36300
    cctccaggac gacgagctgc tgcggctggt gctgcccgcg ctgcgcagcg actacaaggc 36360
    ggcggagacg tacctgcacc ggccgtccgc caagctcacc tgcccggtga tggccctggc 36420
    cggcgaccgt gacccgaagg cgccgctgaa cgaggtggcc gagtggcgtc ggcacaccag 36480
    cgggccgttc tgcctccggg cgtactccgg cggccacttc tacctcaacg accagtggca 36540
    cgagatctgc aacgacatct ccgaccacct gctcgtcacc cgcggcgcgc ccgatgcccg 36600
    cgtcgtgcag cccccgacca gccttatcga aggagcggcg aagagatggc agaacccacg 36660
    gtgaccgacg acctgacggg ggccctcacg cagcccccgc tgggccgcac cgtccgcgcg 36720
    gtggccgacc gtgaactcgg cacccacctc ctggagaccc gcggcatcca ctggatcc 36778
    <210> SEQ ID NO 49
    <211> LENGTH: 11877
    <212> TYPE: PRT
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 49
    Met Ala Met Arg Asp Ser Ile Pro Arg Arg Ala Asp Arg Asp Thr Leu
    1 5 10 15
    Arg Arg Glu Leu Gly Gln Asn Phe Leu Gln Asp Asp Arg Ala Val Arg
    20 25 30
    Asn Leu Val Thr His Val Glu Gly Asp Gly Arg Asn Val Leu Glu Ile
    35 40 45
    Gly Pro Gly Lys Gly Ala Ile Thr Glu Glu Leu Val Arg Ser Phe Asp
    50 55 60
    Thr Val Thr Val Val Glu Met Asp Pro His Trp Ala Ala His Val Arg
    65 70 75 80
    Arg Lys Phe Glu Gly Glu Arg Val Thr Val Phe Gln Gly Asp Phe Leu
    85 90 95
    Asp Phe Arg Ile Pro Arg Asp Ile Asp Thr Val Val Gly Asn Val Pro
    100 105 110
    Phe Gly Ile Thr Thr Gln Ile Leu Arg Ser Leu Leu Glu Ser Thr Asn
    115 120 125
    Trp Gln Ser Ala Ala Leu Ile Val Gln Trp Glu Val Ala Arg Lys Arg
    130 135 140
    Ala Gly Arg Ser Gly Gly Ser Leu Leu Thr Thr Ser Trp Ala Pro Trp
    145 150 155 160
    Tyr Glu Phe Ala Val His Asp Arg Val Arg Ala Ser Ser Phe Arg Pro
    165 170 175
    Met Pro Arg Val Asp Gly Gly Val Leu Thr Ile Arg Arg Arg Pro Gln
    180 185 190
    Pro Leu Leu Pro Glu Ser Ala Ser Arg Ala Phe Gln Asn Phe Ala Glu
    195 200 205
    Ala Val Phe Thr Gly Pro Gly Arg Gly Leu Ala Glu Ile Leu Arg Arg
    210 215 220
    His Ile Pro Lys Arg Thr Tyr Arg Ser Leu Ala Asp Arg His Gly Ile
    225 230 235 240
    Pro Asp Gly Gly Leu Pro Lys Asp Leu Thr Leu Thr Gln Trp Ile Ala
    245 250 255
    Leu Phe Gln Ala Ser Gln Pro Ser Tyr Ala Pro Gly Ala Pro Gly Thr
    260 265 270
    Arg Met Pro Gly Gln Gly Gly Gly Ala Gly Gly Arg Asp Tyr Asp Ser
    275 280 285
    Glu Thr Ser Arg Ala Ala Val Pro Gly Ser Arg Arg Tyr Gly Pro Thr
    290 295 300
    Arg Gly Gly Glu Pro Cys Ala Pro Arg Ala Gln Val Arg Gln Thr Lys
    305 310 315 320
    Gly Arg Gln Gly Ala Arg Gly Ser Ser Tyr Gly Arg Arg Thr Gly Arg
    325 330 335
    Met Ser Ser Ala Gly Ile Thr Arg Thr Gly Ala Arg Thr Pro Val Thr
    340 345 350
    Gly Arg Gly Ala Ala Ala Trp Asp Thr Gly Glu Val Arg Val Arg Arg
    355 360 365
    Gly Leu Pro Pro Ala Gly Pro Asp His Ala Glu His Ser Phe Ser Arg
    370 375 380
    Ala Pro Thr Gly Asp Val Arg Ala Glu Leu Ile Arg Gly Glu Met Ser
    385 390 395 400
    Thr Val Ser Lys Ser Glu Ser Glu Glu Phe Val Ser Val Ser Asn Asp
    405 410 415
    Ala Gly Ser Ala His Gly Thr Ala Glu Pro Val Ala Val Val Gly Ile
    420 425 430
    Ser Cys Arg Val Pro Gly Ala Arg Asp Pro Arg Glu Phe Trp Glu Leu
    435 440 445
    Leu Ala Ala Gly Gly Gln Ala Val Thr Asp Val Pro Ala Asp Arg Trp
    450 455 460
    Asn Ala Gly Asp Phe Tyr Asp Pro Asp Arg Ser Ala Pro Gly Arg Ser
    465 470 475 480
    Asn Ser Arg Trp Gly Gly Phe Ile Glu Asp Val Asp Arg Phe Asp Ala
    485 490 495
    Ala Phe Phe Gly Ile Ser Pro Arg Glu Ala Ala Glu Met Asp Pro Gln
    500 505 510
    Gln Arg Leu Ala Leu Glu Leu Gly Trp Glu Ala Leu Glu Arg Ala Gly
    515 520 525
    Ile Asp Pro Ser Ser Leu Thr Gly Thr Arg Thr Gly Val Phe Ala Gly
    530 535 540
    Ala Ile Trp Asp Asp Tyr Ala Thr Leu Lys His Arg Gln Gly Gly Ala
    545 550 555 560
    Ala Ile Thr Pro His Thr Val Thr Gly Leu His Arg Gly Ile Ile Ala
    565 570 575
    Asn Arg Leu Ser Tyr Thr Leu Gly Leu Arg Gly Pro Ser Met Val Val
    580 585 590
    Asp Ser Gly Gln Ser Ser Ser Leu Val Ala Val His Leu Ala Cys Glu
    595 600 605
    Ser Leu Arg Arg Gly Glu Ser Glu Leu Ala Leu Ala Gly Gly Val Ser
    610 615 620
    Leu Asn Leu Val Pro Asp Ser Ile Ile Gly Ala Ser Lys Phe Gly Gly
    625 630 635 640
    Leu Ser Pro Asp Gly Arg Ala Tyr Thr Phe Asp Ala Arg Ala Asn Gly
    645 650 655
    Tyr Val Arg Gly Glu Gly Gly Gly Phe Val Val Leu Lys Arg Leu Ser
    660 665 670
    Arg Ala Val Ala Asp Gly Asp Pro Val Leu Ala Val Ile Arg Gly Ser
    675 680 685
    Ala Val Asn Asn Gly Gly Ala Ala Gln Gly Met Thr Thr Pro Asp Ala
    690 695 700
    Gln Ala Gln Glu Ala Val Leu Arg Glu Ala His Glu Arg Ala Gly Thr
    705 710 715 720
    Ala Pro Ala Asp Val Arg Tyr Val Glu Leu His Gly Thr Gly Thr Pro
    725 730 735
    Val Gly Asp Pro Ile Glu Ala Ala Ala Leu Gly Ala Ala Leu Gly Thr
    740 745 750
    Gly Arg Pro Ala Gly Gln Pro Leu Leu Val Gly Ser Val Lys Thr Asn
    755 760 765
    Ile Gly His Leu Glu Gly Ala Ala Gly Ile Ala Gly Leu Ile Lys Ala
    770 775 780
    Val Leu Ala Val Arg Gly Arg Ala Leu Pro Ala Ser Leu Asn Tyr Glu
    785 790 795 800
    Thr Pro Asn Pro Ala Ile Pro Phe Glu Glu Leu Asn Leu Arg Val Asn
    805 810 815
    Thr Glu Tyr Leu Pro Trp Glu Pro Glu His Asp Gly Gln Arg Met Val
    820 825 830
    Val Gly Val Ser Ser Phe Gly Met Gly Gly Thr Asn Ala His Val Val
    835 840 845
    Leu Glu Glu Ala Pro Gly Gly Cys Arg Gly Ala Ser Val Val Glu Ser
    850 855 860
    Thr Val Gly Gly Ser Ala Val Gly Gly Gly Val Val Pro Trp Val Val
    865 870 875 880
    Ser Ala Lys Ser Ala Ala Ala Leu Asp Ala Gln Ile Glu Arg Leu Ala
    885 890 895
    Ala Phe Ala Ser Arg Asp Arg Thr Asp Gly Val Asp Ala Gly Ala Val
    900 905 910
    Asp Ala Gly Ala Val Asp Ala Gly Ala Val Ala Arg Val Leu Ala Gly
    915 920 925
    Gly Arg Ala Gln Phe Glu His Arg Ala Val Val Val Gly Ser Gly Pro
    930 935 940
    Asp Asp Leu Ala Ala Ala Leu Ala Ala Pro Glu Gly Leu Val Arg Gly
    945 950 955 960
    Val Ala Ser Gly Val Gly Arg Val Ala Phe Val Phe Pro Gly Gln Gly
    965 970 975
    Thr Gln Trp Ala Gly Met Gly Ala Glu Leu Leu Asp Ser Ser Ala Val
    980 985 990
    Phe Ala Ala Ala Met Ala Glu Cys Glu Ala Ala Leu Ser Pro Tyr Val
    995 1000 1005
    Asp Trp Ser Leu Glu Ala Val Val Arg Gln Ala Pro Gly Ala Pro Thr
    1010 1015 1020
    Leu Glu Arg Val Asp Val Val Gln Pro Val Thr Phe Ala Val Met Val
    1025 1030 1035 1040
    Ser Leu Ala Arg Val Trp Gln His His Gly Val Thr Pro Gln Ala Val
    1045 1050 1055
    Val Gly His Ser Gln Gly Glu Ile Ala Ala Ala Tyr Val Ala Gly Ala
    1060 1065 1070
    Leu Ser Leu Asp Asp Ala Ala Arg Val Val Thr Leu Arg Ser Lys Ser
    1075 1080 1085
    Ile Ala Ala His Leu Ala Gly Lys Gly Gly Met Leu Ser Leu Ala Leu
    1090 1095 1100
    Ser Glu Asp Ala Val Leu Glu Arg Leu Ala Gly Phe Asp Gly Leu Ser
    1105 1110 1115 1120
    Val Ala Ala Val Asn Gly Pro Thr Ala Thr Val Val Ser Gly Asp Pro
    1125 1130 1135
    Val Gln Ile Glu Glu Leu Ala Arg Ala Cys Glu Ala Asp Gly Val Arg
    1140 1145 1150
    Ala Arg Val Ile Pro Val Asp Tyr Ala Ser His Ser Arg Gln Val Glu
    1155 1160 1165
    Ile Ile Glu Ser Glu Leu Ala Glu Val Leu Ala Gly Leu Ser Pro Gln
    1170 1175 1180
    Ala Pro Arg Val Pro Phe Phe Ser Thr Leu Glu Gly Ala Trp Ile Thr
    1185 1190 1195 1200
    Glu Pro Val Leu Asp Gly Gly Tyr Trp Tyr Arg Asn Leu Arg His Arg
    1205 1210 1215
    Val Gly Phe Ala Pro Ala Val Glu Thr Leu Ala Thr Asp Glu Gly Phe
    1220 1225 1230
    Thr His Phe Val Glu Val Ser Ala His Pro Val Leu Thr Met Ala Leu
    1235 1240 1245
    Pro Gly Thr Val Thr Gly Leu Ala Thr Leu Arg Arg Asp Asn Gly Gly
    1250 1255 1260
    Gln Asp Arg Leu Val Ala Ser Leu Ala Glu Ala Trp Ala Asn Gly Leu
    1265 1270 1275 1280
    Ala Val Asp Trp Ser Pro Leu Leu Pro Ser Ala Thr Gly His His Ser
    1285 1290 1295
    Asp Leu Pro Thr Tyr Ala Phe Gln Thr Glu Arg His Trp Leu Gly Glu
    1300 1305 1310
    Ile Glu Ala Leu Ala Pro Ala Gly Glu Pro Ala Val Gln Pro Ala Val
    1315 1320 1325
    Leu Arg Thr Glu Ala Ala Glu Pro Ala Glu Leu Asp Arg Asp Glu Gln
    1330 1335 1340
    Leu Arg Val Ile Leu Asp Lys Val Arg Ala Gln Thr Ala Gln Val Leu
    1345 1350 1355 1360
    Gly Tyr Ala Thr Gly Gly Gln Ile Glu Val Asp Arg Thr Phe Arg Glu
    1365 1370 1375
    Ala Gly Cys Thr Ser Leu Thr Gly Val Asp Leu Arg Asn Arg Ile Asn
    1380 1385 1390
    Ala Ala Phe Gly Val Arg Met Ala Pro Ser Met Ile Phe Asp Phe Pro
    1395 1400 1405
    Thr Pro Glu Ala Leu Ala Glu Gln Leu Leu Leu Val Val His Gly Glu
    1410 1415 1420
    Ala Ala Ala Asn Pro Ala Gly Ala Glu Pro Ala Pro Val Ala Ala Ala
    1425 1430 1435 1440
    Gly Ala Val Asp Glu Pro Val Ala Ile Val Gly Met Ala Cys Arg Leu
    1445 1450 1455
    Pro Gly Gly Val Ala Ser Pro Glu Asp Leu Trp Arg Leu Val Ala Gly
    1460 1465 1470
    Gly Gly Asp Ala Ile Ser Glu Phe Pro Gln Asp Arg Gly Trp Asp Val
    1475 1480 1485
    Glu Gly Leu Tyr His Pro Asp Pro Glu His Pro Gly Thr Ser Tyr Val
    1490 1495 1500
    Arg Gln Gly Gly Phe Ile Glu Asn Val Ala Gly Phe Asp Ala Ala Phe
    1505 1510 1515 1520
    Phe Gly Ile Ser Pro Arg Glu Ala Leu Ala Met Asp Pro Gln Gln Arg
    1525 1530 1535
    Leu Leu Leu Glu Thr Ser Trp Glu Ala Val Glu Asp Ala Gly Ile Asp
    1540 1545 1550
    Pro Thr Ser Leu Arg Gly Arg Gln Val Gly Val Phe Thr Gly Ala Met
    1555 1560 1565
    Thr His Glu Tyr Gly Pro Ser Leu Arg Asp Gly Gly Glu Gly Leu Asp
    1570 1575 1580
    Gly Tyr Leu Leu Thr Gly Asn Thr Ala Ser Val Met Ser Gly Arg Val
    1585 1590 1595 1600
    Ser Tyr Thr Leu Gly Leu Glu Gly Pro Ala Leu Thr Val Asp Thr Ala
    1605 1610 1615
    Cys Ser Ser Ser Leu Val Ala Leu His Leu Ala Val Gln Ala Leu Arg
    1620 1625 1630
    Lys Gly Glu Val Asp Met Ala Leu Ala Gly Gly Val Ala Val Met Pro
    1635 1640 1645
    Thr Pro Gly Met Phe Val Glu Phe Ser Arg Gln Arg Gly Leu Ala Gly
    1650 1655 1660
    Asp Gly Arg Ser Lys Ala Phe Ala Ala Ser Ala Asp Gly Thr Ser Trp
    1665 1670 1675 1680
    Ser Glu Gly Val Gly Val Leu Leu Val Glu Arg Leu Ser Asp Ala Arg
    1685 1690 1695
    Arg Asn Gly His Gln Val Leu Ala Val Val Arg Gly Ser Ala Leu Asn
    1700 1705 1710
    Gln Asp Gly Ala Ser Asn Gly Leu Thr Ala Pro Asn Gly Pro Ser Gln
    1715 1720 1725
    Gln Arg Val Ile Arg Arg Ala Leu Ala Asp Ala Arg Leu Thr Thr Ser
    1730 1735 1740
    Asp Val Asp Val Val Glu Ala His Gly Thr Gly Thr Arg Leu Gly Asp
    1745 1750 1755 1760
    Pro Ile Glu Ala Gln Ala Leu Ile Ala Thr Tyr Gly Gln Gly Arg Asp
    1765 1770 1775
    Asp Glu Gln Pro Leu Arg Leu Gly Ser Leu Lys Ser Asn Ile Gly His
    1780 1785 1790
    Thr Gln Ala Ala Ala Gly Val Ser Gly Val Ile Lys Met Val Gln Ala
    1795 1800 1805
    Met Arg His Gly Leu Leu Pro Lys Thr Leu His Val Asp Glu Pro Ser
    1810 1815 1820
    Asp Gln Ile Asp Trp Ser Ala Gly Ala Val Glu Leu Leu Thr Glu Ala
    1825 1830 1835 1840
    Val Asp Trp Pro Glu Lys Gln Asp Gly Gly Leu Arg Arg Ala Ala Val
    1845 1850 1855
    Ser Ser Phe Gly Ile Ser Gly Thr Asn Ala His Val Val Leu Glu Glu
    1860 1865 1870
    Ala Pro Val Val Val Glu Gly Ala Ser Val Val Glu Pro Ser Val Gly
    1875 1880 1885
    Gly Ser Ala Val Gly Gly Gly Val Thr Pro Trp Val Val Ser Ala Lys
    1890 1895 1900
    Ser Ala Ala Ala Leu Asp Ala Gln Ile Glu Arg Leu Ala Ala Phe Ala
    1905 1910 1915 1920
    Ser Arg Asp Arg Thr Asp Asp Ala Asp Ala Gly Ala Val Asp Ala Gly
    1925 1930 1935
    Ala Val Ala His Val Leu Ala Asp Gly Arg Ala Gln Phe Glu His Arg
    1940 1945 1950
    Ala Val Ala Leu Gly Ala Gly Ala Asp Asp Leu Val Gln Ala Leu Ala
    1955 1960 1965
    Asp Pro Asp Gly Leu Ile Arg Gly Thr Ala Ser Gly Val Gly Arg Val
    1970 1975 1980
    Ala Phe Val Phe Pro Gly Gln Gly Thr Gln Trp Ala Gly Met Gly Ala
    1985 1990 1995 2000
    Glu Leu Leu Asp Ser Ser Ala Val Phe Ala Ala Ala Met Ala Glu Cys
    2005 2010 2015
    Glu Ala Ala Leu Ser Pro Tyr Val Asp Trp Ser Leu Glu Ala Val Val
    2020 2025 2030
    Arg Gln Ala Pro Gly Ala Pro Thr Leu Glu Arg Val Asp Val Val Gln
    2035 2040 2045
    Pro Val Thr Phe Ala Val Met Val Ser Leu Ala Arg Val Trp Gln His
    2050 2055 2060
    His Gly Val Thr Pro Gln Ala Val Val Gly His Ser Gln Gly Glu Ile
    2065 2070 2075 2080
    Ala Ala Ala Tyr Val Ala Gly Ala Leu Pro Leu Asp Asp Ala Ala Arg
    2085 2090 2095
    Val Val Thr Leu Arg Ser Lys Ser Ile Ala Ala His Leu Ala Gly Lys
    2100 2105 2110
    Gly Gly Met Leu Ser Leu Ala Leu Asn Glu Asp Ala Val Leu Glu Arg
    2115 2120 2125
    Leu Ser Asp Phe Asp Gly Leu Ser Val Ala Ala Val Asn Gly Pro Thr
    2130 2135 2140
    Ala Thr Val Val Ser Gly Asp Pro Val Gln Ile Glu Glu Leu Ala Gln
    2145 2150 2155 2160
    Ala Cys Lys Ala Asp Gly Phe Arg Ala Arg Ile Ile Pro Val Asp Tyr
    2165 2170 2175
    Ala Ser His Ser Arg Gln Val Glu Ile Ile Glu Ser Glu Leu Ala Gln
    2180 2185 2190
    Val Leu Ala Gly Leu Ser Pro Gln Ala Pro Arg Val Pro Phe Phe Ser
    2195 2200 2205
    Thr Leu Glu Gly Thr Trp Ile Thr Glu Pro Val Leu Asp Gly Thr Tyr
    2210 2215 2220
    Trp Tyr Arg Asn Leu Arg His Arg Val Gly Phe Ala Pro Ala Ile Glu
    2225 2230 2235 2240
    Thr Leu Ala Val Asp Glu Gly Phe Thr His Phe Val Glu Val Ser Ala
    2245 2250 2255
