US11760797B2 - Anti-interleukin-33 antibodies and uses thereof - Google Patents

Anti-interleukin-33 antibodies and uses thereof Download PDF

Info

Publication number
US11760797B2
US11760797B2 US17/199,810 US202117199810A US11760797B2 US 11760797 B2 US11760797 B2 US 11760797B2 US 202117199810 A US202117199810 A US 202117199810A US 11760797 B2 US11760797 B2 US 11760797B2
Authority
US
United States
Prior art keywords
amino acid
acid sequence
seq
antibody
domain
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active, expires
Application number
US17/199,810
Other versions
US20210284725A1 (en
Inventor
Gerald R. Nakamura
Dhaya Seshasayee
Menno Van Lookeren Campagne
Tiffany WONG
Jia Wu
Hongkang XI
Jack Bevers, III
Hiu Nam Chan
Laetitia COMPS-AGRAR
Racquel CORPUZ
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Genentech Inc
Original Assignee
Genentech Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Genentech Inc filed Critical Genentech Inc
Priority to US17/199,810 priority Critical patent/US11760797B2/en
Assigned to GENENTECH, INC. reassignment GENENTECH, INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: Bevers III, Jack, CAMPAGNE, MENNO VAN LOOKEREN, CHAN, JOYCE, COMPS-AGRAR, LAETITIA, CORPUZ, Racquel, NAKAMURA, GERALD R., SESHASAYEE, DHAYA, WONG, TIFFANY, WU, JIANSHENG, XI, Hongkang
Publication of US20210284725A1 publication Critical patent/US20210284725A1/en
Assigned to GENENTECH, INC. reassignment GENENTECH, INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: WU, Jia
Assigned to GENENTECH, INC. reassignment GENENTECH, INC. CORRECTIVE ASSIGNMENT TO CORRECT THE 8TH INVENTOR'S NAME PREVIOUSLY RECORDED AT REEL: 055728 FRAME: 0478. ASSIGNOR(S) HEREBY CONFIRMS THE ASSIGNMENT . Assignors: Bevers III, Jack, CHAN, Hiu Nam, COMPS-AGRAR, LAETITIA, CORPUZ, Racquel, NAKAMURA, GERALD R., SESHASAYEE, DHAYA, VAN LOOKEREN CAMPAGNE, MENNO, WONG, TIFFANY, WU, JIANSHENG, XI, Hongkang
Priority to US18/364,185 priority patent/US20240092887A1/en
Application granted granted Critical
Publication of US11760797B2 publication Critical patent/US11760797B2/en
Active legal-status Critical Current
Adjusted expiration legal-status Critical

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • C07K16/244Interleukins [IL]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/02Ophthalmic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • the invention relates to anti-interleukin-33 (IL-33) antibodies, and methods of making and using the same, including for treatment of IL-33-mediated disorders.
  • IL-33 anti-interleukin-33
  • Age-related macular degeneration is the leading cause of irreversible blindness in people aged 50 years or older in the developed world.
  • the majority of the visual loss occurs in the advanced stage of AMD, which has two clinical forms: a non-exudative form, geographic atrophy (GA), which is characterized by loss of photoreceptors, retinal pigment epithelium (RPE), and choriocapillaris, and an exudative or wet form, which is characterized by choroidal neovascularization (CNV).
  • GA geographic atrophy
  • RVPE retinal pigment epithelium
  • CNV choroidal neovascularization
  • VA central visual acuity
  • Interleukin-33 is a member of the interleukin-1 (IL-1) cytokine family that is encoded by the IL33 gene, and is expressed in structural cells, such as smooth muscle, epithelial (e.g., retinal pigment epithelium (RPE) cells), endothelial cells (e.g., choroidal endothelial cells), Muller cells, and astrocytes.
  • IL-33 can be induced by inflammatory factors in macrophages and dendritic cells. Cellular stress caused by environmental triggers, such as allergens, toxins, and pathogens, can lead to IL-33 release.
  • IL-33 is released from Muller cells upon phototoxic stress, and induces CCL 2 and monocyte-dependent retinal degeneration in preclinical models.
  • Bioavailable IL-33 associates with a heterodimeric IL-33 receptor complex composed of suppression of tumorigenicity 2 (ST2) protein and interleukin-1 receptor accessory protein (IL-1RAcP) to activate the AP-1 and NF- ⁇ B pathways through the adaptor protein myeloid differentiation primary response 88 (MyD88) and possibly MyD88-adapter-like (Mal) protein.
  • ST2 tumorigenicity 2
  • IL-1RAcP interleukin-1 receptor accessory protein
  • MyD88 myeloid differentiation primary response 88
  • Mal MyD88-adapter-like protein.
  • IL-33 stimulates a number of cell types, including innate type II (ILC2) cells, mast cells, basophils, eosinophils, and dendritic cells, to promote Type 2 immunity.
  • ILC2 innate type II
  • mast cells
  • the IL-33 pathway has been suggested to be involved in various diseases, including ocular diseases (e.g, GA) for which there remains a need to develop improved compositions, and methods for treatment.
  • ocular diseases e.g, GA
  • the present invention relates, inter alia, to anti-IL-33 antibodies and methods of making and using the same.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising a heavy chain variable (VH) domain and a light chain variable (VL) domain, the binding domain comprising the following six complementarity-determining regions (CDRs): (a) a CDR-H1 comprising the amino acid sequence of NYWMT (SEQ ID NO: 1); (b) a CDR-H2 comprising the amino acid sequence of SITYTGGGTYYPDSVKG (SEQ ID NO: 2); (c) a CDR-H3 comprising the amino acid sequence of ANYYYNTYGGFPY (SEQ ID NO: 3); (d) a CDR-L1 comprising the amino acid sequence of LASEGFSNDLA (SEQ ID NO: 4); (e) a CDR-L2 comprising the amino acid sequence of AASRLQD (SEQ ID NO: 5); and (f) a CDR-L3 comprising the amino CDR-H1 comprising
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 7; (b) a VL domain comprising an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 8; or (c) a VH domain as in (a) and a VL domain as in (b).
  • the VH domain comprises: (a) an FR-H1 comprising the amino acid sequence of EVQLVX 1 SGX 2 X 3 X 4 X 5 X 6 PGX 7 SX 8 X 9 X 10 SCX 11 ASGFTFN (SEQ ID NO: 9), wherein X 1 is E or Q; X 2 is G or A; X 3 is G or E; X 4 is L or V; X 5 is V or K; X 6 is Q or K; X 7 is G, A, or T; X 8 is L or V; X 9 is R or K; X 10 is L or V; and X 11 is A, K, or L; (b) an FR-H2 comprising the amino acid sequence of WX 1 RQAPGX 2 GLEWX 3 X 4 (SEQ ID NO: 10), wherein X 1 is I or V; X 2 is K or Q; X 3 is V, M, or I; and X 4 is A or G; (c) an FR-
  • the VH domain comprises: (a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); (b) an FR-H2 comprising the amino acid sequence of WIRQAPGKGLEWVA (SEQ ID NO: 18); (c) an FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
  • the VH domain comprises the amino acid sequence of SEQ ID NO: 7.
  • the VH domain comprises: (a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); (b) an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 39); (c) an FR-H3 comprising the amino acid sequence of RFTISRDNAKNSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 40); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
  • the VH domain comprises the amino acid sequence of SEQ ID NO: 41.
  • the VH domain comprises: (a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); (b) an FR-H2 comprising the amino acid sequence of WIRQAPGKGLEWIA (SEQ ID NO: 42); (c) an FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
  • the VH domain comprises the amino acid sequence of SEQ ID NO: 43.
  • the VH domain comprises: (a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); (b) an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 39); (c) an FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
  • the VH domain comprises the amino acid sequence of SEQ ID NO: 44.
  • the VH domain comprises: (a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); (b) an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 39); (c) an FR-H3 comprising the amino acid sequence of RFTISRDDAKNSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 45); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
  • the VH domain comprises the amino acid sequence of SEQ ID NO: 46.
  • the VH domain comprises: (a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); (b) an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 39); (c) an FR-H3 comprising the amino acid sequence of RFTISRDNAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 47); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
  • the VH domain comprises the amino acid sequence of SEQ ID NO: 48.
  • the VH domain comprises: (a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); (b) an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWIA (SEQ ID NO: 49); (c) an FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
  • the VH domain comprises the amino acid sequence of SEQ ID NO: 50.
  • the VH domain comprises: (a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); (b) an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWIA (SEQ ID NO: 49); (c) an FR-H3 comprising the amino acid sequence of RFTISRDDSKSTLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 51); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
  • the VH domain comprises the amino acid sequence of SEQ ID NO: 52.
  • the VL domain comprises: (a) an FR-L1 comprising the amino acid sequence of X 1 IX 2 X 3 TQSPX 4 X 5 LSX 6 SX 7 GX 8 X 9 X 10 X 11 X 12 X 13 C (SEQ ID NO: 13), wherein X 1 is D or E; X 2 is Q or V; X 3 is M or L; X 4 is S or A; X 5 is S or T; X 6 is A or L; X 7 is V, P, or L; X 8 is D or E; X 9 is R or T; X 10 is V or A; X 11 is T or S; X 12 is I or L; and X 13 is T, S, or E; (b) an FR-L2 comprising the amino acid sequence of WX 1 QQKX 2 GX 3 X 4 PX 5 X 6 LIY (SEQ ID NO: 14), wherein X 1 is Y or F; X 2 is P or S;
  • the VL domain comprises: (a) an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); (b) an FR-L2 comprising the amino acid sequence of WYQQKPGKSPKLLIY (SEQ ID NO: 22); (c) an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYFC (SEQ ID NO: 23); and (d) an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24).
  • the VL domain comprises the amino acid sequence of SEQ ID NO: 8.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 7 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 8.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a heavy chain (HC) comprising an amino acid sequence of SEQ ID NO: 25 and (b) a light chain (LC) comprising an amino acid sequence of SEQ ID NO: 26.
  • HC heavy chain
  • LC light chain
  • the VL domain comprises: (a) an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); (b) an FR-L2 comprising the amino acid sequence of WFQQKPGKAPKSLIY (SEQ ID NO: 53); (c) an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 54); and (d) an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24).
  • the VL domain comprises the amino acid sequence of SEQ ID NO: 55.
  • the VL domain comprises: (a) an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); (b) an FR-L2 comprising the amino acid sequence of WYQQKPGKAPKSLIY (SEQ ID NO: 56); (c) an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYFC (SEQ ID NO: 23); and (d) an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24).
  • the VL domain comprises the amino acid sequence of SEQ ID NO: 57.
  • the VL domain comprises: (a) an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); (b) an FR-L2 comprising the amino acid sequence of WFQQKPGKAPKSLIY (SEQ ID NO: 53); (c) an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYFC (SEQ ID NO: 23); and (d) an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24).
  • the VL domain comprises the amino acid sequence of SEQ ID NO: 58.
  • the VL domain comprises: (a) an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); (b) an FR-L2 comprising the amino acid sequence of WYQQKPGKAPKSLIY (SEQ ID NO: 56); (c) an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 54); and (d) an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24).
  • the VL domain comprises the amino acid sequence of SEQ ID NO: 59.
  • the VL domain comprises: (a) an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); (b) an FR-L2 comprising the amino acid sequence of WYQQKPGKSPKLLIY (SEQ ID NO: 22); (c) an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDVATYYC (SEQ ID NO: 60); and (d) an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24).
  • the VL domain comprises the amino acid sequence of SEQ ID NO: 61.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 41 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 55.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 43 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 55.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 41 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 8.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 43 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 8.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 44 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 8.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 46 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 8.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 48 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 8.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 43 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 57.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 44 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 57.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 46 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 57.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 48 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 57.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 50 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 57.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 43 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 58.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 44 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 58.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 46 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 58.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 48 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 58.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 50 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 58.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 43 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 59.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 44 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 59.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 46 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 59.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 48 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 59.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 50 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 59.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 52 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 61.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 35; (b) a VL domain comprising an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 36; or (c) a VH domain as in (a) and a VL domain as in (b).
  • the VH domain comprises: (a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGTSLKLSCLASGFTFN (SEQ ID NO: 27); (b) an FR-H2 comprising the amino acid sequence of WIRQAPGKGLEWIA (SEQ ID NO: 28); (c) an FR-H3 comprising the amino acid sequence of RFTISRDDAKSTLYLQMNSLRSEDTATYYCTR (SEQ ID NO: 29); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
  • the VH domain comprises the amino acid sequence of SEQ ID NO: 35.
  • the VL domain comprises: (a) an FR-L1 comprising the amino acid sequence of DIQMTQSPASLSASLGETVSIEC (SEQ ID NO: 31); (b) an FR-L2 comprising the amino acid sequence of WYQQKSGKSPQLLIY (SEQ ID NO: 32); (a) an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTRFSLKISGMQPEDEADYFC (SEQ ID NO: 33); and (d) an FR-L4 comprising the amino acid sequence of FGSGTKLEIK (SEQ ID NO: 34).
  • the VL domain comprises the amino acid sequence of SEQ ID NO: 36.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 35 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 36.
  • an isolated antibody that specifically binds IL-33, wherein the antibody comprises a binding domain comprising (a) a heavy chain (HC) comprising an amino acid sequence of SEQ ID NO: 37 and (b) a light chain (LC) comprising an amino acid sequence of SEQ ID NO: 38.
  • HC heavy chain
  • LC light chain
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 65; (b) a VL domain comprising an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 69; or (c) a VH domain as in (a) and a VL domain as in (b).
  • the VH domain comprises: (a) an FR-H1 comprising the amino acid sequence of EVQLVQSGAEVKKPGASVKVSCKASGFTFN (SEQ ID NO: 62); (b) an FR-H2 comprising the amino acid sequence of WVRQAPGQGLEWMG (SEQ ID NO: 63); (c) an FR-H3 comprising the amino acid sequence of RVTMTRDTSTSTVYMELSSLRSEDTAVYYCTR (SEQ ID NO: 64); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
  • the VH domain comprises the amino acid sequence of SEQ ID NO: 65.
  • the VL domain comprises: (a) an FR-L1 comprising the amino acid sequence of EIVLTQSPATLSLSPGERATLSC (SEQ ID NO: 66); (b) an FR-L2 comprising the amino acid sequence of WYQQKPGQAPRLLIY (SEQ ID NO: 67); (c) an FR-L3 comprising the amino acid sequence of GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC (SEQ ID NO: 68); and (d) an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24).
  • the VL domain comprises the amino acid sequence of SEQ ID NO: 69.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 65 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 69.
  • the antibody specifically binds human or cyno IL-33.
  • the antibody specifically binds both human and cyno IL-33.
  • the antibody specifically binds both human and cyno IL-33 with a K D of about 1 nM or lower.
  • the antibody specifically binds human IL-33 with a K D between about 100 fM and about 1 nM.
  • the antibody specifically binds human IL-33 with a K D between about 750 fM and about 300 pM.
  • the antibody specifically binds human IL-33 with a K D between about 1 pM and about 200 pM.
  • the antibody specifically binds human IL-33 with a K D of about 118 pM.
  • the antibody specifically binds human IL-33 with a K D of about 15 pM.
  • the antibody specifically binds cyno IL-33 with a K D between about 100 fM and about 1 nM.
  • the antibody specifically binds cyno IL-33 with a K D between about 1 pM and about 500 pM.
  • the antibody specifically binds cyno IL-33 with a K D between about 20 pM and about 50 pM.
  • the antibody specifically binds cyno IL-33 with a K D of about 35 pM.
  • the antibody specifically binds both human and cyno IL-33 with a K D of between about 1 pM and about 500 pM.
  • the antibody specifically binds both human and cyno IL-33 with a K D of between about 10 pM and about 40 pM.
  • the antibody is capable of inhibiting the binding of IL-33 to an IL-33 receptor.
  • the inhibiting is measured using a cell-based blocking assay.
  • the antibody inhibits binding of human IL-33 to an IL-33 receptor with an IC50 of between about 800 fM and about 100 pM.
  • the IC50 is between about 1 pM and about 50 pM.
  • the IC50 is about 31 pM.
  • the antibody has a viscosity of less than about 5 centipoise (cP) at a concentration of about 180 mg/mL.
  • the antibody has a viscosity of between about 3 cP and about 5 cP at a concentration of about 180 mg/mL.
  • the antibody has a viscosity of about 4.6 cP at a concentration of about 180 mg/mL.
  • the antibody has a turbidity (optical density (OD)) of about 0.5 or lower at a concentration of about 150 mg/ml or higher in phosphate-buffered saline (PBS) pH 7.4.
  • OD optical density
  • the antibody has a turbidity (OD) of between about 0.25 and about 0.5 at a concentration of about 150 mg/ml to about 250 mg/ml.
  • the antibody has a turbidity (OD) of about 0.38 at a concentration of about 200 mg/ml.
  • the antibody is monoclonal, human, humanized, or chimeric.
  • the antibody is an antibody fragment that binds IL-33.
  • the antibody fragment is an Fab, Fab′-SH, Fv, scFv, or (Fab′) 2 fragment.
  • the antibody fragment is an Fab.
  • the antibody is a full-length antibody.
  • the antibody is an IgG antibody.
  • the IgG antibody is an IgG1 antibody.
  • the IgG antibody is an IgG4 antibody.
  • the antibody is a monospecific antibody.
  • the antibody is a multispecific antibody.
  • the antibody is a bispecific antibody.
  • the bispecific antibody comprises a second binding domain that binds to a second biological molecule, wherein the second biological molecule is interleukin-13 (IL-13), interleukin-4 (IL-4), interleukin-5 (IL-5), interleukin-17 (IL-17), Factor D, HtrA1, VEGF, or a VEGF receptor.
  • the second biological molecule is interleukin-13 (IL-13), interleukin-4 (IL-4), interleukin-5 (IL-5), interleukin-17 (IL-17), Factor D, HtrA1, VEGF, or a VEGF receptor.
  • an isolated nucleic acid encoding any one of the antibodies disclosed herein or a set of isolated nucleic acids together encoding the antibody.
  • a vector or a set of vectors comprising any of the isolated nucleic acids or set of isolated nucleic acids disclosed herein.
  • a host cell comprising any one of the vectors or the set of vectors disclosed herein.
  • the host cell is a mammalian cell.
  • the mammalian cell is a Chinese hamster ovary (CHO) cell.
  • the host cell is a prokaryotic cell.
  • the prokaryotic cell is E. coli.
  • provided herein is a method of producing an antibody that specifically binds to IL-33, the method comprising culturing any one of the host cells disclosed herein in a culture medium.
  • the method further comprises recovering the antibody from the host cell or the culture medium.
  • composition comprising any one of the antibodies disclosed herein.
  • composition further comprises a pharmaceutically acceptable carrier, excipient, or diluent.
  • the composition is a pharmaceutical composition.
  • the pharmaceutical composition further comprises an ST2 binding antagonist, a Factor D binding antagonist, an HtrA1 binding antagonist, a VEGF antagonist, a tryptase-beta binding antagonist, a chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) binding antagonist, an interleukin-13 (IL-13) binding antagonist, an interleukin-17 (IL-17) binding antagonist, a JAK1 antagonist, and/or an interleukin-5 (IL-5) binding antagonist.
  • an ST2 binding antagonist a Factor D binding antagonist
  • an HtrA1 binding antagonist an HtrA1 binding antagonist
  • a VEGF antagonist a tryptase-beta binding antagonist
  • a chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) binding antagonist chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) binding antagonist
  • an interleukin-13 (IL-13) binding antagonist an interleukin
  • the pharmaceutical composition comprises a Factor D binding antagonist.
  • the Factor D binding antagonist is an anti-Factor D antibody or an antigen-binding fragment thereof.
  • the pharmaceutical composition comprises an HtrA1 binding antagonist.
  • the HtrA1 binding antagonist is an anti-HtrA1 antibody or an antigen-binding fragment thereof.
  • the pharmaceutical composition comprises a VEGF antagonist.
  • the VEGF antagonist is an anti-VEGF antibody or an antigen-binding fragment thereof.
  • the antibody concentration is about 1 mg/mL to about 400 mg/mL.
  • the antibody concentration is about 150 mg/mL to about 250 mg/mL.
  • the antibody concentration is about 175 mg/mL to about 225 mg/mL.
  • the antibody concentration is about 200 mg/mL.
  • provided herein is any one of the antibodies disclosed herein or any one of the compositions disclosed herein for use as a medicament.
  • provided herein is any one of the antibodies disclosed herein or any one of the compositions disclosed herein for use in treating an IL-33-mediated disorder.
  • the IL-33-mediated disorder is an ocular disorder, an inflammatory condition, an immune disorder, a fibrotic disorder, an eosinophilic disorder, an infection, pain, a central nervous system disorder, or a solid tumor.
  • the ocular disorder is age-related macular degeneration (AMD), retinopathy of the eye, polypoidal choroidal vasculopathy (PCV), diabetic macular edema, dry eye disease, Behcet's disease, retina detachment, glaucoma, uveitis, retinitis pigmentosa, Leber Congenital Amaurosis, Stargardt's disease, traumatic eye injury, or conjunctivitis.
  • AMD age-related macular degeneration
  • PCV polypoidal choroidal vasculopathy
  • diabetic macular edema dry eye disease
  • Behcet's disease retina detachment
  • glaucoma glaucoma
  • uveitis uveitis
  • retinitis pigmentosa Leber Congenital Amaurosis
  • Stargardt's disease Stargardt's disease
  • traumatic eye injury or conjunctivitis.
  • the AMD is geographic atrophy (GA), wet AMD, or dry AMD.
  • the AMD is GA.
  • the AMD is intermediate AMD or advanced AMD.
  • the retinopathy of the eye is diabetic retinopathy (DR) or retinopathy of prematurity (ROP).
  • DR diabetic retinopathy
  • ROI retinopathy of prematurity
  • the retinopathy of the eye is high-altitude DR.
  • the conjunctivitis is infectious conjunctivitis or non-infectious conjunctivitis.
  • the conjunctivitis is allergic conjunctivitis.
  • the inflammatory condition is asthma, sepsis, septic shock, atopic dermatitis, allergic rhinitis, rheumatoid arthritis, or chronic obstructive pulmonary disease (COPD).
  • COPD chronic obstructive pulmonary disease
  • the immune disorder is asthma, rheumatoid arthritis, allergy, anaphylaxis, anaphylactic shock, allergic rhinitis, psoriasis, inflammatory bowel disease (IBD), Crohn's disease, diabetes, or liver disease.
  • the fibrotic disease is idiopathic pulmonary fibrosis (IPF).
  • IPF idiopathic pulmonary fibrosis
  • the eosinophilic disorder is an eosinophil-associated gastrointestinal disorder (EGID).
  • EGID eosinophil-associated gastrointestinal disorder
  • the EGID is eosinophilic esophagitis.
  • the infection is a helminth infection, a protozoan infection, or a viral infection.
  • the protozoan infection is a Leishmania major infection.
  • the viral infection is a respiratory syncytial virus (RSV) infection or an influenza infection.
  • RSV respiratory syncytial virus
  • the pain is inflammatory pain.
  • the central nervous system disorder is Alzheimer's disease.
  • the solid tumor is a breast tumor, a colon tumor, a prostate tumor, a lung tumor, a kidney tumor, a liver tumor, a pancreas tumor, a stomach tumor, an intestinal tumor, a brain tumor, a bone tumor, and a skin tumor.
  • the antibody or composition is used in combination with an ST2 binding antagonist, a Factor D binding antagonist, an HtrA1 binding antagonist, a VEGF antagonist, a tryptase-beta binding antagonist, a CRTH2 binding antagonist, an IL-13 binding antagonist, an IL-17 binding antagonist, a JAK1 antagonist, and/or an IL-5 binding antagonist.
  • the antibody or composition is used in in combination with a Factor D binding antagonist.
  • the Factor D binding antagonist is an anti-Factor D antibody or an antigen-binding fragment thereof.
  • the antibody or composition is used in in combination with an HtrA1 binding antagonist.
  • the HtrA1 binding antagonist is an anti-HtrA1 antibody or an antigen-binding fragment thereof.
  • the antibody or composition is used in in combination with a VEGF antagonist.
  • the VEGF antagonist is an anti-VEGF antibody or an antigen-binding fragment thereof.
  • provided herein is the use of any one of the antibodies disclosed herein or any one of the compositions disclosed herein in the manufacture of a medicament for treating an IL-33-mediated disorder.
  • the IL-33-mediated disorder is an ocular disorder, an inflammatory condition, an immune disorder, a fibrotic disorder, an eosinophilic disorder, an infection, pain, a central nervous system disorder, or a solid tumor.
  • the ocular disorder is AMD, retinopathy of the eye, PCV, diabetic macular edema, dry eye disease, Behcet's disease, retina detachment, glaucoma, uveitis, retinitis pigmentosa, Leber Congenital Amaurosis, Stargardt's disease, traumatic eye injury, or conjunctivitis.
  • the AMD is GA, wet AMD, or dry AMD.
  • the AMD is GA.
  • the AMD is intermediate AMD or advanced AMD.
  • the retinopathy of the eye is DR or ROP.
  • the retinopathy of the eye is high-altitude DR.
  • the conjunctivitis is infectious conjunctivitis or non-infectious conjunctivitis.
  • the conjunctivitis is allergic conjunctivitis.
  • the inflammatory condition is asthma, sepsis, septic shock, atopic dermatitis, allergic rhinitis, rheumatoid arthritis, or COPD.
  • the immune disorder is asthma, rheumatoid arthritis, allergy, anaphylaxis, anaphylactic shock, allergic rhinitis, psoriasis, IBD, Crohn's disease, diabetes, or liver disease.
  • the fibrotic disease is IPF.
  • the eosinophilic disorder is an EGID.
  • the EGID is eosinophilic esophagitis.
  • the infection is a helminth infection, a protozoan infection, or a viral infection.
  • the protozoan infection is a Leishmania major infection.
  • the viral infection is an RSV infection or an influenza infection.
  • the pain is inflammatory pain.
  • the central nervous system disorder is Alzheimer's disease.
  • the solid tumor is a breast tumor, a colon tumor, a prostate tumor, a lung tumor, a kidney tumor, a liver tumor, a pancreas tumor, a stomach tumor, an intestinal tumor, a brain tumor, a bone tumor, and a skin tumor.
  • the medicament is formulated for use in combination with an ST2 binding antagonist, a Factor D binding antagonist, an HtrA1 binding antagonist, a VEGF antagonist, a tryptase-beta binding antagonist, a CRTH2 binding antagonist, an IL-13 binding antagonist, an IL-17 binding antagonist, a JAK1 antagonist, and/or an IL-5 binding antagonist.
  • the medicament is formulated for use in combination with a Factor D binding antagonist.
  • the Factor D binding antagonist is an anti-Factor D antibody or an antigen-binding fragment thereof.
  • the medicament is formulated for use in combination with an HtrA1 binding antagonist.
  • the HtrA1 binding antagonist is an anti-HtrA1 antibody or an antigen-binding fragment thereof.
  • the medicament is formulated for use in combination with a VEGF antagonist.
  • the VEGF antagonist is an anti-VEGF antibody or an antigen-binding fragment thereof.
  • provided herein is a method of treating an IL-33-mediated disorder in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of any one of the antibodies disclosed herein or any one of the compositions disclosed herein.
  • the IL-33-mediated disorder is an ocular disorder, an inflammatory condition, an immune disorder, a fibrotic disorder, an eosinophilic disorder, an infection, pain, a central nervous system disorder, or a solid tumor.
  • the ocular disorder is AMD, retinopathy of the eye, PCV, diabetic macular edema, dry eye disease, Behcet's disease, retina detachment, glaucoma, uveitis, retinitis pigmentosa, Leber Congenital Amaurosis, Stargardt's disease, traumatic eye injury, or conjunctivitis.
  • the AMD is GA, wet AMD, or dry AMD.
  • the AMD is GA.
  • the AMD is intermediate AMD or advanced AMD.
  • the retinopathy of the eye is DR or ROP.
  • the retinopathy of the eye is high-altitude DR.
  • the conjunctivitis is infectious conjunctivitis or non-infectious conjunctivitis.
  • the conjunctivitis is allergic conjunctivitis.
  • the inflammatory condition is asthma, sepsis, septic shock, atopic dermatitis, allergic rhinitis, rheumatoid arthritis, or COPD.
  • the immune disorder is asthma, rheumatoid arthritis, allergy, anaphylaxis, anaphylactic shock, allergic rhinitis, psoriasis, IBD, Crohn's disease, diabetes, and liver disease.
  • the fibrotic disease is IPF.
  • the eosinophilic disorder is an EGID.
  • the EGID is eosinophilic esophagitis.
  • the infection is a helminth infection, a protozoan infection, or a viral infection.
  • the protozoan infection is a Leishmania major infection.
  • the viral infection is an RSV infection or an influenza infection.
  • the pain is inflammatory pain.
  • the solid tumor is a breast tumor, a colon tumor, a prostate tumor, a lung tumor, a kidney tumor, a liver tumor, a pancreas tumor, a stomach tumor, an intestinal tumor, a brain tumor, a bone tumor, and a skin tumor.
  • the method further comprises administering to the subject an ST2 binding antagonist, a Factor D binding antagonist, an HtrA1 binding antagonist, a VEGF antagonist, a tryptase-beta binding antagonist, a CRTH2 binding antagonist, an IL-13 binding antagonist, an IL-17 binding antagonist, a JAK1 antagonist, and/or an IL-5 binding antagonist.
  • the method further comprises administering to the subject a Factor D binding antagonist.
  • the Factor D binding antagonist is anti-Factor D antibody or an antigen-binding fragment thereof.
  • the method further comprises administering to the subject an HtrA1 binding antagonist.
  • the HtrA1 binding antagonist is an anti-HtrA1 antibody or an antigen-binding fragment thereof.
  • the method further comprises administering to the subject a VEGF antagonist.
  • the VEGF antagonist is an anti-VEGF antibody or an antigen-binding fragment thereof.
  • provided herein is a method of treating GA in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of any one of the antibodies disclosed herein or any one of the compositions disclosed herein.
  • the antibody is an Fab fragment.
  • the antibody or the composition is administered intravitreally, ocularly, intraocularly, juxtasclerally, subtenonly, superchoroidally, topically, intravenously, intramuscularly, intradermally, percutaneously, intraarterially, intraperitoneally, intralesionally, intracranially, intraarticularly, intraprostatically, intrapleurally, intratracheally, intrathecally, intranasally, intravaginally, intrarectally, topically, intratumorally, intraperitoneally, peritoneally, intraventricularly, subcutaneously, subconjunctivally, intravesicularly, mucosally, intrapericardially, intraumbilically, intraorbitally, orally, transdermally, by inhalation, by injection, by eye drop, by implantation, by infusion, by continuous infusion, by localized perfusion bathing target cells directly, by catheter, by lavage, in cremes, or in lipid compositions.
  • the antibody or the composition is administered intravitreally, ocularly, intraocularly, juxtasclerally, subtenonly, superchoroidally, or topically.
  • the antibody or the composition is administered intravitreally by injection.
  • the antibody or the composition is administered topically by eye drop or ointment.
  • the antibody or the composition is administered by a port delivery device.
  • the subject is a human.
  • FIGS. 1 A and 1 B are sequence alignments of the heavy chain variable region (VH) and light chain variable region (VL) sequences of the 1E1 hybridoma and 1E1v8 anti-IL-33 antibody clones.
  • VH heavy chain variable region
  • VL light chain variable region
  • CDR complementarity-determining region
  • FIGS. 2 A and 2 B are sequence alignments of the VH and VL sequences of the indicated anti-IL-33 antibody clones. CDR sequences according to Kabat definition are underlined.
  • FIG. 3 A is a network plot showing relationships between clones or bins of anti-IL-33 antibody clones based on blocking activity.
  • FIG. 3 B is a heatmap showing relationships between clones or bins of anti-IL-33 antibody clones based on blocking activity.
  • FIGS. 3 C- 3 E are a series of graphs showing results of epitope binning using surface plasmon resonance (SPR). The graphs show normalized response as a function of time.
  • acceptor human framework for the purposes herein is a framework comprising the amino acid sequence of a light chain variable domain (VL) framework or a heavy chain variable domain (VH) framework derived from a human immunoglobulin framework or a human consensus framework, as defined below.
  • An acceptor human framework “derived from” a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may contain amino acid sequence changes. In some embodiments, the number of amino acid changes are 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less.
  • the VL acceptor human framework is identical in sequence to the VL human immunoglobulin framework sequence or human consensus framework sequence.
  • Binding affinity refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, “binding affinity” refers to intrinsic binding affinity which reflects a 1:1 interaction between members of a binding pair (e.g., antibody and antigen). The affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (K D ). Affinity can be measured by common methods known in the art, including those described herein. Specific illustrative and exemplary embodiments for measuring binding affinity are described in the following.
  • affinity-matured antibody is one with one or more alterations in one or more HVRs and/or framework regions which result in an improvement in the affinity of the antibody for antigen, compared to a parent antibody which does not possess those alteration(s).
  • Preferred affinity-matured antibodies will have nanomolar or even picomolar affinities for the target antigen.
  • Affinity-matured antibodies are produced by procedures known in the art. For example, Marks et al. Bio/Technology 10:779-783, 1992 describes affinity maturation by VH and VL domain shuffling. Random mutagenesis of HVR and/or framework residues is described by: Barbas et al. Proc. Nat. Acad. Sci.
  • antibody herein is used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies, including anti-IL-33/anti-IL-13 bispecific antibodies), and antibody fragments so long as they exhibit the desired antigen-binding activity.
  • IL-33 refers to any native IL-33 from any vertebrate source, including mammals such as primates (e.g., humans and cynomolgus monkeys) and rodents (e.g., mice and rats), unless otherwise indicated.
  • IL-33 is also referred to in the art as nuclear factor of high endothelial venules (NF-HEV; see, e.g., Baekkevold et al. Am. J. Pathol. 163(1): 69-79, 2003), DVS27, C9orf26, and interleukin-1 family member 11 (IL-1F11).
  • NF-HEV nuclear factor of high endothelial venules
  • Human full-length, unprocessed IL-33 contains 270 amino acids (a.a.) and may also be referred to as IL-33 1-270 .
  • Processed forms of human IL-33 include, for example, IL-33 95-270 , IL-33 99-270 , IL-33 109-270 , IL-33 112-270 , IL-33 1-178 , and IL-33 179-270 (Lefrangais et al. Proc. Natl. Acad. Sci. 109(5):1673-1678, 2012 and Martin, Semin. Immunol.
  • processed forms of human IL-33 e.g., IL-3395-270, IL-33 99-270 , IL-33 109-270 , or other forms processed by proteases such as calpain, proteinase 3, neutrophil elastase, and cathepsin G may have increased biological activity compared to full-length IL-33.
  • proteases such as calpain, proteinase 3, neutrophil elastase, and cathepsin G
  • the term also encompasses naturally occurring variants of IL-33, for example, splice variants (e.g., the constitutively active splice variant spIL-33 which lacks exon 3, Hong et al. J. Biol. Chem.
  • IL-33 may be present within a cell (e.g., within the nucleus) or as a secreted cytokine form.
  • Full-length IL-33 protein contains a helix-turn-helix DNA-binding motif including nuclear localization sequence (a.a.1-75 of human IL-33), which includes a chromatin binding motif (a.a. 40-58 of human IL-33).
  • a.a. 40-58 of human IL-33 Forms of IL-33 that are processed and secreted lack these N-terminal motifs.
  • the amino acid sequence of an exemplary human IL-33 can be found, for example, under UniProtKB accession number 095760.
  • IL-33 axis is meant a nucleic acid (e.g., a gene or mRNA transcribed from the gene) or polypeptide that is involved in IL-33 signal transduction.
  • the IL-33 axis may include the ligand IL-33, a receptor (e.g., ST2 and/or IL-1RAcP), adaptor molecules (e.g., MyD88), or proteins that associate with receptor molecules and/or adaptor molecules (e.g., kinases, such as interleukin-1 receptor-associated kinase 1 (IRAK1) and interleukin-1 receptor-associated kinase 4 (IRAK4), or E3 ubiquitin ligases, such as TNF receptor associated factor 6 (TRAF6)).
  • a receptor e.g., ST2 and/or IL-1RAcP
  • adaptor molecules e.g., MyD88
  • proteins that associate with receptor molecules and/or adaptor molecules e.g., kinases
  • interleukin 1 receptor-like 1 and “ST2,” used interchangeably herein, refer to any native ST2 from any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated. ST2 is also referred to in the art as DER4, T1, and FIT-1. The term encompasses “full-length,” unprocessed ST2, as well as any form of ST2 that results from processing in the cell.
  • ST2 At least four isoforms of ST2 are known in the art, including soluble (sST2, also known as IL1RL1-a) and transmembrane (ST2L, also known as IL1RL1-b), which arise from differential mRNA expression from a dual promoter system, and ST2V and ST2LV, which arise from alternative splicing, as described below.
  • the domain structure of ST2L includes three extracellular immunoglobulin-like C2 domains, a transmembrane domain, and a cytoplasmic Toll/Interleukin-1 receptor (TIR) domain.
  • TIR Toll/Interleukin-1 receptor
  • sST2 lacks the transmembrane and cytoplasmic domains contained within ST2L and includes a unique 9 amino acid (a.a.) C-terminal sequence (see, e.g., Kakkar et al. Nat. Rev. Drug Disc. 7: 827-840, 2008). sST2 can function as a decoy receptor to inhibit soluble IL-33.
  • the term also encompasses naturally occurring variants of ST2, e.g., splice variants (e.g., ST2V, which lacks the third immunoglobulin motif and has a unique hydrophobic tail, and ST2LV, which lacks the transmembrane domain of ST2L) or allelic variants (e.g., variants that are protective against asthma risk or that confer asthma risk as described herein).
  • splice variants e.g., ST2V, which lacks the third immunoglobulin motif and has a unique hydrophobic tail
  • ST2LV which lacks the transmembrane domain of ST2L
  • allelic variants e.g., variants that are protective against asthma risk or that confer asthma risk as described herein.
  • the amino acid sequence of an exemplary human ST2 can be found, for example, under UniProtKB accession number Q01638. ST2 is a part of the IL-33 receptor along with the co-receptor protein IL-1RAcP.
  • IL-1RAcP co-receptor interleukin-1 receptor accessory protein
  • anti-IL-33 antibody an “antibody that binds to IL-33,” and “antibody that specifically binds IL-33” refer to an antibody that is capable of binding IL-33 with sufficient affinity such that the antibody is useful as a therapeutic and/or diagnostic agent in targeting IL-33.
  • the extent of binding of an anti-IL-33 antibody to an unrelated, non-IL-33 protein is less than about 10% of the binding of the antibody to IL-33 as measured, e.g., by a radioimmunoassay (RIA).
  • RIA radioimmunoassay
  • an antibody that binds to IL-33 has a dissociation constant (K D ) of ⁇ 1 ⁇ M, ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g., 10 ⁇ 8 M or less, e.g. from 10 ⁇ 8 M to 10 ⁇ 13 M, e.g., from 10 ⁇ 9 M to 10 ⁇ 13 M).
  • an anti-IL-33 antibody binds to an epitope of IL-33 that is conserved among IL-33 from different species.
  • an “antibody that binds to the same epitope” as a reference antibody refers to an antibody that blocks binding of the reference antibody to its antigen in a competition assay by 50% or more, and conversely, the reference antibody blocks binding of the antibody to its antigen in a competition assay by 50% or more.
  • An exemplary competition assay is provided herein.
  • Antibody fragments comprise a portion of an intact antibody, preferably the antigen binding or variable region of the intact antibody.
  • antibody fragments include Fab, Fab′, F(ab′) 2 , and Fv fragments; diabodies; linear antibodies (see U.S. Pat. No. 5,641,870, Example 2; Zapata et al. Protein Eng. 8(10):1057-1062, 1995); single-chain antibody molecules; and multispecific antibodies formed from antibody fragments.
  • Papain digestion of antibodies produces two identical antigen-binding fragments, called “Fab” fragments, and a residual “Fc” fragment, a designation reflecting the ability to crystallize readily.
  • the Fab fragment consists of an entire L chain along with the variable region domain of the H chain (VH), and the first constant domain of one heavy chain (C H 1).
  • Pepsin treatment of an antibody yields a single large F(ab′) 2 fragment which roughly corresponds to two disulfide linked Fab fragments having divalent antigen-binding activity and is still capable of cross-linking antigen.
  • Fab′ fragments differ from Fab fragments by having an additional few residues at the carboxy terminus of the C H 1 domain including one or more cysteines from the antibody hinge region.
  • Fab′-SH is the designation herein for Fab′ in which the cysteine residue(s) of the constant domains bear a free thiol group.
  • F(ab′) 2 antibody fragments originally were produced as pairs of Fab′ fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
  • Fc region herein is used to define a C-terminal region of an immunoglobulin heavy chain that contains at least a portion of the constant region.
  • the term includes native sequence Fc regions and variant Fc regions.
  • a human IgG heavy chain Fc region extends from Cys226, or from Pro230, to the carboxyl-terminus of the heavy chain.
  • the C-terminal lysine (Lys447) of the Fc region may or may not be present.
  • numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat et al. Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md., 1991.
  • “Fv” consists of a dimer of one heavy- and one light-chain variable region domain in tight, noncovalent association. From the folding of these two domains emanate six hypervariable loops (3 loops each from the H and L chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three Hs specific for an antigen) has the ability to recognize and bind antigen, although often at a lower affinity than the entire binding site.
  • Single-chain Fv also abbreviated as “sFv” or “scFv” are antibody fragments that comprise the VH and VL antibody domains connected into a single polypeptide chain.
  • the sFv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the sFv to form the desired structure for antigen binding.
  • diabodies refers to small antibody fragments prepared by constructing sFv fragments (see preceding paragraph) with short linkers (about 5-10 residues) between the VH and VL domains such that inter-chain but not intra-chain pairing of the V domains is achieved, resulting in a bivalent fragment, i.e., fragment having two antigen-binding sites.
  • Bispecific diabodies are heterodimers of two “crossover” sFv fragments in which the VH and VL domains of the two antibodies are present on different polypeptide chains.
  • Diabodies are described more fully in, for example, EP 404,097; WO 93/11161; and Hollinger et al. Proc. Natl. Acad. Sci. USA 90:6444-6448, 1993.
  • binding domain is meant a part of a compound or a molecule that specifically binds to a target epitope, antigen, ligand, or receptor. Binding domains include but are not limited to antibodies (e.g., monoclonal, polyclonal, recombinant, humanized, and chimeric antibodies), antibody fragments or portions thereof (e.g., Fab fragments, Fab′2, scFv antibodies, SMIP, domain antibodies, diabodies, minibodies, scFv-Fc, affibodies, nanobodies, and VH and/or VL domains of antibodies), receptors, ligands, aptamers, and other molecules having an identified binding partner.
  • antibodies e.g., monoclonal, polyclonal, recombinant, humanized, and chimeric antibodies
  • antibody fragments or portions thereof e.g., Fab fragments, Fab′2, scFv antibodies, SMIP, domain antibodies, diabodies, mini
  • blocking antibody or an “antagonist” antibody is one which inhibits or reduces biological activity of the antigen it binds. Certain blocking antibodies or antagonist antibodies substantially or completely inhibit the biological activity of the antigen.
  • a “cell-based blocking assay” refers to an assay in which the ability of an antibody to inhibit or reduce the biological activity of the antigen it binds can be measured.
  • a cell-based assay can be used to measure the concentration of antibody required to inhibit a specific biological or biochemical function.
  • the half maximal inhibitory concentration (IC50) and/or 90% inhibitory concentration (IC90) of an antibody is measured using a cell-based blocking assay.
  • the cell-based blocking assay is used to determine whether an antibody blocks the interaction between a ligand (e.g., IL-33) and its receptor (e.g., ST2 and/or the coreceptor IL-1RAcP).
  • a ligand e.g., IL-33
  • its receptor e.g., ST2 and/or the coreceptor IL-1RAcP.
  • An exemplary cell-based blocking assay for IL-33 is provided, e.g., in Example 2B of U.S. Pat. No. 10,093,730. Additional exemplary cell-based blocking assays for IL-33 are provided, for example, in Example 8 of U.S. Pat. No. 10,093,730, including primary natural killer (NK) cell assays and primary basophil cell assays.
  • NK primary natural killer
  • the “class” of an antibody refers to the type of constant domain or constant region possessed by its heavy chain.
  • the heavy chain constant domains that correspond to the different classes of immunoglobulins are called ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ , respectively.
  • Antibody effector functions refer to those biological activities attributable to the Fc region (a native sequence Fc region or amino acid sequence variant Fc region) of an antibody, and vary with the antibody isotype. Examples of antibody effector functions include: C1 q binding and complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g., B cell receptor); and B cell activation.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • FcRs Fc receptors
  • cytotoxic cells e.g., Natural Killer (NK) cells, neutrophils, and macrophages
  • NK cells Natural Killer cells
  • neutrophils neutrophils
  • macrophages cytotoxic cells
  • the antibodies “arm” the cytotoxic cells and are absolutely required for such killing.
  • the primary cells for mediating ADCC, NK cells express Fc ⁇ RIII only, whereas monocytes express Fc ⁇ RI, Fc ⁇ RII, and Fc ⁇ RIII.
  • FcR expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch et al. Annu. Rev. Immunol. 9:457-492, 1991.
  • an in vitro ADCC assay such as that described in U.S. Pat. No. 5,500,362 or 5,821,337 can be performed.
  • Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells.
  • PBMC peripheral blood mononuclear cells
  • NK Natural Killer
  • ADCC activity of the molecule of interest can be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et al. Proc. Natl. Acad. Sci. USA 95:652-656, 1998.
  • Fc receptor or “FcR” describes a receptor that binds to the Fc region of an antibody.
  • the preferred FcR is a native sequence human FcR.
  • a preferred FcR is one which binds an IgG antibody (a gamma receptor) and includes receptors of the Fc ⁇ RI, Fc ⁇ RII, and Fc ⁇ RIII subclasses, including allelic variants and alternatively spliced forms of these receptors.
  • Fc ⁇ RII receptors include Fc ⁇ RIIA (an “activating receptor”) and Fc ⁇ RIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof.
  • Activating receptor Fc ⁇ RIIA contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain.
  • Inhibiting receptor Fc ⁇ RIIB contains an immunoreceptor tyrosine-based inhibition motif (ITIM) in its cytoplasmic domain (see review M. in Da ⁇ ron, Annu. Rev. Immunol. 15:203-234, 1997).
  • FcRs are reviewed, for example, in Ravetch et al. Annu. Rev. Immunol. 9:457-492, 1991; Capel et al. Immunomethods 4:25-34, 1994; and de Haas et al. J. Lab. Clin. Med. 126:330-41, 1995.
  • FcR FcR
  • the term also includes the neonatal receptor, FcRn, which is responsible for the transfer of maternal IgGs to the fetus (see, e.g., Guyer et al. J. Immunol. 117:587, 1976; and Kim et al. J. Immunol. 24:249, 1994).
  • Human effector cells are leukocytes which express one or more FcRs and perform effector functions. Preferably, the cells express at least Fc ⁇ RIII and perform ADCC effector function. Examples of human leukocytes which mediate ADCC include peripheral blood mononuclear cells (PBMC), natural killer (NK) cells, monocytes, cytotoxic T cells, and neutrophils; with PBMCs and NK cells being preferred.
  • PBMC peripheral blood mononuclear cells
  • NK natural killer cells
  • monocytes cytotoxic T cells
  • neutrophils neutrophils
  • the effector cells can be isolated from a native source, e.g., from blood.
  • “Complement dependent cytotoxicity” or “CDC” refers to the lysis of a target cell in the presence of complement. Activation of the classical complement pathway is initiated by the binding of the first component of the complement system (C1q) to antibodies (of the appropriate subclass) which are bound to their cognate antigen.
  • C1q the first component of the complement system
  • a CDC assay e.g., as described in Gazzano-Santoro et al. J. Immunol. Methods 202:163, 1996, can be performed.
  • epitope is the portion of the antigen to which the antibody selectively binds.
  • the epitope is generally a peptide portion of about 4-15 amino acid residues.
  • full-length antibody “intact antibody,” and “whole antibody” are used herein interchangeably to refer to an antibody having a structure substantially similar to a native antibody structure or having heavy chains that contain an Fc region as defined herein.
  • a “human antibody” is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.
  • a “human consensus framework” is a framework which represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences.
  • the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences.
  • the subgroup of sequences is a subgroup as in Kabat et al. Sequences of Proteins of Immunological Interest , Fifth Edition, NIH Publication 91-3242, Bethesda Md., vols. 1-3, 1991.
  • the subgroup is subgroup kappa III or kappa IV as in Kabat et al. supra.
  • the subgroup is subgroup III as in Kabat et al. supra.
  • “Humanized” forms of non-human (e.g., rodent) antibodies are chimeric antibodies that contain minimal sequence derived from the non-human antibody.
  • humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or non-human primate having the desired antibody specificity, affinity, and capability.
  • donor antibody such as mouse, rat, rabbit or non-human primate having the desired antibody specificity, affinity, and capability.
  • framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
  • humanized antibodies can comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance.
  • the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence.
  • the humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • an “immunoconjugate” is an antibody conjugated to one or more heterologous molecule(s), including but not limited to a cytotoxic agent.
  • isolated when used to describe the various antibodies disclosed herein, means an antibody that has been identified and separated and/or recovered from a cell or cell culture from which it was expressed. Contaminant components of its natural environment are materials that would typically interfere with diagnostic or therapeutic uses for the polypeptide, and can include enzymes, hormones, and other proteinaceous or non-proteinaceous solutes.
  • an antibody is purified to greater than 95% or 99% purity as determined by, for example, electrophoretic (e.g., sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE), isoelectric focusing (IEF), capillary electrophoresis) or chromatographic (e.g., ion exchange or reverse phase HPLC) methods.
  • electrophoretic e.g., sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE), isoelectric focusing (IEF), capillary electrophoresis
  • chromatographic e.g., ion exchange or reverse phase HPLC
  • the antibody will be purified (1) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (2) to homogeneity by SDS-PAGE under non-reducing or reducing conditions using Coomassie blue or, preferably, silver stain.
  • Isolated antibody includes antibodies in situ within recombinant cells, because at least one component of the polypeptide natural environment will not be present. Ordinarily, however, isolated polypeptide will be prepared by at least one purification step.
  • the term “monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts.
  • polyclonal antibody preparations typically include different antibodies directed against different determinants (epitopes)
  • each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen.
  • the modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • the monoclonal antibodies to be used in accordance with the present invention may be made by a variety of techniques, including but not limited to the hybridoma method, recombinant DNA methods, phage-display methods, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci, such methods and other exemplary methods for making monoclonal antibodies being described herein.
  • multispecific antibody is used in the broadest sense and specifically covers an antibody comprising a heavy chain variable domain (VH) and a light chain variable domain (VL), where the VHVL unit has polyepitopic specificity (i.e., is capable of binding to two different epitopes on one biological molecule or each epitope on a different biological molecule).
  • Such multispecific antibodies include, but are not limited to, full-length antibodies, antibodies having two or more VL and VH domains, antibody fragments such as Fab, Fv, dsFv, scFv, diabodies, bispecific diabodies and triabodies, antibody fragments that have been linked covalently or non-covalently.
  • Polyepitopic specificity refers to the ability to specifically bind to two or more different epitopes on the same or different target(s). “Dual specificity” or “bispecificity” refers to the ability to specifically bind to two different epitopes on the same or different target(s). However, in contrast to bispecific antibodies, dual-specific antibodies have two antigen-binding arms that are identical in amino acid sequence and each Fab arm is capable of recognizing two antigens. Dual-specificity allows the antibodies to interact with high affinity with two different antigens as a single Fab or IgG molecule.
  • the multispecific antibody in an IgG1 form binds to each epitope with an affinity of 5 ⁇ M to 0.001 pM, 3 ⁇ M to 0.001 pM, 1 ⁇ M to 0.001 pM, 0.5 ⁇ M to 0.001 pM or 0.1 ⁇ M to 0.001 pM.
  • “Monospecific” refers to the ability to bind only one epitope.
  • KnH knock-into-hole
  • a protuberance for example, KnHs have been introduced in the Fc:Fc binding interfaces, CL:CH1 interfaces, or VH/VL interfaces of antibodies (see, e.g., US 2011/0287009, US2007/0178552, WO 96/027011, WO 98/050431, and Zhu et al. Protein Science 6:781-788, 1997).
  • KnHs drive the pairing of two different heavy chains together during the manufacture of multispecific antibodies.
  • multispecific antibodies having KnH in their Fc regions can further comprise single variable domains linked to each Fc region, or further comprise different heavy chain variable domains that pair with similar or different light chain variable domains.
  • KnH technology can also be used to pair two different receptor extracellular domains together or any other polypeptide sequences that comprises different target recognition sequences (e.g., including affibodies, peptibodies, and other Fc fusions).
  • knock mutation refers to a mutation that introduces a protuberance (knob) into a polypeptide at an interface in which the polypeptide interacts with another polypeptide.
  • the other polypeptide has a hole mutation (see e.g., U.S. Pat. Nos. 5,731,168; 5,807,706; 5,821,333; 7,695,936; and 8,216,805, which are each incorporated herein by reference in their entirety).
  • hole mutation refers to a mutation that introduces a cavity (hole) into a polypeptide at an interface in which the polypeptide interacts with another polypeptide.
  • the other polypeptide has a knob mutation (see e.g., U.S. Pat. Nos. 5,731,168; 5,807,706; 5,821,333; 7,695,936; and 8,216,805, which are each incorporated herein by reference in their entirety).
  • naked antibody refers to an antibody that is not conjugated to a heterologous moiety (e.g., a cytotoxic moiety) or radiolabel.
  • the naked antibody may be present in a pharmaceutical composition.
  • the term “specific binding” or “specifically binds” or is “specific for” a particular polypeptide or an epitope on a particular polypeptide target means binding that is measurably different from a non-specific interaction.
  • Specific binding can be measured, for example, by determining binding of a molecule compared to binding of a control molecule. For example, specific binding can be determined by competition with a control molecule that is similar to the target, for example, an excess of non-labeled target. In this case, specific binding is indicated if the binding of the labeled target to a probe is competitively inhibited by excess unlabeled target.
  • telomere binding or “specifically binds to” or is “specific for” a particular polypeptide or an epitope on a particular polypeptide target as used herein can be exhibited, for example, by a molecule having a K D for the target of 10 ⁇ 4 M or lower, alternatively 10 ⁇ 5 M or lower, alternatively 10 ⁇ 6 M or lower, alternatively 10 ⁇ 7 M or lower, alternatively 10 ⁇ 8 M or lower, alternatively 10 ⁇ 9 M or lower, alternatively 10 ⁇ 10 M or lower, alternatively 10 ⁇ 11 M or lower, alternatively 10 ⁇ 12 M or lower or a K D in the range of 10 ⁇ 4 M to 10 ⁇ 6 M or 10 ⁇ 6 M to 10 ⁇ 10 M or 10 ⁇ 7 M to 10 ⁇ 9 M.
  • affinity and K D values are inversely related. A high affinity for an antigen is measured by a low K D value.
  • the term “specific binding” refers to binding where a molecule binds to a particular polypeptide or epitope on a particular polypeptide without substantially binding to any other polypeptide or polypeptide epitope.
  • variable refers to the fact that certain segments of the variable domains differ extensively in sequence among antibodies.
  • the variable or “V” domain mediates antigen binding and defines specificity of a particular antibody for its particular antigen.
  • variability is not evenly distributed across the 110-amino acid span of the variable domains. Instead, the V regions consist of relatively invariant stretches called framework regions (FRs) of 15-30 amino acids separated by shorter regions of extreme variability called “hypervariable regions” that are each 9-12 amino acids long.
  • FRs framework regions
  • hypervariable regions that are each 9-12 amino acids long.
  • the variable domains of native heavy and light chains each comprise four FRs, largely adopting a beta-sheet configuration, connected by three hypervariable regions, which form loops connecting, and in some cases forming part of, the beta-sheet structure.
  • the hypervariable regions in each chain are held together in close proximity by the FRs and, with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Kabat et al. supra). Accordingly, the HVR and FR sequences generally appear in the following sequence in VH (or VL): FR1-H1(L1)-FR2-H2(L2)-FR3-H3(L3)-FR4.
  • the constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody dependent cellular cytotoxicity (ADCC).
  • hypervariable region when used herein refers to the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops.
  • antibodies comprise six HVRs; three in the VH (H1, H2, H3), and three in the VL (L1, L2, L3).
  • H3 and L3 display the most diversity of the six HVRs, and H3 in particular is believed to play a unique role in conferring fine specificity to antibodies.
  • HVR delineations are in use and are encompassed herein.
  • the Kabat Complementarity Determining Regions are based on sequence variability and are the most commonly used (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)). Chothia refers instead to the location of the structural loops (Chothia and Lesk J. Mol. Biol. 196:901-917 (1987)).
  • the AbM HVRs represent a compromise between the Kabat HVRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody modeling software.
  • the “contact” HVRs are based on an analysis of the available complex crystal structures. The residues from each of these HVRs are noted below.
  • HVRs may comprise “extended HVRs” as follows: 24-36 or 24-34 (L1), 46-56 or 50-56 (L2) and 89-97 or 89-96 (L3) in the VL and 26-35 (H1), 50-65 or 49-65 (H2) and 93-102, 94-102, or 95-102 (H3) in the VH.
  • the variable domain residues are numbered according to Kabat et al., supra, for each of these definitions.
  • Framework or “FR” residues are those variable domain residues other than the HVR residues as herein defined.
  • variable domain residue numbering as in Kabat or “amino acid position numbering as in Kabat,” and variations thereof, refers to the numbering system used for heavy chain variable domains or light chain variable domains of the compilation of antibodies in Kabat et al. supra. Using this numbering system, the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or HVR of the variable domain.
  • a heavy chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g., residues 82a, 82b, and 82c, etc. according to Kabat) after heavy chain FR residue 82.
  • the Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a “standard” Kabat numbered sequence.
  • the Kabat numbering system is generally used when referring to a residue in the variable domain (approximately residues 1-107 of the light chain and residues 1-113 of the heavy chain) (e.g., Kabat et al. supra).
  • the “EU numbering system” or “EU index” is generally used when referring to a residue in an immunoglobulin heavy chain constant region (e.g., the EU index reported in Kabat et al. supra).
  • the “EU index as in Kabat” refers to the residue numbering of the human IgG1 EU antibody.
  • references to residue numbers in the variable domain of antibodies means residue numbering by the Kabat numbering system.
  • references to residue numbers in the constant domain of antibodies means residue numbering by the EU numbering system (e.g., see U.S. Provisional Application No. 60/640,323, Figures for EU numbering).
  • administering is meant a method of giving a dosage of a compound (e.g., an anti-IL-33 antibody provided herein or a nucleic acid encoding an anti-IL-33 antibody provided herein) or a composition (e.g., a pharmaceutical composition, e.g., a pharmaceutical composition including an anti-IL-33 antibody provided herein) to a subject.
  • a compound e.g., an anti-IL-33 antibody provided herein or a nucleic acid encoding an anti-IL-33 antibody provided herein
  • a composition e.g., a pharmaceutical composition, e.g., a pharmaceutical composition including an anti-IL-33 antibody provided herein
  • compositions utilized in the methods described herein can be administered, for example, intravitreally, intramuscularly, intravenously, intradermally, percutaneously, intraarterially, intraperitoneally, intralesionally, intracranially, intraarticularly, intraprostatically, intrapleurally, intratracheally, intrathecally, intranasally, intravaginally, intrarectally, topically, intratumorally, peritoneally, subcutaneously, subconjunctivally, intravesicularly, mucosally, intrapericardially, intraumbilically, intraocularly, intraorbitally, orally, topically, transdermally, periocularly, conjunctivally, subtenonly, intracamerally, subretinally, retrobulbarly, intracanalicularly, by inhalation, by injection, by implantation, by infusion, by continuous infusion, by localized perfusion bathing target cells directly, by catheter, by lavage, in cremes, or in lipid compositions.
  • asthma refers herein to a disorder characterized by variable and recurring symptoms, reversible airflow obstruction (e.g., by bronchodilator), and bronchial hyper-responsiveness, which may or may not be associated with underlying inflammation. Asthma may therefore be inflammatory/inflamed asthma or non-inflammatory/non-inflamed asthma.
  • asthma examples include allergic asthma, exercise-induced asthma, aspirin sensitive/exacerbated asthma, atopic asthma, severe asthma, mild asthma, moderate to severe asthma, corticosteroid na ⁇ ve asthma, chronic asthma, corticosteroid resistant asthma, corticosteroid refractory asthma, newly diagnosed and untreated asthma, asthma due to smoking, asthma uncontrolled on corticosteroids, and other asthmas as mentioned in Bousquet et al. J. Allergy Clin. Immunol. 126(5): 926-938, 2010.
  • a “disorder” or “disease” is any condition that would benefit from treatment with an antibody provided herein.
  • a disorder may be an IL-33-mediated disorder. This includes chronic and acute disorders or diseases including those pathological conditions which predispose the mammal to the disorder in question.
  • disorders to be treated herein include IL-33-mediated disorders (e.g., asthma, allergic rhinitis, atopic dermatitis, and fibrosis (e.g., pulmonary fibrosis, e.g., idiopathic pulmonary fibrosis)).
  • IL-33-mediated disorder refers to any disorder or condition mediated by, or associated with, the IL-33 axis.
  • IL-33-mediated disorders are associated with excess IL-33 levels or activity in which atypical symptoms may manifest due to the levels or activity of IL-33 locally and/or systemically in the body.
  • Exemplary IL-33-mediated disorders include ocular disorders, inflammatory conditions, immune disorders, fibrotic disorders, eosinophilic disorders, infections, pain, central nervous system disorders, and solid tumors.
  • IL-33-mediated disorders are described, for example, in Liew et al. Nature Reviews Immunology 10: 103-110, 2010, which is incorporated herein by reference in its entirety.
  • ocular disorder includes any ocular disorder (also referred to interchangeably herein as “ocular condition”) associated with pathological angiogenesis and/or atrophy.
  • An ocular disorder may be characterized by altered or unregulated proliferation and/or invasion of new blood vessels into the structures of ocular tissues such as the retina or cornea.
  • An ocular disorder may be characterized by atrophy of retinal tissue (photoreceptors and the underlying retinal pigment epithelium (RPE) and choriocapillaris).