    His Pro Val Leu Thr Met Thr Leu Pro Glu Thr Val Thr Gly Leu Gly
    2260 2265 2270
    Thr Leu Arg Arg Glu Gln Gly Gly Gln Glu Arg Leu Val Thr Ser Leu
    2275 2280 2285
    Ala Glu Ala Trp Val Asn Gly Leu Pro Val Ala Trp Thr Ser Leu Leu
    2290 2295 2300
    Pro Ala Thr Ala Ser Arg Pro Gly Leu Pro Thr Tyr Ala Phe Gln Ala
    2305 2310 2315 2320
    Glu Arg Tyr Trp Leu Glu Asn Thr Pro Ala Ala Leu Ala Thr Gly Asp
    2325 2330 2335
    Asp Trp Arg Tyr Arg Ile Asp Trp Lys Arg Leu Pro Ala Ala Glu Gly
    2340 2345 2350
    Ser Glu Arg Thr Gly Leu Ser Gly Arg Trp Leu Ala Val Thr Pro Glu
    2355 2360 2365
    Asp His Ser Ala Gln Ala Ala Ala Val Leu Thr Ala Leu Val Asp Ala
    2370 2375 2380
    Gly Ala Lys Val Glu Val Leu Thr Ala Gly Ala Asp Asp Asp Arg Glu
    2385 2390 2395 2400
    Ala Leu Ala Ala Arg Leu Thr Ala Leu Thr Thr Gly Asp Gly Phe Thr
    2405 2410 2415
    Gly Val Val Ser Leu Leu Asp Gly Leu Val Pro Gln Val Ala Trp Val
    2420 2425 2430
    Gln Ala Leu Gly Asp Ala Gly Ile Lys Ala Pro Leu Trp Ser Val Thr
    2435 2440 2445
    Gln Gly Ala Val Ser Val Gly Arg Leu Asp Thr Pro Ala Asp Pro Asp
    2450 2455 2460
    Arg Ala Met Leu Trp Gly Leu Gly Arg Val Val Ala Leu Glu His Pro
    2465 2470 2475 2480
    Glu Arg Trp Ala Gly Leu Val Asp Leu Pro Ala Gln Pro Asp Ala Ala
    2485 2490 2495
    Ala Leu Ala His Leu Val Thr Ala Leu Ser Gly Ala Thr Gly Glu Asp
    2500 2505 2510
    Gln Ile Ala Ile Arg Thr Thr Gly Leu His Ala Arg Arg Leu Ala Arg
    2515 2520 2525
    Ala Pro Leu His Gly Arg Arg Pro Thr Arg Asp Trp Gln Pro His Gly
    2530 2535 2540
    Thr Val Leu Ile Thr Gly Gly Thr Gly Ala Leu Gly Ser His Ala Ala
    2545 2550 2555 2560
    Arg Trp Met Ala His His Gly Ala Glu His Leu Leu Leu Val Ser Arg
    2565 2570 2575
    Ser Gly Glu Gln Ala Pro Gly Ala Thr Gln Leu Thr Ala Glu Leu Thr
    2580 2585 2590
    Ala Ser Gly Ala Arg Val Thr Ile Ala Ala Cys Asp Val Ala Asp Pro
    2595 2600 2605
    His Ala Met Arg Thr Leu Leu Asp Ala Ile Pro Ala Glu Thr Pro Leu
    2610 2615 2620
    Thr Ala Val Val His Thr Ala Gly Ala Leu Asp Asp Gly Ile Val Asp
    2625 2630 2635 2640
    Thr Leu Thr Ala Glu Gln Val Arg Arg Ala His Arg Ala Lys Ala Val
    2645 2650 2655
    Gly Ala Ser Val Leu Asp Glu Leu Thr Arg Asp Leu Asp Leu Asp Ala
    2660 2665 2670
    Phe Val Leu Phe Ser Ser Val Ser Ser Thr Leu Gly Ile Pro Gly Gln
    2675 2680 2685
    Gly Asn Tyr Ala Pro His Asn Ala Tyr Leu Asp Ala Leu Ala Ala Arg
    2690 2695 2700
    Arg Arg Ala Thr Gly Arg Ser Ala Val Ser Val Ala Trp Gly Pro Trp
    2705 2710 2715 2720
    Asp Gly Gly Gly Met Ala Ala Gly Asp Gly Val Ala Glu Arg Leu Arg
    2725 2730 2735
    Asn His Gly Val Pro Gly Met Asp Pro Glu Leu Ala Leu Ala Ala Leu
    2740 2745 2750
    Glu Ser Ala Leu Gly Arg Asp Glu Thr Ala Ile Thr Val Ala Asp Ile
    2755 2760 2765
    Asp Trp Asp Arg Phe Tyr Leu Ala Tyr Ser Ser Gly Arg Pro Gln Pro
    2770 2775 2780
    Leu Val Glu Glu Leu Pro Glu Val Arg Arg Ile Ile Asp Ala Arg Asp
    2785 2790 2795 2800
    Ser Ala Thr Ser Gly Gln Gly Gly Ser Ser Ala Gln Gly Ala Asn Pro
    2805 2810 2815
    Leu Ala Glu Arg Leu Ala Ala Ala Ala Pro Gly Glu Arg Thr Glu Ile
    2820 2825 2830
    Leu Leu Gly Leu Val Arg Ala Gln Ala Ala Ala Val Leu Arg Met Arg
    2835 2840 2845
    Ser Pro Glu Asp Val Ala Ala Asp Arg Ala Phe Lys Asp Ile Gly Phe
    2850 2855 2860
    Asp Ser Leu Ala Gly Val Glu Leu Arg Asn Arg Leu Thr Arg Ala Thr
    2865 2870 2875 2880
    Gly Leu Gln Leu Pro Ala Thr Leu Val Phe Asp His Pro Thr Pro Leu
    2885 2890 2895
    Ala Leu Val Ser Leu Leu Arg Ser Glu Phe Leu Gly Asp Glu Glu Thr
    2900 2905 2910
    Ala Asp Ala Arg Arg Ser Ala Ala Leu Pro Ala Thr Val Gly Ala Gly
    2915 2920 2925
    Ala Gly Ala Gly Ala Gly Thr Asp Ala Asp Asp Asp Pro Ile Ala Ile
    2930 2935 2940
    Val Ala Met Ser Cys Arg Tyr Pro Gly Asp Ile Arg Ser Pro Glu Asp
    2945 2950 2955 2960
    Leu Trp Arg Met Leu Ser Glu Gly Gly Glu Gly Ile Thr Pro Phe Pro
    2965 2970 2975
    Thr Asp Arg Gly Trp Asp Leu Asp Gly Leu Tyr Asp Ala Asp Pro Asp
    2980 2985 2990
    Ala Leu Gly Arg Ala Tyr Val Arg Glu Gly Gly Phe Leu His Asp Ala
    2995 3000 3005
    Ala Glu Phe Asp Ala Glu Phe Phe Gly Val Ser Pro Arg Glu Ala Leu
    3010 3015 3020
    Ala Met Asp Pro Gln Gln Arg Met Leu Leu Thr Thr Ser Trp Glu Ala
    3025 3030 3035 3040
    Phe Glu Arg Ala Gly Ile Glu Pro Ala Ser Leu Arg Gly Ser Ser Thr
    3045 3050 3055
    Gly Val Phe Ile Gly Leu Ser Tyr Gln Asp Tyr Ala Ala Arg Val Pro
    3060 3065 3070
    Asn Ala Pro Arg Gly Val Glu Gly Tyr Leu Leu Thr Gly Ser Thr Pro
    3075 3080 3085
    Ser Val Ala Ser Gly Arg Ile Ala Tyr Thr Phe Gly Leu Glu Gly Pro
    3090 3095 3100
    Ala Thr Thr Val Asp Thr Ala Cys Ser Ser Ser Leu Thr Ala Leu His
    3105 3110 3115 3120
    Leu Ala Val Arg Ala Leu Arg Ser Gly Glu Cys Thr Met Ala Leu Ala
    3125 3130 3135
    Gly Gly Val Ala Met Met Ala Thr Pro His Met Phe Val Glu Phe Ser
    3140 3145 3150
    Arg Gln Arg Ala Leu Ala Pro Asp Gly Arg Ser Lys Ala Phe Ser Ala
    3155 3160 3165
    Asp Ala Asp Gly Phe Gly Ala Ala Glu Gly Val Gly Leu Leu Leu Val
    3170 3175 3180
    Glu Arg Leu Ser Asp Ala Arg Arg Asn Gly His Pro Val Leu Ala Val
    3185 3190 3195 3200
    Val Arg Gly Thr Ala Val Asn Gln Asp Gly Ala Ser Asn Gly Leu Thr
    3205 3210 3215
    Ala Pro Asn Gly Pro Ser Gln Gln Arg Val Ile Arg Gln Ala Leu Ala
    3220 3225 3230
    Asp Ala Arg Leu Ala Pro Gly Asp Ile Asp Ala Val Glu Thr His Gly
    3235 3240 3245
    Thr Gly Thr Ser Leu Gly Asp Pro Ile Glu Ala Gln Gly Leu Gln Ala
    3250 3255 3260
    Thr Tyr Gly Lys Glu Arg Pro Ala Glu Arg Pro Leu Ala Ile Gly Ser
    3265 3270 3275 3280
    Val Lys Ser Asn Ile Gly His Thr Gln Ala Ala Ala Gly Ala Ala Gly
    3285 3290 3295
    Ile Ile Lys Met Val Leu Ala Met Arg His Gly Thr Leu Pro Lys Thr
    3300 3305 3310
    Leu His Ala Asp Glu Pro Ser Pro His Val Asp Trp Ala Asn Ser Gly
    3315 3320 3325
    Leu Ala Leu Val Thr Glu Pro Ile Asp Trp Pro Ala Gly Thr Gly Pro
    3330 3335 3340
    Arg Arg Ala Ala Val Ser Ser Phe Gly Ile Ser Gly Thr Asn Ala His
    3345 3350 3355 3360
    Val Val Leu Glu Gln Ala Pro Asp Ala Ala Gly Glu Val Leu Gly Ala
    3365 3370 3375
    Asp Glu Val Pro Glu Val Ser Glu Thr Val Ala Met Ala Gly Thr Ala
    3380 3385 3390
    Gly Thr Ser Glu Val Ala Glu Gly Ser Glu Ala Ser Glu Ala Pro Ala
    3395 3400 3405
    Ala Pro Gly Ser Arg Glu Ala Ser Leu Pro Gly His Leu Pro Trp Val
    3410 3415 3420
    Leu Ser Ala Lys Asp Glu Gln Ser Leu Arg Gly Gln Ala Ala Ala Leu
    3425 3430 3435 3440
    His Ala Trp Leu Ser Glu Pro Ala Ala Asp Leu Ser Asp Ala Asp Gly
    3445 3450 3455
    Pro Ala Arg Leu Arg Asp Val Gly Tyr Thr Leu Ala Thr Ser Arg Thr
    3460 3465 3470
    Ala Phe Ala His Arg Ala Ala Val Thr Ala Ala Asp Arg Asp Gly Phe
    3475 3480 3485
    Leu Asp Gly Leu Ala Thr Leu Ala Gln Gly Gly Thr Ser Ala His Val
    3490 3495 3500
    His Leu Asp Thr Ala Arg Asp Gly Thr Thr Ala Phe Leu Phe Thr Gly
    3505 3510 3515 3520
    Gln Gly Ser Gln Arg Pro Gly Ala Gly Arg Glu Leu Tyr Asp Arg His
    3525 3530 3535
    Pro Val Phe Ala Arg Ala Leu Asp Glu Ile Cys Ala His Leu Asp Gly
    3540 3545 3550
    His Leu Glu Leu Pro Leu Leu Asp Val Met Phe Ala Ala Glu Gly Ser
    3555 3560 3565
    Ala Glu Ala Ala Leu Leu Asp Glu Thr Arg Tyr Thr Gln Cys Ala Leu
    3570 3575 3580
    Phe Ala Leu Glu Val Ala Leu Phe Arg Leu Val Glu Ser Trp Gly Met
    3585 3590 3595 3600
    Arg Pro Ala Ala Leu Leu Gly His Ser Val Gly Glu Ile Ala Ala Ala
    3605 3610 3615
    His Val Ala Gly Val Phe Ser Leu Ala Asp Ala Ala Arg Leu Val Ala
    3620 3625 3630
    Ala Arg Gly Arg Leu Met Gln Glu Leu Pro Ala Gly Gly Ala Met Leu
    3635 3640 3645
    Ala Val Gln Ala Ala Glu Asp Glu Ile Arg Val Trp Leu Glu Thr Glu
    3650 3655 3660
    Glu Arg Tyr Ala Gly Arg Leu Asp Val Ala Ala Val Asn Gly Pro Glu
    3665 3670 3675 3680
    Ala Ala Val Leu Ser Gly Asp Ala Asp Ala Ala Arg Glu Ala Glu Ala
    3685 3690 3695
    Tyr Trp Ser Gly Leu Gly Arg Arg Thr Arg Ala Leu Arg Val Ser His
    3700 3705 3710
    Ala Phe His Ser Ala His Met Asp Gly Met Leu Asp Gly Phe Arg Ala
    3715 3720 3725
    Val Leu Glu Thr Val Glu Phe Arg Arg Pro Ser Leu Thr Val Val Ser
    3730 3735 3740
    Asn Val Thr Gly Leu Ala Ala Gly Pro Asp Asp Leu Cys Asp Pro Glu
    3745 3750 3755 3760
    Tyr Trp Val Arg His Val Arg Gly Thr Val Arg Phe Leu Asp Gly Val
    3765 3770 3775
    Arg Val Leu Arg Asp Leu Gly Val Arg Thr Cys Leu Glu Leu Gly Pro
    3780 3785 3790
    Asp Gly Val Leu Thr Ala Met Ala Ala Asp Gly Leu Ala Asp Thr Pro
    3795 3800 3805
    Ala Asp Ser Ala Ala Gly Ser Pro Val Gly Ser Pro Ala Gly Ser Pro
    3810 3815 3820
    Ala Asp Ser Ala Ala Gly Ala Leu Arg Pro Arg Pro Leu Leu Val Ala
    3825 3830 3835 3840
    Leu Leu Arg Arg Lys Arg Ser Glu Thr Glu Thr Val Ala Asp Ala Leu
    3845 3850 3855
    Gly Arg Ala His Ala His Gly Thr Gly Pro Asp Trp His Ala Trp Phe
    3860 3865 3870
    Ala Gly Ser Gly Ala His Arg Val Asp Leu Pro Thr Tyr Ser Phe Arg
    3875 3880 3885
    Arg Asp Arg Tyr Trp Leu Asp Ala Pro Ala Ala Asp Thr Ala Val Asp
    3890 3895 3900
    Thr Ala Gly Leu Gly Leu Gly Thr Ala Asp His Pro Leu Leu Gly Ala
    3905 3910 3915 3920
    Val Val Ser Leu Pro Asp Arg Asp Gly Leu Leu Leu Thr Gly Arg Leu
    3925 3930 3935
    Ser Leu Arg Thr His Pro Trp Leu Ala Asp His Ala Val Leu Gly Ser
    3940 3945 3950
    Val Leu Leu Pro Gly Ala Ala Met Val Glu Leu Ala Ala His Ala Ala
    3955 3960 3965
    Glu Ser Ala Gly Leu Arg Asp Val Arg Glu Leu Thr Leu Leu Glu Pro
    3970 3975 3980
    Leu Val Leu Pro Glu His Gly Gly Val Glu Leu Arg Val Thr Val Gly
    3985 3990 3995 4000
    Ala Pro Ala Gly Glu Pro Gly Gly Glu Ser Ala Gly Asp Gly Ala Arg
    4005 4010 4015
    Pro Val Ser Leu His Ser Arg Leu Ala Asp Ala Pro Ala Gly Thr Ala
    4020 4025 4030
    Trp Ser Cys His Ala Thr Gly Leu Leu Ala Thr Asp Arg Pro Glu Leu
    4035 4040 4045
    Pro Val Ala Pro Asp Arg Ala Ala Met Trp Pro Pro Gln Gly Ala Glu
    4050 4055 4060
    Glu Val Pro Leu Asp Gly Leu Tyr Glu Arg Leu Asp Gly Asn Gly Leu
    4065 4070 4075 4080
    Ala Phe Gly Pro Leu Phe Gln Gly Leu Asn Ala Val Trp Arg Tyr Glu
    4085 4090 4095
    Gly Glu Val Phe Ala Asp Ile Ala Leu Pro Ala Thr Thr Asn Ala Thr
    4100 4105 4110
    Ala Pro Ala Thr Ala Asn Gly Gly Gly Ser Ala Ala Ala Ala Pro Tyr
    4115 4120 4125
    Gly Ile His Pro Ala Leu Leu Asp Ala Ser Leu His Ala Ile Ala Val
    4130 4135 4140
    Gly Gly Leu Val Asp Glu Pro Glu Leu Val Arg Val Pro Phe His Trp
    4145 4150 4155 4160
    Ser Gly Val Thr Val His Ala Ala Gly Ala Ala Ala Ala Arg Val Arg
    4165 4170 4175
    Leu Ala Ser Ala Gly Thr Asp Ala Val Ser Leu Ser Leu Thr Asp Gly
    4180 4185 4190
    Glu Gly Arg Pro Leu Val Ser Val Glu Arg Leu Thr Leu Arg Pro Val
    4195 4200 4205
    Thr Ala Asp Gln Ala Ala Ala Ser Arg Val Gly Gly Leu Met His Arg
    4210 4215 4220
    Val Ala Trp Arg Pro Tyr Ala Leu Ala Ser Ser Gly Glu Gln Asp Pro
    4225 4230 4235 4240
    His Ala Thr Ser Tyr Gly Pro Thr Ala Val Leu Gly Lys Asp Glu Leu
    4245 4250 4255
    Lys Val Ala Ala Ala Leu Glu Ser Ala Gly Val Glu Val Gly Leu Tyr
    4260 4265 4270
    Pro Asp Leu Ala Ala Leu Ser Gln Asp Val Ala Ala Gly Ala Pro Ala
    4275 4280 4285
    Pro Arg Thr Val Leu Ala Pro Leu Pro Ala Gly Pro Ala Asp Gly Gly
    4290 4295 4300
    Ala Glu Gly Val Arg Gly Thr Val Ala Arg Thr Leu Glu Leu Leu Gln
    4305 4310 4315 4320
    Ala Trp Leu Ala Asp Glu His Leu Ala Gly Thr Arg Leu Leu Leu Val
    4325 4330 4335
    Thr Arg Gly Ala Val Arg Asp Pro Glu Gly Ser Gly Ala Asp Asp Gly
    4340 4345 4350
    Gly Glu Asp Leu Ser His Ala Ala Ala Trp Gly Leu Val Arg Thr Ala
    4355 4360 4365
    Gln Thr Glu Asn Pro Gly Arg Phe Gly Leu Leu Asp Leu Ala Asp Asp
    4370 4375 4380
    Ala Ser Ser Tyr Arg Thr Leu Pro Ser Val Leu Ser Asp Ala Gly Leu
    4385 4390 4395 4400
    Arg Asp Glu Pro Gln Leu Ala Leu His Asp Gly Thr Ile Arg Leu Ala
    4405 4410 4415
    Arg Leu Ala Ser Val Arg Pro Glu Thr Gly Thr Ala Ala Pro Ala Leu
    4420 4425 4430
    Ala Pro Glu Gly Thr Val Leu Leu Thr Gly Gly Thr Gly Gly Leu Gly
    4435 4440 4445
    Gly Leu Val Ala Arg His Val Val Gly Glu Trp Gly Val Arg Arg Leu
    4450 4455 4460
    Leu Leu Val Ser Arg Arg Gly Thr Asp Ala Pro Gly Ala Asp Glu Leu
    4465 4470 4475 4480
    Val His Glu Leu Glu Ala Leu Gly Ala Asp Val Ser Val Ala Ala Cys
    4485 4490 4495
    Asp Val Ala Asp Arg Glu Ala Leu Thr Ala Val Leu Asp Ala Ile Pro
    4500 4505 4510
    Ala Glu His Pro Leu Thr Ala Val Val His Thr Ala Gly Val Leu Ser
    4515 4520 4525
    Asp Gly Thr Leu Pro Ser Met Thr Thr Glu Asp Val Glu His Val Leu
    4530 4535 4540
    Arg Pro Lys Val Asp Ala Ala Phe Leu Leu Asp Glu Leu Thr Ser Thr
    4545 4550 4555 4560
    Pro Ala Tyr Asp Leu Ala Ala Phe Val Met Phe Ser Ser Ala Ala Ala
    4565 4570 4575
    Val Phe Gly Gly Ala Gly Gln Gly Ala Tyr Ala Ala Ala Asn Ala Thr
    4580 4585 4590
    Leu Asp Ala Leu Ala Trp Arg Arg Arg Ala Ala Gly Leu Pro Ala Leu
    4595 4600 4605