  • RPE retinal pigment epithelium
  • Non-limiting ocular disorders include, for example, AMD (e.g., wet AMD, dry AMD, intermediate AMD, advanced AMD, and geographic atrophy (GA)), macular degeneration, macular edema, diabetic macular edema (DME) (e.g., focal, non-center DME and diffuse, center-involved DME), retinopathy, diabetic retinopathy (DR) (e.g., proliferative DR (PDR), non-proliferative DR (NPDR), and high-altitude DR), other ischemia-related retinopathies, ROP, retinal vein occlusion (RVO) (e.g., central (CRVO) and branched (BRVO) forms), choroidal neovascularization (CNV) (e.g., myopic CNV), corneal neovascularization, diseases associated with corneal neovascularization, retinal neovascularization, diseases associated with retinal/choroidal neovascular
  • Additional exemplary ocular disorders include retinoschisis (abnormal splitting of the retina neurosensory layers), diseases associated with rubeosis (neovascularization of the angle) and diseases caused by the abnormal proliferation of fibrovascular or fibrous tissue, including all forms of proliferative vitreoretinopathy.
  • Exemplary diseases associated with corneal neovascularization include, but are not limited to, epidemic keratoconjunctivitis, vitamin A deficiency, contact lens overwear, atopic keratitis, superior limbic keratitis, terygium keratitis sicca, Sjögren's syndrome, acne rosacea, phylectenulosis, syphilis, Mycobacteria infections, lipid degeneration, chemical burns, bacterial ulcers, fungal ulcers, Herpes simplex infections, Herpes zoster infections, protozoan infections, Kaposi sarcoma, Mooren ulcer, Terrien's marginal degeneration, marginal keratolysis, rheumatoid arthritis, systemic lupus, polyarteritis, trauma, Wegener's sarcoidosis, scleritis, Stevens-Johnson syndrome, periphigoid radial keratotomy, and corneal graph rejection.
  • Exemplary diseases associated with choroidal neovascularization and defects in the retina vasculature include, but are not limited to, diabetic retinopathy, macular degeneration, sickle cell anemia, sarcoid, syphilis, pseudoxanthoma elasticum, Paget's disease, vein occlusion, artery occlusion, carotid obstructive disease, chronic uveitis/vitritis, mycobacterial infections, Lyme's disease, systemic lupus erythematosis, retinopathy of prematurity, retina edema (including macular edema), Eales disease, Behcet's disease, infections causing retinitis or choroiditis (e.g., multifocal choroidits), presumed ocular histoplasmosis, Best's disease (vitelliform macular degeneration), myopia, optic pits, pars plan
  • Exemplary diseases associated with atrophy of retinal tissues include, but are not limited to, atrophic or nonexudative AMD (e.g., geographic atrophy or advanced dry AMD), macular atrophy (e.g., atrophy associated with neovascularization and/or geographic atrophy), diabetic retinopathy, Stargardt's disease, Sorsby Fundus Dystrophy, retinoschisis, and retinitis pigmentosa.
  • atrophic or nonexudative AMD e.g., geographic atrophy or advanced dry AMD
  • macular atrophy e.g., atrophy associated with neovascularization and/or geographic atrophy
  • diabetic retinopathy e.g., Stargardt's disease, Sorsby Fundus Dystrophy, retinoschisis, and retinitis pigmentosa.
  • Exemplary inflammatory conditions include asthma (e.g., allergic asthma, exercise-induced asthma, aspirin sensitive/exacerbated asthma, atopic asthma, severe asthma, mild asthma, moderate to severe asthma, corticosteroid na ⁇ ve asthma, chronic asthma, corticosteroid resistant asthma, corticosteroid refractory asthma, newly diagnosed and untreated asthma, asthma due to smoking, asthma uncontrolled on corticosteroids, etc.), airway inflammation, airway hyperreactivity, airway hyperresponsiveness, rhinosinusitis, rhinosinusitis with polyps, nasal polyposis, arthritis (e.g., osteoarthritis, rheumatoid arthritis, collagen-induced arthritis, arthritic joints as a result of injury, etc.), eosinophilic inflammation, mast cell-mediated inflammatory diseases, sepsis, septic shock, seronegative enthesopathy and arthropathy (SEA) syndrome, osteoporosis, eosinophilic esophagitis, sc
  • Exemplary immune disorders include those mediated at least in part by mast cells, such as asthma (e.g., allergic asthma), eczema, itch, allergy, atopic allergy, anaphylaxis, anaphylactic shock, allergic bronchopulmonary aspergillosis, allergic rhinitis, allergic conjunctivitis, as well as autoimmune disorders including rheumatoid arthritis, juvenile rheumatoid arthritis, psoriatic arthritis, pancreatitis, psoriasis, plaque psoriasis, guttate psoriasis, inverse psoriasis, pustular psoriasis, erythrodermic psoriasis, paraneoplastic autoimmune diseases, autoimmune hepatitis, bullous pemphigoid, myasthenia gravis, inflammatory bowel disease, Crohn's disease, ulcerative colitis, celiac disease, thyroiditis (e.g., Grav
  • fibrotic disorder and “fibrosis” refer to conditions involving formation of excess fibrous connective tissue in an organ or tissue.
  • exemplary fibrotic disorders include lung fibrosis, liver fibrosis (e.g., fibrosis associated with cirrhosis (e.g., alcohol-induced cirrhosis, viral-induced cirrhosis, post-hepatitis C cirrhosis, and primary biliary cirrhosis), schistosomiasis, cholangitis (e.g., sclerosing cholangitis), and autoimmune-induced hepatitis), kidney fibrosis (e.g., tubulointerstitial fibrosis, scleroderma, diabetic nephritis, and glomerular nephritis), dermal fibrosis (e.g., scleroderma, hypertrophic and keloid scarring, nephrogenic fibrosing dermatopathy
  • lung fibrosis examples include, for example, lung or pulmonary fibrosis associated with idiopathic pulmonary fibrosis, fibrosis with collagen vascular disease, Hermansky-Pudlak syndrome, adult respiratory distress syndrome, nonspecific interstitial pneumonia, respiratory bronciolitis, sarcoidosis, histiocytosis X, bronchiolitis obliterans, and cryptogenic organizing pneumonia.
  • the lung fibrosis is idiopathic pulmonary fibrosis.
  • an “eosinophilic disorder” is a disorder associated with excess eosinophil numbers in which atypical symptoms may manifest due to the levels or activity of eosinophils locally or systemically in the body.
  • Eosinophilic disorders include but are not limited to, asthma (including aspirin sensitive asthma, atopic asthma, and severe asthma), eosinophilic inflammation, atopic dermatitis, allergic rhinitis (including seasonal allergic rhinitis), non-allergic rhinitis, chronic eosinophilic pneumonia, allergic bronchopulmonary aspergillosis, celiac disease, Churg-Strauss syndrome (periarteritis nodosa plus atopy), eosinophilic myalgia syndrome, hypereosinophilic syndrome, edematous reactions including episodic angiodema, helminth infections, where eosinophils may have a protective role, onchocercal dermatitis,
  • Eosinophil-derived secretory products have also been associated with the promotion of angiogenesis and connective tissue formation in tumors and the fibrotic responses seen in conditions such as chronic asthma, Crohn's disease, scleroderma and endomyocardial fibrosis (Munitz et al. Allergy 59: 268-275, 2004; Adamko et al. Allergy 60: 13-22, 2005; Oldhoff et al. Allergy 60: 693-696, 2005).
  • cancer e.g., glioblastoma (such as glioblastoma multiforme) and non-Hodgkin's lymphoma (NHL)
  • glioblastoma such as glioblastoma multiforme
  • NHL non-Hodgkin's lymphoma
  • atopic dermatitis e.g., allergic rhinitis, inflammatory bowel disease, fibrosis (e.g., pulmonary fibrosis (e.g., idiopathic pulmonary fibrosis (IPF) and pulmonary fibrosis secondary to sclerosis) and hepatic fibrosis), and COPD.
  • fibrosis e.g., pulmonary fibrosis (e.g., idiopathic pulmonary fibrosis (IPF) and pulmonary fibrosis secondary to sclerosis
  • COPD hepatic fibrosis
  • infection examples include helminth infection (e.g., nematode infection, such as Trichuris muris infection of mice, which is a model for infection by the human parasite Trichuris trichiura ), protozoan infection (e.g., Leishmania major infection), and viral infection (e.g., respiratory syncytial virus infection and influenza virus infection).
  • helminth infection e.g., nematode infection, such as Trichuris muris infection of mice, which is a model for infection by the human parasite Trichuris trichiura
  • protozoan infection e.g., Leishmania major infection
  • viral infection e.g., respiratory syncytial virus infection and influenza virus infection.
  • pain examples include inflammatory pain, hyperalgesia (e.g., mechanical hyperalgesia), allodynia, and hypernociception (e.g., cutaneous and articular hypernociception, which may or may not be antigen-induced).
  • hyperalgesia e.g., mechanical hyperalgesia
  • allodynia e.g., allodynia
  • hypernociception e.g., cutaneous and articular hypernociception, which may or may not be antigen-induced.
  • central nervous system disorders include subarachnoid hemorrhage, inflammatory diseases of the central nervous system, neurodegenerative diseases (e.g., Alzheimer's disease, experimental autoimmune encephalomyelitis, multiple sclerosis, Parkinson's disease, Huntington's disease), bipolar disorder, and infection of the central nervous system (e.g., viral infection).
  • neurodegenerative diseases e.g., Alzheimer's disease, experimental autoimmune encephalomyelitis, multiple sclerosis, Parkinson's disease, Huntington's disease
  • bipolar disorder e.g., and chronic myelitis
  • solid tumors examples include tumors of the colon, breast, prostate, lung, kidney, liver, pancreas, ovary, head and neck, oral cavity, stomach, duodenum, small intestine, large intestine, gastrointestinal tract, anus, gall bladder, labium, nasopharynx, skin, uterus, male genital organ, urinary organs, bladder, and skin.
  • Solid tumors of non-epithelial origin include sarcomas, brain tumors, and bone tumors.
  • asthma can be categorized in some instances as both an inflammatory disorder and immune disorder and considered by some clinicians to be an autoimmune disorder.
  • an “IL-33 axis binding antagonist” refers to a molecule that inhibits the interaction of an IL-33 axis binding partner with one or more of its binding partners.
  • an IL-33 axis binding antagonist includes IL-33 binding antagonists, ST2 binding antagonists, and IL1RAcP binding antagonists.
  • Exemplary IL-33 axis binding antagonists include anti-IL-33 antibodies and antigen-binding fragments thereof (e.g., anti-IL-33 antibodies such as ANB-020 (AnaptysBio, Inc.) or any of the antibodies described in U.S. Ser. No. 10/093,730, EP1725261, U.S. Pat. No.
  • polypeptides that bind IL-33 and/or its receptor (ST2 and/or IL-1RAcP) and block ligand-receptor interaction e.g., ST2-Fc proteins, such as those described in WO 2014/152195, which is herein incorporated by reference in its entirety; immunoadhesins, peptibodies, and soluble ST2, or derivatives thereof); anti-IL-33 receptor antibodies (e.g., anti-ST2 antibodies, for example, AMG-282 (Amgen) or STLM15 (Janssen) or any of the anti-ST2 antibodies described in WO 2013/173761 and WO 2013/165894, which are each incorporated herein by reference in their entirety; or ST2-Fc proteins, such as those described in WO 2013/173761; WO 2013/165894; or WO 2014/152
  • ST2-Fc proteins such as those described in WO 2013/173761; WO 2013/165894; or WO 2014/152
  • chemoattractant receptor-homologous molecule expressed on Th2 cells refers to any native CRTH2 from any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated.
  • CRTH2 is also referred to as G protein coupled receptor 44 (GPR44), cluster of differentiation 294 (CD294), DL1R, and DP2.
  • GPR44 G protein coupled receptor 44
  • CD294 cluster of differentiation 294
  • DL1R DL1R
  • DP2 chemoattractant receptor-homologous molecule expressed on Th2 cells
  • the term encompasses “full-length,” unprocessed CRTH2, as well as any form of CRTH2 that results from processing in the cell.
  • the amino acid sequence of an exemplary human CRTH2 can be found, for example, under UniProtKB accession number Q9Y5Y4.
  • CRTH2 binding antagonist refers to a molecule that decreases, blocks, inhibits, abrogates or interferes with signal transduction resulting from the interaction of CRTH2 with one or more of its binding partners, such as prostaglandin D2.
  • exemplary CRTH2 binding antagonists known in the art include AMG-853, AP768, AP-761, MLN6095, and ACT129968.
  • IL-5 refers to any native IL-5 from any vertebrate source, including mammals such as primates (e.g. humans) and rodents (e.g., mice and rats), unless otherwise indicated.
  • the term encompasses “full-length,” unprocessed IL-5, as well as any form of IL-5 that results from processing in the cell.
  • the term also encompasses naturally occurring variants of IL-5, such as splice variants or allelic variants.
  • the amino acid sequence of an exemplary IL-5 can be found, for example, under UniProtKB accession number P05113.
  • IL-5 binding antagonist refers to a molecule that decreases, blocks, inhibits, abrogates or interferes with signal transduction resulting from the interaction of IL-5 with one or more of its binding partners, such as IL-5 receptor, alpha (ILSRA).
  • IL-5 binding antagonists that can be used in the methods disclosed herein include, for example, anti-IL-5 antibodies (e.g., mepolizumab and reslizumab) and anti-IL-5R antibodies.
  • IL-13 refers to any native IL-13 from any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated.
  • IL-13 is a cytokine secreted by many cell types, including T helper type 2 (Th2) cells.
  • Th2 T helper type 2
  • the term encompasses “full-length,” unprocessed IL-13, as well as any form of IL-13 that results from processing in the cell.
  • the amino acid sequence of an exemplary human IL-13 can be found, for example, under UniProtKB accession number P35225.
  • IL-13 binding antagonist refers to a molecule that decreases, blocks, inhibits, abrogates or interferes with signal transduction resulting from the interaction of IL-13 with one or more of its binding partners, such as IL-4 receptor alpha (IL4Ra), IL-13 receptor alpha1 (IL13RA1) and IL-13 receptor alpha2 (IL13RA2).
  • IL-13 binding antagonists include anti-IL-13 antibodies, for example, lebrikizumab, 228B/C-1, 228A-4, 227-26, and 227-43 (see, for example, U.S. Pat. Nos. 7,674,459; 8,067,199; 8,088,618; 8,318,160; and 8,734,797).
  • IL-17 refers to any native IL-17 from any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated, and includes family members IL-17A, IL-17B, IL-17C, IL-17D, IL-17E, and IL-17F.
  • the term encompasses “full-length,” unprocessed IL-17, as well as any form of IL-17 that results from processing in the cell.
  • the amino acid sequence of an exemplary human IL-17A can be found, for example, under UniProtKB accession number Q16552.
  • the amino acid sequence of an exemplary human IL-17B can be found, for example, under UniProtKB accession number Q9UHF5.
  • the amino acid sequence of an exemplary human IL-17C can be found, for example, under UniProtKB accession number Q9POM4.
  • the amino acid sequence of an exemplary human IL-17D can be found, for example, under UniProtKB accession number Q8TAD2.
  • the amino acid sequence of an exemplary human IL-17E can be found, for example, under UniProtKB accession number Q9H293.
  • the amino acid sequence of an exemplary human IL-17F can be found, for example, under UniProtKB accession number Q96PD4.
  • IL-17 binding antagonist refers to a molecule that decreases, blocks, inhibits, abrogates or interferes with signal transduction resulting from the interaction of IL-17 with one or more of its binding partners, such as interleukin-17 receptor (IL-17R) family member proteins interleukin 17 receptor A (IL17RA), interleukin 17 receptor B (IL17RB), interleukin 17 receptor C (IL17RC), interleukin 17 receptor D (IL17RD), interleukin 17 receptor E (IL17RE), and interleukin 17 receptor E-like (IL17REL).
  • IL-17 binding antagonists include, for example, anti-IL-17 antibodies (e.g., ixekizumab (LY2439821) and anti-IL-17R antibodies (e.g., brodalumab (AMG-827)).
  • Janus kinase 1 refers to any native JAK1 from any vertebrate source, including mammals such as primates (e.g. humans) and rodents (e.g., mice and rats), unless otherwise indicated.
  • the term encompasses “full-length,” unprocessed JAK1 as well as any form of JAK1 that results from processing in the cell.
  • the term also encompasses naturally occurring variants of JAK1, e.g., splice variants or allelic variants.
  • the amino acid sequence of an exemplary JAK1 can be found, for example, under UniProtKB accession number P23458.
  • JAK1 antagonist refers to compounds or agents which inhibit or reduce the biological activity of JAK1.
  • exemplary JAK1 antagonists include small molecule inhibitors (e.g., ruxolitinib, GLPG0634, and GSK2586184).
  • the term “ST2 binding antagonist” refers to a molecule that inhibits the interaction of an ST2 with IL-33, IL1RAcP, and/or a second ST2 molecule.
  • the ST2 binding antagonist may be a protein, such as an “ST2-Fc protein” that includes an IL-33-binding domain (e.g., all or a portion of an ST2 or IL1RAcP protein) and a multimerizing domain (e.g., an Fc portion of an immunoglobulin, e.g., an Fc domain of an IgG selected from the isotypes IgG1, IgG2, IgG3, and IgG4, as well as any allotype within each isotype group), which are attached to one another either directly or indirectly through a linker (e.g., a serine-glycine (SG) linker, glycine-glycine (GG) linker, or variant thereof (e.g., a SGG, a GGS, an SGS
  • a ST2 binding antagonist may be an anti-ST2 antibody, for example, AMG-282 (Amgen) or STLM15 (Janssen) or any of the anti-ST2 antibodies described in WO 2013/173761 and WO 2013/165894.
  • tryptase-beta refers to any native tryptase-beta from any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated.
  • the term encompasses tryptase beta-1 (encoded by the TPSAB1 gene, which also encodes tryptase alpha-1) and tryptase beta-2 (encoded by the TPSB2 gene).
  • the term encompasses “full-length,” unprocessed tryptase-beta as well as any form of tryptase-beta that results from processing in the cell.
  • the amino acid sequence of an exemplary human tryptase beta-2 can be found, for example, under UniProtKB accession number P20231.
  • tryptase-beta antagonist refers to compounds or agents which inhibit or reduce the biological activity of tryptase beta.
  • Factor D refers to any native Factor D from any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated.
  • Factor D is also referred to as C3 proactivator convertase, properdin factor D esterase, Factor D (complement), Complement Factor D, CFD, and adipsin.
  • the term encompasses “full-length,” unprocessed Factor D, as well as any form of Factor D that results from processing in the cell.
  • the amino acid sequence of an exemplary human Factor D can be found, for example, under UniProtKB accession number P00746.
  • Factor D binding antagonist refers to compounds or agents which inhibit or reduce the biological activity of Factor D.
  • Exemplary Factor D binding antagonists include, for example, small molecule inhibitors and anti-Factor D antibodies, for example, any anti-Factor D antibody described in WO 2007/056227, WO 01/70818, and/or US 2002/0081293, which are each incorporated herein by reference in their entirety.
  • the anti-Factor D antibody is or is derived from monoclonal antibody 166-32, produced by the hybridoma deposited with the ATCC and designated HB 12476.
  • HtrA1 refers to any native HtrA1 from any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated. HtrA1 is also known in the art as HtrA serine peptidase 1, L56, and Serine protease 11. The term encompasses “full-length,” unprocessed HtrA1 as well as any form of HtrA1 that results from processing in the cell. The term also encompasses naturally occurring variants of HtrA1, e.g., splice variants or allelic variants. The amino acid sequence of an exemplary human HtrA1 can be found, for example, under UniProtKB accession number Q92743.
  • HtrA1 binding antagonist refers to compounds or agents which inhibit or reduce the biological activity of HtrA1.
  • Exemplary HtrA1 binding antagonists include, for example, small molecule inhibitors and anti-HtrA1 antibodies, for example, any anti-HtrA1 antibody described in U.S. Ser. No. 10/421,822 or U.S. Pat. No. 9,738,727, each of which is incorporated herein by reference in its entirety.
  • vascular endothelial growth factor refers to vascular endothelial growth factor protein A, as exemplified by Swiss Prot Accession Number P15692.
  • VEGF encompasses the protein having the amino acid sequence exemplified by Swiss Prot Accession Number P15692 as well as homologues and isoforms thereof.
  • VEGF also encompasses the known isoforms, e.g., splice isoforms of VEGF, e.g., VEGF 111 , VEGF 121 , VEGF 145 , VEGF 165 , VEGF 189 , and VEGF 206 , together with the naturally-occurring allelic and processed forms thereof, including the 110-amino acid human vascular endothelial cell growth factor generated by plasmin cleavage of VEGF 165 as described in Ferrara Mol. Biol. Cell. 21:687 (2010), Leung et al., Science, 246:1306 (1989), and Houck et al., Mol.
  • VEGF also refers to VEGFs from non-human species such as mouse, rat or primate. Sometimes the VEGF from a specific species are indicated by terms such as hVEGF for human VEGF, mVEGF for murine VEGF, and the like.
  • VEGF is also used to refer to truncated forms of the polypeptide comprising amino acids 8 to 109 or 1 to 109 of the 165-amino acid human vascular endothelial cell growth factor.
  • VEGF 109 Reference to any such forms of VEGF may be identified in the present application, e.g., by “VEGF 109 ,” “VEGF (8-109),” “VEGF (1-109)” or “VEGF 165 .”
  • the amino acid positions for a “truncated” native VEGF are numbered as indicated in the native VEGF sequence. For example, amino acid position 17 (methionine) in truncated native VEGF is also position 17 (methionine) in native VEGF.
  • the truncated native VEGF has binding affinity for the KDR and Flt-1 receptors comparable to native VEGF.
  • VEGF variant refers to a VEGF polypeptide which includes one or more amino acid mutations in the native VEGF sequence.
  • the one or more amino acid mutations include amino acid substitution(s).
  • numbers refer to the amino acid residue position along the amino acid sequence of the putative native VEGF (provided in Leung et al., supra and Houck et al., supra).
  • VEGF indicates VEGF-A.
  • VEGF antagonist refers to a molecule capable of binding to VEGF, reducing VEGF expression levels, or neutralizing, blocking, inhibiting, abrogating, reducing, or interfering with VEGF biological activities, including, but not limited to, VEGF binding to one or more VEGF receptors, VEGF signaling, and VEGF-mediated angiogenesis and endothelial cell survival or proliferation.
  • a molecule capable of neutralizing, blocking, inhibiting, abrogating, reducing, or interfering with VEGF biological activities can exert its effects by binding to one or more VEGF receptor (VEGFR) (e.g., VEGFR1, VEGFR2, VEGFR3, membrane-bound VEGF receptor (mbVEGFR), or soluble VEGF receptor (sVEGFR)).
  • VEGFR VEGF receptor
  • mbVEGFR3 membrane-bound VEGF receptor
  • sVEGFR soluble VEGF receptor
  • VEGF antagonists useful in the methods disclosed herein are polypeptides that specifically bind to VEGF, anti-VEGF antibodies and antigen-binding fragments thereof, receptor molecules and derivatives which bind specifically to VEGF thereby sequestering its binding to one or more receptors, fusions proteins (e.g., VEGF-Trap (Regeneron)), and VEGF 121 -gelonin (Peregrine).
  • VEGF-Trap (Regeneron)
  • Peregrine VEGF 121 -gelonin
  • VEGF antagonists also include antagonist variants of VEGF polypeptides, antisense nucleobase oligomers complementary to at least a fragment of a nucleic acid molecule encoding a VEGF polypeptide; small RNAs complementary to at least a fragment of a nucleic acid molecule encoding a VEGF polypeptide; ribozymes that target VEGF; peptibodies to VEGF; and VEGF aptamers.
  • VEGF antagonists also include polypeptides that bind to VEGFR, anti-VEGFR antibodies, and antigen-binding fragments thereof, and derivatives which bind to VEGFR thereby blocking, inhibiting, abrogating, reducing, or interfering with VEGF biological activities (e.g., VEGF signaling), or fusions proteins.
  • VEGF antagonists also include nonpeptide small molecules that bind to VEGF or VEGFR and are capable of blocking, inhibiting, abrogating, reducing, or interfering with VEGF biological activities.
  • VEGF activities specifically includes VEGF-mediated biological activities of VEGF.
  • the VEGF antagonist reduces or inhibits, by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more, the expression level or biological activity of VEGF.
  • the VEGF inhibited by the VEGF-specific antagonist is VEGF (8-109), VEGF (1-109), or VEGF 165 .
  • VEGF antagonists can include, but are not limited to, anti-VEGFR2 antibodies and related molecules (e.g., ramucirumab, tanibirumab, aflibercept), anti-VEGFR1 antibodies and related molecules (e.g., icrucumab, aflibercept (VEGF Trap-Eye; EYLEA®), and ziv-aflibercept (VEGF Trap; ZALTRAP®)), bispecific VEGF antibodies (e.g., MP-0250, vanucizumab (VEGF-ANG2), and bispecific antibodies disclosed in US 2001/0236388), bispecific antibodies including combinations of two of anti-VEGF, anti-VEGFR1, and anti-VEGFR2 arms, anti-VEGF antibodies (e.g., bevacizumab, sevacizumab, and ranibizumab), and nonpeptide small molecule VEGF antagonists (e.g., pazopanib, axitinib,
  • anti-VEGF antibody an “antibody that binds to VEGF,” and “antibody that specifically binds VEGF” refer to an antibody that is capable of binding VEGF with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting VEGF.
  • the extent of binding of an anti-VEGF antibody to an unrelated, non-VEGF protein is less than about 10% of the binding of the antibody to VEGF as measured, for example, by a radioimmunoassay (RIA).
  • RIA radioimmunoassay
  • an antibody that binds to VEGF has a dissociation constant (Kd) of ⁇ 1 ⁇ M, ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g. 10 ⁇ 8 M or less, e.g., from 10 ⁇ 8 M to 10 ⁇ 13 M, e.g., from 10 ⁇ 9 M to 10 ⁇ 13 M).
  • Kd dissociation constant
  • an anti-VEGF antibody binds to an epitope of VEGF that is conserved among VEGF from different species.
  • the anti-VEGF antibody can be used as a therapeutic agent in targeting and interfering with diseases or conditions wherein the VEGF activity is involved.
  • the antibody may be subjected to other biological activity assays, e.g., in order to evaluate its effectiveness as a therapeutic.
  • biological activity assays are known in the art and depend on the target antigen and intended use for the antibody. Examples include the HUVEC inhibition assay; tumor cell growth inhibition assays (as described in WO 89/06692, for example); antibody-dependent cellular cytotoxicity (ADCC) and complement-mediated cytotoxicity (CDC) assays (U.S. Pat. No.
  • anti-VEGF antibody will usually not bind to other VEGF homologues such as VEGF-B or VEGF-C, nor other growth factors such as PIGF, PDGF, or bFGF.
  • anti-VEGF antibody is a monoclonal antibody that binds to the same epitope as the monoclonal anti-VEGF antibody A4.6.1 produced by hybridoma ATCC HB 10709.
  • the anti-VEGF antibody is a recombinant humanized anti-VEGF monoclonal antibody generated according to Presta et al. (1997) Cancer Res. 57:4593-4599, including but not limited to the antibody known as bevacizumab (BV; AVASTIN®).
  • bevacizumab also known as “rhuMAb VEGF” or “AVASTIN®,” is a recombinant humanized anti-VEGF monoclonal antibody generated according to Presta et al. (1997) Cancer Res. 57:4593-4599. It comprises mutated human IgG1 framework regions and antigen-binding complementarity-determining regions from the murine anti-hVEGF monoclonal antibody A.4.6.1 that blocks binding of human VEGF to its receptors. Approximately 93% of the amino acid sequence of bevacizumab, including most of the framework regions, is derived from human IgG1, and about 7% of the sequence is derived from the murine antibody A4.6.1.
  • Bevacizumab has a molecular mass of about 149,000 daltons and is glycosylated. Bevacizumab and other humanized anti-VEGF antibodies are further described in U.S. Pat. No. 6,884,879 issued Feb. 26, 2005, the entire disclosure of which is expressly incorporated herein by reference. Additional preferred antibodies include the G6 or B20 series antibodies (e.g., G6-31, B20-4.1), as described in PCT Application Publication Nos. WO 2005/012359 and WO 2005/044853, which are each incorporated herein by reference in their entirety. For additional preferred antibodies see U.S. Pat. Nos.
  • Other preferred antibodies include those that bind to a functional epitope on human VEGF comprising of residues F17, M18, D19, Y21, Y25, Q89, 191, K101, E103, and C104 or, alternatively, comprising residues F17, Y21, Q22, Y25, D63, 183, and Q89.
  • Additional anti-VEGF antibodies include anti-VEGF antibodies described in PCT Application Publication No. WO 2009/155724.
  • the anti-VEGF antibody “ranibizumab” also known as “LUCENTIS®” or “rhuFab V2” is a humanized, affinity-matured anti-human VEGF Fab fragment.
  • Ranibizumab is produced by standard recombinant technology methods in Escherichia coli expression vector and bacterial fermentation. Ranibizumab is not glycosylated and has a molecular mass of ⁇ 48,000 daltons. See WO 98/45331 and US 2003/0190317.
  • chemotherapeutic agent is a chemical compound useful in the treatment of cancer.
  • examples of chemotherapeutic agents include alkylating agents such as thiotepa and cyclosphosphamide (CYTOXAN®); alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, triethylenephosphoramide, triethylenethiophosphoramide and trimethylomelamine; acetogenins (especially bullatacin and bullatacinone); delta-9-tetrahydrocannabinol (dronabinol, MARINOL®); beta-lapachone; lapachol; colchicines; betulinic acid; a camptothecin (including the synthetic analogue topotecan (HYCAMTIN®), C
  • celecoxib or etoricoxib proteosome inhibitor
  • proteosome inhibitor e.g. PS341
  • bortezomib VELCADE®
  • CCI-779 tipifarnib (R11577); orafenib, ABT510
  • Bcl-2 inhibitor such as oblimersen sodium (GENASENSE®)
  • pixantrone EGFR inhibitors
  • tyrosine kinase inhibitors serine-threonine kinase inhibitors
  • serine-threonine kinase inhibitors such as rapamycin (sirolimus, RAPAMUNE®
  • farnesyltransferase inhibitors such as lonafarnib (SCH 6636, SARASARTM)
  • pharmaceutically acceptable salts, acids or derivatives of any of the above as well as combinations of two or more of the above such as CHOP, an abbreviation for a combined therapy of cyclophosphamide, dox
  • Chemotherapeutic agents as defined herein include “anti-hormonal agents” or “endocrine therapeutics” which act to regulate, reduce, block, or inhibit the effects of hormones that can promote the growth of cancer. They may be hormones themselves, including, but not limited to: anti-estrogens with mixed agonist/antagonist profile, including, tamoxifen (NOLVADEX®), 4-hydroxytamoxifen, toremifene (FARESTON®), idoxifene, droloxifene, raloxifene (EVISTA®), trioxifene, keoxifene, and selective estrogen receptor modulators (SERMs) such as SERM3; pure anti-estrogens without agonist properties, such as fulvestrant (FASLODEX®), and EM800 (such agents may block estrogen receptor (ER) dimerization, inhibit DNA binding, increase ER turnover, and/or suppress ER levels); aromatase inhibitors, including steroidal aromatase inhibitors such as forme
  • cytotoxic agent refers to a substance that inhibits or prevents a cellular function and/or causes cell death or destruction.