    Ser Leu Gly Trp Gly Leu Trp Ala Glu Thr Ser Gly Met Thr Gly Glu
    4610 4615 4620
    Leu Gly Gln Ala Asp Leu Arg Arg Met Ser Arg Ala Gly Ile Gly Gly
    4625 4630 4635 4640
    Ile Ser Asp Ala Glu Gly Ile Ala Leu Leu Asp Ala Ala Leu Arg Asp
    4645 4650 4655
    Asp Arg His Pro Val Leu Leu Pro Leu Arg Leu Asp Ala Ala Gly Leu
    4660 4665 4670
    Arg Asp Ala Ala Gly Asn Asp Pro Ala Gly Ile Pro Ala Leu Phe Arg
    4675 4680 4685
    Asp Val Val Gly Ala Arg Thr Val Arg Ala Arg Pro Ser Ala Ala Ser
    4690 4695 4700
    Ala Ser Thr Thr Ala Gly Thr Ala Gly Thr Pro Gly Thr Ala Asp Gly
    4705 4710 4715 4720
    Ala Ala Glu Thr Ala Ala Val Thr Leu Ala Asp Arg Ala Ala Thr Val
    4725 4730 4735
    Asp Gly Pro Ala Arg Gln Arg Leu Leu Leu Glu Phe Val Val Gly Glu
    4740 4745 4750
    Val Ala Glu Val Leu Gly His Ala Arg Gly His Arg Ile Asp Ala Glu
    4755 4760 4765
    Arg Gly Phe Leu Asp Leu Gly Phe Asp Ser Leu Thr Ala Val Glu Leu
    4770 4775 4780
    Arg Asn Arg Leu Asn Ser Ala Gly Gly Leu Ala Leu Pro Ala Thr Leu
    4785 4790 4795 4800
    Val Phe Asp His Pro Ser Pro Ala Ala Leu Ala Ser His Leu Asp Ala
    4805 4810 4815
    Glu Leu Pro Arg Gly Ala Ser Asp Gln Asp Gly Ala Gly Asn Arg Asn
    4820 4825 4830
    Gly Asn Glu Asn Gly Thr Thr Ala Ser Arg Ser Thr Ala Glu Thr Asp
    4835 4840 4845
    Ala Leu Leu Ala Gln Leu Thr Arg Leu Glu Gly Ala Leu Val Leu Thr
    4850 4855 4860
    Gly Leu Ser Asp Ala Pro Gly Ser Glu Glu Val Leu Glu His Leu Arg
    4865 4870 4875 4880
    Ser Leu Arg Ser Met Val Thr Gly Glu Thr Gly Thr Gly Thr Ala Ser
    4885 4890 4895
    Gly Ala Pro Asp Gly Ala Gly Ser Gly Ala Glu Asp Arg Pro Trp Ala
    4900 4905 4910
    Ala Gly Asp Gly Ala Gly Gly Gly Ser Glu Asp Gly Ala Gly Val Pro
    4915 4920 4925
    Asp Phe Met Asn Ala Ser Ala Glu Glu Leu Phe Gly Leu Leu Asp Gln
    4930 4935 4940
    Asp Pro Ser Thr Asp Met Ser Thr Val Asn Glu Glu Lys Tyr Leu Asp
    4945 4950 4955 4960
    Tyr Leu Arg Arg Ala Thr Ala Asp Leu His Glu Ala Arg Gly Arg Leu
    4965 4970 4975
    Arg Glu Leu Glu Ala Lys Ala Gly Glu Pro Val Ala Ile Val Gly Met
    4980 4985 4990
    Ala Cys Arg Leu Pro Gly Gly Val Ala Ser Pro Glu Asp Leu Trp Arg
    4995 5000 5005
    Leu Val Ala Gly Gly Glu Asp Ala Ile Ser Glu Phe Pro Gln Asp Arg
    5010 5015 5020
    Gly Trp Asp Val Glu Gly Leu Tyr Asp Pro Asn Pro Glu Ala Thr Gly
    5025 5030 5035 5040
    Lys Ser Tyr Ala Arg Glu Ala Gly Phe Leu Tyr Glu Ala Gly Glu Phe
    5045 5050 5055
    Asp Ala Asp Phe Phe Gly Ile Ser Pro Arg Glu Ala Leu Ala Met Asp
    5060 5065 5070
    Pro Gln Gln Arg Leu Leu Leu Glu Ala Ser Trp Glu Ala Phe Glu His
    5075 5080 5085
    Ala Gly Ile Pro Ala Ala Thr Ala Arg Gly Thr Ser Val Gly Val Phe
    5090 5095 5100
    Thr Gly Val Met Tyr His Asp Tyr Ala Thr Arg Leu Thr Asp Val Pro
    5105 5110 5115 5120
    Glu Gly Ile Glu Gly Tyr Leu Gly Thr Gly Asn Ser Gly Ser Val Ala
    5125 5130 5135
    Ser Gly Arg Val Ala Tyr Thr Leu Gly Leu Glu Gly Pro Ala Val Thr
    5140 5145 5150
    Val Asp Thr Ala Cys Ser Ser Ser Leu Val Ala Leu His Leu Ala Val
    5155 5160 5165
    Gln Ala Leu Arg Lys Gly Glu Val Asp Met Ala Leu Ala Gly Gly Val
    5170 5175 5180
    Thr Val Met Ser Thr Pro Ser Thr Phe Val Glu Phe Ser Arg Gln Arg
    5185 5190 5195 5200
    Gly Leu Ala Pro Asp Gly Arg Ser Lys Ser Phe Ser Ser Thr Ala Asp
    5205 5210 5215
    Gly Thr Ser Trp Ser Glu Gly Val Gly Val Leu Leu Val Glu Arg Leu
    5220 5225 5230
    Ser Asp Ala Arg Arg Lys Gly His Arg Ile Leu Ala Val Val Arg Gly
    5235 5240 5245
    Thr Ala Val Asn Gln Asp Gly Ala Ser Ser Gly Leu Thr Ala Pro Asn
    5250 5255 5260
    Gly Pro Ser Gln Gln Arg Val Ile Arg Arg Ala Leu Ala Asp Ala Arg
    5265 5270 5275 5280
    Leu Thr Thr Ser Asp Val Asp Val Val Glu Ala His Gly Thr Gly Thr
    5285 5290 5295
    Arg Leu Gly Asp Pro Ile Glu Ala Gln Ala Val Ile Ala Thr Tyr Gly
    5300 5305 5310
    Gln Gly Arg Asp Gly Glu Gln Pro Leu Arg Leu Gly Ser Leu Lys Ser
    5315 5320 5325
    Asn Ile Gly His Thr Gln Ala Ala Ala Gly Val Ser Gly Val Ile Lys
    5330 5335 5340
    Met Val Gln Ala Met Arg His Gly Val Leu Pro Lys Thr Leu His Val
    5345 5350 5355 5360
    Glu Lys Pro Thr Asp Gln Val Asp Trp Ser Ala Gly Ala Val Glu Leu
    5365 5370 5375
    Leu Thr Glu Ala Met Asp Trp Pro Asp Lys Gly Asp Gly Gly Leu Arg
    5380 5385 5390
    Arg Ala Ala Val Ser Ser Phe Gly Val Ser Gly Thr Asn Ala His Val
    5395 5400 5405
    Val Leu Glu Glu Ala Pro Ala Ala Glu Glu Thr Pro Ala Ser Glu Ala
    5410 5415 5420
    Thr Pro Ala Val Glu Pro Ser Val Gly Ala Gly Leu Val Pro Trp Leu
    5425 5430 5435 5440
    Val Ser Ala Lys Thr Pro Ala Ala Leu Asp Ala Gln Ile Gly Arg Leu
    5445 5450 5455
    Ala Ala Phe Ala Ser Gln Gly Arg Thr Asp Ala Ala Asp Pro Gly Ala
    5460 5465 5470
    Val Ala Arg Val Leu Ala Gly Gly Arg Ala Glu Phe Glu His Arg Ala
    5475 5480 5485
    Val Val Leu Gly Thr Gly Gln Asp Asp Phe Ala Gln Ala Leu Thr Ala
    5490 5495 5500
    Pro Glu Gly Leu Ile Arg Gly Thr Pro Ser Asp Val Gly Arg Val Ala
    5505 5510 5515 5520
    Phe Val Phe Pro Gly Gln Gly Thr Gln Trp Ala Gly Met Gly Ala Glu
    5525 5530 5535
    Leu Leu Asp Val Ser Lys Glu Phe Ala Ala Ala Met Ala Glu Cys Glu
    5540 5545 5550
    Ser Ala Leu Ser Arg Tyr Val Asp Trp Ser Leu Glu Ala Val Val Arg
    5555 5560 5565
    Gln Ala Pro Gly Ala Pro Thr Leu Glu Arg Val Asp Val Val Gln Pro
    5570 5575 5580
    Val Thr Phe Ala Val Met Val Ser Leu Ala Lys Val Trp Gln His His
    5585 5590 5595 5600
    Gly Val Thr Pro Gln Ala Val Val Gly His Ser Gln Gly Glu Ile Ala
    5605 5610 5615
    Ala Ala Tyr Val Ala Gly Ala Leu Thr Leu Asp Asp Ala Ala Arg Val
    5620 5625 5630
    Val Thr Leu Arg Ser Lys Ser Ile Ala Ala His Leu Ala Gly Lys Gly
    5635 5640 5645
    Gly Met Ile Ser Leu Ala Leu Ser Glu Glu Ala Thr Arg Gln Arg Ile
    5650 5655 5660
    Glu Asn Leu His Gly Leu Ser Ile Ala Ala Val Asn Gly Pro Thr Ala
    5665 5670 5675 5680
    Thr Val Val Ser Gly Asp Pro Thr Gln Ile Gln Glu Leu Ala Gln Ala
    5685 5690 5695
    Cys Glu Ala Asp Gly Val Arg Ala Arg Ile Ile Pro Val Asp Tyr Ala
    5700 5705 5710
    Ser His Ser Ala His Val Glu Thr Ile Glu Ser Glu Leu Ala Glu Val
    5715 5720 5725
    Leu Ala Gly Leu Ser Pro Arg Thr Pro Glu Val Pro Phe Phe Ser Thr
    5730 5735 5740
    Leu Glu Gly Ala Trp Ile Thr Glu Pro Val Leu Asp Gly Thr Tyr Trp
    5745 5750 5755 5760
    Tyr Arg Asn Leu Arg His Arg Val Gly Phe Ala Pro Ala Val Glu Thr
    5765 5770 5775
    Leu Ala Thr Asp Glu Gly Phe Thr His Phe Ile Glu Val Ser Ala His
    5780 5785 5790
    Pro Val Leu Thr Met Thr Leu Pro Glu Thr Val Thr Gly Leu Gly Thr
    5795 5800 5805
    Leu Arg Arg Glu Gln Gly Gly Gln Glu Arg Leu Val Thr Ser Leu Ala
    5810 5815 5820
    Glu Ala Trp Thr Asn Gly Leu Thr Ile Asp Trp Ala Pro Val Leu Pro
    5825 5830 5835 5840
    Thr Ala Thr Gly His His Pro Glu Leu Pro Thr Tyr Ala Phe Gln Arg
    5845 5850 5855
    Arg His Tyr Trp Leu His Asp Ser Pro Ala Val Gln Gly Ser Val Gln
    5860 5865 5870
    Asp Ser Trp Arg Tyr Arg Ile Asp Trp Lys Arg Leu Ala Val Ala Asp
    5875 5880 5885
    Ala Ser Glu Arg Ala Gly Leu Ser Gly Arg Trp Leu Val Val Val Pro
    5890 5895 5900
    Glu Asp Arg Ser Ala Glu Ala Ala Pro Val Leu Ala Ala Leu Ser Gly
    5905 5910 5915 5920
    Ala Gly Ala Asp Pro Val Gln Leu Asp Val Ser Pro Leu Gly Asp Arg
    5925 5930 5935
    Gln Arg Leu Ala Ala Thr Leu Gly Glu Ala Leu Ala Ala Ala Gly Gly
    5940 5945 5950
    Ala Val Asp Gly Val Leu Ser Leu Leu Ala Trp Asp Glu Ser Ala His
    5955 5960 5965
    Pro Gly His Pro Ala Pro Phe Thr Arg Gly Thr Gly Ala Thr Leu Thr
    5970 5975 5980
    Leu Val Gln Ala Leu Glu Asp Ala Gly Val Ala Ala Pro Leu Trp Cys
    5985 5990 5995 6000
    Val Thr His Gly Ala Val Ser Val Gly Arg Ala Asp His Val Thr Ser
    6005 6010 6015
    Pro Ala Gln Ala Met Val Trp Gly Met Gly Arg Val Ala Ala Leu Glu
    6020 6025 6030
    His Pro Glu Arg Trp Gly Gly Leu Ile Asp Leu Pro Ser Asp Ala Asp
    6035 6040 6045
    Arg Ala Ala Leu Asp Arg Met Thr Thr Val Leu Ala Gly Gly Thr Gly
    6050 6055 6060
    Glu Asp Gln Val Ala Val Arg Ala Ser Gly Leu Leu Ala Arg Arg Leu
    6065 6070 6075 6080
    Val Arg Ala Ser Leu Pro Ala His Gly Thr Ala Ser Pro Trp Trp Gln
    6085 6090 6095
    Ala Asp Gly Thr Val Leu Val Thr Gly Ala Glu Glu Pro Ala Ala Ala
    6100 6105 6110
    Glu Ala Ala Arg Arg Leu Ala Arg Asp Gly Ala Gly His Leu Leu Leu
    6115 6120 6125
    His Thr Thr Pro Ser Gly Ser Glu Gly Ala Glu Gly Thr Ser Gly Ala
    6130 6135 6140
    Ala Glu Asp Ser Gly Leu Ala Gly Leu Val Ala Glu Leu Ala Asp Leu
    6145 6150 6155 6160
    Gly Ala Thr Ala Thr Val Val Thr Cys Asp Leu Thr Asp Ala Glu Ala
    6165 6170 6175
    Ala Ala Arg Leu Leu Ala Gly Val Ser Asp Ala His Pro Leu Ser Ala
    6180 6185 6190
    Val Leu His Leu Pro Pro Thr Val Asp Ser Glu Pro Leu Ala Ala Thr
    6195 6200 6205
    Asp Ala Asp Ala Leu Ala Arg Val Val Thr Ala Lys Ala Thr Ala Ala
    6210 6215 6220
    Leu His Leu Asp Arg Leu Leu Arg Glu Ala Ala Ala Ala Gly Gly Arg
    6225 6230 6235 6240
    Pro Pro Val Leu Val Leu Phe Ser Ser Val Ala Ala Ile Trp Gly Gly
    6245 6250 6255
    Ala Gly Gln Gly Ala Tyr Ala Ala Gly Thr Ala Phe Leu Asp Ala Leu
    6260 6265 6270
    Ala Gly Gln His Arg Ala Asp Gly Pro Thr Val Thr Ser Val Ala Trp
    6275 6280 6285
    Ser Pro Trp Glu Gly Ser Arg Val Thr Glu Gly Ala Thr Gly Glu Arg
    6290 6295 6300
    Leu Arg Arg Leu Gly Leu Arg Pro Leu Ala Pro Ala Thr Ala Leu Thr
    6305 6310 6315 6320
    Ala Leu Asp Thr Ala Leu Gly His Gly Asp Thr Ala Val Thr Ile Ala
    6325 6330 6335
    Asp Val Asp Trp Ser Ser Phe Ala Pro Gly Phe Thr Thr Ala Arg Pro
    6340 6345 6350
    Gly Thr Leu Leu Ala Asp Leu Pro Glu Ala Arg Arg Ala Leu Asp Glu
    6355 6360 6365
    Gln Gln Ser Thr Thr Ala Ala Asp Asp Thr Val Leu Ser Arg Glu Leu
    6370 6375 6380
    Gly Ala Leu Thr Gly Ala Glu Gln Gln Arg Arg Met Gln Glu Leu Val
    6385 6390 6395 6400
    Arg Glu His Leu Ala Val Val Leu Asn His Pro Ser Pro Glu Ala Val
    6405 6410 6415
    Asp Thr Gly Arg Ala Phe Arg Asp Leu Gly Phe Asp Ser Leu Thr Ala
    6420 6425 6430
    Val Glu Leu Arg Asn Arg Leu Lys Asn Ala Thr Gly Leu Ala Leu Pro
    6435 6440 6445
    Ala Thr Leu Val Phe Asp Tyr Pro Thr Pro Arg Thr Leu Ala Glu Phe
    6450 6455 6460
    Leu Leu Ala Glu Ile Leu Gly Glu Gln Ala Gly Ala Gly Glu Gln Leu
    6465 6470 6475 6480
    Pro Val Asp Gly Gly Val Asp Asp Glu Pro Val Ala Ile Val Gly Met
    6485 6490 6495
    Ala Cys Arg Leu Pro Gly Gly Val Ala Ser Pro Glu Asp Leu Trp Arg
    6500 6505 6510
    Leu Val Ala Gly Gly Glu Asp Ala Ile Ser Gly Phe Pro Gln Asp Arg
    6515 6520 6525
    Gly Trp Asp Val Glu Gly Leu Tyr Asp Pro Asp Pro Asp Ala Ser Gly
    6530 6535 6540
    Arg Thr Tyr Cys Arg Ala Gly Gly Phe Leu Asp Glu Ala Gly Glu Phe
    6545 6550 6555 6560
    Asp Ala Asp Phe Phe Gly Ile Ser Pro Arg Glu Ala Leu Ala Met Asp
    6565 6570 6575
    Pro Gln Gln Arg Leu Leu Leu Glu Thr Ser Trp Glu Ala Val Glu Asp
    6580 6585 6590
    Ala Gly Ile Asp Pro Thr Ser Leu Gln Gly Gln Gln Val Gly Val Phe
    6595 6600 6605
    Ala Gly Thr Asn Gly Pro His Tyr Glu Pro Leu Leu Arg Asn Thr Ala
    6610 6615 6620
    Glu Asp Leu Glu Gly Tyr Val Gly Thr Gly Asn Ala Ala Ser Ile Met
    6625 6630 6635 6640
    Ser Gly Arg Val Ser Tyr Thr Leu Gly Leu Glu Gly Pro Ala Val Thr
    6645 6650 6655
    Val Asp Thr Ala Cys Ser Ser Ser Leu Val Ala Leu His Leu Ala Val
    6660 6665 6670
    Gln Ala Leu Arg Lys Gly Glu Cys Gly Leu Ala Leu Ala Gly Gly Val
    6675 6680 6685
    Thr Val Met Ser Thr Pro Thr Thr Phe Val Glu Phe Ser Arg Gln Arg
    6690 6695 6700
    Gly Leu Ala Glu Asp Gly Arg Ser Lys Ala Phe Ala Ala Ser Ala Asp
    6705 6710 6715 6720
    Gly Phe Gly Pro Ala Glu Gly Val Gly Met Leu Leu Val Glu Arg Leu
    6725 6730 6735
    Ser Asp Ala Arg Arg Asn Gly His Arg Val Leu Ala Val Val Arg Gly
    6740 6745 6750
    Ser Ala Val Asn Gln Asp Gly Ala Ser Asn Gly Leu Thr Ala Pro Asn
    6755 6760 6765
    Gly Pro Ser Gln Gln Arg Val Ile Arg Arg Ala Leu Ala Asp Ala Arg
    6770 6775 6780
    Leu Thr Thr Ala Asp Val Asp Val Val Glu Ala His Gly Thr Gly Thr
    6785 6790 6795 6800
    Arg Leu Gly Asp Pro Ile Glu Ala Gln Ala Leu Ile Ala Thr Tyr Gly
    6805 6810 6815
    Gln Gly Arg Asp Thr Glu Gln Pro Leu Arg Leu Gly Ser Leu Lys Ser
    6820 6825 6830
    Asn Ile Gly His Thr Gln Ala Ala Ala Gly Val Ser Gly Ile Ile Lys
    6835 6840 6845
    Met Val Gln Ala Met Arg His Gly Val Leu Pro Lys Thr Leu His Val
    6850 6855 6860
    Asp Arg Pro Ser Asp Gln Ile Asp Trp Ser Ala Gly Thr Val Glu Leu
    6865 6870 6875 6880
    Leu Thr Glu Ala Met Asp Trp Pro Arg Lys Gln Glu Gly Gly Leu Arg
    6885 6890 6895
    Arg Ala Ala Val Ser Ser Phe Gly Ile Ser Gly Thr Asn Ala His Ile
    6900 6905 6910
    Val Leu Glu Glu Ala Pro Val Asp Glu Asp Ala Pro Ala Asp Glu Pro
    6915 6920 6925
    Ser Val Gly Gly Val Val Pro Trp Leu Val Ser Ala Lys Thr Pro Ala
    6930 6935 6940
    Ala Leu Asp Ala Gln Ile Gly Arg Leu Ala Ala Phe Ala Ser Gln Gly
    6945 6950 6955 6960