  • Cytotoxic agents include, but are not limited to, radioactive isotopes (e.g., At 21 , I 131 , I 125 , Y 90 , Re 186 , Re 188 , Sm 153 , Bi 212 , P 32 , Pb 212 and radioactive isotopes of Lu); chemotherapeutic agents or drugs (e.g., methotrexate, adriamicin, vinca alkaloids (e.g., vincristine, vinblastine, etoposide), doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin or other intercalating agents); growth inhibitory agents; enzymes and fragments thereof such as nucleolytic enzymes; antibiotics; toxins such as small molecule toxins or enzymatically active toxins of
  • a “growth inhibitory agent” when used herein refers to a compound or composition which inhibits growth of a cell either in vitro or in vivo.
  • the growth inhibitory agent may be one which significantly reduces the percentage of cells in S phase.
  • growth inhibitory agents include agents that block cell cycle progression (at a place other than S phase), such as agents that induce G1 arrest and M-phase arrest.
  • Classical M-phase blockers include the vincas (e.g., vincristine and vinblastine), taxanes, and topoisomerase II inhibitors such as doxorubicin, epirubicin, daunorubicin, etoposide, and bleomycin.
  • DNA alkylating agents such as tamoxifen, prednisone, dacarbazine, mechlorethamine, cisplatin, methotrexate, 5-fluorouracil, and ara-C. Further information can be found in Mendelsohn et al. eds., The Molecular Basis of Cancer , Chapter 1, entitled “Cell cycle regulation, oncogenes, and antineoplastic drugs” by Murakami et al. (W.B. Saunders, Philadelphia, 1995), e.g., p. 13.
  • Taxanes are anticancer drugs both derived from the yew tree.
  • Docetaxel (TAXOTERE®), derived from the European yew, is a semisynthetic analogue of paclitaxel (TAXOL®). Paclitaxel and docetaxel promote the assembly of microtubules from tubulin dimers and stabilize microtubules by preventing depolymerization, which results in the inhibition of mitosis in cells.
  • isolated nucleic acid refers to a nucleic acid molecule that has been separated from a component of its natural environment.
  • An isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
  • control sequences refers to DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism.
  • the control sequences that are suitable for prokaryotes include a promoter, optionally an operator sequence, and a ribosome binding site.
  • Eukaryotic cells are known to utilize promoters, polyadenylation signals, and enhancers.
  • host cell refers to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells.
  • Host cells include “transformants” and “transformed cells,” which include the primary transformed cell and progeny derived therefrom without regard to the number of passages. Progeny may not be completely identical in nucleic acid content to a parent cell, but may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein.
  • the host cell may be an “isolated host cell,” which refers to a host cell that has been separated from a component of its natural environment.
  • Nucleic acid is “operably linked” when it is placed into a functional relationship with another nucleic acid sequence.
  • DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide;
  • a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or
  • a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation.
  • “operably linked” means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.
  • Percent (%) amino acid sequence identity with respect to the polypeptide sequences identified herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the polypeptide being compared, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared.
  • % amino acid sequence identity values are generated using the sequence comparison computer program ALIGN-2.
  • the ALIGN-2 sequence comparison computer program was authored by Genentech, Inc. and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087.
  • the ALIGN-2 program is publicly available through Genentech, Inc., South San Francisco, Calif.
  • the ALIGN-2 program should be compiled for use on a UNIX operating system, preferably digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
  • the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B is calculated as follows: 100 times the fraction X/Y where X is the number of amino acid residues scored as identical matches by the sequence alignment program ALIGN-2 in that program's alignment of A and B, and where Y is the total number of amino acid residues in B.
  • amino acid sequences described herein are contiguous amino acid sequences unless otherwise specified.
  • package insert is used to refer to instructions customarily included in commercial packages of therapeutic products, that contain information about the indications, usage, dosage, administration, combination therapy, contraindications and/or warnings concerning the use of such therapeutic products.
  • composition refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
  • a “pharmaceutically acceptable carrier” refers to an ingredient in a pharmaceutical formulation, other than an active ingredient, which is nontoxic to a subject.
  • a pharmaceutically acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer, or preservative.
  • prodrug refers to a precursor or derivative form of a pharmaceutically active substance that is less cytotoxic to tumor cells compared to the parent drug and is capable of being enzymatically activated or converted into the more active parent form. See, e.g., Wilman, “Prodrugs in Cancer Chemotherapy” Biochemical Society Transactions, 14, pp. 375-382, 615th Meeting Harbor (1986) and Stella et al. “Prodrugs: A Chemical Approach to Targeted Drug Delivery,” Directed Drug Delivery , Borchardt et al. (ed.), pp. 247-267, Humana Press (1985).
  • the prodrugs of this invention include, but are not limited to, phosphate-containing prodrugs, thiophosphate-containing prodrugs, sulfate-containing prodrugs, peptide-containing prodrugs, D-amino acid-modified prodrugs, glycosylated prodrugs, ⁇ -lactam-containing prodrugs, optionally substituted phenoxyacetamide-containing prodrugs or optionally substituted phenylacetamide-containing prodrugs, 5-fluorocytosine and other 5-fluorouridine prodrugs which can be converted into the more active cytotoxic free drug.
  • cytotoxic drugs that can be derivatized into a prodrug form for use in this invention include, but are not limited to, those chemotherapeutic agents described above.
  • Reduce or inhibit is meant the ability to cause an overall decrease preferably of 20% or greater, more preferably of 50% or greater, and most preferably of 75%, 85%, 90%, 95%, or greater. Reduce or inhibit can refer to the symptoms of the disorder being treated, the presence or size of metastases, and/or the size of the primary tumor.
  • a “subject” is a vertebrate, preferably a mammal, more preferably a human. Mammals include, but are not limited to, farm animals (such as cows, and sheep), sport animals, pets (such as cats, dogs and horses), primates (e.g., humans and non-human primates such as monkeys), and rodents (e.g., mice and rats).
  • farm animals such as cows, and sheep
  • sport animals such as cats, dogs and horses
  • primates e.g., humans and non-human primates such as monkeys
  • rodents e.g., mice and rats.
  • terapéuticaally effective amount refers to an amount of a compound (e.g., an anti-IL-33 antibody provided herein (including an antibody fragment, such an Fab fragment) or a nucleic acid encoding an anti-IL-33 antibody provided herein) or a composition (e.g., a pharmaceutical composition, e.g., a pharmaceutical composition including an anti-IL-33 antibody provided herein) to treat a disease or disorder in a subject.
  • a compound e.g., an anti-IL-33 antibody provided herein (including an antibody fragment, such an Fab fragment) or a nucleic acid encoding an anti-IL-33 antibody provided herein
  • a composition e.g., a pharmaceutical composition, e.g., a pharmaceutical composition including an anti-IL-33 antibody provided herein
  • the therapeutically effective amount of the antibody or antibody fragment may ameliorate or treat the disease, or prevent, reduce, ameliorate, or treat symptoms associated with the disease.
  • the therapeutically effective amount of the antibody or antibody fragment may reduce the number of cancer cells; reduce the primary tumor size; inhibit (i.e., slow to some extent and preferably stop) cancer cell infiltration into peripheral organs; inhibit (i.e., slow to some extent and preferably stop) tumor metastasis; inhibit, to some extent, tumor growth; and/or relieve to some extent one or more of the symptoms associated with the disorder.
  • the antibody or antibody fragment may prevent growth and/or kill existing cancer cells, it may be cytostatic and/or cytotoxic.
  • efficacy in vivo can, for example, be measured by assessing the duration of survival, time to disease progression (TTP), duration of disease free survival (DFS), duration of progression free survival (PFS), the response rates (RR), duration of response, and/or quality of life.
  • TTP time to disease progression
  • DFS duration of disease free survival
  • PFS duration of progression free survival
  • RR response rates
  • treatment refers to clinical intervention in an attempt to alter the natural course of the individual being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Desirable effects of treatment include, but are not limited to, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.
  • antibodies disclosed herein are used to delay development of a disease or to slow the progression of a disease.
  • a patient may be successfully “treated” for asthma if, for example, after receiving an asthma therapy, the patient shows observable and/or measurable reduction in or absence of one or more of the following: recurrent wheezing, coughing, trouble breathing, chest tightness, symptoms that occur or worsen at night, symptoms that are triggered by cold air, exercise or exposure to allergens.
  • Tumor refers to all neoplastic cell growth and proliferation, whether malignant or benign, and all pre-cancerous and cancerous cells and tissues.
  • vector is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
  • plasmid refers to a circular double stranded DNA loop into which additional DNA segments may be ligated.
  • phage vector Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome.
  • viral vector is capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
  • vectors e.g., non-episomal mammalian vectors
  • vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
  • certain vectors are capable of directing the expression of genes to which they are operatively linked.
  • Such vectors are referred to herein as “recombinant expression vectors” (or simply, “recombinant vectors” or “expression vectors”).
  • expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
  • plasmid and “vector” may be used interchangeably.
  • Turbidity refers to the cloudiness or haziness of a liquid due to suspended insoluble particles. Turbidity can be assessed by measuring the optical density (OD) of a liquid sample, e.g., using a spectrophotometer.
  • viscosity refers to a measure of a fluid's resistance to deformation at a given rate.
  • the SI unit of dynamic viscosity is the pascal-second (Pa ⁇ s), but is also commonly expressed as centipoise (cP), which is equal to one millipascal-second (mPa ⁇ s).
  • the invention is based, at least in part, on improved antibodies that bind to IL-33.
  • the antibodies provided herein have unexpectedly advantageous properties, including high stability (including under conditions of chemical and light stress) and reduced oxidation compared to existing anti-IL-33 antibodies.
  • the antibodies disclosed herein may lack a tryptophan residue in CDR-H3 that can result in decreased stability due to oxidation.
  • the antibodies provided herein also bind to human and cynomolgus monkey (cyno) IL-33 with high affinity and inhibitory activity, e.g., as assessed using surface plasmon resonance (SPR) and in cell-based blocking assays (e.g., using HEK-BLUETM cells), respectively.
  • SPR surface plasmon resonance
  • cell-based blocking assays e.g., using HEK-BLUETM cells
  • the antibodies provided herein have low viscosity at high protein concentrations and high solubility.
  • Antibodies disclosed herein are useful, e.g., for the treatment of IL-33-mediated disorders.
  • the unexpectedly favorable properties described above are particularly advantageous in the context of ocular administration, e.g., for treatment of ocular disorders (e.g., AMD (e.g., GA)).
  • targeted inhibition of IL-33 signaling in the eye may protect photoreceptors and RPE in the area bordering GA lesions, e.g., by limiting the influx of inflammatory mononuclear phagocytes.
  • an anti-IL-33 antibody that includes at least one, two, three, four, five, or six CDRs selected from: (a) CDR-H1 comprising the amino acid sequence of NYWMT (SEQ ID NO: 1); (b) CDR-H2 comprising the amino acid sequence of SITYTGGGTYYPDSVKG (SEQ ID NO: 2); (c) CDR-H3 comprising the amino acid sequence of ANYYYNTYGGFPY (SEQ ID NO: 3); (d) CDR-L1 comprising the amino acid sequence of LASEGFSNDLA (SEQ ID NO: 4); (e) CDR-L2 comprising the amino acid sequence of AASRLQD (SEQ ID NO: 5); and (f) CDR-L3 comprising the amino acid sequence of QQGSKYPLT (SEQ ID NO: 6), or a combination of one or more of the above CDRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 8
  • the anti-IL-33 antibody includes at least one, two, three, four, five, or six CDRs selected from: (a) CDR-H1 comprising the amino acid sequence of NYWMT (SEQ ID NO: 1); (b) CDR-H2 comprising the amino acid sequence of SITYTGGGTYYPDSVKG (SEQ ID NO: 2); (c) CDR-H3 comprising the amino acid sequence of ANYYYNTYGGFPY (SEQ ID NO: 3); (d) CDR-L1 comprising the amino acid sequence of LASEGFSNDLA (SEQ ID NO: 4); (e) CDR-L2 comprising the amino acid sequence of AASRLQD (SEQ ID NO: 5); and (f) CDR-L3 comprising the amino acid sequence of QQGSKYPLT (SEQ ID NO: 6).
  • CDR-H1 comprising the amino acid sequence of NYWMT (SEQ ID NO: 1
  • CDR-H2 comprising the amino acid sequence of SITYTGGGTYYPDSVKG (S
  • an anti-IL-33 antibody that includes (a) a VH domain comprising an amino acid sequence having at least 90% sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, the amino acid sequence of SEQ ID NO: 7; (b) a VL domain comprising an amino acid sequence having at least 90% sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, the amino acid sequence of SEQ ID NO: 8; or (c) a VH domain as in (a) and a VL domain as in (b).
  • a VH domain comprising an amino acid sequence having at least 90% sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, the amino
  • any of the anti-IL-33 antibodies provided herein may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVX 1 SGX 2 X 3 X 4 X 5 X 6 PGX 7 SX 8 X 9 X 10 SCX 11 ASGFTFN (SEQ ID NO: 9), wherein X 1 is E or Q; X 2 is G or A; X 3 is G or E; X 4 is L or V; X 5 is V or K; X 6 is Q or K; X 7 is G, A, or T; X 8 is L or V; X 9 is R or K; X 10 is L or V; and X 11 is A, K, or L; an FR-H2 comprising the amino acid sequence of WX 1 RQAPGX 2 GLEWX 3 X 4 (SEQ ID NO: 10), wherein X 1 is I or V; X 2 is K or Q; X 3 is V, M, or
  • the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WIRQAPGKGLEWVA (SEQ ID NO: 18); an FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 9
  • 80% sequence identity
  • the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WIRQAPGKGLEWVA (SEQ ID NO: 18); an FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
  • the VH domain comprises the amino acid sequence of SEQ ID NO: 7.
  • the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 39); an FR-H3 comprising the amino acid sequence of RFTISRDNAKNSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 40); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%,
  • 80% sequence identity
  • the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 39); an FR-H3 comprising the amino acid sequence of RFTISRDNAKNSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 40); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
  • the VH domain comprises the amino acid sequence of SEQ ID NO: 41.
  • the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WIRQAPGKGLEWIA (SEQ ID NO: 42); an FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%,
  • 80% sequence identity
  • the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WIRQAPGKGLEWIA (SEQ ID NO: 42); an FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
  • the VH domain comprises the amino acid sequence of SEQ ID NO: 43.
  • the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 39); an FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%,
  • 80% sequence identity
  • the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 39); an FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
  • the VH domain comprises the amino acid sequence of SEQ ID NO: 44.
  • the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 39); an FR-H3 comprising the amino acid sequence of RFTISRDDAKNSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 45); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%,
  • 80% sequence identity
  • the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 39); an FR-H3 comprising the amino acid sequence of RFTISRDDAKNSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 45); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
  • the VH domain comprises the amino acid sequence of SEQ ID NO: 46.
  • the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 39); an FR-H3 comprising the amino acid sequence of RFTISRDNAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 47); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%,
  • 80% sequence identity
  • the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 39); an FR-H3 comprising the amino acid sequence of RFTISRDNAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 47); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
  • the VH domain comprises the amino acid sequence of SEQ ID NO: 48.
  • the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWIA (SEQ ID NO: 49); an FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%,
  • 80% sequence identity
  • the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWIA (SEQ ID NO: 49); an FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
  • the VH domain comprises the amino acid sequence of SEQ ID NO: 50.
  • the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWIA (SEQ ID NO: 49); an FR-H3 comprising the amino acid sequence of RFTISRDDSKSTLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 51); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%,
  • 80% sequence identity
  • the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWIA (SEQ ID NO: 49); an FR-H3 comprising the amino acid sequence of RFTISRDDSKSTLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 51); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
  • the VH domain comprises the amino acid sequence of SEQ ID NO: 52.
  • any of the anti-IL-33 antibodies provided herein may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of X 1 IX 2 X 3 TQSPX 4 X 5 LSX 6 SX 7 GX 8 X 9 X 10 X 11 X 12 X 13 C (SEQ ID NO: 13), wherein X 1 is D or E; X 2 is Q or V; X 3 is M or L; X 4 is S or A; X 5 is S or T; X 6 is A or L; X 7 is V, P, or L; X 8 is D or E; X 9 is R or T; X 10 is V or A; X 11 is T or S; X 12 is I or L; and X 13 is T, S, or E; an FR-L2 comprising the amino acid sequence of WX 1 QQKX 2 GX 3 X 4 PX 5 X 6 LIY (SEQ ID NO: 14), wherein X
  • the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of X 1 IX 2 X 3 TQSPX 4 X 5 LSX 6 SX 7 GX 8 X 9 X 10 X 11 X 12 X 13 C (SEQ ID NO: 13), wherein X 1 is D or E; X 2 is Q or V; X 3 is M or L; X 4 is S or A; X 5 is S or T; X 6 is A or L; X 7 is V, P, or L; X 8 is D or E; X 9 is R or T; X 10 is V or A; X 11 is T or S; X 12 is I or L; and X 13 is T, S, or E; an FR-L2 comprising the amino acid sequence of WX 1 QQKX 2 GX 3 X 4 PX 5 X 6 LIY (SEQ ID NO: 14), wherein X 1 is D or E
  • the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); an FR-L2 comprising the amino acid sequence of WYQQKPGKSPKLLIY (SEQ ID NO: 22); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYFC (SEQ ID NO: 23); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%
  • the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); an FR-L2 comprising the amino acid sequence of WYQQKPGKSPKLLIY (SEQ ID NO: 22); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYFC (SEQ ID NO: 23); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24).
  • the VL domain comprises the amino acid sequence of SEQ ID NO: 8.
  • the anti-IL-33 antibody may include (a) CDR-H1 comprising the amino acid sequence of NYWMT (SEQ ID NO: 1); (b) CDR-H2 comprising the amino acid sequence of SITYTGGGTYYPDSVKG (SEQ ID NO: 2); (c) CDR-H3 comprising the amino acid sequence of ANYYYNTYGGFPY (SEQ ID NO: 3); (d) CDR-L1 comprising the amino acid sequence of LASEGFSNDLA (SEQ ID NO: 4); (e) CDR-L2 comprising the amino acid sequence of AASRLQD (SEQ ID NO: 5); and (f) CDR-L3 comprising the amino acid sequence of QQGSKYPLT (SEQ ID NO: 6).
  • the anti-IL-33 antibody comprises (a) a heavy chain variable (VH) domain comprising an amino acid sequence having at least 90% sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, SEQ ID NO: 7; (b) a light chain variable (VL) domain comprising an amino acid sequence having at least 90% sequence (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, SEQ ID NO: 8; or (c) a VH domain as in (a) and a VL domain as in (b).
  • VH heavy chain variable
  • VL light chain variable
  • the anti-IL-33 antibody includes the following heavy chain framework regions: FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); FR-H2 comprising the amino acid sequence of WIRQAPGKGLEWVA (SEQ ID NO: 18); FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
  • the anti-IL-33 antibody includes the following light chain framework regions: FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); FR-L2 comprising the amino acid sequence of WYQQKPGKSPKLLIY (SEQ ID NO: 22); FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYFC (SEQ ID NO: 23); and FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24).
  • the anti-IL-33 antibody includes a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 7 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 8.
  • the exemplary anti-IL-33 antibody is 1E1v8.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 7 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 8.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a heavy chain (HC) comprising an amino acid sequence of SEQ ID NO: 25 and (b) a light chain (LC) comprising an amino acid sequence of SEQ ID NO: 26.
  • HC heavy chain
  • LC light chain
  • the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); an FR-L2 comprising the amino acid sequence of WFQQKPGKAPKSLIY (SEQ ID NO: 53); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 54); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%,
  • 80% sequence identity
  • the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); an FR-L2 comprising the amino acid sequence of WFQQKPGKAPKSLIY (SEQ ID NO: 53); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 54); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24).
  • the VL domain comprises the amino acid sequence of SEQ ID NO: 55.
  • the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); an FR-L2 comprising the amino acid sequence of WYQQKPGKAPKSLIY (SEQ ID NO: 56); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYFC (SEQ ID NO: 23); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 9
  • 80% sequence identity
  • the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); an FR-L2 comprising the amino acid sequence of WYQQKPGKAPKSLIY (SEQ ID NO: 56); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYFC (SEQ ID NO: 23); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24).
  • the VL domain comprises the amino acid sequence of SEQ ID NO: 57.
  • the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); an FR-L2 comprising the amino acid sequence of WFQQKPGKAPKSLIY (SEQ ID NO: 53); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYFC (SEQ ID NO: 23); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 9
  • 80% sequence identity
  • the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); an FR-L2 comprising the amino acid sequence of WFQQKPGKAPKSLIY (SEQ ID NO: 53); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYFC (SEQ ID NO: 23); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24).
  • the VL domain comprises the amino acid sequence of SEQ ID NO: 58.
  • the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); an FR-L2 comprising the amino acid sequence of WYQQKPGKAPKSLIY (SEQ ID NO: 56); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 54); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%,
  • 80% sequence identity
  • the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); an FR-L2 comprising the amino acid sequence of WYQQKPGKAPKSLIY (SEQ ID NO: 56); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 54); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24).
  • the VL domain comprises the amino acid sequence of SEQ ID NO: 59.
  • the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); an FR-L2 comprising the amino acid sequence of WYQQKPGKSPKLLIY (SEQ ID NO: 22); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDVATYYC (SEQ ID NO: 60); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%,
  • 80% sequence identity
  • the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); an FR-L2 comprising the amino acid sequence of WYQQKPGKSPKLLIY (SEQ ID NO: 22); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDVATYYC (SEQ ID NO: 60); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24).
  • the VL domain comprises the amino acid sequence of SEQ ID NO: 61.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 41 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 55.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 43 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 55.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 41 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 8.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 43 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 8.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 44 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 8.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 46 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 8.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 48 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 8.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 43 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 57.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 44 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 57.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 46 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 57.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 48 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 57.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 50 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 57.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 43 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 58.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 44 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 58.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 46 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 58.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 48 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 58.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 50 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 58.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 43 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 59.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 44 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 59.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 46 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 59.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 48 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 59.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 50 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 59.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 52 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 61.
  • an anti-IL-33 antibody that includes (a) a VH domain comprising an amino acid sequence having at least 90% sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, the amino acid sequence of SEQ ID NO: 35; (b) a VL domain comprising an amino acid sequence having at least 90% sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, the amino acid sequence of SEQ ID NO: 36; or (c) a VH domain as in (a) and a VL domain as in (b).
  • a VH domain comprising an amino acid sequence having at least 90% sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, the amino
  • the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGTSLKLSCLASGFTFN (SEQ ID NO: 27); an FR-H2 comprising the amino acid sequence of WIRQAPGKGLEWIA (SEQ ID NO: 28); an FR-H3 comprising the amino acid sequence of RFTISRDDAKSTLYLQMNSLRSEDTATYYCTR (SEQ ID NO: 29); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%,
  • 80% sequence identity
  • the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGTSLKLSCLASGFTFN (SEQ ID NO: 27); an FR-H2 comprising the amino acid sequence of WIRQAPGKGLEWIA (SEQ ID NO: 28); an FR-H3 comprising the amino acid sequence of RFTISRDDAKSTLYLQMNSLRSEDTATYYCTR (SEQ ID NO: 29); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
  • the VH domain comprises the amino acid sequence of SEQ ID NO: 35.
  • the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPASLSASLGETVSIEC (SEQ ID NO: 31); an FR-L2 comprising the amino acid sequence of WYQQKSGKSPQLLIY (SEQ ID NO: 32); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTRFSLKISGMQPEDEADYFC (SEQ ID NO: 33); and an FR-L4 comprising the amino acid sequence of FGSGTKLEIK (SEQ ID NO: 34), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%
  • the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPASLSASLGETVSIEC (SEQ ID NO: 31); an FR-L2 comprising the amino acid sequence of WYQQKSGKSPQLLIY (SEQ ID NO: 32); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTRFSLKISGMQPEDEADYFC (SEQ ID NO: 33); and an FR-L4 comprising the amino acid sequence of FGSGTKLEIK (SEQ ID NO: 34).
  • the VL domain comprises the amino acid sequence of SEQ ID NO: 36.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 35 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 36.
  • an isolated antibody that specifically binds IL-33, wherein the antibody comprises (a) a heavy chain (HC) comprising an amino acid sequence of SEQ ID NO: 37 and (b) a light chain (LC) comprising an amino acid sequence of SEQ ID NO: 38.
  • HC heavy chain
  • LC light chain
  • an anti-IL-33 antibody that includes (a) a VH domain comprising an amino acid sequence having at least 90% sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, the amino acid sequence of SEQ ID NO: 65; (b) a VL domain comprising an amino acid sequence having at least 90% sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, the amino acid sequence of SEQ ID NO: 69; or (c) a VH domain as in (a) and a VL domain as in (b).
  • a VH domain comprising an amino acid sequence having at least 90% sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, the
  • the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVQSGAEVKKPGASVKVSCKASGFTFN (SEQ ID NO: 62); an FR-H2 comprising the amino acid sequence of WVRQAPGQGLEWMG (SEQ ID NO: 63); an FR-H3 comprising the amino acid sequence of RVTMTRDTSTSTVYMELSSLRSEDTAVYYCTR (SEQ ID NO: 64); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 9
  • FR-H1
  • the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVQSGAEVKKPGASVKVSCKASGFTFN (SEQ ID NO: 62); an FR-H2 comprising the amino acid sequence of WVRQAPGQGLEWMG (SEQ ID NO: 63); an FR-H3 comprising the amino acid sequence of RVTMTRDTSTSTVYMELSSLRSEDTAVYYCTR (SEQ ID NO: 64); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
  • the VH domain comprises the amino acid sequence of SEQ ID NO: 65.
  • the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of EIVLTQSPATLSLSPGERATLSC (SEQ ID NO: 66); an FR-L2 comprising the amino acid sequence of WYQQKPGQAPRLLIY (SEQ ID NO: 67); an FR-L3 comprising the amino acid sequence of GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC (SEQ ID NO: 68); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%,
  • the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of EIVLTQSPATLSLSPGERATLSC (SEQ ID NO: 66); an FR-L2 comprising the amino acid sequence of WYQQKPGQAPRLLIY (SEQ ID NO: 67); an FR-L3 comprising the amino acid sequence of GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC (SEQ ID NO: 68); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24).
  • the VL domain comprises the amino acid sequence of SEQ ID NO: 69.
  • an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 65 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 69.
  • any of the antibodies provided herein may specifically bind human or cynomolgus monkey (cyno) IL-33.
  • the antibody specifically binds both human and cyno IL-33.
  • an anti-IL-33 antibody provided herein specifically binds both human and cyno IL-33 with a K D of 100 nM or lower (e.g., 100 nM or lower, 10 nM or lower, 1 nM or lower, 100 pM or lower, 10 pM or lower, 1 pM or lower, or 0.1 pM or lower).
  • the antibody specifically binds human IL-33 with a K D of 1 nM or lower (e.g., 1 nm or lower, 100 pM or lower, 10 pM or lower, 1 pM or lower, or 0.1 pM or lower).
  • the antibody specifically binds human IL-33 with a K D between 100 fM and 1 nM.
  • the antibody specifically binds human IL-33 with a K D between 100 fM and 1 nM.
  • the antibody specifically binds human IL-33 with a K D between 750 fM and 300 pM.
  • the antibody specifically binds human IL-33 with a K D between 1 pM and 200 pM. In some instances, the antibody specifically binds human IL-33 with a K D of 118 pM. In other instances, the antibody specifically binds human IL-33 with a K D of 15 pM.
  • the antibody specifically binds cyno IL-33 with a K D of 1 nM or lower (e.g., 1 nm or lower, 100 pM or lower, 10 pM or lower, 1 pM or lower, or 0.1 pM or lower).
  • the antibody specifically binds cyno IL-33 with a K D between 100 fM and 1 nM.
  • the antibody specifically binds cyno IL-33 with a K D between 1 pM and 500 pM.
  • the antibody specifically binds cyno IL-33 with a K D between 20 pM and 50 pM.
  • the antibody specifically binds cyno IL-33 with a K D of 35 pM.
  • the antibody specifically binds both human and cyno IL-33 with a K D of 1 nM or lower (e.g., 1 nm or lower, 100 pM or lower, 10 pM or lower, 1 pM or lower, or 0.1 pM or lower).
  • the antibody specifically binds both human and cyno IL-33 with a K D of between 1 pM and 500 pM.
  • the antibody specifically binds both human and cyno IL-33 with a K D of between 10 pM and 40 pM.
  • the antibody specifically binds human IL-33 with a K D of between about 1 pM and about 1 nM (e.g., between about 1 pM and about 900 pM, between about 1 pM and about 800 pM, between about 1 pM and about 700 pM, between about 1 pM and about 600 pM, between about 1 pM and about 500 pM, between about 1 pM and about 400 pM, between about 1 pM and about 300 pM, between about 1 pM and about 200 pM, between about 1 pM and about 190 pM, between about 1 pM and about 180 pM, between about 1 pM and about 170 pM, between about 1 pM and about 160 pM, between about 1 pM and about 150 pM, between about 1 pM and about 140 pM, between about 1 pM and about 130 pM, between about 1 pM and about 120 pM, between about
  • the antibody specifically binds human IL-33 with a K D of between about 1 pM and about 250 pM (e.g., between about 1 pM and about 250 pM, between about 1 pM and about 225 pM, between about 1 pM and about 200 pM, between about 1 pM and about 190 pM, between about 1 pM and about 180 pM, between about 1 pM and about 170 pM, between about 1 pM and about 160 pM, between about 1 pM and about 150 pM, between about 1 pM and about 140 pM, between about 1 pM and about 130 pM, between about 1 pM and about 120 pM, between about 1 pM and about 110 pM, between about 1 pM and about 100 pM, between about 1 pM and about 90 pM, between about 1 pM and about 80 pM, between about 1 pM and about 70 pM, between about 1 pM and about
  • the antibody specifically binds human IL-33 with a K D of between about 50 pM and about 180 pM (e.g., about 50 pM, about 60 pM, about 70 pM, about 80 pM, about 90 pM, about 100 pM, about 110 pM, about 120 pM, about 130 pM, about 140 pM, about 150 pM, about 160 pM, or about 180 pM).
  • the antibody specifically binds human IL-33 with a K D of 118 pM.
  • the antibody specifically binds human IL-33 with a K D of 15 pM. Any of the preceding K D values may be determined by surface plasmon resonance, for example, as described herein (see, e.g., the Examples, including Examples 4, 6, and 7).
  • the antibody specifically binds human IL-33 with a K D of about 400 pM or lower at 25° C.
  • the antibody specifically binds human IL-33 with a K D of about 390 pM or lower, about 380 pM or lower, about 375 pM or lower, about 350 pM or lower, about 325 pM or lower, about 300 pM or lower, about 275 pM or lower, about 250 pM or lower, about 250 pM or lower, about 225 pM or lower, about 200 pM or lower, about 175 pM or lower, about 150 pM or lower, about 130 pM or lower, about 125 pM or lower, about 100 pM or lower, about 75 pM or lower, about 50 pM or lower, about 25 pM or lower, about 20 pM or lower at 25° C., about 15 pM or lower at 25° C., about 10 pM or lower at 25° C.
  • the antibody specifically binds human IL-33 with a K D of about 1 pM to about 150 pM (e.g., about 1 pM, about 5 pM, about 10 pM, about 15 pM, about 20 pM, about 30 pM, about 40 pM, about 50 pM, about 60 pM, about 70 pM, about 80 pM, about 90 pM, about 100 pM, about 110 pM, about 120 pM, about 130 pM, about 140 pM, or about 150 pM) at 25° C.
  • the antibody specifically binds human IL-33 with a K D of about 15 pM at 25° C.
  • the antibody may be a Fab fragment.
  • any of the preceding K D values may be determined by surface plasmon resonance, for example, as described herein (see, e.g., the Examples, including Examples 4, 6, and 7).
  • the antibody specifically binds human IL-33 with a K D of about 400 pM or lower at 37° C.
  • the antibody specifically binds human IL-33 with a K D of about 390 pM or lower, about 380 pM or lower, about 375 pM or lower, about 350 pM or lower, about 325 pM or lower, about 300 pM or lower, about 275 pM or lower, about 250 pM or lower, about 250 pM or lower, about 225 pM or lower, about 200 pM or lower, about 175 pM or lower, about 150 pM or lower, about 130 pM or lower, about 125 pM or lower, about 100 pM or lower, about 75 pM or lower, about 50 pM or lower, about 25 pM or lower, about 20 pM or lower, about 15 pM or lower, about 10 pM or lower, or about 5 pM or lower at 37° C.
  • the antibody specifically binds human IL-33 with a K D of about 1 pM to about 150 pM (e.g., about 1 pM, about 5 pM, about 10 pM, about 15 pM, about 20 pM, about 30 pM, about 40 pM, about 50 pM, about 60 pM, about 70 pM, about 80 pM, about 90 pM, about 100 pM, about 110 pM, about 120 pM, about 130 pM, about 140 pM, or about 150 pM) at 37° C.
  • the antibody specifically binds human IL-33 with a K D of about 15 pM at 37° C.
  • the antibody may be a Fab fragment.
  • any of the preceding K D values may be determined by surface plasmon resonance, for example, as described herein (see, e.g., the Examples, including Examples 4, 6, and 7).
  • the antibody specifically binds cyno IL-33 with a K D of between about 1 pM and about 1 nM (e.g., between about 1 pM and about 900 pM, between about 1 pM and about 800 pM, between about 1 pM and about 700 pM, between about 1 pM and about 600 pM, between about 1 pM and about 500 pM, between about 1 pM and about 400 pM, between about 1 pM and about 300 pM, between about 1 pM and about 200 pM, between about 1 pM and about 190 pM, between about 1 pM and about 180 pM, between about 1 pM and about 170 pM, between about 1 pM and about 160 pM, between about 1 pM and about 150 pM, between about 1 pM and about 140 pM, between about 1 pM and about 130 pM, between about 1 pM and about 120 pM, between about 1
  • the antibody specifically binds cyno IL-33 with a K D of between about 100 pM and about 750 pM (e.g., between about 100 pM and about 750 pM, between about 200 pM and about 750 pM, between about 225 pM and about 750 pM, between about 250 pM and about 750 pM, between about 265 pM and about 750 pM, between about 275 pM and about 750 pM, between about 300 pM and about 750 pM, between about 325 pM and about 750 pM, between about 350 pM and about 750 pM, between about 375 pM and about 750 pM, between about 400 pM and about 750 pM, between about 425 pM and about 750 pM, between about 450 pM and about 750 pM, between about 475 pM and about 750 pM, between about 500 pM and about 750
  • the antibody specifically binds cyno IL-33 with a K D of about 400 pM or lower at 25° C.
  • the antibody specifically binds cyno IL-33 with a K D of about 390 pM or lower, about 380 pM or lower, about 375 pM or lower, about 350 pM or lower, about 325 pM or lower, about 300 pM or lower, about 275 pM or lower, about 250 pM or lower, about 250 pM or lower, about 225 pM or lower, about 200 pM or lower, about 175 pM or lower, about 150 pM or lower, about 130 pM or lower, about 125 pM or lower, about 100 pM or lower, about 75 pM or lower, about 50 pM or lower, about 25 pM or lower, about 20 pM or lower at 25° C., about 15 pM or lower at 25° C., about 10 p
  • the antibody specifically binds cyno IL-33 with a K D of about 1 pM to about 150 pM (e.g., about 1 pM, about 5 pM, about 10 pM, about 15 pM, about 20 pM, about 30 pM, about 40 pM, about 50 pM, about 60 pM, about 70 pM, about 80 pM, about 90 pM, about 100 pM, about 110 pM, about 120 pM, about 130 pM, about 140 pM, or about 150 pM) at 25° C.
  • the antibody specifically binds cyno IL-33 with a K D of about 22 pM at 25° C.
  • the antibody may be a Fab fragment.
  • any of the preceding K D values may be determined by surface plasmon resonance, for example, as described herein (see, e.g., the Examples, including Examples 4, 6, and 7).
  • the antibody specifically binds cyno IL-33 with a K D of about 400 pM or lower at 37° C.
  • the antibody specifically binds cyno IL-33 with a K D of about 390 pM or lower, about 380 pM or lower, about 375 pM or lower, about 350 pM or lower, about 325 pM or lower, about 300 pM or lower, about 275 pM or lower, about 250 pM or lower, about 250 pM or lower, about 225 pM or lower, about 200 pM or lower, about 175 pM or lower, about 150 pM or lower, about 130 pM or lower, about 125 pM or lower, about 100 pM or lower, about 75 pM or lower, about 50 pM or lower, about 25 pM or lower, about 20 pM or lower, about 15 pM or lower, about 10 pM or lower, or about 5 pM
  • the antibody specifically binds cyno IL-33 with a K D of about 1 pM to about 150 pM (e.g., about 1 pM, about 5 pM, about 10 pM, about 15 pM, about 20 pM, about 30 pM, about 40 pM, about 50 pM, about 60 pM, about 70 pM, about 80 pM, about 90 pM, about 100 pM, about 110 pM, about 120 pM, about 130 pM, about 140 pM, or about 150 pM) at 37° C.
  • the antibody specifically binds cyno IL-33 with a K D of about 34 pM at 37° C.
  • the antibody may be a Fab fragment.
  • any of the preceding K D values may be determined by surface plasmon resonance, for example, as described herein (see, e.g., the Examples, including Examples 4, 6, and 7).
  • an anti-IL-33 antibody provided herein is capable of inhibiting the binding of IL-33 to an IL-33 receptor. In some instances, the inhibiting is measured using a cell-based blocking assay. In some instances, the antibody inhibits the binding of human IL-33 to an IL-33 receptor with a half-maximal inhibitory concentration (IC50) of between about 750 fM and about 250 pM (e.g., between about 750 fM and about 250 pM, between about 1 pM and about 250 pM, between about 1 pM and about 100 pM, between about 1 pM and about 50 pM, between about 1 pM and about 10 pM, or between about 1 pM and about 5 pM).
  • IC50 half-maximal inhibitory concentration
  • the antibody inhibits the binding of human IL-33 to an IL-33 receptor with an IC50 of about 50 pM or below (e.g., about 50 pM or below, about 40 pM or below, about 30 pM or below, about 20 pM or below, about 15 pM or below, about 10 pM or below, about 9 pM or below, about 8 pM or below, about 7 pM or below, about 6 pM or below, about 5 pM or below, about 4 pM or below, about 3 pM or below, about 2.5 pM or below, about 2 pM or below, about 1 pM or below, about 900 fM or below, about 800 fM or below, or about 750 fM or below).
  • an IC50 of about 50 pM or below e.g., about 50 pM or below, about 40 pM or below, about 30 pM or below, about 20 pM or below, about 15 pM or below, about
  • the antibody inhibits the binding of human IL-33 to an IL-33 receptor with an IC50 of between about 1 pM and about 50 pM. In some instances, the antibody inhibits the binding of human IL-33 to an IL-33 receptor with an IC50 of about 31 pM. In some instances, the inhibiting is measured using a cell-based blocking assay using HEK-BLUETM cells, for example, as described herein (see, e.g., the Examples, including Examples 3 and 6).
  • the antibody inhibits the binding of cyno IL-33 to an IL-33 receptor with an IC50 of between about 1 nM and about 10 nM (e.g., between about 1 nM and about 10 nM, between about 1 nM and about 9 nM, between about 1 nM and about 8 nM, between about 1 nM and about 7 nM, between about 1 nM and about 6 nM, between about 1 nM and about 5 nM, between about 1 nM and about 4 nM, or between about 1 nM and about 3 nM).
  • the inhibiting is measured using a cell-based blocking assay using HEK-BLUETM cells, for example, as described herein (see, e.g., the Examples, including Examples 3 and 6).
  • any of the antibodies provided herein may have a viscosity of less than about 10 centipoise (cP), e.g., at a concentration of about 100 mg/mL, about 110 mg/mL, about 120 mg/mL, about 130 mg/mL, about 140 mg/mL, about 150 mg/mL, about 160 mg/mL, about 170 mg/mL, about 180 mg/mL, about 190 mg/mL, about 200 mg/mL, about 210 mg/mL, about 220 mg/mL, about 230 mg/mL, about 240 mg/mL, about 250 mg/mL, about 260 mg/mL, about 270 mg/mL, about 280 mg/mL, about 290 mg/mL, about 300 mg/mL, about 310 mg/mL, about 320 mg/mL, about 330 mg/mL, about 340 mg/mL, about 350 mg/mL, about 360 mg/mL, about 370 mg/mL, about
  • the antibody has a viscosity of less than about 10 cP, less than about 9.5 cP, less than about 9 cP, less than about 8.5 cP, less than about 8 cP, less than about 7.5 cP, less than about 7 cP, less than about 6.5 cP, less than about 6 cP, less than about 5.5 cP, less than about 5 cP, less than about 4.5 cP, less than about 4 cP, less than about 3.5 cP, less than about 3 cP, less than about 2.5 cP, less than about 2 cP, less than about 1.5 cP, less than about 1 cP, or less than about 0.5 cP, e.g., at a concentration of about 100 mg/mL, about 110 mg/mL, about 120 mg/mL, about 130 mg/mL, about 140 mg/mL, about 150 mg/mL, about 160 mg/mL, about 170 mg/mL, about
  • the antibody has a viscosity of less than about 10 cP, less than about 9.5 cP, less than about 9 cP, less than about 8.5 cP, less than about 8 cP, less than about 7.5 cP, less than about 7 cP, less than about 6.5 cP, less than about 6 cP, less than about 5.5 cP, less than about 5 cP, less than about 4.5 cP, less than about 4 cP, less than about 3.5 cP, less than about 3 cP, less than about 2.5 cP, less than about 2 cP, less than about 1.5 cP, less than about 1 cP, or less than about 0.5 cP, e.g., at a concentration of about 180 mg/mL.
  • an antibody provided herein may have a viscosity of less than about 5 cP, e.g., at a concentration of about 100 mg/mL or higher (e.g., about 100 mg/mL, about 110 mg/mL, about 120 mg/mL, about 130 mg/mL, about 140 mg/mL, about 150 mg/mL, about 160 mg/mL, about 170 mg/mL, about 180 mg/mL, about 190 mg/mL, about 200 mg/mL, about 210 mg/mL, about 220 mg/mL, about 230 mg/mL, about 240 mg/mL, about 250 mg/mL, about 260 mg/mL, about 270 mg/mL, about 280 mg/mL, about 290 mg/mL, about 300 mg/mL, about 310 mg/mL, about 320 mg/mL, about 330 mg/mL, about 340 mg/mL, about 350 mg/mL, about 360 mg/m
  • the antibody has a viscosity of between about 0.5 cP and about 5 cP, between about 0.5 cP and about 4.5 cP, between about 0.5 cP and about 4 cP, between about 0.5 cP and about 3.5 cP, between about 0.5 cP and about 3 cP, between about 0.5 cP and about 2.5 cP, between about 0.5 cP and about 2 cP, between about 0.5 cP and about 1.5 cP, between about 0.5 cP and about 1 cP, between about 1 cP and about 5 cP, between about 1 cP and about 4.5 cP, between about 1 cP and about 4 cP, between about 1 cP and about 3.5 cP, between about 1 cP and about 3 cP, between about 1 cP and about 2.5 cP, between about 1 cP and about 2 cP, between about 1 cP and about 1.5 cP, between about 1.5 cP and
  • the antibody has a viscosity of between about 0.5 cP and about 5 cP, between about 0.5 cP and about 4.5 cP, between about 0.5 cP and about 4 cP, between about 0.5 cP and about 3.5 cP, between about 0.5 cP and about 3 cP, between about 0.5 cP and about 2.5 cP, between about 0.5 cP and about 2 cP, between about 0.5 cP and about 1.5 cP, between about 0.5 cP and about 1 cP, between about 1 cP and about 5 cP, between about 1 cP and about 4.5 cP, between about 1 cP and about 4 cP, between about 1 cP and about 3.5 cP, between about 1 cP and about 3 cP, between about 1 cP and about 2.5 cP, between about 1 cP and about 2 cP, between about 1 cP and about 1.5 cP, between about 1.5 cP and
  • the antibody may have a viscosity of about 4.6 cP at a concentration of about 180 mg/mL.
  • any of the antibodies provided herein may have a turbidity (OD) of about 1 or lower, e.g., at a concentration of about 100 mg/mL or higher (e.g., about 100 mg/mL or higher, about 110 mg/mL or higher, about 120 mg/mL or higher, about 130 mg/mL or higher, about 140 mg/mL or higher, about 140 mg/mL or higher, about 150 mg/mL or higher, about 160 mg/mL or higher, about 170 mg/mL or higher, about 180 mg/mL or higher, about 190 mg/mL or higher, about 200 mg/mL or higher, about 210 mg/mL or higher, about 220 mg/mL or higher, about 230 mg/mL or higher, about 240 mg/mL or higher, about 250 mg/mL or higher, about 260 mg/mL or higher, about 270 mg/mL or higher, about 280 mg/mL or higher, about 290 mg/mL or higher, about 300 mg/mL
  • any of the antibodies provided herein may have a turbidity (optical density (OD)) of about 0.5 or lower, about 0.45 or lower, about 0.4 or lower, about 0.35 or lower, about 0.3 or lower, about 0.25 or lower, about 0.2 or lower, about 0.15 or lower, about 0.1 or lower, or about 0.05 or lower, e.g., at a concentration of about 100 mg/mL or higher (e.g., about 100 mg/mL or higher, about 110 mg/mL or higher, about 120 mg/mL or higher, about 130 mg/mL or higher, about 140 mg/mL or higher, about 140 mg/mL or higher, about 140 mg/mL or higher, about 150 mg/mL or higher, about 160 mg/mL or higher, about 170 mg/mL or higher, about 180 mg/mL or higher, about 190 mg/mL or higher, about 200 mg/mL or higher, about 210 mg/mL or higher, about 220 mg/mL or higher, about 230 mg/
  • any of the antibodies provided herein may have a turbidity (OD) of between about 0.05 and about 0.5, between about 0.1 and about 0.5, between about 0.15 and about 0.5, between about 0.2 and about 0.5, between about 0.25 and about 0.5, between about 0.3 and about 0.5, between about 0.35 and about 0.5, between about 0.4 and about 0.5, between about 0.45 and about 0.5, between about 0.05 and about 0.45, between about 0.1 and about 0.45, between about 0.15 and about 0.45, between about 0.2 and about 0.45, between about 0.25 and about 0.45, between about 0.3 and about 0.45, between about 0.35 and about 0.45, between about 0.4 and about 0.45, between about 0.05 and about 0.4, between about 0.1 and about 0.4, between about 0.15 and about 0.4, between about 0.2 and about 0.4, between about 0.25 and about 0.4, between about 0.3 and about 0.4, between about 0.35 and about 0.4, between about 0.05 and about 0.45, between about 0.05 and about 0.4, between
  • any of the antibodies provided herein may have a turbidity (OD) of between about 0.05 and about 0.5, between about 0.1 and about 0.5, between about 0.15 and about 0.5, between about 0.2 and about 0.5, between about 0.25 and about 0.5, between about 0.3 and about 0.5, between about 0.35 and about 0.5, between about 0.4 and about 0.5, between about 0.45 and about 0.5, between about 0.05 and about 0.45, between about 0.1 and about 0.45, between about 0.15 and about 0.45, between about 0.2 and about 0.45, between about 0.25 and about 0.45, between about 0.3 and about 0.45, between about 0.35 and about 0.45, between about 0.4 and about 0.45, between about 0.05 and about 0.4, between about 0.1 and about 0.4, between about 0.15 and about 0.4, between about 0.2 and about 0.4, between about 0.25 and about 0.4, between about 0.3 and about 0.4, between about 0.35 and about 0.4, between about 0.05 and about 0.45, between about 0.05 and about 0.4, between
  • any of the antibodies provided herein may have a turbidity (OD) of between about 0.25 and about 0.5 at a concentration of about 150 mg/mL to about 250 mg/mL.
  • the antibody has a turbidity (OD) of about 0.38 at a concentration of about 200 mg/mL.
  • any of the anti-IL-33 antibodies described herein may have one or more (e.g., 1, 2, 3, 4, or 5) of the following features: (i) the antibody specifically binds human IL-33 with a K D of between about 1 pM and about 200 pM; (ii) the antibody specifically binds cyno IL-33 with a K D of between about 1 pM and about 200 pM; (iii) the antibody inhibits the binding of human IL-33 to an IL-33 receptor (e.g., ST2 and/or IL-1RAcP) with an IC50 of between about 1 pM and about 250 pM, for example, in a cell-based blocking assay using HEK-BLUETM cells; (iv) the antibody has a viscosity of between about 3 cP and about 5 cP at a concentration of about 180 mg/mL; and/or (v) the antibody has a tur
  • any of the anti-IL-33 antibodies described herein may have one of the preceding features. In some instances, any of the anti-IL-33 antibodies described herein may have two of the preceding features. In some instances, any of the anti-IL-33 antibodies described herein may have three of the preceding features. In some instances, any of the anti-IL-33 antibodies described herein may have four of the preceding features. In some instances, any of the anti-IL-33 antibodies described herein may have all five of the preceding features.
  • anti-IL-33 antibodies may be a monoclonal antibody, including a chimeric, humanized, or human antibody.
  • any of the anti-IL-33 antibodies provided herein may be an antibody fragment, e.g., a Fv, Fab, Fab′, scFv, diabody, or F(ab′) 2 fragment.
  • the antibody fragment is an Fab fragment.
  • any of the anti-IL-33 antibodies provided herein may be a full-length antibody, e.g., an intact IgG1 antibody, an intact IgG4 antibody, or other antibody class or isotype as defined herein.
  • the antibody is an IgG4 antibody that comprises a mutation in the hinge region.
  • the mutation is a substitution mutation.
  • the substitution mutation is at amino acid residue S228 (EU numbering).
  • the substitution mutation is an S228P mutation.
  • any of the anti-IL-33 antibodies provided herein may be a monospecific antibody.
  • any of the anti-IL-33 antibodies provided herein may be a multispecific antibody (e.g., a bispecific antibody).
  • the bispecific antibody comprises a second binding domain that binds to a second biological molecule, wherein the second biological molecule is interleukin-13 (IL-13), interleukin-4 (IL-4), interleukin-5 (IL-5), interleukin-17 (IL-17), Factor D, HtrA1, VEGF, or a VEGF receptor.
  • any of the anti-IL-33 antibodies disclosed herein may incorporate any of the features, singly or in combination, as described in Sections 1-7 below:
  • an antibody provided herein has a dissociation constant (K D ) of ⁇ 1 ⁇ M, ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, ⁇ 1 pM, or ⁇ 0.1 pM (e.g., 10 ⁇ 6 M or less, e.g., from 10 ⁇ 6 M to 10 ⁇ 9 M or less, e.g., from 10 ⁇ 9 M to 10 ⁇ 13 M or less).
  • K D dissociation constant
  • K D is measured by a radiolabeled antigen binding assay (RIA).
  • RIA radiolabeled antigen binding assay
  • an RIA is performed with the Fab version of an antibody of interest and its antigen.
  • solution binding affinity of Fabs for antigen is measured by equilibrating Fab with a minimal concentration of ( 125 I)-labeled antigen in the presence of a titration series of unlabeled antigen, then capturing bound antigen with an anti-Fab antibody-coated plate (see, e.g., Chen et al. J. Mol. Biol. 293:865-881, 1999).
  • MICROTITER® multi-well plates (Thermo Scientific) are coated overnight with 5 pg/mL of a capturing anti-Fab antibody (Cappel Labs) in 50 mM sodium carbonate (pH 9.6), and subsequently blocked with 2% (w/v) bovine serum albumin in PBS for two to five hours at room temperature (approximately 23° C.).
  • a non-adsorbent plate NUNCTM #269620
  • 100 pM or 26 pM [ 125 I]-antigen are mixed with serial dilutions of a Fab of interest (e.g., consistent with assessment of the anti-VEGF antibody, Fab-12, in Presta et al. Cancer Res.
  • the Fab of interest is then incubated overnight; however, the incubation may continue for a longer period (e.g., about 65 hours) to ensure that equilibrium is reached. Thereafter, the mixtures are transferred to the capture plate for incubation at room temperature (e.g., for one hour). The solution is then removed and the plate washed eight times with 0.1% polysorbate 20 (TWEEN®-20) in PBS. When the plates have dried, 150 ⁇ L/well of scintillant (MICROSCINT-20TM; Packard) is added, and the plates are counted on a TOPCOUNTTM gamma counter (Packard) for ten minutes. Concentrations of each Fab that give less than or equal to 20% of maximal binding are chosen for use in competitive binding assays.
  • K D is measured using a BIACORE® surface plasmon resonance assay.
  • a BIACORE®-2000 or a BIACORE®-3000 (BIAcore, Inc.) is performed at 25° C. with immobilized antigen CM5 chips at ⁇ 10 response units (RU).
  • CM5 chips ⁇ 10 response units
  • RU response units
  • carboxymethylated dextran biosensor chips CM5, BIACORE, Inc.
  • EDC N-ethyl-N′-(3-dimethylaminopropyl)-carbodiimide hydrochloride
  • NHS N-hydroxysuccinimide
  • Antigen is diluted with 10 mM sodium acetate, pH 4.8, to 5 ⁇ g/ml ( ⁇ 0.2 ⁇ M) before injection at a flow rate of 5 ⁇ L/minute to achieve approximately 10 response units (RU) of coupled protein.
  • 1 M ethanolamine is injected to block unreacted groups.
  • two-fold serial dilutions of Fab (0.78 nM to 500 nM) are injected in phosphate buffered saline (PBS) with 0.05% polysorbate 20 (TWEEN®-20) surfactant (PBST) at 25° C. at a flow rate of approximately 25 ⁇ L/min.
  • association rates (k on ) and dissociation rates (k off ) are calculated using a simple one-to-one Langmuir binding model (BIACORE® Evaluation Software version 3.2) by simultaneously fitting the association and dissociation sensorgrams.
  • the equilibrium dissociation constant (K D ) is calculated as the ratio k off /k on . See, for example, Chen et al. ( J. Mol. Biol. 293:865-881, 1999).
  • any of the antibodies provided herein may be an antibody fragment (e.g., an antigen-binding (e.g., IL-33-binding) antibody fragment).
  • Antibody fragments include, but are not limited to, Fab, Fab′, Fab′-SH, F(ab′) 2 , Fv, and scFv fragments, and other fragments described below.
  • the antibody fragment is an Fab.
  • Fab fragment antigen-binding
  • Fab′ fragment antigen-binding
  • Diabodies are antibody fragments with two antigen-binding sites that may be bivalent or bispecific. See, for example, EP 404,097; WO 1993/01161; Hudson et al. Nat. Med. 9:129-134, 2003; and Hollinger et al. Proc. Nat. Acad. Sci. USA 90: 6444-6448, 1993. Triabodies and tetrabodies are also described in Hudson et al. Nat. Med. 9:129-134, 2003.
  • Single-domain antibodies are antibody fragments comprising all or a portion of the heavy chain variable domain or all or a portion of the light chain variable domain of an antibody.
  • a single-domain antibody is a human single-domain antibody (see, e.g., U.S. Pat. No. 6,248,516 B1).
  • Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant host cells (e.g., E. coli or phage), as described herein.
  • recombinant host cells e.g., E. coli or phage
  • an antibody provided herein is a chimeric antibody.
  • Certain chimeric antibodies are described, e.g., in U.S. Pat. No. 4,816,567; and Morrison et al. Proc. Nat. Acad. Sci. USA, 81:6851-6855, 1984).
  • a chimeric antibody comprises a non-human variable region (e.g., a variable region derived from a mouse, rat, hamster, rabbit, or non-human primate, such as a monkey) and a human constant region.
  • a chimeric antibody is a “class switched” antibody in which the class or subclass has been changed from that of the parent antibody. Chimeric antibodies include antigen-binding fragments thereof.
  • a chimeric antibody is a humanized antibody.
  • a non-human antibody is humanized to reduce immunogenicity to humans, while retaining the specificity and affinity of the parental non-human antibody.
  • a humanized antibody comprises one or more variable domains in which HVRs (or portions thereof) are derived from a non-human antibody, and FRs (or portions thereof) are derived from human antibody sequences.
  • a humanized antibody optionally will also comprise at least a portion of a human constant region.
  • some FR residues in a humanized antibody are substituted with corresponding residues from a non-human antibody (e.g., the antibody from which the HVR residues are derived), for example, to restore or improve antibody specificity or affinity.
  • Human framework regions that may be used for humanization include but are not limited to: framework regions selected using the “best-fit” method (see, e.g., Sims et al. J. Immunol. 151:2296, 1993); framework regions derived from the consensus sequence of human antibodies of a particular subgroup of light or heavy chain variable regions (see, e.g., Carter et al. Proc. Nat. Acad. Sci. USA, 89:4285, 1992; and Presta et al. J. Immunol., 151:2623, 1993); human mature (somatically mutated) framework regions or human germline framework regions (see, e.g., Almagro et al. Front. Biosci.
  • an antibody provided herein is a human antibody.
  • Human antibodies can be produced using various techniques known in the art. Human antibodies are described generally in van Dijk et al. Curr. Opin. Pharmacol. 5:368-74, 2001 and Lonberg, Curr. Opin. Immunol. 20:450-459, 2008.
  • Human antibodies may be prepared by administering an immunogen to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge.
  • Such animals typically contain all or a portion of the human immunoglobulin loci, which replace the endogenous immunoglobulin loci, or which are present extrachromosomally or integrated randomly into the animal's chromosomes.
  • the endogenous immunoglobulin loci have generally been inactivated.
  • Human antibodies can also be made by hybridoma-based methods. Human myeloma and mouse-human heteromyeloma cell lines for the production of human monoclonal antibodies have been described. (See, e.g., Kozbor J. Immunol. 133:3001, 1984; Brodeur et al. Monoclonal Antibody Production Techniques and Applications , pp. 51-63 (Marcel Dekker, Inc., New York, 1987); and Boerner et al. J. Immunol. 147: 86, 1991). Human antibodies generated via human B-cell hybridoma technology are also described in Li et al. Proc. Natl. Acad. Sci. USA, 103:3557-3562, 2006.
  • Additional methods include those described, for example, in U.S. Pat. No. 7,189,826 (describing production of monoclonal human IgM antibodies from hybridoma cell lines) and Ni, Xiandai Mianyixue, 26(4):265-268, 2006 (describing human-human hybridomas).
  • Human hybridoma technology Trioma technology
  • Human antibodies may also be generated by isolating Fv clone variable domain sequences selected from human-derived phage display libraries. Such variable domain sequences may then be combined with a desired human constant domain. Techniques for selecting human antibodies from antibody libraries are described below.
  • Antibodies disclosed herein may be isolated by screening combinatorial libraries for antibodies with the desired activity or activities. For example, a variety of methods are known in the art for generating phage display libraries and screening such libraries for antibodies possessing the desired binding characteristics. Such methods are reviewed, e.g., in Hoogenboom et al. in Methods in Molecular Biology 178:1-37 (O'Brien et al., ed., Human Press, Totowa, N.J., 2001) and further described, e.g., in the McCafferty et al. Nature 348:552-554, 1990; Clackson et al. Nature 352: 624-628, 1991; Marks et al. J. Mol. Biol.
  • repertoires of VH and VL genes are separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be screened for antigen-binding phage as described in Winter et al. Ann. Rev. Immunol., 12: 433-455, 1994.
  • Phage typically display antibody fragments, either as single-chain Fv (scFv) fragments or as Fab fragments.
  • naive repertoire can be cloned (e.g., from human) to provide a single source of antibodies to a wide range of non-self and also self antigens without any immunization as described by Griffiths et al. EMBO J. 12: 725-734, 1993.
  • naive libraries can also be made synthetically by cloning unrearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable HVR3 regions and to accomplish rearrangement in vitro, as described by Hoogenboom et al. J. Mol. Biol., 227: 381-388, 1992.
  • Patent publications describing human antibody phage libraries include, for example: U.S. Pat. No. 5,750,373, and US Patent Publication Nos. 2005/0079574, 2005/0119455, 2005/0266000, 2007/0117126, 2007/0160598, 2007/0237764, 2007/0292936, and 2009/0002360.
  • Antibodies or antibody fragments isolated from human antibody libraries are considered human antibodies or human antibody fragments herein.
  • an antibody provided herein is a multispecific antibody, for example, a bispecific antibody.
  • Multispecific antibodies are monoclonal antibodies that have binding specificities for at least two different sites.
  • bispecific antibodies may bind to two different epitopes of IL-33.
  • one of the binding specificities is for IL-33 and the other is for any other antigen (e.g., a second biological molecule, e.g., IL-13, IL-4, IL-5, IL-17, Factor D, HtrA1, VEGF, or a VEGF receptor).
  • a second biological molecule e.g., IL-13, IL-4, IL-5, IL-17, Factor D, HtrA1, VEGF, or a VEGF receptor.
  • the bispecific antibody may have binding specificity for IL-33 and IL-13; IL-33 and IL-4; IL-33 and IL-5; IL-33 and IL-17; IL-33 and Factor D; IL-33 and HtrA1; IL-33 and VEGF; or IL-33 and a VEGF receptor (e.g., VEGFR1, VEGFR2, VEGFR3, membrane-bound VEGF receptor (mbVEGFR), or soluble VEGF receptor (sVEGFR)).
  • the bispecific antibody may have binding specificity for IL-33 and Factor D.
  • the bispecific antibody may have binding specificity for IL-33 and HtrA1.
  • the bispecific antibody may have binding specificity for IL-33 and VEGF. In other instances, the bispecific antibody may have binding specificity for IL-33 and a VEGF receptor. In particular, the bispecific antibody may have binding specificity for IL-33 and IL-13. Bispecific antibodies can be prepared as full-length antibodies or antibody fragments.
  • Multispecific antibodies include, but are not limited to, recombinant co-expression of two immunoglobulin heavy chain-light chain pairs having different specificities (see Milstein et al. Nature 305: 537, 1983; WO 93/08829; and Traunecker et al. EMBO J. 10: 3655, 1991), and “knob-in-hole” engineering (see, e.g., U.S. Pat. No. 5,731,168).
  • Multi-specific antibodies may also be made by engineering electrostatic steering effects for making antibody Fc-heterodimeric molecules (WO 2009/089004A1); cross-linking two or more antibodies or fragments (see, e.g., U.S. Pat. No.
  • the antibody or fragment herein also includes a “Dual Acting Fab” or “DAF” comprising an antigen binding site that binds to IL-33 as well as another, different antigen (see, US 2008/0069820, for example).
  • knobs-into-holes as a method of producing multispecific antibodies is described, e.g., in U.S. Pat. No. 5,731,168, WO2009/089004, US2009/0182127, US2011/0287009, Marvin and Zhu, Acta Pharmacol. Sin . (2005) 26(6):649-658, and Kontermann (2005) Acta Pharmacol. Sin., 26:1-9.
  • a brief nonlimiting discussion is provided below.