    Arg Thr Asp Ala Ala Asp Pro Gly Ala Val Ala Arg Val Leu Ala Gly
    6965 6970 6975
    Gly Arg Ala Gln Phe Glu His Arg Ala Val Ala Leu Gly Thr Gly Gln
    6980 6985 6990
    Asp Asp Leu Ala Ala Ala Leu Ala Ala Pro Glu Gly Leu Val Arg Gly
    6995 7000 7005
    Val Ala Ser Gly Val Gly Arg Val Ala Phe Val Phe Pro Gly Gln Gly
    7010 7015 7020
    Thr Gln Trp Ala Gly Met Gly Ala Glu Leu Leu Asp Val Ser Lys Glu
    7025 7030 7035 7040
    Phe Ala Ala Ala Met Ala Glu Cys Glu Ala Ala Leu Ala Pro Tyr Val
    7045 7050 7055
    Asp Trp Ser Leu Glu Ala Val Val Arg Gln Ala Pro Gly Ala Pro Thr
    7060 7065 7070
    Leu Glu Arg Val Asp Val Val Gln Pro Val Thr Phe Ala Val Met Val
    7075 7080 7085
    Ser Leu Ala Lys Val Trp Gln His His Gly Val Thr Pro Gln Ala Val
    7090 7095 7100
    Val Gly His Ser Gln Gly Glu Ile Ala Ala Ala Tyr Val Ala Gly Ala
    7105 7110 7115 7120
    Leu Ser Leu Asp Asp Ala Ala Arg Val Val Thr Leu Arg Ser Lys Ser
    7125 7130 7135
    Ile Gly Ala His Leu Ala Gly Gln Gly Gly Met Leu Ser Leu Ala Leu
    7140 7145 7150
    Ser Glu Ala Ala Val Val Glu Arg Leu Ala Gly Phe Asp Gly Leu Ser
    7155 7160 7165
    Val Ala Ala Val Asn Gly Pro Thr Ala Thr Val Val Ser Gly Asp Pro
    7170 7175 7180
    Thr Gln Ile Gln Glu Leu Ala Gln Ala Cys Glu Ala Asp Gly Val Arg
    7185 7190 7195 7200
    Ala Arg Ile Ile Pro Val Asp Tyr Ala Ser His Ser Ala His Val Glu
    7205 7210 7215
    Thr Ile Glu Ser Glu Leu Ala Asp Val Leu Ala Gly Leu Ser Pro Gln
    7220 7225 7230
    Thr Pro Gln Val Pro Phe Phe Ser Thr Leu Glu Gly Ala Trp Ile Thr
    7235 7240 7245
    Glu Pro Ala Leu Asp Gly Gly Tyr Trp Tyr Arg Asn Leu Arg His Arg
    7250 7255 7260
    Val Gly Phe Ala Pro Ala Val Glu Thr Leu Ala Thr Asp Glu Gly Phe
    7265 7270 7275 7280
    Thr His Phe Val Glu Val Ser Ala His Pro Val Leu Thr Met Ala Leu
    7285 7290 7295
    Pro Glu Thr Val Thr Gly Leu Gly Thr Leu Arg Arg Asp Asn Gly Gly
    7300 7305 7310
    Gln His Arg Leu Thr Thr Ser Leu Ala Glu Ala Trp Ala Asn Gly Leu
    7315 7320 7325
    Thr Val Asp Trp Ala Ser Leu Leu Pro Thr Thr Thr Thr His Pro Asp
    7330 7335 7340
    Leu Pro Thr Tyr Ala Phe Gln Thr Glu Arg Tyr Trp Pro Gln Pro Asp
    7345 7350 7355 7360
    Leu Ser Ala Ala Gly Asp Ile Thr Ser Ala Gly Leu Gly Ala Ala Glu
    7365 7370 7375
    His Pro Leu Leu Gly Ala Ala Val Ala Leu Ala Asp Ser Asp Gly Cys
    7380 7385 7390
    Leu Leu Thr Gly Ser Leu Ser Leu Arg Thr His Pro Trp Leu Ala Asp
    7395 7400 7405
    His Ala Val Ala Gly Thr Val Leu Leu Pro Gly Thr Ala Phe Val Glu
    7410 7415 7420
    Leu Ala Phe Arg Ala Gly Asp Gln Val Gly Cys Asp Leu Val Glu Glu
    7425 7430 7435 7440
    Leu Thr Leu Asp Ala Pro Leu Val Leu Pro Arg Arg Gly Ala Val Arg
    7445 7450 7455
    Val Gln Leu Ser Val Gly Ala Ser Asp Glu Ser Gly Arg Arg Thr Phe
    7460 7465 7470
    Gly Leu Tyr Ala His Pro Glu Asp Ala Pro Gly Glu Ala Glu Trp Thr
    7475 7480 7485
    Arg His Ala Thr Gly Val Leu Ala Ala Arg Ala Asp Arg Thr Ala Pro
    7490 7495 7500
    Val Ala Asp Pro Glu Ala Trp Pro Pro Pro Gly Ala Glu Pro Val Asp
    7505 7510 7515 7520
    Val Asp Gly Leu Tyr Glu Arg Phe Ala Ala Asn Gly Tyr Gly Tyr Gly
    7525 7530 7535
    Pro Leu Phe Gln Gly Val Arg Gly Val Trp Arg Arg Gly Asp Glu Val
    7540 7545 7550
    Phe Ala Asp Val Ala Leu Pro Ala Glu Val Ala Gly Ala Glu Gly Ala
    7555 7560 7565
    Arg Phe Gly Leu His Pro Ala Leu Leu Asp Ala Ala Val Gln Ala Ala
    7570 7575 7580
    Gly Ala Gly Arg Gly Val Arg Arg Gly His Ala Ala Ala Val Arg Leu
    7585 7590 7595 7600
    Glu Arg Asp Leu Leu Tyr Ala Val Gly Ala Thr Ala Leu Arg Val Arg
    7605 7610 7615
    Leu Ala Pro Ala Gly Pro Asp Thr Val Ser Val Ser Ala Ala Asp Ser
    7620 7625 7630
    Ser Gly Gln Pro Val Phe Ala Ala Asp Ser Leu Thr Val Leu Pro Val
    7635 7640 7645
    Asp Pro Ala Gln Leu Ala Ala Phe Ser Asp Pro Thr Leu Asp Ala Leu
    7650 7655 7660
    His Leu Leu Glu Trp Thr Ala Trp Asp Gly Ala Ala Gln Ala Leu Pro
    7665 7670 7675 7680
    Gly Ala Val Val Leu Gly Gly Asp Ala Asp Gly Leu Ala Ala Ala Leu
    7685 7690 7695
    Arg Ala Gly Gly Thr Glu Val Leu Ser Phe Pro Asp Leu Thr Asp Leu
    7700 7705 7710
    Val Glu Ala Val Asp Arg Gly Glu Thr Pro Ala Pro Ala Thr Val Leu
    7715 7720 7725
    Val Ala Cys Pro Ala Ala Gly Pro Asp Gly Pro Glu His Val Arg Glu
    7730 7735 7740
    Ala Leu His Gly Ser Leu Ala Leu Met Gln Ala Trp Leu Ala Asp Glu
    7745 7750 7755 7760
    Arg Phe Thr Asp Gly Arg Leu Val Leu Val Thr Arg Asp Ala Val Ala
    7765 7770 7775
    Ala Arg Ser Gly Asp Gly Leu Arg Ser Thr Gly Gln Ala Ala Val Trp
    7780 7785 7790
    Gly Leu Gly Arg Ser Ala Gln Thr Glu Ser Pro Gly Arg Phe Val Leu
    7795 7800 7805
    Leu Asp Leu Ala Gly Glu Ala Arg Thr Ala Gly Asp Ala Thr Ala Gly
    7810 7815 7820
    Asp Gly Leu Thr Thr Gly Asp Ala Thr Val Gly Gly Thr Ser Gly Asp
    7825 7830 7835 7840
    Ala Ala Leu Gly Ser Ala Leu Ala Thr Ala Leu Gly Ser Gly Glu Pro
    7845 7850 7855
    Gln Leu Ala Leu Arg Asp Gly Ala Leu Leu Val Pro Arg Leu Ala Arg
    7860 7865 7870
    Ala Ala Ala Pro Ala Ala Ala Asp Gly Leu Ala Ala Ala Asp Gly Leu
    7875 7880 7885
    Ala Ala Leu Pro Leu Pro Ala Ala Pro Ala Leu Trp Arg Leu Glu Pro
    7890 7895 7900
    Gly Thr Asp Gly Ser Leu Glu Ser Leu Thr Ala Ala Pro Gly Asp Ala
    7905 7910 7915 7920
    Glu Thr Leu Ala Pro Glu Pro Leu Gly Pro Gly Gln Val Arg Ile Ala
    7925 7930 7935
    Ile Arg Ala Thr Gly Leu Asn Phe Arg Asp Val Leu Ile Ala Leu Gly
    7940 7945 7950
    Met Tyr Pro Asp Pro Ala Leu Met Gly Thr Glu Gly Ala Gly Val Val
    7955 7960 7965
    Thr Ala Thr Gly Pro Gly Val Thr His Leu Ala Pro Gly Asp Arg Val
    7970 7975 7980
    Met Gly Leu Leu Ser Gly Ala Tyr Ala Pro Val Val Val Ala Asp Ala
    7985 7990 7995 8000
    Arg Thr Val Ala Arg Met Pro Glu Gly Trp Thr Phe Ala Gln Gly Ala
    8005 8010 8015
    Ser Val Pro Val Val Phe Leu Thr Ala Val Tyr Ala Leu Arg Asp Leu
    8020 8025 8030
    Ala Asp Val Lys Pro Gly Glu Arg Leu Leu Val His Ser Ala Ala Gly
    8035 8040 8045
    Gly Val Gly Met Ala Ala Val Gln Leu Ala Arg His Trp Gly Val Glu
    8050 8055 8060
    Val His Gly Thr Ala Ser His Gly Lys Trp Asp Ala Leu Arg Ala Leu
    8065 8070 8075 8080
    Gly Leu Asp Asp Ala His Ile Ala Ser Ser Arg Thr Leu Asp Phe Glu
    8085 8090 8095
    Ser Ala Phe Arg Ala Ala Ser Gly Gly Ala Gly Met Asp Val Val Leu
    8100 8105 8110
    Asn Ser Leu Ala Arg Glu Phe Val Asp Ala Ser Leu Arg Leu Leu Gly
    8115 8120 8125
    Pro Gly Gly Arg Phe Val Glu Met Gly Lys Thr Asp Val Arg Asp Ala
    8130 8135 8140
    Glu Arg Val Ala Ala Asp His Pro Gly Val Gly Tyr Arg Ala Phe Asp
    8145 8150 8155 8160
    Leu Gly Glu Ala Gly Pro Glu Arg Ile Gly Glu Met Leu Ala Glu Val
    8165 8170 8175
    Ile Ala Leu Phe Glu Asp Gly Val Leu Arg His Leu Pro Val Thr Thr
    8180 8185 8190
    Trp Asp Val Arg Arg Ala Arg Asp Ala Phe Arg His Val Ser Gln Ala
    8195 8200 8205
    Arg His Thr Gly Lys Val Val Leu Thr Met Pro Ser Gly Leu Asp Pro
    8210 8215 8220
    Glu Gly Thr Val Leu Leu Thr Gly Gly Thr Gly Ala Leu Gly Gly Ile
    8225 8230 8235 8240
    Val Ala Arg His Val Val Gly Glu Trp Gly Val Arg Arg Leu Leu Leu
    8245 8250 8255
    Val Ser Arg Arg Gly Thr Asp Ala Pro Gly Ala Gly Glu Leu Val His
    8260 8265 8270
    Glu Leu Glu Ala Leu Gly Ala Asp Val Ser Val Ala Ala Cys Asp Val
    8275 8280 8285
    Ala Asp Arg Glu Ala Leu Thr Ala Val Leu Asp Ser Ile Pro Ala Glu
    8290 8295 8300
    His Pro Leu Thr Ala Val Val His Thr Ala Gly Val Leu Ser Asp Gly
    8305 8310 8315 8320
    Thr Leu Pro Ser Met Thr Ala Glu Asp Val Glu His Val Leu Arg Pro
    8325 8330 8335
    Lys Val Asp Ala Ala Phe Leu Leu Asp Glu Leu Thr Ser Thr Pro Gly
    8340 8345 8350
    Tyr Asp Leu Ala Ala Phe Val Met Phe Ser Ser Ala Ala Ala Val Phe
    8355 8360 8365
    Gly Gly Ala Gly Gln Gly Ala Tyr Ala Ala Ala Asn Ala Thr Leu Asp
    8370 8375 8380
    Ala Leu Ala Trp Arg Arg Arg Thr Ala Gly Leu Pro Ala Leu Ser Leu
    8385 8390 8395 8400
    Gly Trp Gly Leu Trp Ala Glu Thr Ser Gly Met Thr Gly Gly Leu Ser
    8405 8410 8415
    Asp Thr Asp Arg Ser Arg Leu Ala Arg Ser Gly Ala Thr Pro Met Asp
    8420 8425 8430
    Ser Glu Leu Thr Leu Ser Leu Leu Asp Ala Ala Met Arg Arg Asp Asp
    8435 8440 8445
    Pro Ala Leu Val Pro Ile Ala Leu Asp Val Ala Ala Leu Arg Ala Gln
    8450 8455 8460
    Gln Arg Asp Gly Met Leu Ala Pro Leu Leu Ser Gly Leu Thr Arg Gly
    8465 8470 8475 8480
    Ser Arg Val Gly Gly Ala Pro Val Asn Gln Arg Arg Ala Ala Ala Gly
    8485 8490 8495
    Gly Ala Gly Glu Ala Asp Thr Asp Leu Gly Gly Arg Leu Ala Ala Met
    8500 8505 8510
    Thr Pro Asp Asp Arg Val Ala His Leu Arg Asp Leu Val Arg Thr His
    8515 8520 8525
    Val Ala Thr Val Leu Gly His Gly Thr Pro Ser Arg Val Asp Leu Glu
    8530 8535 8540
    Arg Ala Phe Arg Asp Thr Gly Phe Asp Ser Leu Thr Ala Val Glu Leu
    8545 8550 8555 8560
    Arg Asn Arg Leu Asn Ala Ala Thr Gly Leu Arg Leu Pro Ala Thr Leu
    8565 8570 8575
    Val Phe Asp His Pro Thr Pro Gly Glu Leu Ala Gly His Leu Leu Asp
    8580 8585 8590
    Glu Leu Ala Thr Ala Ala Gly Gly Ser Trp Ala Glu Gly Thr Gly Ser
    8595 8600 8605
    Gly Asp Thr Ala Ser Ala Thr Asp Arg Gln Thr Thr Ala Ala Leu Ala
    8610 8615 8620
    Glu Leu Asp Arg Leu Glu Gly Val Leu Ala Ser Leu Ala Pro Ala Ala
    8625 8630 8635 8640
    Gly Gly Arg Pro Glu Leu Ala Ala Arg Leu Arg Ala Leu Ala Ala Ala
    8645 8650 8655
    Leu Gly Asp Asp Gly Asp Asp Ala Thr Asp Leu Asp Glu Ala Ser Asp
    8660 8665 8670
    Asp Asp Leu Phe Ser Phe Ile Asp Lys Glu Leu Gly Asp Ser Asp Phe
    8675 8680 8685
    Met Ala Asn Asn Glu Asp Lys Leu Arg Asp Tyr Leu Lys Arg Val Thr
    8690 8695 8700
    Ala Glu Leu Gln Gln Asn Thr Arg Arg Leu Arg Glu Ile Glu Gly Arg
    8705 8710 8715 8720
    Thr His Glu Pro Val Ala Ile Val Gly Met Ala Cys Arg Leu Pro Gly
    8725 8730 8735
    Gly Val Ala Ser Pro Glu Asp Leu Trp Gln Leu Val Ala Gly Asp Gly
    8740 8745 8750
    Asp Ala Ile Ser Glu Phe Pro Gln Asp Arg Gly Trp Asp Val Glu Gly
    8755 8760 8765
    Leu Tyr Asp Pro Asp Pro Asp Ala Ser Gly Arg Thr Tyr Cys Arg Ser
    8770 8775 8780
    Gly Gly Phe Leu His Asp Ala Gly Glu Phe Asp Ala Asp Phe Phe Gly
    8785 8790 8795 8800
    Ile Ser Pro Arg Glu Ala Leu Ala Met Asp Pro Gln Gln Arg Leu Ser
    8805 8810 8815
    Leu Thr Thr Ala Trp Glu Ala Ile Glu Ser Ala Gly Ile Asp Pro Thr
    8820 8825 8830
    Ala Leu Lys Gly Ser Gly Leu Gly Val Phe Val Gly Gly Trp His Thr
    8835 8840 8845
    Gly Tyr Thr Ser Gly Gln Thr Thr Ala Val Gln Ser Pro Glu Leu Glu
    8850 8855 8860
    Gly His Leu Val Ser Gly Ala Ala Leu Gly Phe Leu Ser Gly Arg Ile
    8865 8870 8875 8880
    Ala Tyr Val Leu Gly Thr Asp Gly Pro Ala Leu Thr Val Asp Thr Ala
    8885 8890 8895
    Cys Ser Ser Ser Leu Val Ala Leu His Leu Ala Val Gln Ala Leu Arg
    8900 8905 8910
    Lys Gly Glu Cys Asp Met Ala Leu Ala Gly Gly Val Thr Val Met Pro
    8915 8920 8925
    Asn Ala Asp Leu Phe Val Gln Phe Ser Arg Gln Arg Gly Leu Ala Ala
    8930 8935 8940
    Asp Gly Arg Ser Lys Ala Phe Ala Thr Ser Ala Asp Gly Phe Gly Pro
    8945 8950 8955 8960
    Ala Glu Gly Ala Gly Val Leu Leu Val Glu Arg Leu Ser Asp Ala Arg
    8965 8970 8975
    Arg Asn Gly His Arg Ile Leu Ala Val Val Arg Gly Ser Ala Val Asn
    8980 8985 8990
    Gln Asp Gly Ala Ser Asn Gly Leu Thr Ala Pro His Gly Pro Ser Gln
    8995 9000 9005
    Gln Arg Val Ile Arg Arg Ala Leu Ala Asp Ala Arg Leu Ala Pro Gly
    9010 9015 9020
    Asp Val Asp Val Val Glu Ala His Gly Thr Gly Thr Arg Leu Gly Asp
    9025 9030 9035 9040
    Pro Ile Glu Ala Gln Ala Leu Ile Ala Thr Tyr Gly Gln Glu Lys Ser
    9045 9050 9055
    Ser Glu Gln Pro Leu Arg Leu Gly Ala Leu Lys Ser Asn Ile Gly His
    9060 9065 9070
    Thr Gln Ala Ala Ala Gly Val Ala Gly Val Ile Lys Met Val Gln Ala
    9075 9080 9085
    Met Arg His Gly Leu Leu Pro Lys Thr Leu His Val Asp Glu Pro Ser
    9090 9095 9100
    Asp Gln Ile Asp Trp Ser Ala Gly Thr Val Glu Leu Leu Thr Glu Ala
    9105 9110 9115 9120
    Val Asp Trp Pro Glu Lys Gln Asp Gly Gly Leu Arg Arg Ala Ala Val
    9125 9130 9135
    Ser Ser Phe Gly Ile Ser Gly Thr Asn Ala His Val Val Leu Glu Glu
    9140 9145 9150
    Ala Pro Ala Val Glu Asp Ser Pro Ala Val Glu Pro Pro Ala Gly Gly
    9155 9160 9165
    Gly Val Val Pro Trp Pro Val Ser Ala Lys Thr Pro Ala Ala Leu Asp
    9170 9175 9180
    Ala Gln Ile Gly Gln Leu Ala Ala Tyr Ala Asp Gly Arg Thr Asp Val
    9185 9190 9195 9200
    Asp Pro Ala Val Ala Ala Arg Ala Leu Val Asp Ser Arg Thr Ala Met
    9205 9210 9215
    Glu His Arg Ala Val Ala Val Gly Asp Ser Arg Glu Ala Leu Arg Asp
    9220 9225 9230
    Ala Leu Arg Met Pro Glu Gly Leu Val Arg Gly Thr Ser Ser Asp Val
    9235 9240 9245
    Gly Arg Val Ala Phe Val Phe Pro Gly Gln Gly Thr Gln Trp Ala Gly
    9250 9255 9260
    Met Gly Ala Glu Leu Leu Asp Ser Ser Pro Glu Phe Ala Ala Ser Met
    9265 9270 9275 9280
    Ala Glu Cys Glu Thr Ala Leu Ser Arg Tyr Val Asp Trp Ser Leu Glu
    9285 9290 9295
    Ala Val Val Arg Gln Glu Pro Gly Ala Pro Thr Leu Asp Arg Val Asp
    9300 9305 9310