  • a “protuberance” refers to at least one amino acid side chain which projects from the interface of a first polypeptide and is therefore positionable in a compensatory cavity in the adjacent interface (i.e., the interface of a second polypeptide) so as to stabilize the heteromultimer, and thereby favor heteromultimer formation over homomultimer formation, for example.
  • the protuberance may exist in the original interface or may be introduced synthetically (e.g., by altering nucleic acid encoding the interface). In some embodiments, a nucleic acid encoding the interface of the first polypeptide is altered to encode the protuberance.
  • nucleic acid encoding at least one “original” amino acid residue in the interface of the first polypeptide is replaced with nucleic acid encoding at least one “import” amino acid residue which has a larger side chain volume than the original amino acid residue. It will be appreciated that there can be more than one original and corresponding import residue.
  • the side chain volumes of the various amino residues are shown, for example, in Table 1 of US 2011/0287009 or Table 1 of U.S. Pat. No. 7,642,228.
  • import residues for the formation of a protuberance are naturally occurring amino acid residues selected from arginine (R), phenylalanine (F), tyrosine (Y) and tryptophan (W).
  • an import residue is tryptophan or tyrosine.
  • the original residue for the formation of the protuberance has a small side chain volume, such as alanine, asparagine, aspartic acid, glycine, serine, threonine, or valine. See, for example, U.S. Pat. No. 7,642,228.
  • a “cavity” refers to at least one amino acid side chain which is recessed from the interface of a second polypeptide and therefore accommodates a corresponding protuberance on the adjacent interface of a first polypeptide.
  • the cavity may exist in the original interface or may be introduced synthetically (e.g., by altering nucleic acid encoding the interface).
  • nucleic acid encoding the interface of the second polypeptide is altered to encode the cavity. To achieve this, the nucleic acid encoding at least one “original” amino acid residue in the interface of the second polypeptide is replaced with DNA encoding at least one “import” amino acid residue which has a smaller side chain volume than the original amino acid residue.
  • import residues for the formation of a cavity are naturally occurring amino acid residues selected from alanine (A), serine (S), threonine (T), and valine (V).
  • an import residue is serine, alanine, or threonine.
  • the original residue for the formation of the cavity has a large side chain volume, such as tyrosine, arginine, phenylalanine, or tryptophan.
  • the protuberance is “positionable” in the cavity which means that the spatial location of the protuberance and cavity on the interface of a first polypeptide and second polypeptide respectively and the sizes of the protuberance and cavity are such that the protuberance can be located in the cavity without significantly perturbing the normal association of the first and second polypeptides at the interface.
  • protuberances such as Tyr, Phe, and Trp do not typically extend perpendicularly from the axis of the interface and have preferred conformations
  • the alignment of a protuberance with a corresponding cavity may, in some instances, rely on modeling the protuberance/cavity pair based upon a three-dimensional structure such as that obtained by X-ray crystallography or nuclear magnetic resonance (NMR). This can be achieved using widely accepted techniques in the art.
  • a knob mutation in an IgG1 constant region is T366W.
  • a hole mutation in an IgG1 constant region comprises one or more mutations selected from T366S, L368A, and Y407V.
  • a hole mutation in an IgG1 constant region comprises T366S, L368A, and Y407V.
  • a knob mutation in an IgG4 constant region is T366W.
  • a hole mutation in an IgG4 constant region comprises one or more mutations selected from T366S, L368A, and Y407V.
  • a hole mutation in an IgG4 constant region comprises T366S, L368A, and Y407V.
  • amino acid sequence variants of the antibodies provided herein are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibody.
  • Amino acid sequence variants of an antibody may be prepared by introducing appropriate modifications into the nucleotide sequence encoding the antibody, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final construct possesses the desired characteristics, for example, antigen-binding.
  • antibody variants having one or more amino acid substitutions are provided.
  • Sites of interest for substitutional mutagenesis include the HVRs and FRs.
  • Conservative substitutions are shown in Table A under the heading of “preferred substitutions.” More substantial changes are provided in Table A under the heading of “exemplary substitutions,” and as further described below in reference to amino acid side chain classes.
  • Amino acid substitutions may be introduced into an antibody of interest and the products screened for a desired activity, e.g., retained/improved antigen binding, decreased immunogenicity, or improved ADCC or CDC.
  • Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
  • substitutional variant involves substituting one or more HVR (e.g., CDR) residues of a parent antibody (e.g., a humanized or human antibody).
  • HVR e.g., CDR
  • a parent antibody e.g., a humanized or human antibody
  • modifications e.g., improvements
  • an exemplary substitutional variant is an affinity matured antibody, which may be conveniently generated, for example, using phage display-based affinity maturation techniques such as those described herein. Briefly, one or more HVR residues are mutated and the variant antibodies displayed on phage and screened for a particular biological activity (e.g., binding affinity).
  • Alterations may be made in HVRs (e.g., CDRs), e.g., to improve antibody affinity.
  • HVRs e.g., CDRs
  • Such alterations may be made in HVR “hotspots,” i.e., residues encoded by codons that undergo mutation at high frequency during the somatic maturation process (see, e.g., Chowdhury, Methods Mol. Biol. 207:179-196, 2008), and/or residues that contact antigen, with the resulting variant VH or VL being tested for binding affinity.
  • Affinity maturation by constructing and reselecting from secondary libraries has been described, e.g., in Hoogenboom et al.
  • affinity maturation diversity is introduced into the variable genes chosen for maturation by any of a variety of methods (e.g., error-prone PCR, chain shuffling, or oligonucleotide-directed mutagenesis).
  • a secondary library is then created. The library is then screened to identify any antibody variants with the desired affinity.
  • Another method to introduce diversity involves HVR-directed approaches, in which several HVR residues (e.g., 4-6 residues at a time) are randomized. HVR residues involved in antigen binding may be specifically identified, e.g., using alanine scanning mutagenesis or modeling. HVR-H3 and HVR-L3 in particular are often targeted.
  • substitutions, insertions, or deletions may occur within one or more HVRs (e.g., CDRs) so long as such alterations do not substantially reduce the ability of the antibody to bind antigen.
  • HVRs e.g., CDRs
  • conservative alterations e.g., conservative substitutions as provided herein
  • Such alterations may, for example, be outside of antigen contacting residues in the HVRs.
  • each HVR either is unaltered, or contains no more than one, two or three amino acid substitutions.
  • a useful method for identification of residues or regions of an antibody that may be targeted for mutagenesis is called “alanine scanning mutagenesis” as described by Cunningham et al. Science 244:1081-1085, 1989.
  • a residue or group of target residues e.g., charged residues such as Arg, Asp, His, Lys, and Glu
  • a neutral or negatively charged amino acid e.g., Ala or polyalanine
  • Further substitutions may be introduced at the amino acid locations demonstrating functional sensitivity to the initial substitutions.
  • a crystal structure of an antigen-antibody complex to identify contact points between the antibody and antigen. Such contact residues and neighboring residues may be targeted or eliminated as candidates for substitution.
  • Variants may be screened to determine whether they contain the desired properties.
  • Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues.
  • terminal insertions include an antibody with an N-terminal methionyl residue.
  • Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody to an enzyme (e.g., for ADEPT) or a polypeptide which increases the serum half-life of the antibody.
  • an antibody provided herein is altered to increase or decrease the extent to which the antibody is glycosylated.
  • Addition or deletion of glycosylation sites to an antibody may be conveniently accomplished by altering the amino acid sequence such that one or more glycosylation sites is created or removed.
  • the carbohydrate attached thereto may be altered.
  • Native antibodies produced by mammalian cells typically comprise a branched, biantennary oligosaccharide that is generally attached by an N-linkage to Asn297 of the CH2 domain of the Fc region. See, for example, Wright et al. TIBTECH 15:26-32, 1997.
  • the oligosaccharide may include various carbohydrates, for example, mannose, N-acetyl glucosamine (GlcNAc), galactose, and sialic acid, as well as a fucose attached to a GlcNAc in the “stem” of the biantennary oligosaccharide structure.
  • modifications of the oligosaccharide in an antibody disclosed herein may be made in order to create antibody variants with certain improved properties.
  • antibody variants having a carbohydrate structure that lacks fucose attached (directly or indirectly) to an Fc region.
  • the amount of fucose in such antibody may be from 1% to 80%, from 1% to 65%, from 5% to 65% or from 20% to 40%.
  • the amount of fucose is determined by calculating the average amount of fucose within the sugar chain at Asn297, relative to the sum of all glycostructures attached to Asn 297 (e. g. complex, hybrid and high mannose structures) as measured by MALDI-TOF mass spectrometry, as described in WO 2008/077546, for example.
  • Asn297 refers to the asparagine residue located at about position 297 in the Fc region (Eu numbering of Fc region residues); however, Asn297 may also be located about ⁇ 3 amino acids upstream or downstream of position 297, i.e., between positions 294 and 300, due to minor sequence variations in antibodies. Such fucosylation variants may have improved ADCC function. See, e.g., US Patent Publication Nos. 2003/0157108 and 2004/0093621.
  • Examples of publications related to “defucosylated” or “fucose-deficient” antibody variants include: US 2003/0157108; WO 2000/61739; WO 2001/29246; US 2003/0115614; US 2002/0164328; US 2004/0093621; US 2004/0132140; US 2004/0110704; US 2004/0110282; US 2004/0109865; WO 2003/085119; WO 2003/084570; WO 2005/035586; WO 2005/035778; WO 2005/053742; WO 2002/031140; Okazaki et al. J. Mol. Biol. 336:1239-1249, 2004; Yamane-Ohnuki et al. Biotech.
  • Examples of cell lines capable of producing defucosylated antibodies include Lec13 CHO cells deficient in protein fucosylation (Ripka et al. Arch. Biochem . Biophys. 249:533-545, 1986; US 2003/0157108; and WO 2004/056312 A1, especially at Example 11), and knockout cell lines, such as alpha-1,6-fucosyltransferase gene, FUT8, knockout CHO cells (see, e.g., Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614, 2004; Kanda et al. Biotechnol. Bioeng. 94(4):680-688, 2006; and WO 2003/085107).
  • Antibodies variants are further provided with bisected oligosaccharides, e.g., in which a biantennary oligosaccharide attached to the Fc region of the antibody is bisected by GlcNAc. Such antibody variants may have reduced fucosylation and/or improved ADCC function. Examples of such antibody variants are described, e.g., in WO 2003/011878; U.S. Pat. No. 6,602,684; and US 2005/0123546. Antibody variants with at least one galactose residue in the oligosaccharide attached to the Fc region are also provided. Such antibody variants may have improved CDC function. Such antibody variants are described, e.g., in WO 1997/30087; WO 1998/58964; and WO 1999/22764.
  • one or more amino acid modifications may be introduced into the Fc region of an antibody provided herein, thereby generating an Fc region variant.
  • the Fc region variant may comprise a human Fc region sequence (e.g., a human IgG1, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification (e.g. a substitution) at one or more amino acid positions.
  • the invention contemplates an antibody variant that possesses some but not all effector functions, which make it a desirable candidate for applications in which the half-life of the antibody in vivo is important yet certain effector functions (such as complement and ADCC) are unnecessary or deleterious.
  • In vitro and/or in vivo cytotoxicity assays can be conducted to confirm the reduction/depletion of CDC and/or ADCC activities.
  • Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks Fc ⁇ R binding (hence likely lacking ADCC activity), but retains FcRn binding ability.
  • NK cells express Fc(RIII only, whereas monocytes express Fc(RI, Fc(RII and Fc(RIII.
  • FcR expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch et al. Annu. Rev. Immunol. 9:457-492, 1991.
  • Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest is described in U.S. Pat. No. 5,500,362 (see, e.g. Hellstrom et al. Proc. Natl. Acad. Sci. USA 83:7059-7063, 1986 and Hellstrom et al. Proc. Natl. Acad. Sci.
  • non-radioactive assays methods may be employed (see, for example, ACTITM non-radioactive cytotoxicity assay for flow cytometry (CellTechnology, Inc. Mountain View, Calif.; and CYTOTOX 96® non-radioactive cytotoxicity assay (Promega, Madison, Wis.).
  • Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells.
  • ADCC activity of the molecule of interest may be assessed in vivo, for example, in an animal model such as that disclosed in Clynes et al. Proc. Natl. Acad. Sci. USA 95:652-656, 1998.
  • C1q binding assays may also be carried out to confirm that the antibody is unable to bind C1q and hence lacks CDC activity. See, e.g., C1q and C3c binding ELISA in WO 2006/029879 and WO 2005/100402.
  • a CDC assay may be performed (see, e.g., Gazzano-Santoro et al. J. Immunol. Methods 202:163, 1996; Cragg et al.
  • FcRn binding and in vivo clearance/half-life determinations can also be performed using methods known in the art (see, e.g., Petkova et al. Intl. Immunol. 18(12):1759-1769, 2006).
  • Antibodies with reduced effector function include those with substitution of one or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Pat. No. 6,737,056).
  • Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called “DANA” Fc mutant with substitution of residues 265 and 297 to alanine (U.S. Pat. No. 7,332,581).
  • an antibody variant comprises an Fc region with one or more amino acid substitutions which improve ADCC, e.g., substitutions at positions 298, 333, and/or 334 of the Fc region (EU numbering of residues).
  • alterations are made in the Fc region that result in altered (i.e., either improved or diminished) C1q binding and/or Complement Dependent Cytotoxicity (CDC), for example, as described in U.S. Pat. No. 6,194,551, WO 99/51642, and Idusogie et al. J. Immunol. 164: 4178-4184, 2000.
  • CDC Complement Dependent Cytotoxicity
  • Antibodies with increased half-lives and improved binding to the neonatal Fc receptor (FcRn), which is responsible for the transfer of maternal IgGs to the fetus are described in US2005/0014934.
  • Those antibodies comprise an Fc region with one or more substitutions therein which improve binding of the Fc region to FcRn.
  • Such Fc variants include those with substitutions at one or more of Fc region residues: 238, 256, 265, 272, 286, 303, 305, 307, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 or 434, e.g., substitution of Fc region residue 434 (U.S. Pat. No. 7,371,826).
  • cysteine engineered antibodies for example, “thioMAbs,” in which one or more residues of an antibody are substituted with cysteine residues.
  • the substituted residues occur at accessible sites of the antibody.
  • reactive thiol groups are thereby positioned at accessible sites of the antibody and may be used to conjugate the antibody to other moieties, such as drug moieties or linker-drug moieties, to create an immunoconjugate, as described further herein.
  • any one or more of the following residues may be substituted with cysteine: V205 (Kabat numbering) of the light chain; A118 (EU numbering) of the heavy chain; and S400 (EU numbering) of the heavy chain Fc region.
  • Cysteine engineered antibodies may be generated as described, e.g., in U.S. Pat. No. 7,521,541.
  • an antibody provided herein may be further modified to contain additional nonproteinaceous moieties that are known in the art and readily available.
  • the moieties suitable for derivatization of the antibody include but are not limited to water soluble polymers.
  • water soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1, 3-dioxolane, poly-1,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran or poly(n-vinyl pyrrolidone)polyethylene glycol, propropylene glycol homopolymers, prolypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols (e.g., gly
  • Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water.
  • the polymer may be of any molecular weight, and may be branched or unbranched.
  • the number of polymers attached to the antibody may vary, and if more than one polymer is attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody to be improved, whether the antibody derivative will be used in a therapy under defined conditions, etc.
  • conjugates of an antibody and nonproteinaceous moiety that may be selectively heated by exposure to radiation are provided.
  • the nonproteinaceous moiety is a carbon nanotube (Kam et al. Proc. Natl. Acad. Sci. USA 102: 11600-11605, 2005).
  • the radiation may be of any wavelength, and includes, but is not limited to, wavelengths that do not harm ordinary cells, but which heat the nonproteinaceous moiety to a temperature at which cells proximal to the antibody-nonproteinaceous moiety are killed.
  • Antibodies may be produced using recombinant methods and compositions, for example, as described in U.S. Pat. No. 4,816,567.
  • isolated nucleic acid encoding an anti-IL-33 antibody described herein is provided.
  • Such nucleic acid may encode an amino acid sequence comprising the VL and/or an amino acid sequence comprising the VH of the antibody (e.g., the light and/or heavy chains of the antibody).
  • one or more vectors e.g., expression vectors
  • a host cell comprising such nucleic acid is provided.
  • a host cell comprises (e.g., has been transformed with): (1) a vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and an amino acid sequence comprising the VH of the antibody, or (2) a first vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and a second vector comprising a nucleic acid that encodes an amino acid sequence comprising the VH of the antibody.
  • the host cell is eukaryotic, for example, a Chinese Hamster Ovary (CHO) cell, 293 cell, or lymphoid cell (e.g., Y0, NS0, Sp20 cell).
  • a method of making an anti-IL-33 antibody comprises culturing a host cell comprising a nucleic acid encoding the antibody, as provided above, under conditions suitable for expression of the antibody, and optionally recovering the antibody from the host cell (or host cell culture medium).
  • nucleic acid encoding an antibody for example, as described above, is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell.
  • nucleic acid may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
  • Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells described herein.
  • antibodies may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed.
  • For expression of antibody fragments and polypeptides in bacteria see, for example, U.S. Pat. Nos. 5,648,237, 5,789,199, and 5,840,523. (See also Charlton, Methods in Molecular Biology, Vol. 248 (B. K. C. Lo, ed., Humana Press, Totowa, N.J., 2003), pp. 245-254, describing expression of antibody fragments in E. coli .)
  • the antibody may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
  • eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for antibody-encoding vectors, including fungi and yeast strains whose glycosylation pathways have been “humanized,” resulting in the production of an antibody with a partially or fully human glycosylation pattern. See Gerngross Nat. Biotech. 22:1409-1414, 2004 and Li et al. Nat. Biotech. 24:210-215, 2006.
  • Suitable host cells for the expression of glycosylated antibody are also derived from multicellular organisms (invertebrates and vertebrates). Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells.
  • Plant cell cultures can also be utilized as hosts. See, for example, U.S. Pat. Nos. 5,959,177, 6,040,498, 6,420,548, 7,125,978, and 6,417,429 (describing PLANTIBODIESTM technology for producing antibodies in transgenic plants).
  • Vertebrate cells may also be used as hosts.
  • mammalian cell lines that are adapted to grow in suspension may be useful.
  • Other examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293 cells as described, e.g., in Graham et al. J. Gen Virol. 36:59, 1977); baby hamster kidney cells (BHK); mouse sertoli cells (TM4 cells as described, e.g., in Mather Biol. Reprod.
  • monkey kidney cells (CV1); African green monkey kidney cells (VERO-76); human cervical carcinoma cells (HELA); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3A); human lung cells (W138); human liver cells (Hep G2); mouse mammary tumor (MMT 060562); TRI cells, as described, e.g., in Mather et al., Annals N.Y. Acad. Sci. 383:44-68, 1982; MRC 5 cells; and FS4 cells.
  • Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR ⁇ CHO cells (Urlaub et al. Proc. Natl. Acad. Sci.
  • Anti-IL-33 antibodies provided herein may be identified, screened for, or characterized for their physical/chemical properties and/or biological activities by various assays known in the art.
  • an anti-IL-33 antibody disclosed herein is tested for its antigen-binding activity, for example, by known methods such as ELISA, Western blot, and the like.
  • competition assays may be used to identify an antibody that competes with an anti-IL-33 antibody disclosed herein for binding to IL-33.
  • a competing antibody binds to the same epitope (e.g., a linear or a conformational epitope) that is bound by an anti-IL-33 antibody disclosed herein.
  • epitope e.g., a linear or a conformational epitope
  • mapping an epitope to which an antibody binds are provided in Morris “Epitope Mapping Protocols,” in Methods in Molecular Biology Vol. 66 (Humana Press, Totowa, N.J.), 1996.
  • immobilized IL-33 is incubated in a solution comprising a first labeled antibody that binds to IL-33 and a second unlabeled antibody that is being tested for its ability to compete with the first antibody for binding to IL-33.
  • the second antibody may be present in a hybridoma supernatant.
  • immobilized IL-33 is incubated in a solution comprising the first labeled antibody but not the second unlabeled antibody. After incubation under conditions permissive for binding of the first antibody to IL-33, excess unbound antibody is removed, and the amount of label associated with immobilized IL-33 is measured.
  • assays are provided for identifying anti-IL-33 antibodies thereof having biological activity.
  • Biological activity may include, for example, binding to IL-33 (e.g., IL-33 in the blood stream), or a peptide fragment thereof, either in vivo, in vitro, or ex vivo.
  • biological activity may include blocking or neutralizing IL-33, or preventing IL-33 from binding to a ligand, for example, a receptor (e.g., the IL-33 receptor ST2 and/or IL-1RAcP).
  • biological activity may include binding to site 1 on IL-33 and blocking of binding to the IL-33 receptor (i.e., ST2 and/or IL-1RAcP).
  • Antibodies having such biological activity in vivo and/or in vitro are also provided.
  • an antibody disclosed herein is tested for such biological activity.
  • an anti-IL-33 antibody disclosed herein is tested for inhibition in a cell-based IL-33 blocking assay.
  • an anti-IL-33 antibody disclosed herein is tested for inhibition of IL-33-induced reporter activity in a cell-based blocking assay (e.g., an IL-33 HEK-BLUETM cell-based assay as described herein (see, e.g., Examples 3 and 6)).
  • an antibody disclosed herein is tested for inhibition of an IL-33 activity in primary cells, for example, in a primary NK cell assay (see, e.g., Example 8, Section C of WO 2016/077381) or a primary basophil assay (see, e.g., Example 8, Section D of WO 2016/077381).
  • an antibody disclosed herein is tested for inhibiting the binding of IL-33 to an IL-33 receptor in a competitive binding ELISA (see, e.g., Example 8, Section F of WO 2016/077381).
  • the invention also provides immunoconjugates comprising an anti-IL-33 antibody provided herein conjugated to one or more cytotoxic agents, such as chemotherapeutic agents or drugs, growth inhibitory agents, toxins (e.g., protein toxins, enzymatically active toxins of bacterial, fungal, plant, or animal origin, or fragments thereof), or radioactive isotopes.
  • cytotoxic agents such as chemotherapeutic agents or drugs, growth inhibitory agents, toxins (e.g., protein toxins, enzymatically active toxins of bacterial, fungal, plant, or animal origin, or fragments thereof), or radioactive isotopes.
  • an immunoconjugate is an antibody-drug conjugate (ADC) in which an antibody is conjugated to one or more drugs, including but not limited to a maytansinoid (see U.S. Pat. Nos. 5,208,020, 5,416,064 and European Patent EP 0 425 235 B1); an auristatin such as monomethylauristatin drug moieties DE and DF (MMAE and MMAF) (see U.S. Pat. Nos. 5,635,483 and 5,780,588, and 7,498,298); a dolastatin; a calicheamicin or derivative thereof (see U.S. Pat. Nos.
  • ADC antibody-drug conjugate
  • drugs including but not limited to a maytansinoid (see U.S. Pat. Nos. 5,208,020, 5,416,064 and European Patent EP 0 425 235 B1); an auristatin such as monomethylauristatin drug moieties DE and DF (MMAE and
  • an immunoconjugate comprises an antibody as described herein conjugated to an enzymatically active toxin or fragment thereof, including but not limited to diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa ), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), Momordica charantia inhibitor, curcin, crotin, Sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes.
  • an enzymatically active toxin or fragment thereof including but not limited to diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain
  • an immunoconjugate comprises an antibody as described herein conjugated to a radioactive atom to form a radioconjugate.
  • a variety of radioactive isotopes are available for the production of radioconjugates. Examples include At 211 , I 131 , I 125 , Y 90 , Re 186 , Re 188 , Sm 153 , Bi 212 , P 32 , Pb 212 and radioactive isotopes of Lu.
  • the radioconjugate When used for detection, it may comprise a radioactive atom for scintigraphic studies, for example technetium-99m (tc99m) or I 123 , or a spin label for nuclear magnetic resonance (NMR) imaging (also known as magnetic resonance imaging, mri), such as iodine-123 again, iodine-131, indium-111, fluorine-19, carbon-13, nitrogen-15, oxygen-17, gadolinium, manganese or iron.
  • a radioactive atom for scintigraphic studies for example technetium-99m (tc99m) or I 123
  • NMR nuclear magnetic resonance
  • mri nuclear magnetic resonance
  • Conjugates of an antibody and cytotoxic agent may be made using a variety of bifunctional protein coupling agents such as N-succinimidyl-3-(2-pyridyldithio) propionate (SPDP), succinimidyl-4-(N-maleimidomethyl) cyclohexane-1-carboxylate (SMCC), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCl), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as toluene 2,6-diisocyanate), and bis-active fluorine compounds (such as
  • a ricin immunotoxin can be prepared as described in Vitetta et al. Science 238:1098, 1987.
  • Carbon-14-labeled 1-isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody. See WO 94/11026.
  • the linker may be a “cleavable linker” facilitating release of a cytotoxic drug in the cell.
  • an acid-labile linker, peptidase-sensitive linker, photolabile linker, dimethyl linker or disulfide-containing linker see, e.g., Chari et al. Cancer Res. 52:127-131, 1992; U.S. Pat. No. 5,208,020) may be used.
  • the immunoconjugates or ADCs herein expressly contemplate, but are not limited to such conjugates prepared with cross-linker reagents including, but not limited to, BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, MPBH, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, sulfo-EMCS, sulfo-GMBS, sulfo-KMUS, sulfo-MBS, sulfo-SIAB, sulfo-SMCC, and sulfo-SMPB, and SVSB (succinimidyl-(4-vinylsulfone)benzoate) which are commercially available (e.g., from Pierce Biotechnology, Inc., Rockford, Ill., U.S.A.).
  • cross-linker reagents including, but not limited to, BMPS, EMCS, GMBS, HBVS, LC-SMCC
  • any of the anti-IL-33 antibodies provided herein is useful for detecting the presence of IL-33 in a biological sample.
  • the term “detecting” as used herein encompasses quantitative or qualitative detection.
  • a biological sample comprises a cell or tissue, such as smooth muscle, epithelial cells, endothelial cells, blood, blood cells (e.g., macrophages, innate type II (ILC2) cells, mast cells, basophils, eosinophils, and dendritic cells), central nervous system cells (e.g., glia cells), or eye cells (e.g., retinal cells (e.g., Muller cells or retinal pigment epithelium (RPE) cells) and vascular endothelial cells of the eye).
  • RPE retinal cells
  • an anti-IL-33 antibody for use in a method of diagnosis or detection is provided.
  • a method of detecting the presence of IL-33 in a biological sample comprises contacting the biological sample with an anti-IL-33 antibody as described herein under conditions permissive for binding of the anti-IL-33 antibody to IL-33, and detecting whether a complex is formed between the anti-IL-33 antibody and IL-33.
  • Such method may be an in vitro or in vivo method.
  • an anti-IL-33 antibody is used to select subjects eligible for therapy with an anti-IL-33 antibody, for example, where IL-33 is a biomarker for selection of patients.
  • disorders that may be diagnosed using an antibody disclosed herein include IL-33-mediated disorders, including, for example, ocular disorders (e.g., age-related macular degeneration (AMD) or retinopathy of the eye), inflammatory conditions (e.g., asthma, sepsis, septic shock, atopic dermatitis, allergic rhinitis, rheumatoid arthritis, and chronic obstructive pulmonary disease (COPD)), immune disorders (e.g., asthma, rheumatoid arthritis, allergy, atopic allergy, anaphylaxis, anaphylactic shock, allergic rhinitis, psoriasis, inflammatory bowel disease (IBD), Crohn's disease, diabetes, and liver disease), fibrotic disorders (e.g., pulmonary fibrosis (e.g., idiopathic pulmonary fibrosis), eosinophilic disorders (e.g., eosinophil-associated gastrointestinal disorders (EG
  • the ocular disorder that may be diagnosed using an antibody disclosed herein includes AMD (e.g., wet AMD, dry AMD, intermediate AMD, advanced AMD, and geographic atrophy (GA)), retinopathy (e.g., diabetic retinopathy (DR), retinopathy of prematurity (ROP), and high-altitude DR), polypoidal choroidal vasculopathy (PCV), diabetic macular edema, dry eye disease, Behcet's disease, retina detachment, glaucoma, uveitis (e.g., infectious and non-infectious uveitis), retinitis pigmentosa, Leber Congenital Amaurosis, Stargardt's disease, traumatic eye injury, and conjunctivitis (e.g., infectious conjunctivitis, non-infectious conjunctivitis, and allergic conjunctivitis).
  • AMD e.g., wet AMD, dry AMD, intermediate AMD, advanced AMD, and geographic atrophy
  • the ocular disorder includes AMD (including wet AMD, dry AMD, and GA), retinopathy (e.g., DR and ROP), PCV, diabetic macular edema, dry eye disease, Behcet's disease, allergic conjunctivitis, and retina detachment.
  • the ocular disorder includes intermediate AMD, advanced AMD, glaucoma, uveitis (e.g., infectious and non-infectious uveitis), retinitis pigmentosa, Leber Congenital Amaurosis, Stargardt's disease, high-altitude diabetic retinopathy, traumatic eye injury, and conjunctivitis (e.g., infectious conjunctivitis and non-infectious conjunctivitis).
  • uveitis e.g., infectious and non-infectious uveitis
  • retinitis pigmentosa e.g., Leber Congenital Amaurosis, Stargardt's disease, high-altitude diabetic retinopathy, traumatic eye injury
  • conjunctivitis e.g., infectious conjunctivitis and non-infectious conjunctivitis.
  • labeled anti-IL-33 antibodies include, but are not limited to, labels or moieties that are detected directly (such as fluorescent, chromophoric, electron-dense, chemiluminescent, and radioactive labels), as well as moieties, such as enzymes or ligands, that are detected indirectly, e.g., through an enzymatic reaction or molecular interaction.
  • Exemplary labels include, but are not limited to, the radioisotopes 32 P, 14 C, 125 I, 3 H, and 131 I, fluorophores such as rare earth chelates or fluorescein and its derivatives, rhodamine and its derivatives, dansyl, umbelliferone, luceriferases, e.g., firefly luciferase and bacterial luciferase (U.S. Pat. No.
  • luciferin 2,3-dihydrophthalazinediones
  • horseradish peroxidase HRP
  • alkaline phosphatase alkaline phosphatase
  • ⁇ -galactosidase glucoamylase
  • lysozyme saccharide oxidases, e.g., glucose oxidase, galactose oxidase, and glucose-6-phosphate dehydrogenase
  • heterocyclic oxidases such as uricase and xanthine oxidase, coupled with an enzyme that employs hydrogen peroxide to oxidize a dye precursor such as HRP, lactoperoxidase, or microperoxidase, biotin/avidin, spin labels, bacteriophage labels, stable free radicals, and the like.
  • compositions of an anti-IL-33 antibody disclosed herein are prepared by mixing such antibody having the desired degree of purity with one or more optional pharmaceutically acceptable carriers (see, e.g., Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed., 1980), in the form of lyophilized formulations or aqueous solutions.
  • Pharmaceutically acceptable carriers are generally nontoxic to recipients at the dosages and concentrations employed, and include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arg
  • Exemplary pharmaceutically acceptable carriers herein further include interstitial drug dispersion agents such as soluble neutral-active hyaluronidase glycoproteins (sHASEGP), for example, human soluble PH-20 hyaluronidase glycoproteins, such as rHuPH20 (HYLENEX®, Baxter International, Inc.).
  • sHASEGP soluble neutral-active hyaluronidase glycoproteins
  • rHuPH20 HYLENEX®, Baxter International, Inc.
  • Certain exemplary sHASEGPs and methods of use, including rHuPH20 are described in US Patent Publication Nos. 2005/0260186 and 2006/0104968.
  • a sHASEGP is combined with one or more additional glycosaminoglycanases such as chondroitinases.
  • Exemplary lyophilized antibody formulations are described in U.S. Pat. No. 6,267,958.
  • Aqueous antibody formulations include those described in U.S. Pat. No. 6,171,586 and WO 2006/044908, the latter formulations including a histidine-acetate buffer.
  • the formulation herein may also contain more than one active ingredients as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other.
  • a complement pathway inhibitor e.g., a Factor D binding antagonist
  • HtrA1 binding antagonist e.g., a VEGF antagonist
  • HtrA1 binding antagonist e.g., a VEGF antagonist
  • HtrA1 binding antagonist e.g., a VEGF antagonist
  • tryptase-beta binding antagonist e.g., a tryptase-beta binding antagonist
  • chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) binding antagonist e.g., an interleukin-13 (IL-13) binding antagonist, an interleukin-17 (IL-17) binding antagonist, a JAK1 antagonist, and/or an interleukin-5 (IL-5) binding antagonist.
  • a complement pathway inhibitor e.g., a Factor D binding
  • the complement pathway inhibitor is a Factor D binding antagonist.
  • the Factor D binding antagonist is an anti-Factor D antibody or an antigen-binding fragment thereof, for example, as described below in Section G, “Therapeutic Methods and Compositions.”
  • the HtrA1 binding antagonist is an anti-HtrA1 antibody or an antigen-binding fragment thereof, for example, as described below in Section G, “Therapeutic Methods and Compositions.”
  • the anti-HtrA1 antibody fragment is an Fab, Fab′-SH, Fv, scFv, or an (Fab′) 2 fragment.
  • the anti-Factor D antibody fragment is an Fab, Fab′-SH, Fv, scFv, or an (Fab′) 2 fragment.
  • the VEGF antagonist is an anti-VEGF antibody or an antigen-binding fragment thereof, for example, as described below in Section G, “Therapeutic Methods and Compositions.”
  • the anti-VEGF antibody fragment is an Fab, Fab′-SH, Fv, scFv, or an (Fab′) 2 fragment.
  • the VEGF antagonist is an anti-VEGF receptor antibody or an antigen-binding fragment thereof.
  • the anti-VEGF receptor antibody fragment is an Fab, Fab′-SH, Fv, scFv, or an (Fab′) 2 fragment.
  • Such active ingredients are suitably present in combination in amounts that are effective for the purpose intended.
  • Active ingredients may be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions.
  • colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
  • Sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g., films, or microcapsules.
  • an antibody disclosed herein may be combined, for example, with ophthalmologically acceptable preservatives, co-solvents, surfactants, viscosity enhancers, penetration enhancers, buffers, sodium chloride, and/or water.
  • Preservatives may be included, for example, to inhibit microbial contamination during use. Suitable preservatives include: edetate disodium, methyl paraben, propyl paraben, sorbic acid, phenylethyl alcohol, chlorobutanol, polyquaternium-1, or other agents known in the art. Such preservatives are typically employed at a level of from 0.001 to 1.0% w/v.
  • compositions intended to be administered topically to the eye may be formulated as eye drops or eye ointments.
  • the total amount of antibody will be about 0.001 to 1.0% (w/w), for example, about 0.01 to about 1.0% (w/w), of such a formulation.
  • the formulations to be used for in vivo administration are generally sterile. Sterility may be readily accomplished, for example, by filtration through sterile filtration membranes.
  • An anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein) can be formulated in a polymeric formulation.
  • any suitable concentration of any of the antibodies disclosed herein may be used in the compositions (e.g., pharmaceutical compositions).
  • the concentration of an antibody in a composition disclosed herein may range, for example, from about 1 mg/mL to about 400 mg/mL (e.g., about 1 mg/mL to about 400 mg/mL, about 1 mg/mL to about 375 mg/mL, about 1 mg/mL to about 350 mg/mL, about 1 mg/mL to about 325 mg/mL, about 1 mg/mL to about 300 mg/mL, about 1 mg/mL to about 275 mg/mL, about 1 mg/mL to about 250 mg/mL, about 1 mg/mL to about 225 mg/mL, about 1 mg/mL to about 200 mg/mL, about 1 mg/mL to about 175 mg/mL, about 1 mg/mL to about 150 mg/mL, about 1 mg/mL to about 125 mg/mL, about 1 mg/mL to about 100 mg/m
  • the antibody is at a concentration of about 50 mg/mL to about 300 mg/mL (e.g., about 50 mg/mL, about 60 mg/mL, about 70 mg/mL, about 80 mg/mL, about 90 mg/mL, about 100 mg/mL, about 110 mg/mL, about 120 mg/mL, about 130 mg/mL, about 140 mg/mL, about 150 mg/mL, about 160 mg/mL, about 170 mg/mL, about 180 mg/mL, about 190 mg/mL, about 200 mg/mL, about 210 mg/mL, about 220 mg/mL, about 230 mg/mL, about 240 mg/mL, about 250 mg/mL, about 260 mg/mL, about 270 mg/mL, about 280 mg/mL, about 290 mg/mL, or about 300 mg/mL.
  • the antibody is at a concentration of about 175 mg/mL to about 225 mg/mL (e.g., about 175 mg/mL, about 176 mg/mL, about 177 mg/mL, about 178 mg/mL about 179 mg/mL, about 180 mg/mL, about 181 mg/mL, about 182 mg/mL, about 183 mg/mL, about 184 mg/mL, about 185 mg/mL, about 186 mg/mL, about 187 mg/mL, about 188 mg/mL, about 189 mg/mL, about 190 mg/mL, about 191 mg/mL, about 192 mg/mL, about 193 mg/mL, about 194 mg/mL, about 195 mg/mL, about 196 mg/mL, about 197 mg/mL, about 198 mg/mL, about 199 mg/mL, about 200 mg/mL, about 201 mg/mL, about 202 mg/mL, about
  • anti-IL-33 antibodies Any of the anti-IL-33 antibodies disclosed herein may be used in therapeutic methods.
  • the invention provides an IL-33 axis binding antagonist for use as a medicament.
  • an anti-IL-33 antibody for use as a medicament is provided.
  • an anti-IL-33 antibody for use in treating IL-33-mediated disorders is provided.
  • an anti-IL-33 antibody for use in a method of treatment is provided.
  • the invention provides an anti-IL-33 antibody for use in a method of treating an individual having an IL-33-mediated disorder comprising administering to the individual an effective amount of the anti-IL-33 antibody.
  • the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, for example, as described below.
  • An “individual” according to any of the above embodiments is preferably a human.
  • the invention provides an IL-33 axis binding antagonist in the manufacture or preparation of a medicament.
  • the invention provides for the use of an anti-IL-33 antibody in the manufacture or preparation of a medicament.
  • the medicament is for treatment of an IL-33-mediated disorder.
  • the medicament is for use in a method of treating IL-33-mediated disorder comprising administering to an individual having IL-33-mediated disorder an effective amount of the medicament.
  • the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, e.g., as described below.
  • An “individual” according to any of the above embodiments may be a human.
  • the invention provides a method for treating an IL-33-mediated disorder.
  • the method comprises administering the individual having such an IL-33-mediated disorder an effective amount of an IL-33 axis binding antagonist.
  • the method comprises administering to an individual having such IL-33-mediated disorder an effective amount of an anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein).
  • the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, as described below.
  • An “individual” according to any of the above embodiments may be a human.
  • the invention provides pharmaceutical formulations comprising any of the anti-IL-33 antibodies provided herein, e.g., for use in any of the above therapeutic methods.
  • a pharmaceutical formulation comprises any of the anti-IL-33 antibodies provided herein and a pharmaceutically acceptable carrier.
  • a pharmaceutical formulation comprises any of the anti-IL-33 antibodies provided herein and at least one additional therapeutic agent, for example, as described below.
  • the IL-33 mediated disorder may be an ocular disorder, an inflammatory condition, an immune disorder, a fibrotic disorder, an eosinophilic disorder, an infection, pain, a central nervous system disorder, or a solid tumor.
  • an inflammatory condition may be asthma, airway hyperresponsiveness, airway inflammation, sepsis, septic shock, atopic dermatitis, allergic rhinitis, rheumatoid arthritis, or chronic obstructive pulmonary disease (COPD).
  • COPD chronic obstructive pulmonary disease
  • an immune disorder may be asthma, rheumatoid arthritis, allergy, atopic allergy, anaphylaxis, anaphylactic shock, allergic rhinitis, psoriasis, inflammatory bowel disease (IBD), Crohn's disease, diabetes, or liver disease.
  • the fibrotic disease may be idiopathic pulmonary fibrosis (IPF).
  • the eosinophilic disorder may be an eosinophil-associated gastrointestinal disorder (EGID).
  • the EGID may be eosinophilic esophagitis.
  • the infection may be a helminth infection, a protozoan infection, or a viral infection.
  • the protozoan infection may be Leishmania major infection.
  • the viral infection may be respiratory syncytial virus (RSV) infection or influenza infection.
  • the pain may be inflammatory pain.
  • the central nervous system disorder may be Alzheimer's disease.
  • the solid tumor may be a breast tumor, colon tumor, prostate tumor, lung tumor, kidney tumor, liver tumor, pancreas tumor, stomach tumor, intestinal tumor, brain tumor, bone tumor, or skin tumor.
  • the IL-33-mediated disorder may be asthma, allergic rhinitis, atopic dermatitis, COPD, eosinophilic esophagitis, or pulmonary fibrosis (e.g., IPF).
  • the IL-33-mediated disorder is asthma.
  • the IL-33-mediated disorder is pulmonary fibrosis (e.g., IPF).
  • the IL-33-mediated disorder may be an ocular disorder (e.g., any ocular disorder disclosed herein).
  • ocular disorders include, for example, AMD (e.g., wet AMD, dry AMD, intermediate AMD, advanced AMD, and geographic atrophy (GA)), macular degeneration, macular edema, DME (e.g., focal, non-center DME and diffuse, center-involved DME), retinopathy, diabetic retinopathy (DR) (e.g., proliferative DR (PDR), non-proliferative DR (NPDR), and high-altitude DR), other ischemia-related retinopathies, ROP, retinal vein occlusion (RVO) (e.g., central (CRVO) and branched (BRVO) forms), CNV (e.g., myopic CNV), corneal neovascularization, diseases associated with corneal neovascularization, retinal
  • AMD e.g., wet AMD
  • Additional exemplary ocular disorders include retinoschisis (abnormal splitting of the retina neurosensory layers), diseases associated with rubeosis (neovascularization of the angle) and diseases caused by the abnormal proliferation of fibrovascular or fibrous tissue, including all forms of proliferative vitreoretinopathy.
  • Exemplary diseases associated with corneal neovascularization include, but are not limited to, epidemic keratoconjunctivitis, vitamin A deficiency, contact lens overwear, atopic keratitis, superior limbic keratitis, terygium keratitis sicca, Sj ⁇ gren's syndrome, acne rosacea, phylectenulosis, syphilis, Mycobacteria infections, lipid degeneration, chemical burns, bacterial ulcers, fungal ulcers, Herpes simplex infections, Herpes zoster infections, protozoan infections, Kaposi sarcoma, Mooren ulcer, Terrien's marginal degeneration, marginal keratolysis, rheumatoid arthritis, systemic lupus, polyarteritis, trauma, Wegener's sarcoidosis, scleritis, Stevens-Johnson syndrome, periphigoid radial keratotomy, and corneal graph rejection.
  • Exemplary diseases associated with choroidal neovascularization and defects in the retina vasculature include, but are not limited to, diabetic retinopathy, macular degeneration, sickle cell anemia, sarcoid, syphilis, pseudoxanthoma elasticum, Paget's disease, vein occlusion, artery occlusion, carotid obstructive disease, chronic uveitis/vitritis, mycobacterial infections, Lyme's disease, systemic lupus erythematosis, retinopathy of prematurity, retina edema (including macular edema), Eales disease, Behcet's disease, infections causing retinitis or choroiditis (e.g., multifocal choroidits), presumed ocular histoplasmosis, Best's disease (vitelliform macular degeneration), myopia, optic pits, pars plan
  • Exemplary diseases associated with atrophy of retinal tissues include, but are not limited to, atrophic or nonexudative AMD (e.g., geographic atrophy or advanced dry AMD), macular atrophy (e.g., atrophy associated with neovascularization and/or geographic atrophy), diabetic retinopathy, Stargardt's disease, Sorsby Fundus Dystrophy, retinoschisis and retinitis pigmentosa.
  • AMD e.g., geographic atrophy or advanced dry AMD
  • macular atrophy e.g., atrophy associated with neovascularization and/or geographic atrophy
  • diabetic retinopathy e.g., Stargardt's disease
  • Sorsby Fundus Dystrophy retinoschisis and retinitis pigmentosa.
  • the ocular disorder includes AMD (including wet AMD, dry AMD, and GA), retinopathy (e.g., DR and ROP), PCV, diabetic macular edema, dry eye disease, Behcet's disease, allergic conjunctivitis, and retina detachment.
  • the ocular disorder includes intermediate AMD, advanced AMD, glaucoma, uveitis (e.g., infectious and non-infectious uveitis), retinitis pigmentosa, Leber Congenital Amaurosis, Stargardt's disease, high-altitude diabetic retinopathy, traumatic eye injury, and conjunctivitis (e.g., infectious conjunctivitis and non-infectious conjunctivitis).
  • uveitis e.g., infectious and non-infectious uveitis
  • retinitis pigmentosa e.g., Leber Congenital Amaurosis, Stargardt's disease, high-altitude diabetic retinopathy, traumatic eye injury
  • conjunctivitis e.g., infectious conjunctivitis and non-infectious conjunctivitis.
  • the invention provides a method of treating an ocular disorder in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of an anti-IL-33 antibody, for example, an anti-IL-33 antibody disclosed herein.
  • the ocular disorder may be selected from the group consisting of age-related macular degeneration (AMD), including wet AMD, dry AMD, intermediate AMD, advanced AMD, and geographic atrophy (GA)), retinopathy (e.g., diabetic retinopathy (DR), retinopathy of prematurity (ROP), and high-altitude DR), polypoidal choroidal vasculopathy (PCV), diabetic macular edema, dry eye disease, Behcet's disease, retina detachment, glaucoma, uveitis (e.g., infectious and non-infectious uveitis), retinitis pigmentosa, Leber Congenital Amaurosis (also known as Leber's congenital amau
  • the ophthalmologic disorder includes AMD (including wet AMD, dry AMD, and GA), retinopathy (e.g., DR and ROP), PCV, diabetic macular edema, dry eye disease, Behcet's disease, allergic conjunctivitis, and retina detachment.
  • the ocular disorder includes intermediate AMD, advanced AMD, glaucoma, uveitis (e.g., infectious and non-infectious uveitis), retinitis pigmentosa, Leber Congenital Amaurosis, Stargardt's disease, high-altitude diabetic retinopathy, traumatic eye injury, and conjunctivitis (e.g., infectious conjunctivitis and non-infectious conjunctivitis).
  • uveitis e.g., infectious and non-infectious uveitis
  • retinitis pigmentosa e.g., Leber Congenital Amaurosis, Stargardt's disease, high-altitude diabetic retinopathy, traumatic eye injury
  • conjunctivitis e.g., infectious conjunctivitis and non-infectious conjunctivitis.
  • an anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein) can be used either alone or in combination with other agents in a therapy.
  • an anti-IL-33 antibody e.g., any anti-IL-33 antibody disclosed herein
  • an additional therapeutic agent is an ST2 binding antagonist, a complement pathway inhibitor (e.g., a Factor D binding antagonist), an HtrA1 binding antagonist, a VEGF antagonist, a tryptase-beta binding antagonist, a chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) binding antagonist, an interleukin-13 (IL-13) binding antagonist, an interleukin-17 (IL-17) binding antagonist, a JAK1 antagonist, and/or an interleukin-5 (IL-5) binding antagonist.
  • an additional therapeutic agent is a chemotherapeutic agent, an anti-hormonal agent, a cytotoxic agent, a growth inhibitory agent, or combinations thereof.
  • An anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein) for use in any of the methods described herein can be formulated in a polymeric formulation.
  • any of the preceding methods further comprises administering one or more additional compounds.
  • the anti-IL-33 antibody or polymeric formulation is administered simultaneously with the additional compound(s).
  • the anti-IL33 antibody or polymeric formulation is administered before or after the additional compound(s).
  • the additional compound binds to a second biological molecule selected from the group consisting of IL-1 ⁇ ; IL-6; IL-6R; IL-13; IL-13R; PDGF; angiopoietin; Ang2; Tie2; S1P; integrins ⁇ v ⁇ 3, ⁇ v ⁇ 5, and ⁇ 5 ⁇ 1; betacellulin; apelin/APJ; erythropoietin; complement factor D; TNF ⁇ ; HtrA1; a VEGF receptor; ST-2 receptor; and proteins genetically linked to AMD risk, such as complement pathway components C2, factor B, factor H, CFHR3, C3b, C5, C5a, and C3a; HtrA1; ARMS2; TIMP3; HLA; interleukin-8 (IL-8); CX3CR1; TLR3; TLR4; CETP; LIPC; COL10A1; and TNFRSF10A.
  • a second biological molecule selected from the group consisting of IL
  • the additional compound is an antibody or antigen-binding fragment thereof.
  • the ocular disorder is an intraocular neovascular disease selected from the group consisting of proliferative retinopathies, choroidal neovascularization (CNV), age-related macular degeneration (AMD), diabetic and other ischemia-related retinopathies, diabetic macular edema, pathological myopia, von Hippel-Lindau disease, histoplasmosis of the eye, retinal vein occlusion (RVO), including CRVO and BRVO, corneal neovascularization, retinal neovascularization, and retinopathy of prematurity (ROP).
  • CNV proliferative retinopathies
  • AMD age-related macular degeneration
  • RVO retinal vein occlusion
  • ROP retinal neovascularization
  • ROP retinopathy of prematurity
  • the additional compound is a bispecific antibody (e.g., an anti-VEGF/anti-Ang2 bispecific antibody, such as RG-7716 or any bispecific anti-VEGF/anti-Ang2 bispecific antibody disclosed in WO 2010/069532 or WO 2016/073157 or a variant thereof.
  • a bispecific antibody e.g., an anti-VEGF/anti-Ang2 bispecific antibody, such as RG-7716 or any bispecific anti-VEGF/anti-Ang2 bispecific antibody disclosed in WO 2010/069532 or WO 2016/073157 or a variant thereof.
  • the additional compound is an anti-IL-6 antibody, for example, EBI-031 (Eleven Biotherapeutics; see, e.g., WO 2016/073890), siltuximab (SYLVANT®), olokizumab, clazakizumab, sirukumab, elsilimomab, OPR-003, MEDI5117, PF-04236921, or a variant thereof.
  • EBI-031 Eleven Biotherapeutics; see, e.g., WO 2016/073890
  • siltuximab SYLVANT®
  • olokizumab olokizumab
  • clazakizumab sirukumab
  • sirukumab elsilimomab
  • OPR-003 MEDI5117
  • PF-04236921 a variant thereof.
  • the additional compound is an anti-IL-6R antibody, for example, tocilizumab (ACTEMRA®) (see, e.g., WO 1992/019579), sarilumab, ALX-0061, SA237, or a variant thereof.
  • ACTEMRA® tocilizumab
  • ALX-0061 ALX-0061
  • SA237 or a variant thereof.
  • an antibody of the invention, and/or polymeric formulation thereof may be administered in combination with at least one additional therapeutic agent for treatment of an ocular disorder, for example, an ocular disorder described herein (e.g., AMD (e.g., wet AMD), DME, DR, RVO, or GA).
  • an ocular disorder described herein e.g., AMD (e.g., wet AMD), DME, DR, RVO, or GA).
  • VEGF antagonists include, without limitation, anti-angiogenic agents, such as VEGF antagonists, including, for example, anti-VEGF antibodies (e.g., the anti-VEGF Fab LUCENTIS® (ranibizumab)), soluble receptor fusion proteins (e.g., the recombinant soluble receptor fusion protein EYLEA® (aflibercept, also known as VEGF Trap Eye; Regeneron/Aventis)), aptamers (e.g., the anti-VEGF pegylated aptamer MACUGEN® (pegaptanib sodium; NeXstar Pharmaceuticals/OSI Pharmaceuticals)), and VEGFR tyrosine kinase inhibitors (e.g., 4-(4-bromo-2-fluoroanilino)-6-methoxy-7-(1-methylpiperidin-4-ylmethoxy)quinazoline (ZD6474), 4-(4-fluoro-2-methylin
  • additional therapeutic agents that can be used in combination with an antibody of the invention, and/or polymeric formulation thereof, for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA), include, but are not limited to, VISUDYNE® (verteporfin; a light-activated drug that is typically used in conjunction with photodynamic therapy with a non-thermal laser), PKC412, Endovion (NS 3728; NeuroSearch A/S), neurotrophic factors (e.g., glial derived neurotrophic factor (GDNF) and ciliary neurotrophic factor (CNTF)), diltiazem, dorzolamide, PHOTOTROP®, 9-cis-retinal, eye medication (e.g., phospholine iodide, echothiophate, or carbonic anhydrase inhibitors), veovastat (AE-941; AEterna Laboratories, Inc.), Sirna-027 (AGF-745; Sima Therapeutics
  • An antibody of the invention, and/or polymeric formulation thereof, may be administered in combination with a therapy or surgical procedure for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA), including, for example, laser photocoagulation (e.g., panretinal photocoagulation (PRP)), drusen lasering, macular hole surgery, macular translocation surgery, implantable miniature telescopes, PHI-motion angiography (also known as micro-laser therapy and feeder vessel treatment), proton beam therapy, microstimulation therapy, retinal detachment and vitreous surgery, scleral buckle, submacular surgery, transpupillary thermotherapy, photosystem I therapy, use of RNA interference (RNAi), extracorporeal rheopheresis (also known as membrane differential filtration and rheotherapy), microchip implantation, stem cell therapy, gene replacement therapy, ribozyme gene therapy (including gene therapy for hypoxia response element, Oxford Biomedica; Lentipak, Genetix
  • an antibody of the invention, and/or polymeric formulation thereof can be administered in combination with an anti-angiogenic agent for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA).
  • an anti-angiogenic agent for treatment of an ocular disorder e.g., AMD, DME, DR, RVO, or GA.
  • Any suitable anti-angiogenic agent can be used in combination with an antibody of the invention, including, but not limited to, those listed by Carmeliet et al. Nature 407:249-257, 2000.
  • the anti-angiogenic agent is a VEGF antagonist, including, but not limited to, an anti-VEGF antibody (e.g., the anti-VEGF Fab LUCENTIS® (ranibizumab), RTH-258 (formerly ESBA-1008, an anti-VEGF single-chain antibody fragment; Novartis), or a bispecific anti-VEGF antibody (e.g., an anti-VEGF/anti-angiopoeitin 2 bispecific antibody such as RG-7716; Roche)), a soluble recombinant receptor fusion protein (e.g., EYLEA® (aflibercept)), a VEGF variant, a soluble VEGFR fragment, an aptamer capable of blocking VEGF (e.g., pegaptanib) or VEGFR, a neutralizing anti-VEGFR antibody, a small molecule inhibitor of VEGFR tyrosine kinases, an anti-VEGF DARPin® (e.g., abici), a
  • the bispecific anti-IL-33 antibody binds to a therapeutic agent targeting a second biological molecule, including but not limited to IL-1p; IL-6; IL-6R; PDGF (e.g., PDGF-BB); angiopoietin; angiopoietin 2; Tie2; S1P; integrins ⁇ v ⁇ 3, ⁇ v ⁇ 5, and ⁇ 5 ⁇ 1; betacellulin; apelin/APJ; erythropoietin; complement factor D; TNF ⁇ ; HtrA1; a VEGF receptor (e.g., VEGFR1, VEGFR2, VEGFR3, mbVEGFR, or sVEGFR); ST-2 receptor; and proteins genetically linked to age-related macular degeneration (AMD) risk, such as complement pathway components C2, factor B, factor H, CFHR3, C3b, C5, C5a, and C3a; HtrA1; ARMS2; TIMP3; H
  • the additional compound is a bispecific antibody (e.g., an anti-VEGF/anti-Ang2 bispecific antibody, such as RG-7716 or any bispecific anti-VEGF/anti-Ang2 bispecific antibody disclosed in WO 2010/069532 or WO 2016/073157 or a variant thereof).
  • a bispecific antibody e.g., an anti-VEGF/anti-Ang2 bispecific antibody, such as RG-7716 or any bispecific anti-VEGF/anti-Ang2 bispecific antibody disclosed in WO 2010/069532 or WO 2016/073157 or a variant thereof.
  • an antibody of the invention, and/or polymeric formulation thereof can be administered in combination with an agent that has activity against neovascularization for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA), such as an anti-inflammatory drug, a mammalian target of rapamycin (mTOR) inhibitor (e.g., rapamycin, AFINITOR® (everolimus), and TORISEL® (temsirolimus)), cyclosporine, a tumor necrosis factor (TNF) antagonist (e.g., an anti-TNF ⁇ antibody or antigen-binding fragment thereof (e.g., infliximab, adalimumab, certolizumab pegol, and golimumab) or a soluble receptor fusion protein (e.g., etanercept)), an anti-complement agent, a nonsteroidal anti-inflammatory agent (NSAID), or combinations thereof.
  • an antibody of the invention, and/or polymeric formulation thereof can be administered in combination with an agent that is neuroprotective and can potentially reduce the progression of dry AMD to wet AMD, such as the class of drugs called the “neurosteroids,” which include drugs such as dehydroepiandrosterone (DHEA) (brand names: PRASTERATM and FIDELIN®), dehydroepiandrosterone sulfate, and pregnenolone sulfate.
  • DHEA dehydroepiandrosterone
  • PRASTERATM and FIDELIN® brand names: PRASTERATM and FIDELIN®
  • dehydroepiandrosterone sulfate and pregnenolone sulfate.
  • Any suitable AMD therapeutic agent can be administered as an additional therapeutic agent in combination with an antibody of the invention, and/or polymeric formulation thereof, for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA), including, but not limited to, a VEGF antagonist, for example, an anti-VEGF antibody (e.g., LUCENTIS® (ranibizumab), RTH-258 (formerly ESBA-1008, an anti-VEGF single-chain antibody fragment; Novartis), or a bispecific anti-VEGF antibody (e.g., an anti-VEGF/anti-angiopoeitin 2 bispecific antibody such as RG-7716; Roche)), a soluble VEGF receptor fusion protein (e.g., EYLEA® (aflibercept)), an anti-VEGF DARPin® (e.g., abicipar pegol; Molecular Partners AG/Allergan), or an anti-VEGF aptamer (e.g., MACUGEN® (pe
  • AMD therapeutic agents can be co-formulated.
  • the anti-PDGFR antibody REGN2176-3 can be co-formulated with aflibercept (EYLEA®).
  • EYLEA® aflibercept
  • such a co-formulation can be administered in combination with an antibody of the invention.
  • the ocular disorder is AMD (e.g., wet AMD).
  • An antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with LUCENTIS® (ranibizumab) for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA).
  • an ocular disorder e.g., AMD, DME, DR, RVO, or GA.
  • the ocular disorder is AMD (e.g., wet AMD).
  • the ocular disorder is GA.
  • An antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with EYLEA® (aflibercept) for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA).
  • an ocular disorder e.g., AMD, DME, DR, RVO, or GA.
  • the ocular disorder is AMD (e.g., wet AMD).
  • the ocular disorder is GA.
  • An antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with MACUGEN® (pegaptanib sodium) for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA).
  • an ocular disorder e.g., AMD, DME, DR, RVO, or GA.
  • the ocular disorder is AMD (e.g., wet AMD).
  • the ocular disorder is GA.
  • An antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with VISUDYNE® (verteporfin) in combination with photodynamic therapy for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA).
  • an ocular disorder e.g., AMD, DME, DR, RVO, or GA.
  • the ocular disorder is AMD (e.g., wet AMD).
  • the ocular disorder is GA.
  • An antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with a PDGF antagonist for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA).
  • a PDGF antagonist for treatment of an ocular disorder e.g., AMD, DME, DR, RVO, or GA.
  • exemplary PDGF antagonists which may be used in combination with an antibody of the invention include an anti-PDGF antibody, an anti-PDGFR antibody, a small molecule inhibitor (e.g., squalamine), an anti-PDGF-B pegylated aptamer such as FOVISTA® (E10030; Ophthotech/Novartis), or a dual PDGF/VEGF antagonist (e.g., a small molecule inhibitor (e.g., DE-120 (Santen) or X-82 (TyrogeneX)) or a bispecific anti-PDGF/anti-VEGF antibody).
  • FOVISTA® can be administered as an adjunct therapy to an antibody of the invention.
  • OHR-102 can be administered in combination with VEGF antagonists such as LUCENTIS® or EYLEA®.
  • an antibody of the invention can be administered in combination with OHR-102, LUCENTIS®, and/or EYLEA®.
  • the ocular disorder is AMD (e.g., wet AMD).
  • the ocular disorder is GA.
  • An antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with RTH-258 for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA).
  • RTH-258 can be administered, for example, by intravitreal injection or eye infusion.
  • the ocular disorder is AMD (e.g., wet AMD).
  • the ocular disorder is GA.
  • An antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with RTH-258 for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA).
  • RTH-258 can be administered, for example, by intravitreal injection or eye infusion.
  • the ocular disorder is AMD (e.g., wet AMD).
  • the ocular disorder is GA.
  • An antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with abicipar pegol for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA).
  • an ocular disorder e.g., AMD, DME, DR, RVO, or GA.
  • the ocular disorder is AMD (e.g., wet AMD).
  • the ocular disorder is GA.
  • any suitable DME and/or DR therapeutic agent can be administered in combination with an antibody of the invention, and/or polymeric formulation thereof, for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA), including, but not limited, to a VEGF antagonist (e.g., LUCENTIS® or EYLEA®), a corticosteroid (e.g., a corticosteroid implant (e.g., OZURDEX® (dexamethasone intravitreal implant) or ILUVIEN® (fluocinolone acetonide intravitreal implant)) or a corticosteroid formulated for administration by intravitreal injection (e.g., triamcinolone acetonide)), or combinations thereof.
  • the ocular disorder is DME and/or DR.
  • An antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with LUCENTIS® (ranibizumab) for treatment of DME and/or DR (e.g., NPDR or PDR).
  • LUCENTIS® ranibizumab
  • DME DME
  • DR e.g., NPDR or PDR
  • An antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with EYLEA® (aflibercept) for treatment of DME and/or DR (e.g., NPDR or PDR).
  • EYLEA® libercept
  • DME DME
  • DR e.g., NPDR or PDR
  • An antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with OZURDEX® (dexamethasone intravitreal implant) for treatment of DME and/or DR.
  • OZURDEX® diexamethasone intravitreal implant
  • An antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with ILUVIEN® (dexamethasone intravitreal implant) for treatment of DME and/or DR.
  • ILUVIEN® diexamethasone intravitreal implant
  • the TAO/PRN treatment regimen or TAE treatment regimen may be used to administer an AMD therapeutic agent (e.g., ranibizumab or aflibercept) in combination with an antibody of the invention, and/or polymeric formulation thereof.