    Val Val Gln Pro Val Thr Phe Ala Val Met Val Ser Leu Ala Lys Val
    9315 9320 9325
    Trp Gln His His Gly Ile Thr Pro Gln Ala Val Val Gly His Ser Gln
    9330 9335 9340
    Gly Glu Ile Ala Ala Ala Tyr Val Ala Gly Ala Leu Thr Leu Asp Asp
    9345 9350 9355 9360
    Ala Ala Arg Val Val Thr Leu Arg Ser Lys Ser Ile Ala Ala His Leu
    9365 9370 9375
    Ala Gly Lys Gly Gly Met Ile Ser Leu Ala Leu Asp Glu Ala Ala Val
    9380 9385 9390
    Leu Lys Arg Leu Ser Asp Phe Asp Gly Leu Ser Val Ala Ala Val Asn
    9395 9400 9405
    Gly Pro Thr Ala Thr Val Val Ser Gly Asp Pro Thr Gln Ile Glu Glu
    9410 9415 9420
    Leu Ala Arg Thr Cys Glu Ala Asp Gly Val Arg Ala Arg Ile Ile Pro
    9425 9430 9435 9440
    Val Asp Tyr Ala Ser His Ser Arg Gln Val Glu Ile Ile Glu Lys Glu
    9445 9450 9455
    Leu Ala Glu Val Leu Ala Gly Leu Ala Pro Gln Ala Pro His Val Pro
    9460 9465 9470
    Phe Phe Ser Thr Leu Glu Gly Thr Trp Ile Thr Glu Pro Val Leu Asp
    9475 9480 9485
    Gly Thr Tyr Trp Tyr Arg Asn Leu Arg His Arg Val Gly Phe Ala Pro
    9490 9495 9500
    Ala Val Glu Thr Leu Ala Val Asp Gly Phe Thr His Phe Ile Glu Val
    9505 9510 9515 9520
    Ser Ala His Pro Val Leu Thr Met Thr Leu Pro Glu Thr Val Thr Gly
    9525 9530 9535
    Leu Gly Thr Leu Arg Arg Glu Gln Gly Gly Gln Glu Arg Leu Val Thr
    9540 9545 9550
    Ser Leu Ala Glu Ala Trp Ala Asn Gly Leu Thr Ile Asp Trp Ala Pro
    9555 9560 9565
    Ile Leu Pro Thr Ala Thr Gly His His Pro Glu Leu Pro Thr Tyr Ala
    9570 9575 9580
    Phe Gln Thr Glu Arg Phe Trp Leu Gln Ser Ser Ala Pro Thr Ser Ala
    9585 9590 9595 9600
    Ala Asp Asp Trp Arg Tyr Arg Val Glu Trp Lys Pro Leu Thr Ala Ser
    9605 9610 9615
    Gly Gln Ala Asp Leu Ser Gly Arg Trp Ile Val Ala Val Gly Ser Glu
    9620 9625 9630
    Pro Glu Ala Glu Leu Leu Gly Ala Leu Lys Ala Ala Gly Ala Glu Val
    9635 9640 9645
    Asp Val Leu Glu Ala Gly Ala Asp Asp Asp Arg Glu Ala Leu Ala Ala
    9650 9655 9660
    Arg Leu Thr Ala Leu Thr Thr Gly Asp Gly Phe Thr Gly Val Val Ser
    9665 9670 9675 9680
    Leu Leu Asp Asp Leu Val Pro Gln Val Ala Trp Val Gln Ala Leu Gly
    9685 9690 9695
    Asp Ala Gly Ile Lys Ala Pro Leu Trp Ser Val Thr Gln Gly Ala Val
    9700 9705 9710
    Ser Val Gly Arg Leu Asp Thr Pro Ala Asp Pro Asp Arg Ala Met Leu
    9715 9720 9725
    Trp Gly Leu Gly Arg Val Val Ala Leu Glu His Pro Glu Arg Trp Ala
    9730 9735 9740
    Gly Leu Val Asp Leu Pro Ala Gln Pro Asp Ala Ala Ala Leu Ala His
    9745 9750 9755 9760
    Leu Val Thr Ala Leu Ser Gly Ala Thr Gly Glu Asp Gln Ile Ala Ile
    9765 9770 9775
    Arg Thr Thr Gly Leu His Ala Arg Arg Leu Ala Arg Ala Pro Leu His
    9780 9785 9790
    Gly Arg Arg Pro Thr Arg Asp Trp Gln Pro His Gly Thr Val Leu Ile
    9795 9800 9805
    Thr Gly Gly Thr Gly Ala Leu Gly Ser His Ala Ala Arg Trp Met Ala
    9810 9815 9820
    His His Gly Ala Glu His Leu Leu Leu Val Ser Arg Ser Gly Glu Gln
    9825 9830 9835 9840
    Ala Pro Gly Ala Thr Gln Leu Thr Ala Glu Leu Thr Ala Ser Gly Ala
    9845 9850 9855
    Arg Val Thr Ile Ala Ala Cys Asp Val Ala Asp Pro His Ala Met Arg
    9860 9865 9870
    Thr Leu Leu Asp Ala Ile Pro Ala Glu Thr Pro Leu Thr Ala Val Val
    9875 9880 9885
    His Thr Ala Gly Ala Pro Gly Gly Asp Pro Leu Asp Val Thr Gly Pro
    9890 9895 9900
    Glu Asp Ile Ala Arg Ile Leu Gly Ala Lys Thr Ser Gly Ala Glu Val
    9905 9910 9915 9920
    Leu Asp Asp Leu Leu Arg Gly Thr Pro Leu Asp Ala Phe Val Leu Tyr
    9925 9930 9935
    Ser Ser Asn Ala Gly Val Trp Gly Ser Gly Ser Gln Gly Val Tyr Ala
    9940 9945 9950
    Ala Ala Asn Ala His Leu Asp Ala Leu Ala Ala Arg Arg Arg Ala Arg
    9955 9960 9965
    Gly Glu Thr Ala Thr Ser Val Ala Trp Gly Leu Trp Ala Gly Asp Gly
    9970 9975 9980
    Met Gly Arg Gly Ala Asp Asp Ala Tyr Trp Gln Arg Arg Gly Ile Arg
    9985 9990 9995 10000
    Pro Met Ser Pro Asp Arg Ala Leu Asp Glu Leu Ala Lys Ala Leu Ser
    10005 10010 10015
    His Asp Glu Thr Phe Val Ala Val Ala Asp Val Asp Trp Glu Arg Phe
    10020 10025 10030
    Ala Pro Ala Phe Thr Val Ser Arg Pro Ser Leu Leu Leu Asp Gly Val
    10035 10040 10045
    Pro Glu Ala Arg Gln Ala Leu Ala Ala Pro Val Gly Ala Pro Ala Pro
    10050 10055 10060
    Gly Asp Ala Ala Val Ala Pro Thr Gly Gln Ser Ser Ala Leu Ala Ala
    10065 10070 10075 10080
    Ile Thr Ala Leu Pro Glu Pro Glu Arg Arg Pro Ala Leu Leu Thr Leu
    10085 10090 10095
    Val Arg Thr His Ala Ala Ala Val Leu Gly His Ser Ser Pro Asp Arg
    10100 10105 10110
    Val Ala Pro Gly Arg Ala Phe Thr Glu Leu Gly Phe Asp Ser Leu Thr
    10115 10120 10125
    Ala Val Gln Leu Arg Asn Gln Leu Ser Thr Val Val Gly Asn Arg Leu
    10130 10135 10140
    Pro Ala Thr Thr Val Phe Asp His Pro Thr Pro Ala Ala Leu Ala Ala
    10145 10150 10155 10160
    His Leu His Glu Ala Tyr Leu Ala Pro Ala Glu Pro Ala Pro Thr Asp
    10165 10170 10175
    Trp Glu Gly Arg Val Arg Arg Ala Leu Ala Glu Leu Pro Leu Asp Arg
    10180 10185 10190
    Leu Arg Asp Ala Gly Val Leu Asp Thr Val Leu Arg Leu Thr Gly Ile
    10195 10200 10205
    Glu Pro Glu Pro Gly Ser Gly Gly Ser Asp Gly Gly Ala Ala Asp Pro
    10210 10215 10220
    Gly Ala Glu Pro Glu Ala Ser Ile Asp Asp Leu Asp Ala Glu Ala Leu
    10225 10230 10235 10240
    Ile Arg Met Ala Leu Gly Pro Arg Asn Thr Met Thr Ser Ser Asn Glu
    10245 10250 10255
    Gln Leu Val Asp Ala Leu Arg Ala Ser Leu Lys Glu Asn Glu Glu Leu
    10260 10265 10270
    Arg Lys Glu Ser Arg Arg Arg Ala Asp Arg Arg Gln Glu Pro Met Ala
    10275 10280 10285
    Ile Val Gly Met Ser Cys Arg Phe Ala Gly Gly Ile Arg Ser Pro Glu
    10290 10295 10300
    Asp Leu Trp Asp Ala Val Ala Ala Gly Lys Asp Leu Val Ser Glu Val
    10305 10310 10315 10320
    Pro Glu Glu Arg Gly Trp Asp Ile Asp Ser Leu Tyr Asp Pro Val Pro
    10325 10330 10335
    Gly Arg Lys Gly Thr Thr Tyr Val Arg Asn Ala Ala Phe Leu Asp Asp
    10340 10345 10350
    Ala Ala Gly Phe Asp Ala Ala Phe Phe Gly Ile Ser Pro Arg Glu Ala
    10355 10360 10365
    Leu Ala Met Asp Pro Gln Gln Arg Gln Leu Leu Glu Ala Ser Trp Glu
    10370 10375 10380
    Val Phe Glu Arg Ala Gly Ile Asp Pro Ala Ser Val Arg Gly Thr Asp
    10385 10390 10395 10400
    Val Gly Val Tyr Val Gly Cys Gly Tyr Gln Asp Tyr Ala Pro Asp Ile
    10405 10410 10415
    Arg Val Ala Pro Glu Gly Thr Gly Gly Tyr Val Val Thr Gly Asn Ser
    10420 10425 10430
    Ser Ala Val Ala Ser Gly Arg Ile Ala Tyr Ser Leu Gly Leu Glu Gly
    10435 10440 10445
    Pro Ala Val Thr Val Asp Thr Ala Cys Ser Ser Ser Leu Val Ala Leu
    10450 10455 10460
    His Leu Ala Leu Lys Gly Leu Arg Asn Gly Asp Cys Ser Thr Ala Leu
    10465 10470 10475 10480
    Val Gly Gly Val Ala Val Leu Ala Thr Pro Gly Ala Phe Ile Glu Phe
    10485 10490 10495
    Ser Ser Gln Gln Ala Met Ala Ala Asp Gly Arg Thr Lys Gly Phe Ala
    10500 10505 10510
    Ser Ala Ala Asp Gly Leu Ala Trp Gly Glu Gly Val Ala Val Leu Leu
    10515 10520 10525
    Leu Glu Arg Leu Ser Asp Ala Arg Arg Lys Gly His Arg Val Leu Ala
    10530 10535 10540
    Val Val Arg Gly Ser Ala Ile Asn Gln Asp Gly Ala Ser Asn Gly Leu
    10545 10550 10555 10560
    Thr Ala Pro His Gly Pro Ser Gln Gln His Leu Ile Arg Gln Ala Leu
    10565 10570 10575
    Ala Asp Ala Arg Leu Thr Ser Ser Asp Val Asp Val Val Glu Gly His
    10580 10585 10590
    Gly Thr Gly Thr Arg Leu Gly Asp Pro Ile Glu Ala Gln Ala Leu Leu
    10595 10600 10605
    Ala Thr Tyr Gly Gln Gly Arg Ala Pro Gly Gln Pro Leu Arg Leu Gly
    10610 10615 10620
    Thr Leu Lys Ser Asn Ile Gly His Thr Gln Ala Ala Ser Gly Val Ala
    10625 10630 10635 10640
    Gly Val Ile Lys Met Val Gln Ala Leu Arg His Gly Val Leu Pro Lys
    10645 10650 10655
    Thr Leu His Val Asp Glu Pro Thr Asp Gln Val Asp Trp Ser Ala Gly
    10660 10665 10670
    Ser Val Glu Leu Leu Thr Glu Ala Val Asp Trp Pro Glu Arg Pro Gly
    10675 10680 10685
    Arg Leu Arg Arg Ala Gly Val Ser Ala Phe Gly Val Gly Gly Thr Asn
    10690 10695 10700
    Ala His Val Val Leu Glu Glu Ala Pro Ala Val Glu Glu Ser Pro Ala
    10705 10710 10715 10720
    Val Glu Pro Pro Ala Gly Gly Gly Val Val Pro Trp Pro Val Ser Ala
    10725 10730 10735
    Lys Thr Ser Ala Ala Leu Asp Ala Gln Ile Gly Gln Leu Ala Ala Tyr
    10740 10745 10750
    Ala Glu Asp Arg Thr Asp Val Asp Pro Ala Val Ala Ala Arg Ala Leu
    10755 10760 10765
    Val Asp Ser Arg Thr Ala Met Glu His Arg Ala Val Ala Val Gly Asp
    10770 10775 10780
    Ser Arg Glu Ala Leu Arg Asp Ala Leu Arg Met Pro Glu Gly Leu Val
    10785 10790 10795 10800
    Arg Gly Thr Val Thr Asp Pro Gly Arg Val Ala Phe Val Phe Pro Gly
    10805 10810 10815
    Gln Gly Thr Gln Trp Ala Gly Met Gly Ala Glu Leu Leu Asp Ser Ser
    10820 10825 10830
    Pro Glu Phe Ala Ala Ala Met Ala Glu Cys Glu Thr Ala Leu Ser Pro
    10835 10840 10845
    Tyr Val Asp Trp Ser Leu Glu Ala Val Val Arg Gln Ala Pro Ser Ala
    10850 10855 10860
    Pro Thr Leu Asp Arg Val Asp Val Val Gln Pro Val Thr Phe Ala Val
    10865 10870 10875 10880
    Met Val Ser Leu Ala Lys Val Trp Gln His His Gly Ile Thr Pro Glu
    10885 10890 10895
    Ala Val Ile Gly His Ser Gln Gly Glu Ile Ala Ala Ala Tyr Val Ala
    10900 10905 10910
    Gly Ala Leu Thr Leu Asp Asp Ala Ala Arg Val Val Thr Leu Arg Ser
    10915 10920 10925
    Lys Ser Ile Ala Ala His Leu Ala Gly Lys Gly Gly Met Ile Ser Leu
    10930 10935 10940
    Ala Leu Ser Glu Glu Ala Thr Arg Gln Arg Ile Glu Asn Leu His Gly
    10945 10950 10955 10960
    Leu Ser Ile Ala Ala Val Asn Gly Pro Thr Ala Thr Val Val Ser Gly
    10965 10970 10975
    Asp Pro Thr Gln Ile Gln Glu Leu Ala Gln Ala Cys Glu Ala Asp Gly
    10980 10985 10990
    Ile Arg Ala Arg Ile Ile Pro Val Asp Tyr Ala Ser His Ser Ala His
    10995 11000 11005
    Val Glu Thr Ile Glu Asn Glu Leu Ala Asp Val Leu Ala Gly Leu Ser
    11010 11015 11020
    Pro Gln Thr Pro Gln Val Pro Phe Phe Ser Thr Leu Glu Gly Thr Trp
    11025 11030 11035 11040
    Ile Thr Glu Pro Ala Leu Asp Gly Gly Tyr Trp Tyr Arg Asn Leu Arg
    11045 11050 11055
    His Arg Val Gly Phe Ala Pro Ala Val Glu Thr Leu Ala Thr Asp Glu
    11060 11065 11070
    Gly Phe Thr His Phe Ile Glu Val Ser Ala His Pro Val Leu Thr Met
    11075 11080 11085
    Thr Leu Pro Asp Lys Val Thr Gly Leu Ala Thr Leu Arg Arg Glu Asp
    11090 11095 11100
    Gly Gly Gln His Arg Leu Thr Thr Ser Leu Ala Glu Ala Trp Ala Asn
    11105 11110 11115 11120
    Gly Leu Ala Leu Asp Trp Ala Ser Leu Leu Pro Ala Thr Gly Ala Leu
    11125 11130 11135
    Ser Pro Ala Val Pro Asp Leu Pro Thr Tyr Ala Phe Gln His Arg Ser
    11140 11145 11150
    Tyr Trp Ile Ser Pro Ala Gly Pro Gly Glu Ala Pro Ala His Thr Ala
    11155 11160 11165
    Ser Gly Arg Glu Ala Val Ala Glu Thr Gly Leu Ala Trp Gly Pro Gly
    11170 11175 11180
    Ala Glu Asp Leu Asp Glu Glu Gly Arg Arg Ser Ala Val Leu Ala Met
    11185 11190 11195 11200
    Val Met Arg Gln Ala Ala Ser Val Leu Arg Cys Asp Ser Pro Glu Glu
    11205 11210 11215
    Val Pro Val Asp Arg Pro Leu Arg Glu Ile Gly Phe Asp Ser Leu Thr
    11220 11225 11230
    Ala Val Asp Phe Arg Asn Arg Val Asn Arg Leu Thr Gly Leu Gln Leu
    11235 11240 11245
    Pro Pro Thr Val Val Phe Gln His Pro Thr Pro Val Ala Leu Ala Glu
    11250 11255 11260
    Arg Ile Ser Asp Glu Leu Ala Glu Arg Asn Trp Ala Val Ala Glu Pro
    11265 11270 11275 11280
    Ser Asp His Glu Gln Ala Glu Glu Glu Lys Ala Ala Ala Pro Ala Gly
    11285 11290 11295
    Ala Arg Ser Gly Ala Asp Thr Gly Ala Gly Ala Gly Met Phe Arg Ala
    11300 11305 11310
    Leu Phe Arg Gln Ala Val Glu Asp Asp Arg Tyr Gly Glu Phe Leu Asp
    11315 11320 11325
    Val Leu Ala Glu Ala Ser Ala Phe Arg Pro Gln Phe Ala Ser Pro Glu
    11330 11335 11340
    Ala Cys Ser Glu Arg Leu Asp Pro Val Leu Leu Ala Gly Gly Pro Thr
    11345 11350 11355 11360
    Asp Arg Ala Glu Gly Arg Ala Val Leu Val Gly Cys Thr Gly Thr Ala
    11365 11370 11375
    Ala Asn Gly Gly Pro His Glu Phe Leu Arg Leu Ser Thr Ser Phe Gln
    11380 11385 11390
    Glu Glu Arg Asp Phe Leu Ala Val Pro Leu Pro Gly Tyr Gly Thr Gly
    11395 11400 11405
    Thr Gly Thr Gly Thr Ala Leu Leu Pro Ala Asp Leu Asp Thr Ala Leu
    11410 11415 11420
    Asp Ala Gln Ala Arg Ala Ile Leu Arg Ala Ala Gly Asp Ala Pro Val
    11425 11430 11435 11440
    Val Leu Leu Gly His Ser Gly Gly Ala Leu Leu Ala His Glu Leu Ala
    11445 11450 11455
    Phe Arg Leu Glu Arg Ala His Gly Ala Pro Pro Ala Gly Ile Val Leu
    11460 11465 11470
    Val Asp Pro Tyr Pro Pro Gly His Gln Glu Pro Ile Glu Val Trp Ser
    11475 11480 11485
    Arg Gln Leu Gly Glu Gly Leu Phe Ala Gly Glu Leu Glu Pro Met Ser
    11490 11495 11500
    Asp Ala Arg Leu Leu Ala Met Gly Arg Tyr Ala Arg Phe Leu Ala Gly
    11505 11510 11515 11520
    Pro Arg Pro Gly Arg Ser Ser Ala Pro Val Leu Leu Val Arg Ala Ser
    11525 11530 11535
    Glu Pro Leu Gly Asp Trp Gln Glu Glu Arg Gly Asp Trp Arg Ala His
    11540 11545 11550
    Trp Asp Leu Pro His Thr Val Ala Asp Val Pro Gly Asp His Phe Thr
    11555 11560 11565
    Met Met Arg Asp His Ala Pro Ala Val Ala Glu Ala Val Leu Ser Trp
    11570 11575 11580
    Leu Asp Ala Ile Glu Gly Ile Glu Gly Ala Gly Lys Met Thr Asp Arg
    11585 11590 11595 11600
    Pro Leu Asn Val Asp Ser Gly Leu Trp Ile Arg Arg Phe His Pro Ala
    11605 11610 11615
    Pro Asn Ser Ala Val Arg Leu Val Cys Leu Pro His Ala Gly Gly Ser
    11620 11625 11630
    Ala Ser Tyr Phe Phe Arg Phe Ser Glu Glu Leu His Pro Ser Val Glu
    11635 11640 11645
    Ala Leu Ser Val Gln Tyr Pro Gly Arg Gln Asp Arg Arg Ala Glu Pro
    11650 11655 11660
    Cys Leu Glu Ser Val Glu Glu Leu Ala Glu His Val Val Ala Ala Thr
    11665 11670 11675 11680
    Glu Pro Trp Trp Gln Glu Gly Arg Leu Ala Phe Phe Gly His Ser Leu
    11685 11690 11695
    Gly Ala Ser Val Ala Phe Glu Thr Ala Arg Ile Leu Glu Gln Arg His
    11700 11705 11710
    Gly Val Arg Pro Glu Gly Leu Tyr Val Ser Gly Arg Arg Ala Pro Ser
    11715 11720 11725
    Leu Ala Pro Asp Arg Leu Val His Gln Leu Asp Asp Arg Ala Phe Leu
    11730 11735 11740
    Ala Glu Ile Arg Arg Leu Ser Gly Thr Asp Glu Arg Phe Leu Gln Asp
    11745 11750 11755 11760
    Asp Glu Leu Leu Arg Leu Val Leu Pro Ala Leu Arg Ser Asp Tyr Lys
    11765 11770 11775
    Ala Ala Glu Thr Tyr Leu His Arg Pro Ser Ala Lys Leu Thr Cys Pro
    11780 11785 11790
    Val Met Ala Leu Ala Gly Asp Arg Asp Pro Lys Ala Pro Leu Asn Glu
    11795 11800 11805
    Val Ala Glu Trp Arg Arg His Thr Ser Gly Pro Phe Cys Leu Arg Ala
    11810 11815 11820
    Tyr Ser Gly Gly His Phe Tyr Leu Asn Asp Gln Trp His Glu Ile Cys
    11825 11830 11835 11840
    Asn Asp Ile Ser Asp His Leu Leu Val Thr Arg Gly Ala Pro Asp Ala
    11845 11850 11855
    Arg Val Val Gln Pro Pro Thr Ser Leu Ile Glu Gly Ala Ala Lys Arg
    11860 11865 11870
    Trp Gln Asn Pro Arg
    11875
    <210> SEQ ID NO 50
    <211> LENGTH: 1248
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 50
    gtgaaaagcg ccttatccga cctcgcattc ttcggcggcc ccgccgcttt cgaccagccg 60
    ctcctcgtgg ggcggcccaa ccgcatcgac cgcgccaggc tgtacgagcg gctcgaccgg 120
    gccctcgaca gccagtggct gtccaacggc ggcccgctcg tccgcgagtt cgaggagcgc 180
    gtcgccgggc tcgccggggt ccggcatgcc gtggccacct gcaacgccac ggccgggctc 240
    cagctcctcg cgcacgccgc cggcctcacc ggcgaagtga tcatgccgtc gatgacgttc 300
    gccgccaccc cgcacgcact gcgctggatc ggcctcaccc cggtcttcgc cgacatcgac 360
    ccggacaccg gcaacctcga cccggaccag gtggccgccg cggtcacacc ccgcacctcg 420
    gccgtcgtcg gcgtccacct ctggggccgc ccctgcgccg ccgaccagct gcggaaggtc 480
    gccgacgagc acggcctgcg gctgtacttc gacgccgcgc acgccctcgg ctgcgcggtc 540
    gacggccggc ccgccggcag cctcggcgac gccgaggtct tcagcttcca cgccaccaag 600
    gccgtcaacg ccttcgaggg cggcgccgtc gtcaccgacg acgccgacct cgccgcccgg 660
    atccgcgccc tccacaactt cggcttcgac ctgcccggcg gcagccccgc cggcgggacc 720
    aacgccaaga tgagcgaggc cgccgccgcc atgggcctca cctccctcga cgcgtttccc 780
    gaggtcatcg accggaaccg gcgcaaccac gccgcctacc gcgagcacct cgcggacctc 840
    cccggcgtcc tcgtcgccga ccacgaccgc cacggcctca acaaccacca gtacgtgatc 900
    gtcgagatcg acgaggccac caccggcatc caccgcgacc tcgtcatgga ggtcctgaag 960
    gccgaaggcg tgcacacccg cgcctacttc tcgccgggct gccacgagct ggagccgtac 1020
    cgcgggcagc cgcacgcccc gctgccgcac accgaacgcc tcgccgcgcg cgtgctgtcc 1080
    ctgccgaccg gcaccgccat cggcgacgac gacatccgcc gggtcgccga cctgctgcgt 1140
    ctctgcgcga cccgcggccg cgaactgacc gcgcgccacc gcgacacggc ccccgccccg 1200
    ctcgcggccc cccagacatc cacgcccacg attggacgct cccgatga 1248
    <210> SEQ ID NO 51
    <211> LENGTH: 415
    <212> TYPE: PRT
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 51
    Met Lys Ser Ala Leu Ser Asp Leu Ala Phe Phe Gly Gly Pro Ala Ala
    1 5 10 15
    Phe Asp Gln Pro Leu Leu Val Gly Arg Pro Asn Arg Ile Asp Arg Ala
    20 25 30
    Arg Leu Tyr Glu Arg Leu Asp Arg Ala Leu Asp Ser Gln Trp Leu Ser
    35 40 45
    Asn Gly Gly Pro Leu Val Arg Glu Phe Glu Glu Arg Val Ala Gly Leu
    50 55 60
    Ala Gly Val Arg His Ala Val Ala Thr Cys Asn Ala Thr Ala Gly Leu
    65 70 75 80
    Gln Leu Leu Ala His Ala Ala Gly Leu Thr Gly Glu Val Ile Met Pro
    85 90 95
    Ser Met Thr Phe Ala Ala Thr Pro His Ala Leu Arg Trp Ile Gly Leu
    100 105 110
    Thr Pro Val Phe Ala Asp Ile Asp Pro Asp Thr Gly Asn Leu Asp Pro
    115 120 125
    Asp Gln Val Ala Ala Ala Val Thr Pro Arg Thr Ser Ala Val Val Gly
    130 135 140
    Val His Leu Trp Gly Arg Pro Cys Ala Ala Asp Gln Leu Arg Lys Val
    145 150 155 160
    Ala Asp Glu His Gly Leu Arg Leu Tyr Phe Asp Ala Ala His Ala Leu
    165 170 175
    Gly Cys Ala Val Asp Gly Arg Pro Ala Gly Ser Leu Gly Asp Ala Glu
    180 185 190
    Val Phe Ser Phe His Ala Thr Lys Ala Val Asn Ala Phe Glu Gly Gly
    195 200 205
    Ala Val Val Thr Asp Asp Ala Asp Leu Ala Ala Arg Ile Arg Ala Leu
    210 215 220
    His Asn Phe Gly Phe Asp Leu Pro Gly Gly Ser Pro Ala Gly Gly Thr
    225 230 235 240
    Asn Ala Lys Met Ser Glu Ala Ala Ala Ala Met Gly Leu Thr Ser Leu
    245 250 255
    Asp Ala Phe Pro Glu Val Ile Asp Arg Asn Arg Arg Asn His Ala Ala
    260 265 270
    Tyr Arg Glu His Leu Ala Asp Leu Pro Gly Val Leu Val Ala Asp His
    275 280 285
    Asp Arg His Gly Leu Asn Asn His Gln Tyr Val Ile Val Glu Ile Asp
    290 295 300
    Glu Ala Thr Thr Gly Ile His Arg Asp Leu Val Met Glu Val Leu Lys
    305 310 315 320
    Ala Glu Gly Val His Thr Arg Ala Tyr Phe Ser Pro Gly Cys His Glu
    325 330 335
    Leu Glu Pro Tyr Arg Gly Gln Pro His Ala Pro Leu Pro His Thr Glu
    340 345 350
    Arg Leu Ala Ala Arg Val Leu Ser Leu Pro Thr Gly Thr Ala Ile Gly
    355 360 365
    Asp Asp Asp Ile Arg Arg Val Ala Asp Leu Leu Arg Leu Cys Ala Thr
    370 375 380
    Arg Gly Arg Glu Leu Thr Ala Arg His Arg Asp Thr Ala Pro Ala Pro
    385 390 395 400
    Leu Ala Ala Pro Gln Thr Ser Thr Pro Thr Ile Gly Arg Ser Arg
    405 410 415
    <210> SEQ ID NO 52
    <211> LENGTH: 1458
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 52
    atgaccgccc ccgccctttc cgccaccgcc ccggccgaac gctgcgcgca ccccggagcc 60
    gatctggggg cggcggtcca cgccgtcggc cagaccctcg ccgccggcgg cctcgtgccg 120
    cccgacgagg ccggaacgac cgcccgccac ctcgtccggc tcgccgtgcg ctacggcaac 180
    agccccttca ccccgctgga ggaggcccgc cacgacctgg gcgtcgaccg ggacgccttc 240
    cggcgcctcc tcgccctgtt cgggcaggtc ccggagctcc gcaccgcggt cgagaccggc 300
    cccgccgggg cgtactggaa gaacaccctg ctcccgctcg aacagcgcgg cgtcttcgac 360
    gcggcgctcg ccaggaagcc cgtcttcccg tacagcgtcg gcctctaccc cggcccgacc 420
    tgcatgttcc gctgccactt ctgcgtccgt gtgaccggcg cccgctacga cccgtccgcc 480
    ctcgacgccg gcaacgccat gttccggtcg gtcatcgacg agatacccgc gggcaacccc 540
    tcggcgatgt acttctccgg cggcctggag ccgctcacca accccggcct cgggagcctg 600
    gccgcgcacg ccaccgacca cggcctgcgg cccaccgtct acacgaactc cttcgcgctc 660
    accgagcgca ccctggagcg ccagcccggc ctctggggcc tgcacgccat ccgcacctcg 720
    ctctacggcc tcaacgacga ggagtacgag cagaccaccg gcaagaaggc cgccttccgc 780
    cgcgtccgcg agaacctgcg ccgcttccag cagctgcgcg ccgagcgcga gtcgccgatc 840
    aacctcggct tcgcctacat cgtgctcccg ggccgtgcct cccgcctgct cgacctggtc 900
    gacttcatcg ccgacctcaa cgacgccggg cagggcagga cgatcgactt cgtcaacatt 960
    cgcgaggact acagcggccg tgacgacggc aagctgccgc aggaggagcg ggccgagctc 1020
    caggaggccc tcaacgcctt cgaggagcgg gtccgcgagc gcacccccgg actccacatc 1080
    gactacggct acgccctgaa cagcctgcgc accggggccg acgccgaact gctgcggatc 1140
    aagcccgcca ccatgcggcc caccgcgcac ccgcaggtcg cggtgcaggt cgatctcctc 1200
    ggcgacgtgt acctgtaccg cgaggccggc ttccccgacc tggacggcgc gacccgctac 1260
    atcgcgggcc gcgtgacccc cgacacctcc ctcaccgagg tcgtcaggga cttcgtcgag 1320
    cgcggcggcg aggtggcggc cgtcgacggc gacgagtact tcatggacgg cttcgatcag 1380
    gtcgtcaccg cccgcctgaa ccagctggag cgcgacgccg cggacggctg ggaggaggcc 1440
    cgcggcttcc tgcgctga 1458
    <210> SEQ ID NO 53
    <211> LENGTH: 485
    <212> TYPE: PRT
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 53
    Met Thr Ala Pro Ala Leu Ser Ala Thr Ala Pro Ala Glu Arg Cys Ala
    1 5 10 15
    His Pro Gly Ala Asp Leu Gly Ala Ala Val His Ala Val Gly Gln Thr
    20 25 30
    Leu Ala Ala Gly Gly Leu Val Pro Pro Asp Glu Ala Gly Thr Thr Ala
    35 40 45
    Arg His Leu Val Arg Leu Ala Val Arg Tyr Gly Asn Ser Pro Phe Thr
    50 55 60
    Pro Leu Glu Glu Ala Arg His Asp Leu Gly Val Asp Arg Asp Ala Phe
    65 70 75 80
    Arg Arg Leu Leu Ala Leu Phe Gly Gln Val Pro Glu Leu Arg Thr Ala
    85 90 95
    Val Glu Thr Gly Pro Ala Gly Ala Tyr Trp Lys Asn Thr Leu Leu Pro
    100 105 110
    Leu Glu Gln Arg Gly Val Phe Asp Ala Ala Leu Ala Arg Lys Pro Val
    115 120 125
    Phe Pro Tyr Ser Val Gly Leu Tyr Pro Gly Pro Thr Cys Met Phe Arg
    130 135 140
    Cys His Phe Cys Val Arg Val Thr Gly Ala Arg Tyr Asp Pro Ser Ala
    145 150 155 160
    Leu Asp Ala Gly Asn Ala Met Phe Arg Ser Val Ile Asp Glu Ile Pro
    165 170 175
    Ala Gly Asn Pro Ser Ala Met Tyr Phe Ser Gly Gly Leu Glu Pro Leu
    180 185 190
    Thr Asn Pro Gly Leu Gly Ser Leu Ala Ala His Ala Thr Asp His Gly
    195 200 205
    Leu Arg Pro Thr Val Tyr Thr Asn Ser Phe Ala Leu Thr Glu Arg Thr
    210 215 220
    Leu Glu Arg Gln Pro Gly Leu Trp Gly Leu His Ala Ile Arg Thr Ser
    225 230 235 240
    Leu Tyr Gly Leu Asn Asp Glu Glu Tyr Glu Gln Thr Thr Gly Lys Lys
    245 250 255
    Ala Ala Phe Arg Arg Val Arg Glu Asn Leu Arg Arg Phe Gln Gln Leu
    260 265 270
    Arg Ala Glu Arg Glu Ser Pro Ile Asn Leu Gly Phe Ala Tyr Ile Val
    275 280 285
    Leu Pro Gly Arg Ala Ser Arg Leu Leu Asp Leu Val Asp Phe Ile Ala
    290 295 300
    Asp Leu Asn Asp Ala Gly Gln Gly Arg Thr Ile Asp Phe Val Asn Ile
    305 310 315 320
    Arg Glu Asp Tyr Ser Gly Arg Asp Asp Gly Lys Leu Pro Gln Glu Glu
    325 330 335
    Arg Ala Glu Leu Gln Glu Ala Leu Asn Ala Phe Glu Glu Arg Val Arg
    340 345 350
    Glu Arg Thr Pro Gly Leu His Ile Asp Tyr Gly Tyr Ala Leu Asn Ser
    355 360 365
    Leu Arg Thr Gly Ala Asp Ala Glu Leu Leu Arg Ile Lys Pro Ala Thr
    370 375 380
    Met Arg Pro Thr Ala His Pro Gln Val Ala Val Gln Val Asp Leu Leu
    385 390 395 400
    Gly Asp Val Tyr Leu Tyr Arg Glu Ala Gly Phe Pro Asp Leu Asp Gly
    405 410 415
    Ala Thr Arg Tyr Ile Ala Gly Arg Val Thr Pro Asp Thr Ser Leu Thr
    420 425 430
    Glu Val Val Arg Asp Phe Val Glu Arg Gly Gly Glu Val Ala Ala Val
    435 440 445
    Asp Gly Asp Glu Tyr Phe Met Asp Gly Phe Asp Gln Val Val Thr Ala
    450 455 460
    Arg Leu Asn Gln Leu Glu Arg Asp Ala Ala Asp Gly Trp Glu Glu Ala
    465 470 475 480
    Arg Gly Phe Leu Arg
    485
    <210> SEQ ID NO 54
    <211> LENGTH: 879
    <212> TYPE: DNA
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 54
    atgaagggaa tagtcctggc cggcgggagc ggaactcggc tgcatccggc gacctcggtc 60
    atttcgaagc agattcttcc ggtctacaac aaaccgatga tctactatcc gctgtcggtt 120
    ctcatgctcg gcggtattcg cgagattcaa atcatctcga ccccccagca catcgaactc 180
    ttccagtcgc ttctcggaaa cggcaggcac ctgggaatag aactcgacta tgcggtccag 240
    aaagagcccg caggaatcgc ggacgcactt ctcgtcggag ccgagcacat cggcgacgac 300
    acctgcgccc tgatcctggg cgacaacatc ttccacgggc ccggcctcta cacgctcctg 360
    cgggacagca tcgcgcgcct cgacggctgc gtgctcttcg gctacccggt caaggacccc 420
    gagcggtacg gcgtcgccga ggtggacgcg acgggccggc tgaccgacct cgtcgagaag 480
    cccgtcaagc cgcgctccaa cctcgccgtc accggcctct acctctacga caacgacgtc 540
    gtcgacatcg ccaagaacat ccggccctcg ccgcgcggcg agctggagat caccgacgtc 600
    aaccgcgtct acctggagcg gggccgggcc gaactcgtca acctgggccg cggcttcgcc 660
    tggctggaca ccggcaccca cgactcgctc ctgcgggccg cccagtacgt ccaggtcctg 720
    gaggagcggc agggcgtctg gatcgcgggc cttgaggaga tcgccttccg catgggcttc 780
    atcgacgccg aggcctgtca cggcctggga gaaggcctct cccgcaccga gtacggcagc 840
    tatctgatgg agatcgccgg ccgcgaggga gccccgtga 879
    <210> SEQ ID NO 55
    <211> LENGTH: 292
    <212> TYPE: PRT
    <213> ORGANISM: Streptomyces venezuelae
    <400> SEQUENCE: 55
    Met Lys Gly Ile Val Leu Ala Gly Gly Ser Gly Thr Arg Leu His Pro
    1 5 10 15
    Ala Thr Ser Val Ile Ser Lys Gln Ile Leu Pro Val Tyr Asn Lys Pro
    20 25 30
    Met Ile Tyr Tyr Pro Leu Ser Val Leu Met Leu Gly Gly Ile Arg Glu
    35 40 45
    Ile Gln Ile Ile Ser Thr Pro Gln His Ile Glu Leu Phe Gln Ser Leu
    50 55 60
    Leu Gly Asn Gly Arg His Leu Gly Ile Glu Leu Asp Tyr Ala Val Gln
    65 70 75 80
    Lys Glu Pro Ala Gly Ile Ala Asp Ala Leu Leu Val Gly Ala Glu His
    85 90 95
    Ile Gly Asp Asp Thr Cys Ala Leu Ile Leu Gly Asp Asn Ile Phe His
    100 105 110
    Gly Pro Gly Leu Tyr Thr Leu Leu Arg Asp Ser Ile Ala Arg Leu Asp
    115 120 125
    Gly Cys Val Leu Phe Gly Tyr Pro Val Lys Asp Pro Glu Arg Tyr Gly
    130 135 140
    Val Ala Glu Val Asp Ala Thr Gly Arg Leu Thr Asp Leu Val Glu Lys
    145 150 155 160
    Pro Val Lys Pro Arg Ser Asn Leu Ala Val Thr Gly Leu Tyr Leu Tyr
    165 170 175
    Asp Asn Asp Val Val Asp Ile Ala Lys Asn Ile Arg Pro Ser Pro Arg
    180 185 190
    Gly Glu Leu Glu Ile Thr Asp Val Asn Arg Val Tyr Leu Glu Arg Gly
    195 200 205
    Arg Ala Glu Leu Val Asn Leu Gly Arg Gly Phe Ala Trp Leu Asp Thr
    210 215 220
    Gly Thr His Asp Ser Leu Leu Arg Ala Ala Gln Tyr Val Gln Val Leu
    225 230 235 240
    Glu Glu Arg Gln Gly Val Trp Ile Ala Gly Leu Glu Glu Ile Ala Phe
    245 250 255
    Arg Met Gly Phe Ile Asp Ala Glu Ala Cys His Gly Leu Gly Glu Gly
    260 265 270
    Leu Ser Arg Thr Glu Tyr Gly Ser Tyr Leu Met Glu Ile Ala Gly Arg
    275 280 285
    Glu Gly Ala Pro
    290