  • an AMD therapeutic agent e.g., ranibizumab or aflibercept
  • the ocular disorder is AMD (e.g., wet AMD).
  • the ocular disorder is GA.
  • Such combination therapies noted above encompass combined administration (where two or more therapeutic agents are included in the same or separate formulations), and separate administration, in which case, administration of the antibody of the invention can occur prior to, simultaneously, and/or following, administration of the additional therapeutic agent or agents.
  • administration of the anti-IL33 antibody, or polymeric formulation and administration of an additional therapeutic agent occur within about one, two, three, four, or five months, or within about one, two or three weeks, or within about one, two, three, four, five, or six days, of each other.
  • an anti-IL-33 antibody may be co-administered with an anti-IL-13 antibody, e.g., for the treatment of an inflammatory disorder, such as, for example, asthma, airway hyperresponsiveness, airway inflammation, sepsis, septic shock, atopic dermatitis, allergic rhinitis, rheumatoid arthritis, or chronic obstructive pulmonary disease (COPD), or a fibrotic disorder, such as, for example, idiopathic pulmonary fibrosis (IPF).
  • an inflammatory disorder such as, for example, asthma, airway hyperresponsiveness, airway inflammation, sepsis, septic shock, atopic dermatitis, allergic rhinitis, rheumatoid arthritis, or chronic obstructive pulmonary disease (COPD), or a fibrotic disorder, such as, for example, idiopathic pulmonary fibrosis (IPF).
  • an inflammatory disorder such as, for example, asthma, airway hyper
  • any of the anti-IL-33 antibodies described herein may be administered in combination with an additional IL-33 axis binding antagonist.
  • the additional IL-33 axis binding antagonist is anti-IL-33 antibody such as ANB-020 (AnaptyxBio Inc.) or any of the antibodies described in WO2014164959, EP1725261, U.S. Pat. No.
  • an anti-IL-33 antibody may be co-administered with a complement pathway inhibitor.
  • a complement pathway inhibitor may be an inhibitor of the alternative complement pathway (e.g., Factor D, properdin, Factor B, Factor Ba, and Factor Bb) or the classical complement pathway (e.g., C3a, C5, C5a, C5b, C6, C7, C8, C9, and C5b-9).
  • the complement pathway inhibitor may be any complement pathway inhibitor described in WO 2007/056227, which is incorporated herein by reference in its entirety.
  • the complement pathway inhibitor may be a Factor D binding antagonist.
  • a Factor D binding antagonist may an anti-Factor D antibody or an antigen-binding fragment thereof, for example, any Factor D antibody described in WO 2007/056227, WO 01/70818, and/or US 2002/0081293, which are each incorporated herein by reference in their entirety.
  • the anti-Factor D antibody may comprise an amino acid sequence having at least 70% sequence identity (e.g., 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, the monoclonal antibody 166-32 produced from the hybridoma deposited with the American Type Culture Collection (ATCC) and designated HB12476.
  • 70% sequence identity e.g., 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 9
  • the anti-Factor D antibody is a humanized derivative of monoclonal antibody 166-32. In some embodiments, the anti-Factor D antibody binds to the same epitope as monoclonal antibody 166-32. In some instances, the anti-Factor D antibody is an antibody fragment derived from monoclonal antibody 166-32. In some instances, the antibody fragment derived from monoclonal antibody 166-32 is an Fab, Fab′-SH, Fv, scFv, or an (Fab′) 2 fragment. In some embodiments, the antibody fragment derived from monoclonal antibody 166-32 is an Fab.
  • an anti-IL-33 antibody may be co-administered with an HtrA1 binding antagonist.
  • the HtrA1 binding antagonist may be an anti-HtrA1 antibody or an antigen-binding fragment thereof. Any of the anti-HtrA1 antibodies or antigen-binding fragments thereof known in the art and/or described herein may be used.
  • the anti-HtrA1 antibody is an anti-HtrA1 antibody described in U.S. Ser. No. 10/421,822 or U.S. Pat. No. 9,738,727.
  • the anti-HtrA1 antibody fragment is an Fab, Fab′-SH, Fv, scFv, or an (Fab′) 2 fragment. In some embodiments, the anti-HtrA1 antibody fragment is an Fab.
  • an anti-IL-33 antibody may be co-administered with a VEGF antagonist.
  • the VEGF antagonist may be an anti-VEGF antibody or an antigen-binding fragment thereof. Any of the anti-VEGF antibodies or antigen-binding fragments thereof known in the art and/or described herein may be used.
  • the anti-VEGF antibody is bevacizumab (AVASTIN®) or ranibizumab (LUCENTIS®).
  • the anti-VEGF antibody fragment is an Fab, Fab′-SH, Fv, scFv, or an (Fab′) 2 fragment.
  • the anti-VEGF antibody fragment is an Fab.
  • the anti-VEGF antibody or antigen-binding fragment thereof is or is derived from any anti-VEGF antibody described in WO 2005/044853, which is incorporated herein by reference in its entirety.
  • the anti-VEGF antibody is or is derived from a G6 series antibody (e.g., G6, G6-8, G6-23, G6-23.1, G6-23.2, or G6-31) or a B20 series antibody (e.g., B20, B20-4, or B20-4.1).
  • the anti-VEGF antibody is a humanized derivative of any of the preceding antibodies.
  • the anti-VEGF antibody is an antibody fragment derived from any of the preceding antibodies.
  • the antibody fragment is an Fab, Fab′-SH, Fv, scFv, or an (Fab′) 2 fragment.
  • the antibody fragment is an Fab.
  • the invention provides a method of treating geographic atrophy in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of an anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein) and a therapeutically effective amount of a Factor D binding antagonist.
  • an anti-IL-33 antibody e.g., any anti-IL-33 antibody disclosed herein
  • a Factor D binding antagonist may be an anti-Factor D antibody or an antigen-binding fragment thereof, for example, any Factor D antibody described in WO 2007/056227, WO 01/70818, and/or US 2002/0081293.
  • the anti-Factor D antibody may comprise an amino acid sequence having at least 70% sequence identity (e.g., 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, the monoclonal antibody 166-32 produced from the hybridoma deposited with the American Type Culture Collection (ATCC) and designated HB12476.
  • 70% sequence identity e.g., 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 9
  • the anti-Factor D antibody is a humanized derivative of monoclonal antibody 166-32. In some embodiments, the anti-Factor D antibody binds to the same epitope as monoclonal antibody 166-32. In some instances, the anti-Factor D antibody is an antibody fragment derived from monoclonal antibody 166-32. In some instances, the antibody fragment derived from monoclonal antibody 166-32 is an Fab, Fab′-SH, Fv, scFv, or an (Fab′) 2 fragment. In some embodiments, the antibody fragment derived from monoclonal antibody 166-32 is an Fab.
  • the invention provides a method of treating GA, AMD (wet or dry), DR, PCV, or ROP in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of an anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein) and a therapeutically effective amount of a HtrA1 binding antagonist.
  • the HtrA1 binding antagonist may be an anti-HtrA1 antibody or an antigen-binding fragment thereof, for example, any HtrA1 antibody described in U.S. Ser. No. 10/421,822 or U.S. Pat. No. 9,738,727.
  • the anti-HtrA1 antibody is an antibody fragment.
  • the antibody fragment is an Fab, Fab′-SH, Fv, scFv, or an (Fab′) 2 fragment.
  • the antibody fragment derived is an Fab.
  • an additional therapeutic agent is an asthma therapy, as described below.
  • Moderate asthma is currently treated with a daily inhaled anti-inflammatory-corticosteroid or mast cell inhibitor such as cromolyn sodium or nedocromil plus an inhaled beta2-agonist as needed (3-4 times per day) to relieve breakthrough symptoms or allergen- or exercise-induced asthma.
  • exemplary inhaled corticosteroids include QVAR®, PULMICORT®, SYMBICORT®, AEROBID®, FLOVENT®, FLONASE®, ADVAIR®, and AZMACORT®.
  • Additional asthma therapies include long acting bronchial dilators (LABD).
  • the LABD is a long-acting beta-2 agonist (LABA), leukotriene receptor antagonist (LTRA), long-acting muscarinic antagonist (LAMA), theophylline, or oral corticosteroids (OCS).
  • LABDs include SYMBICORT®, ADVAIR®, BROVANA®, FORADIL®, PERFOROMISTTM and SEREVENT®.
  • Such combination therapies noted above encompass combined administration (where two or more therapeutic agents are included in the same or separate formulations), and separate administration, in which case, administration of the antibody disclosed herein can occur prior to, simultaneously, and/or following, administration of the additional therapeutic agent or agents.
  • administration of the anti-IL-33 antibody and administration of an additional therapeutic agent occur within about one month, or within about one, two or three weeks, or within about one, two, three, four, five, or six days, of each other.
  • Antibodies disclosed herein can also be used in combination with radiation therapy.
  • An anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein) (and any additional therapeutic agent) can be administered by any suitable means, including parenteral, intrapulmonary, and intranasal, and, if desired for local treatment, intralesional administration.
  • Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration.
  • an anti-IL-33 antibody may be administered intravitreally, intramuscularly, intravenously, intradermally, percutaneously, intraarterially, intraperitoneally, intralesionally, intracranially, intraarticularly, intraprostatically, intrapleurally, intratracheally, intrathecally, intranasally, intravaginally, intrarectally, topically, intratumorally, peritoneally, subcutaneously, subconjunctivally, intravesicularly, mucosally, intrapericardially, intraumbilically, intraocularly, intraorbitally, orally, topically, transdermally, periocularly, conjunctivally, subtenonly, intracamerally, subretinally, retrobulbarly, intracanalicularly, by inhalation, by injection, by implantation, by infusion, by continuous infusion, by localized perfusion bathing target cells directly, by catheter, by lavage,
  • compositions utilized in the methods described herein can also be administered systemically or locally. Dosing can be by any suitable route, for example, by injections, such as intravenous or subcutaneous injections, depending in part on whether the administration is brief or chronic. Various dosing schedules including but not limited to single or multiple administrations over various time-points, bolus administration, and pulse infusion are contemplated herein.
  • an anti-IL-33 antibody may be administered directly to the eye by ocular tissue injection, for example, using intravitreal, intraocular, periocular, conjunctival, subconjunctival, subtenon, intracameral, subretinal, retrobulbar, or intracanalicular injections; by direct application to the eye, for example, using a catheter or other placement device (e.g., a retinal pellet, intraocular insert, suppository or an implant comprising a porous, non-porous, or gelatinous material); by topical ocular drops or ointments; or by a slow-release device in the cul-de-sac or implanted adjacent to the sclera (transscleral) or in the sclera (intrascleral) or within the eye.
  • Intracameral injection may be through the cornea into the anterior chamber to allow the agent to reach the trabecular
  • Antibodies disclosed herein would be formulated, dosed, and administered in a fashion consistent with good medical practice. Factors for consideration in this context include the particular disorder being treated, the particular mammal being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the agent, the method of administration, the scheduling of administration, and other factors known to medical practitioners.
  • the antibody need not be, but is optionally formulated with one or more agents currently used to prevent or treat the disorder in question. The effective amount of such other agents depends on the amount of antibody present in the formulation, the type of disorder or treatment, and other factors discussed above. These are generally used in the same dosages and with administration routes as described herein, or about from 1 to 99% of the dosages described herein, or in any dosage and by any route that is empirically/clinically determined to be appropriate.
  • an antibody disclosed herein when used alone or in combination with one or more other additional therapeutic agents, will depend on the type of disease to be treated, the type of antibody, the severity and course of the disease, whether the antibody is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the antibody, and the discretion of the attending physician.
  • the antibody is suitably administered to the patient at one time or over a series of treatments.
  • about 1 ⁇ g/kg to 15 mg/kg (e.g., 0.1 mg/kg to 10 mg/kg) of antibody can be an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion.
  • One typical daily dosage might range from about 1 ⁇ g/kg to 100 mg/kg or more, depending on the factors mentioned above. For repeated administrations over several days or longer, depending on the condition, the treatment would generally be sustained until a desired suppression of disease symptoms occurs.
  • One exemplary dosage of the antibody would be in the range from about 0.05 mg/kg to about 10 mg/kg.
  • one or more doses of about 0.5 mg/kg, 2.0 mg/kg, 4.0 mg/kg or 10 mg/kg (or any combination thereof) may be administered to the patient.
  • Such doses may be administered intermittently, e.g. every week, every two weeks, every three weeks, or every four weeks (e.g., such that the patient receives from about two to about twenty, or e.g., about six doses of the antibody).
  • a dose may be administered once per month, (e.g., by subcutaneous injection).
  • An initial higher loading dose, followed by one or more lower doses may be administered.
  • other dosage regimens may be useful. The progress of this therapy is easily monitored by conventional techniques and assays.
  • any of the above formulations or therapeutic methods may be carried out using an immunoconjugate disclosed herein in place of or in addition to an anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein).
  • an article of manufacture containing materials useful for the treatment, prevention and/or diagnosis of the disorders described above is provided.
  • the article of manufacture may include an anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein).
  • the article of manufacture comprises a container and a label or package insert on or associated with the container.
  • Suitable containers include, for example, bottles, vials, syringes, IV solution bags, etc.
  • the containers may be formed from a variety of materials such as glass or plastic.
  • the container holds a composition which is by itself or combined with another composition effective for treating, preventing and/or diagnosing the condition and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
  • At least one active agent in the composition is an antibody disclosed herein.
  • the label or package insert indicates that the composition is used for treating the condition of choice.
  • the article of manufacture may comprise (a) a first container with a composition contained therein, wherein the composition comprises an antibody disclosed herein; and (b) a second container with a composition contained therein, wherein the composition comprises a further cytotoxic or otherwise therapeutic agent.
  • the article of manufacture in this embodiment disclosed herein may further comprise a package insert indicating that the compositions can be used to treat a particular condition.
  • the article of manufacture may further comprise a second (or third) container comprising a pharmaceutically acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution.
  • BWFI bacteriostatic water for injection
  • phosphate-buffered saline such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution.
  • BWFI bacteriostatic water for injection
  • phosphate-buffered saline such as phosphate-buffered saline
  • Ringer's solution such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution.
  • BWFI bacteriostatic water for
  • any of the above articles of manufacture may include an immunoconjugate disclosed herein in place of or in addition to an anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein).
  • Sprague Dawley rats (Charles River, Hollister, Calif.) were immunized with 100 ag/animal for the first dose and 50 ⁇ g/animal for rest of the boosts with human IL-33 divided among sites: intraperitoneal (i.p.), subcutaneous (s.c.) at base of tail, s.c. at nape of neck, and s.c. in both hocks, with Toll-like receptor cocktail adjuvant including monophosphoryl lipid A (MPL) (Sigma-Aldrich, St.
  • MPL monophosphoryl lipid A
  • the lymphocytes were enriched for B cells using biotinylated anti-rat CD4 (Clone OX-35), biotinylated anti-rat CD8a (Clone OX-8), biotinylated anti-rat 11 b/c (Clone OX42), biotinylated anti-rat CD161 (Clone 10/78), and biotinylated anti-rat granulocyte marker (Clone HIS48) antibodies (BD Biosciences), followed by magnetic separation (Miltenyi Biotec, San Diego, Calif.) using streptavidin beads.
  • the B cells were further enriched by using anti-rat IgM (Clone G53-238, BD Biosciences) and followed by magnetic separation (Miltenyi Biotec, San Diego, Calif.) using streptavidin beads. IgM depleted B-cells were fused with Sp2ab mouse myeloma cells (Abeome, Athens, Ga.) via electrofusion (Harvard Apparatus, Holliston, Mass.).
  • Fused cells were incubated at 37° C., 7% CO 2 , overnight in CLONACELLTM-HY Medium C (StemCell Technologies, Vancouver, BC, Canada), before centrifugation and resuspension in CLONACELLTM-HY Medium E (StemCell Technologies) supplemented with hypoxanthine and thymidine (HAT) (Sigma-Aldrich) and plating into 6-well plates and incubation to allow growth at 37° C., 7% CO 2 .
  • CLONACELLTM-HY Medium C StemCell Technologies, Vancouver, BC, Canada
  • HAT hypoxanthine and thymidine
  • hybridomas were stained with anti-rat IgG (goat polyclonal, Jackson ImmunoResearch) conjugated to ALEXA FLUOR® 488 dye, cynomolgus monkey (cyno) IL-33 conjugated to ALEXA FLUOR® 643 dye (Novus Biological) and human IL-33 conjugated to phycoerythrin (PE) (Novus Biological) and sorted for IgG + /human IL-33 + cells/cyno IL-33 + hybridoma cells using a FACSARIATM III sorter (BD, Franklin Lakes, N.J.).
  • Rat hybridoma derived anti-IL-33 antibodies of interest were cloned using standard molecular cloning techniques. Clones were formatted into human IgG vectors for transient expression in CHO cells using standard protocols and purified using MABSELECT SURETM (GE).
  • Hybridoma clones generated as described above were tested for binding to human IL-33 in an ELISA format.
  • 384 well NUNC MAXISORB® plates (Thermo Scientific Nunc 384-well MAXISORB®, Cat. No. 464718) were coated with 50 ⁇ l of IL-33 at 1 ⁇ g/ml in coating buffer (50 mM carbonate, pH 9.6) overnight at 4° C. Plates were then blocked with ELISA diluent buffer (100 ⁇ l/well for 1 h). Hybridoma supernatants or purified hybridoma antibody diluted in ELISA diluent buffer were added to blocked plates (50 ⁇ l/well) and allowed to incubate at room temperature for 30 min.
  • the IL-33 neutralization activity of anti-IL-33 antibodies as obtained from methods described above were determined by a cell-based assay.
  • HEK-BLUETM IL-33 cells (InvivoGen, Cat. No. hkb-hlL-33) were grown and treated according to manufacturer's supplied protocol.
  • Serial dilutions of anti-IL-33 purified hybridoma antibodies were preincubated for 1 h at 37° C. with human IL-33 (160 pM), cyno IL-33 (300 pM) or mutant human IL-33 (14 pM) in test medium.
  • Premixed antibody and IL-33 was added to the cells and incubated at 37° C. in a CO 2 incubator for 20-24 h.
  • QUANTI-BLUETM alkaline phosphatase detection medium (Invivogen, Cat. No. rep-qb2) was prepared according to manufacturer's protocol. QUANTI-BLUETM (40 ⁇ l) was added to a flat9 bottom 384 well plate (Thermo Scientific NUNCTM 384-well MAXISORBTM, Cat. No. 464718) and 10 ⁇ l of cell supernatant was added. After 1 h incubation at 37° C., secreted embryonic alkaline phosphatase (SEAP) levels were determined using a spectrophotometer at 620-655 nm. IC50 values generated by GENEDATA SCREENER® software are shown in Table 1 below. The amino acid sequences of the heavy chain variable region and light chain variable region of 1E1 are shown in FIGS. 1 A and 1 B , respectively.
  • An array-based SPR imaging system (CFM/IBIS, CARTERRA® USA) was used to analyze binding kinetics and epitope bin a panel of anti-IL-33 monoclonal antibodies.
  • Purified hybridoma antibodies were diluted at 10 ⁇ g/mi in 10 mM sodium acetate buffer pH 4.5.
  • amine coupling antibodies were directly immobilized onto a SPR sensorprism CMD 200M chip (XanTec Bioanalytics, Germany) using a Continuous Flow Microspotter (CARTERRA®, USA) to create an array of antibodies.
  • the IBIS MX96 SPR imager (SPRi) (CARTERRA®, USA) was used to evaluate binding to the immobilized antibodies and the experiments were performed at 25° C. in a running buffer of 10 mM 4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid (HEPES), pH 7.4, 150 mM NaCl, 3 mM EDTA, and 0.005% TWEEN®20 (HBS-TE).
  • HEPES 4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid
  • HBS-TE TWEEN®20
  • IL-33 was injected for a time of 3 min and allowed to disassociate for a time of 10 min. The surface was regenerated between cycles with 10 mM glycine pH 1.7.
  • top anti-IL-33 antibodies were measured using SPR on a BIACORE® T200 instrument (GE Healthcare).
  • a CM5 Series S sensorchip was coated with anti-rat Fc (Jackson) to create a capture surface.
  • Antibody binding was measured to human, cyno, rat, mouse and oxidized IL-33 (His-tagged) using a concentration series starting with 50 nM with 1:3 dilutions.
  • Sensorgrams for binding of cytokine were recorded using an injection time of 2 min with a flow rate of 30 ⁇ l/min, at a temperature of 25° C., and with a running buffer of 10 mM HEPES, pH 7.4, 150 mM NaCl, 3 mM EDTA, and 0.005% TWEEN®20. After injection, disassociation of the IL-33 from the antibody was monitored for 10 min in running buffer. The surface was regenerated between binding cycles with a 30 ⁇ injection of 10 mM glycine HCl pH 1.7.
  • Humanization variants were generated by grafting the light chain and heavy chain CDRs from rat anti-IL-33 clone 1E1 into the closest matching human frameworks. Residues at Vernier positions were allowed to toggle between rat and human.
  • a matrix of light chain and heavy chain variants in a human IgG1 backbone were transiently expressed small scale in EXPI293FTM cells and purified using MABSELECT SURETM antibody purification resin (GE).
  • Variants 1E1v1-1E1v23 (see Table 3 below) were analyzed for binding to cytokine and functional activity. The amino acid sequences of the heavy chain variable region and light chain variable region of these variants are shown in FIGS. 2 A and 2 B , respectively.
  • a protein A sensorchip (GE Healthcare) was used following manufacturer provided protocols to capture humanized anti-IL-33 antibodies using a BIACORE® T200 instrument (GE). Antibody binding was measured to human IL-33 (His-tagged) using multi-cycle kinetics. Sensorgrams for binding of IL-33 were recorded using an injection time of 2 min with a flow rate of 30 ⁇ l/min, at a temperature of 25° C., and with a running buffer of 10 mM HEPES, pH 7.4, 150 mM NaCl, 3 mM EDTA, and 0.005% TWEEN620. After injection, disassociation of IL-33 from the antibody was monitored for 10 min in running buffer.
  • the IL-33 neutralization activity of selected anti-IL-33 1E1 humanization variants were determined by a HEK-BLUETM IL-33 cell-based assay (InvivoGen, Cat. No. hkb-hlL-33). The assay was performed as described above using human IL-33 (160 pM). IC 50 values generated by GENEDATA SCREENER® software are shown in Table 3 below.
  • the 1E1v8 variant was reformatted into a human IgG1 Fab construct and expressed in E. coli .
  • Bacteria were lysed following expression and Fab was purified using GAMMABINDTM Plus sepharose (GE) following standard methods.
  • GAMMABINDTM Plus sepharose (GE) following standard methods.
  • a secondary purification step was performed using a HITRAP® sepharose high performance (SP HP) column (GE) to obtain final protein.
  • the binding kinetics of the 1E1v8 Fab were measured using SPR on a BIACORE® 8k instrument (GE Healthcare). 1E1v8 Fab was directly immobilized on 4 different flow cells of a CM5 Series S sensorchip at low density using amine coupling. Antibody fragment binding was measured to human and cyno IL-33 (His-tagged) using a concentration series starting with 50 nM with 1:3 dilutions. Sensorgrams for binding of IL-33 were recorded using an injection time of 2 min with a flow rate of 100 ⁇ l/min, at a temperature of 25° C.
  • Table 5 shows results of MA analysis for 1E1v8 Fab.
  • Oxidatively stressed samples were prepared by incubating 1 mM 2,2′-azobis (2-amidinopropane) dihydrochloride (AAPH) with 1.25 mg of antibody in low-ionic histidine-acetate, pH 5.5, for 16 h at 40° C. After 16 h, AAPH was quenched by adding to the solution a 20:1 excess of methionine (Met) to AAPH. Control samples were spiked with water instead of AAPH. Control and stress samples were buffer-exchanged prior to analysis.
  • AAPH 2,2′-azobis (2-amidinopropane) dihydrochloride
  • antibody samples were incubated at 1 mg/mL and 150 mg/mL in low-ionic buffer, pH 5.5, for 2 weeks at 40° C. or PBS, pH 7.4, for 2 weeks at 37° C. Control samples were stored at ⁇ 70° C.
  • Ultra-high-performance liquid chromatography-high resolution mass spectrometry (UHPLC-HRMS) analysis was performed as follows. Tryptic digests were analyzed using an ACQUITY® H-Class UHPLC (Waters) coupled to a Q EXACTIVETM (Thermo Fisher) mass spectrometer (MS). Separation of a 10 ⁇ g injection was performed on an ACQUITY® UPLC Peptide CSH C18 column (Waters) with 1.7 ⁇ m, 130 ⁇ particles running a flow rate of 0.2 mL/min at 77° C. Mobile phase A was water, and mobile phase B was acetonitrile, each containing 0.1% formic acid.
  • the gradient was as follows: 2 min of 1% mobile phase B, 5 min of 1-13% mobile phase B, 35 min of 13-35% mobile phase B, 2 min of 35-95% mobile phase B, 2 min of 95% mobile phase B.
  • MS data were collected in positive ion mode using a Top 8 data-dependent scan mode with resolution set to 35 000 for MS scans and 17 500 for MS2 scans. Dynamic exclusion was turned off, and the precursor scan range was set at 200-2000 m/z. External calibration of the instrument was conducted prior to sample analysis. Data were processed using instrument vendor software specific for biopharmaceutical characterization.
  • Relative quantitation of the chemical sequence motif was generated by integrating the extracted ion chromatograms of the monoisotopic m/z using the two most abundant charge states for the native tryptic peptide and its modified counterpart.
  • the modified peptide peak area was divided by the sum of the modified and native peak areas and multiplied by 100 to obtain the percent modification for each chemical sequence motif.
  • the percent change in deamidation of asparagine (N) residues, isomerization of aspartic acid (D) residues, and hydrolysis at asparagine-proline/aspartic acid-proline (NP/DP) bonds was measured following accelerated thermal stress in histidine-acetate and PBS buffers.
  • the percent change in oxidation of methionine (M) and tryptophan (W) residues was measured following oxidative stress.
  • Viscosity measurements of the 1E1v8 Fab were performed on a Anton Paar Modular Compact Rheometer MCR502 using a CP20-0.3 measuring cone with a 20 mm diameter and 0.3 angle and a P-PTD 200/56/AIR lower plate with a 56 mm diameter. Samples went through shear-rate sweeps ramping from 10 to 10,000 s ⁇ 1 . The reported value is the average of 2-3 shear rate sweeps of a sample at 1,000 s ⁇ 1 at 25° C. with increasing protein concentration ranging from 4-177 mg/ml in 20 mM histidine acetate, 150 mM NaCl, 240 mM sucrose at pH 5.5. Table 7 shows viscosity results of the 1E1v8 Fab, and Table 8 shows solubility results of the 1E1v8 Fab.
  • the 1E1v8 Fab proved to have properties superior to those of the prior 10C12 antibody, which had lower viscosity at 188 mg/mL and had higher turbidity as compared to 1E1v8, as shown in Tables 9 and 10.
  • Anti-IL-33 antibodies obtained from available sequences were reformatted into a human IgG1 Fab and human IgG1 constructs.
  • the huIgG1 Fabs were expressed in E. coli .
  • Bacteria were lysed following expression and Fab was purified using GAMMABIND® Plus Sepharose (GE) following standard methods.
  • GAMMABIND® Plus Sepharose (GE) following standard methods.
  • a secondary purification step was performed using a HITRAP® SP HP column (GE) to obtain final protein.
  • the human IgG1s were expressed transiently in EXPI293F® cells and purified using MABSELECT SURETM (GE).
  • An array-based SPR imaging system (CFM/IBIS, CARTERRA®, USA) was used to epitope bin a panel of anti-IL-33 monoclonal antibodies (see Table 11).
  • Anti-IL-33 antibodies 10C12 and 4G12 are described in U.S. Pat. No. 10,093,730.
  • Purified monoclonal antibodies were diluted at 10 ⁇ g/ml in 10 mM sodium acetate buffer pH 4.5.
  • amine coupling antibodies were directly immobilized onto a SPR sensorprism CMD 200M chip (XanTec Bioanalytics, Germany) using a Continuous Flow Microspotter (CARTERRA®, USA) to create an array of antibodies.
  • the IBIS MX96 SPRi (CARTERRA®, USA) was used to evaluate binding to the immobilized antibodies and the experiments were performed at 25′C in a running buffer of 10 mM HEPES, pH 7.4, 150 mM NaCl, 3 mM EDTA, and 0.005% TWEEN®20 (HBS-TE).
  • human IL-33 was first injected for 4 min at 100 nM and was followed by a second 4 min injection of purified antibody at 10 ⁇ g/ml in a running buffer of HBS-TE. The surface was regenerated between cycles with 10 mM glycine pH 1.7.
  • the binding data was processed using Epitope Binning software tool (CARTERRA®, USA) and the results are shown in FIGS. 3 A- 3 E .
  • Anti-IL-33 monoclonal antibodies that were directly immobilized onto a sensorprism chip via amine coupling were binned against each other to assess overlapping epitopes. After human IL-33 was allowed to bind to the immobilized antibodies, each antibody was injected in solution one at a time to evaluate whether it was able to still bind to antigen or if it was blocked by antigen bound to the immobilized antibodies. For all antibodies, binding/binning data was collected from immobilization on the chip surface and also when injected in solution. Relationships between clones or bins of clones based on blocking activity and shown in the form of network plots and a heatmap ( FIGS. 3 A and 3 B ).
  • Clones 1E1v8, 10C12, RG18, and 158LS all directly blocked each other and showed similar blocking activity when compared to other antibodies ( FIG. 3 C ). Additionally, they blocked and were blocked by clones 4G12 and Ab43. Clones 4G12 and Ab43 showed different blocking activity because they also block RG3 and 3F110 ( FIG. 3 D ). Clone 640087-7B only blocked and is blocked by clones RG3 and 3F110 ( FIG. 3 E ).
  • Phase 1a multicenter, open label, single dose, dose escalation study investigates the ocular and systemic safety, tolerability, pharmacokinetics (PK), and immunogenicity of intravitreal (IVT) injections of anti-IL-33 antibody in patients with GA secondary to AMD.
  • PK pharmacokinetics
  • IVTT immunogenicity of intravitreal injections of anti-IL-33 antibody in patients with GA secondary to AMD.
  • Patients Male or female, who are at least 50 years of age, have a best corrected visual acuity (BCVA) in the range of Snellen 20/125-20/400, and have a GA lesion area of at least 0.5 disc area, inclusive, are eligible.
  • Site investigators are qualified ophthalmologists. Only one eye may be chosen as the study eye. If both eyes are eligible, the eye with the worse vision (i.e., worse visual acuity (VA) and/or least function as determined by the investigator and patient) will be selected for the study treatment (study eye).
  • Each patient must satisfy all eligibility criteria at both the screening and the Day 1 visit (i.e., when the patient is enrolled into the study and when study drug is administered).
  • images taken at the screening visit i.e., color fundus photographs, fluorescein angiogram, and spectral domain optical coherence tomography
  • the central reading center for evaluation by the Day 1 visit.
  • Eligible patients are sequentially enrolled into cohorts. Each cohort is administered at gradually ascending dose levels with 1 sentinel patient at each level to ensure only 1 active patient is dosed initially at any dose level. Use of a sentinel patient at each level is to ensure that at most, 1 active patient is dosed for the first time at any dose level. Eligible patients are dosed with the study drug on Day 1, which will occur within 28 days of screening.
  • This study consists of two stages: a single-ascending dose stage with 4 planned ITV doses (1 mg, 3 mg, 10 mg, and 20 