Claims (15)

What is claimed is:
1. An isolated nucleic acid that comprises a sequence identical or complementary to all or part of a coding sequence for a narbonolide polyketide synthase gene from Streptomyces narbonensis, wherein said, part of said coding sequence is selected from the group consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, and SEQ ID NO:12.
2. The isolated nucleic acid of claim 1, wherein said coding sequence encodes a ketosynthase domain.
3. The isolated nucleic acid of claim 1, wherein said coding sequence encodes an acyltransferase domain.
4. The isolated nucleic acid of claim 1, wherein said coding sequence encodes an acyl carrier protein domain.
5. The isolated nucleic acid of claim 1, that encodes a module, said module comprising a ketosynthase domain, an acyltransferase domain, and an acyl carrier protein domain.
6. The isolated nucleic acid of claim 1 that encodes an open reading frame, said open reading frame comprising two or more modules, each module comprising a ketosynthase domain, an acyltransferase domain, and an acyl carrier protein domain.
7. The isolated nucleic acid of claim 1 that encodes a gene cluster, said gene cluster comprising two or more open reading frames, each of said open reading frames comprising two or more modules, each of said modules comprising a ketosynthase domain, an acyltransferase domain, and an acyl carrier protein activity domain.
8. The isolated nucleic acid of claim 1 that is selected from the group consisting of cosmids pKOS037-23 and pKOS037-26.
9. A recombinant DNA expression vector comprising the nucleic acid of claim 8.
10. An isolated and purified nucleic acid segment comprising a nucleic acid sequence comprising a macrolide biosynthetic gene cluster encoding methymycin, pikomycin, neomethymycin, narbomycin, or a combination thereof, or a biologically active variant or fragment thereof which is from Streptomyces narbonensis.
11. A host cell, the genome of which is augmented with the nucleic acid sequence of claim 10.
12. An isolated and purified DNA molecule comprising a first DNA segment encoding a first module and a second DNA segment encoding a second module, wherein the DNA segments together encode a recombinant polyhydroxyalkanoate monomer synthase, and wherein at least one DNA segment is derived from the pikA gene cluster of Streptomyces narbonensis.
13. A method of providing a polyhydroxyalkanoate monomer, comprising:
(a) introducing into a host cell a DNA molecule comprising a DNA segment encoding a recombinant polyhydroxyalkanoate monomer synthase operably linked to a promoter functional in the host cell, wherein the recombinant polyhydroxyalkanoate monomer synthase comprises a first module and a second module, and wherein at least one DNA segment is derived from the pikA gene cluster of Streptomyces narbonensis; and
(b) expressing the DNA encoding the recombinant polyhydroxyalkanoate monomer synthase in the host cell so as to generate a polyhydroxyalkanoate monomer.
14. A recombinant vector comprising one or more modules of a polyketide synthase wherein at least one module is from Streptomyces narbonensis.
15. A method of providing a polyhydroxyalkanoate monomer, comprising:
(a) introducing into a host cell a DNA molecule encoding a fusion polypeptide, wherein the DNA molecule comprises a first DNA segment operably linked to a promoter functional in the host cell and a second DNA segment, wherein at least one DNA segment is derived from the pikA gene cluster of Streptomyces narbonensis; and
(b) expressing the DNA in the host cell so as to generate the fusion polypeptide.
US10/271,889 2001-04-17 2002-10-15 DNA encoding methymycin and pikromycin Abandoned US20030194784A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US10/271,889 US20030194784A1 (en) 2001-04-17 2002-10-15 DNA encoding methymycin and pikromycin

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US09/836,821 US20030087405A1 (en) 1998-06-26 2001-04-17 Products encoded by a methymycin/pikromycin biosynthetic gene cluster
US09/860,846 US20020164742A1 (en) 1998-06-26 2001-05-18 DNA encoding methymycin and pikromycin
US09/861,289 US20020110897A1 (en) 1998-06-26 2001-05-18 Polyketide synthase encoded by a methymycin/pikromycin biosynthetic gene cluster
US10/271,889 US20030194784A1 (en) 2001-04-17 2002-10-15 DNA encoding methymycin and pikromycin

Related Parent Applications (3)

Application Number Title Priority Date Filing Date
US09/836,821 Continuation-In-Part US20030087405A1 (en) 1998-06-26 2001-04-17 Products encoded by a methymycin/pikromycin biosynthetic gene cluster
US09/861,289 Continuation-In-Part US20020110897A1 (en) 1998-06-26 2001-05-18 Polyketide synthase encoded by a methymycin/pikromycin biosynthetic gene cluster
US09/860,846 Continuation-In-Part US20020164742A1 (en) 1998-06-26 2001-05-18 DNA encoding methymycin and pikromycin

Publications (1)

Publication Number Publication Date
US20030194784A1 true US20030194784A1 (en) 2003-10-16

Family

ID=28795037

Family Applications (1)

Application Number Title Priority Date Filing Date
US10/271,889 Abandoned US20030194784A1 (en) 2001-04-17 2002-10-15 DNA encoding methymycin and pikromycin

Country Status (1)

Country Link
US (1) US20030194784A1 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090112259A1 (en) * 2007-10-31 2009-04-30 Angiotech Pharmaceuticals, Inc. Recombinant expressed bioadsorbable polyhydroxyalkonate monofilament and multi-filaments self-retaining sutures

Citations (39)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4874748A (en) * 1986-03-24 1989-10-17 Abbott Laboratories Cloning vectors for streptomyces and use thereof in macrolide antibiotic production
US4885251A (en) * 1985-04-22 1989-12-05 Eli Lilly And Company Recombinant DNA expression vectors and DNA compounds which encode isopenicillin N synthetase
US4886757A (en) * 1987-04-15 1989-12-12 Eli Lilly And Company Spiramycin resistance-conferring cloning vectors
US4892819A (en) * 1985-11-25 1990-01-09 Eli Lilly And Company Recombinant DNA expression vectors and DNA compounds that encode isopenicillin N synthetase from penicillium chrysogenum
US4935340A (en) * 1985-06-07 1990-06-19 Eli Lilly And Company Method of isolating antibiotic biosynthetic genes
US4952502A (en) * 1987-02-24 1990-08-28 Eli Lilly And Company Carbomycin biosynthetic gene, designated carG, for use in streptomyces and other organisms
US5057425A (en) * 1988-07-29 1991-10-15 Eli Lilly And Company Picromycin resistance-conferring gene, designated pica, for use in streptomyces and other organisms
US5063155A (en) * 1988-03-28 1991-11-05 Eli Lilly And Company Method for producing 2"'-o-demethyltylosin
US5068189A (en) * 1988-05-13 1991-11-26 Eli Lilly And Company Recombinant dna vectors encoding a 4"-o-isovaleryl acylase derived from a carbomycin biosynthetic gene, designated care, for use in streptomyces and other organisms
US5098837A (en) * 1988-06-07 1992-03-24 Eli Lilly And Company Macrolide biosynthetic genes for use in streptomyces and other organisms
US5108918A (en) * 1988-08-11 1992-04-28 Gist-Brocades Method for identifying and using biosynthetic genes for enhanced production of secondary metabolites
US5116968A (en) * 1988-05-10 1992-05-26 American Cyanamid Company Macrolide compounds
US5141926A (en) * 1990-04-18 1992-08-25 Abbott Laboratories Erythromycin derivatives
US5149639A (en) * 1986-03-24 1992-09-22 Abbott Laboratories Biologically pure cultures of streptomyces and use thereof in macrolide antibiotic production
US5149638A (en) * 1988-09-29 1992-09-22 Eli Lilly And Company Tylosin biosynthetic genes tylA, tylB and tylI
US5168052A (en) * 1988-03-28 1992-12-01 Eli Lilly And Company Method for producing 20-deoxotylosin
US5229279A (en) * 1987-06-29 1993-07-20 Massachusetts Institute Of Technology Method for producing novel polyester biopolymers
US5245023A (en) * 1987-06-29 1993-09-14 Massachusetts Institute Of Technology Method for producing novel polyester biopolymers
US5250430A (en) * 1987-06-29 1993-10-05 Massachusetts Institute Of Technology Polyhydroxyalkanoate polymerase
US5462862A (en) * 1988-08-11 1995-10-31 Gist-Brocades N.V. Method and compositions for enhancing production of secondary metabolites using clustered biosynthetic genes
US5480794A (en) * 1987-06-29 1996-01-02 Massachusetts Institute Of Technology And Metabolix, Inc. Overproduction and purification of soluble PHA synthase
US5514544A (en) * 1991-07-26 1996-05-07 Eli Lilly And Company Activator gene for macrolide biosynthesis
US5545553A (en) * 1994-09-26 1996-08-13 The Rockefeller University Glycosyltransferases for biosynthesis of oligosaccharides, and genes encoding them
US5589385A (en) * 1990-07-26 1996-12-31 American Cyanamid Company Cloning of the biosynthetic pathway for chlortetracycline and tetracycline formation and cosmids useful therein
US5610041A (en) * 1991-07-19 1997-03-11 Board Of Trustees Operating Michigan State University Processes for producing polyhydroxybutyrate and related polyhydroxyalkanoates in the plastids of higher plants
US5665564A (en) * 1988-05-27 1997-09-09 Pharmacia & Upjohn S.P.A. Isolation and characterisation of genes resistant to anthracycline antibiotics
US5672491A (en) * 1993-09-20 1997-09-30 The Leland Stanford Junior University Recombinant production of novel polyketides
US5672497A (en) * 1986-03-21 1997-09-30 Eli Lilly And Company Method for increasing the antibiotic-producing ability of antibiotic-producing microorganisms
US5702717A (en) * 1995-10-25 1997-12-30 Macromed, Inc. Thermosensitive biodegradable polymers based on poly(ether-ester)block copolymers
US5712146A (en) * 1993-09-20 1998-01-27 The Leland Stanford Junior University Recombinant combinatorial genetic library for the production of novel polyketides
US5716849A (en) * 1994-06-08 1998-02-10 Novartis Finance Corporation Genes for the biosynthesis of soraphen
US5744350A (en) * 1993-11-02 1998-04-28 Merck & Co., Inc. DNA encoding triol polyketide synthase
US5824513A (en) * 1991-01-17 1998-10-20 Abbott Laboratories Recombinant DNA method for producing erythromycin analogs
US5830750A (en) * 1993-09-20 1998-11-03 The John Innes Institute Recombinant production of novel polyketides
US6033883A (en) * 1996-12-18 2000-03-07 Kosan Biosciences, Inc. Production of polyketides in bacteria and yeast
US6090601A (en) * 1998-01-23 2000-07-18 Kosan Bioscience Sorangium polyketide synthase
US6117659A (en) * 1997-04-30 2000-09-12 Kosan Biosciences, Inc. Recombinant narbonolide polyketide synthase
US6303767B1 (en) * 1998-11-05 2001-10-16 Kosan Biosciences, Inc. Nucleic acids encoding narbonolide polyketide synthase enzymes from streptomyces narbonensis
US6503741B1 (en) * 1998-05-28 2003-01-07 Kosan Biosciences, Inc. Polyketide synthase genes from Streptomyces venezuelae

Patent Citations (49)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4885251A (en) * 1985-04-22 1989-12-05 Eli Lilly And Company Recombinant DNA expression vectors and DNA compounds which encode isopenicillin N synthetase
US4935340A (en) * 1985-06-07 1990-06-19 Eli Lilly And Company Method of isolating antibiotic biosynthetic genes
US4892819A (en) * 1985-11-25 1990-01-09 Eli Lilly And Company Recombinant DNA expression vectors and DNA compounds that encode isopenicillin N synthetase from penicillium chrysogenum
US5672497A (en) * 1986-03-21 1997-09-30 Eli Lilly And Company Method for increasing the antibiotic-producing ability of antibiotic-producing microorganisms
US4874748A (en) * 1986-03-24 1989-10-17 Abbott Laboratories Cloning vectors for streptomyces and use thereof in macrolide antibiotic production
US5149639A (en) * 1986-03-24 1992-09-22 Abbott Laboratories Biologically pure cultures of streptomyces and use thereof in macrolide antibiotic production
US4952502A (en) * 1987-02-24 1990-08-28 Eli Lilly And Company Carbomycin biosynthetic gene, designated carG, for use in streptomyces and other organisms
US4886757A (en) * 1987-04-15 1989-12-12 Eli Lilly And Company Spiramycin resistance-conferring cloning vectors
US5250430A (en) * 1987-06-29 1993-10-05 Massachusetts Institute Of Technology Polyhydroxyalkanoate polymerase
US5512669A (en) * 1987-06-29 1996-04-30 Massachusetts Institute Of Technology Gene encoding bacterial acetoacetyl-COA reductase
US5663063A (en) * 1987-06-29 1997-09-02 Massachusetts Institute Of Technology Method for producing polyester biopolymers
US5534432A (en) * 1987-06-29 1996-07-09 Massachusetts Institute Of Technology Polyhydroxybutyrate polymerase
US5798235A (en) * 1987-06-29 1998-08-25 Massachusetts Institute Of Technology Gene encoding bacterial acetoacetylco a reductase
US5480794A (en) * 1987-06-29 1996-01-02 Massachusetts Institute Of Technology And Metabolix, Inc. Overproduction and purification of soluble PHA synthase
US5661026A (en) * 1987-06-29 1997-08-26 Massachusetts Institute Of Technology Gene encoding bacterial beta-ketothiolase
US5245023A (en) * 1987-06-29 1993-09-14 Massachusetts Institute Of Technology Method for producing novel polyester biopolymers
US5229279A (en) * 1987-06-29 1993-07-20 Massachusetts Institute Of Technology Method for producing novel polyester biopolymers
US5168052A (en) * 1988-03-28 1992-12-01 Eli Lilly And Company Method for producing 20-deoxotylosin
US5063155A (en) * 1988-03-28 1991-11-05 Eli Lilly And Company Method for producing 2"'-o-demethyltylosin
US5116968A (en) * 1988-05-10 1992-05-26 American Cyanamid Company Macrolide compounds
US5068189A (en) * 1988-05-13 1991-11-26 Eli Lilly And Company Recombinant dna vectors encoding a 4"-o-isovaleryl acylase derived from a carbomycin biosynthetic gene, designated care, for use in streptomyces and other organisms
US5665564A (en) * 1988-05-27 1997-09-09 Pharmacia & Upjohn S.P.A. Isolation and characterisation of genes resistant to anthracycline antibiotics
US5098837A (en) * 1988-06-07 1992-03-24 Eli Lilly And Company Macrolide biosynthetic genes for use in streptomyces and other organisms
US5057425A (en) * 1988-07-29 1991-10-15 Eli Lilly And Company Picromycin resistance-conferring gene, designated pica, for use in streptomyces and other organisms
US5462862A (en) * 1988-08-11 1995-10-31 Gist-Brocades N.V. Method and compositions for enhancing production of secondary metabolites using clustered biosynthetic genes
US5108918A (en) * 1988-08-11 1992-04-28 Gist-Brocades Method for identifying and using biosynthetic genes for enhanced production of secondary metabolites
US5149638A (en) * 1988-09-29 1992-09-22 Eli Lilly And Company Tylosin biosynthetic genes tylA, tylB and tylI
US5141926A (en) * 1990-04-18 1992-08-25 Abbott Laboratories Erythromycin derivatives
US5589385A (en) * 1990-07-26 1996-12-31 American Cyanamid Company Cloning of the biosynthetic pathway for chlortetracycline and tetracycline formation and cosmids useful therein
US5866410A (en) * 1990-07-26 1999-02-02 American Cyanamid Company Cloning of the biosynthetic pathway for chlortetracycline and tetracycline formation and cosmids useful therein
US5824513A (en) * 1991-01-17 1998-10-20 Abbott Laboratories Recombinant DNA method for producing erythromycin analogs
US5610041A (en) * 1991-07-19 1997-03-11 Board Of Trustees Operating Michigan State University Processes for producing polyhydroxybutyrate and related polyhydroxyalkanoates in the plastids of higher plants
US5514544A (en) * 1991-07-26 1996-05-07 Eli Lilly And Company Activator gene for macrolide biosynthesis
US5830750A (en) * 1993-09-20 1998-11-03 The John Innes Institute Recombinant production of novel polyketides
US6077696A (en) * 1993-09-20 2000-06-20 The Johns Innes Institute Recombinant production of novel polyketides
US5712146A (en) * 1993-09-20 1998-01-27 The Leland Stanford Junior University Recombinant combinatorial genetic library for the production of novel polyketides
US5843718A (en) * 1993-09-20 1998-12-01 The Leland Stanford Junior University Recombinant production of novel polyketides
US5672491A (en) * 1993-09-20 1997-09-30 The Leland Stanford Junior University Recombinant production of novel polyketides
US5962290A (en) * 1993-09-20 1999-10-05 The Leland Stanford Junior University Recombinant production of novel polyketides
US6022731A (en) * 1993-09-20 2000-02-08 The Leland Stanford Junior University Recombinant production of novel polyketides
US5744350A (en) * 1993-11-02 1998-04-28 Merck & Co., Inc. DNA encoding triol polyketide synthase
US5716849A (en) * 1994-06-08 1998-02-10 Novartis Finance Corporation Genes for the biosynthesis of soraphen
US5545553A (en) * 1994-09-26 1996-08-13 The Rockefeller University Glycosyltransferases for biosynthesis of oligosaccharides, and genes encoding them
US5702717A (en) * 1995-10-25 1997-12-30 Macromed, Inc. Thermosensitive biodegradable polymers based on poly(ether-ester)block copolymers
US6033883A (en) * 1996-12-18 2000-03-07 Kosan Biosciences, Inc. Production of polyketides in bacteria and yeast
US6117659A (en) * 1997-04-30 2000-09-12 Kosan Biosciences, Inc. Recombinant narbonolide polyketide synthase
US6090601A (en) * 1998-01-23 2000-07-18 Kosan Bioscience Sorangium polyketide synthase
US6503741B1 (en) * 1998-05-28 2003-01-07 Kosan Biosciences, Inc. Polyketide synthase genes from Streptomyces venezuelae
US6303767B1 (en) * 1998-11-05 2001-10-16 Kosan Biosciences, Inc. Nucleic acids encoding narbonolide polyketide synthase enzymes from streptomyces narbonensis

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090112259A1 (en) * 2007-10-31 2009-04-30 Angiotech Pharmaceuticals, Inc. Recombinant expressed bioadsorbable polyhydroxyalkonate monofilament and multi-filaments self-retaining sutures
US20100057123A1 (en) * 2007-10-31 2010-03-04 Angiotech Pharmaceuticals, Inc. Recombinant expressed bioadsorbable polyhydroxyalkanoate monofilament and multi-filaments self-retaining sutures

Similar Documents

Publication Publication Date Title
US6265202B1 (en) DNA encoding methymycin and pikromycin
AU758421B2 (en) Recombinant oleandolide polyketide synthase
US5945320A (en) Platenolide synthase gene
DK2271666T3 (en) NRPS-PKS GROUP AND ITS MANIPULATION AND APPLICABILITY
JPH09224687A (en) Polyketide synthase gene
US20040023343A1 (en) Biosynthetic genes for spinosyn insecticide production
US6600029B1 (en) Metabolic engineering of polyhydroxyalkanoate monomer synthases
KR20180093083A (en) Kelimycin biosynthesis gene cluster
US6303767B1 (en) Nucleic acids encoding narbonolide polyketide synthase enzymes from streptomyces narbonensis
KR100882692B1 (en) Biosynthetic Genes for Butenyl-Spinosine Pesticide Production
KR20100034055A (en) Vectors and methods for cloning gene clusters or portions thereof
US20030073824A1 (en) DNA encoding methymycin and pikromycin
CN114517175B (en) Genetically engineered bacteria and their applications
CA2463167A1 (en) Production, detection and use of transformant cells
US20030113874A1 (en) Genes and proteins for the biosynthesis of rosaramicin
US20040091975A1 (en) Midecamycin biosynthetic genes
US7109019B2 (en) Gene cluster for production of the enediyne antitumor antibiotic C-1027
US20040219645A1 (en) Polyketides and their synthesis
US7105491B2 (en) Biosynthesis of enediyne compounds by manipulation of C-1027 gene pathway
US20030143666A1 (en) Genetic locus for everninomicin biosynthesis
US20040161839A1 (en) Method to alter sugar moieties
KR20190031865A (en) Recombinant Microorganisms Producing Milbemycin D and Method of Preparing Milbemycin D Using the Same
KR100549690B1 (en) Genes involved in F-008 polyketide synthesis
JPH1094395A (en) Frenolicin gene cluster
CN107164394A (en) The biological synthesis gene cluster of atypia square ring chlorins compound nenestatin A a kind of and its application

Legal Events

Date Code Title Description
AS Assignment

Owner name: REGENTS OF THE UNIVERSITY OF MINNESOTA, MINNESOTA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:SHERMAN, DAVID H.;LIU, HUNG-WEN;XUE, YONGQUAN;AND OTHERS;REEL/FRAME:013881/0288;SIGNING DATES FROM 20030103 TO 20030310

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION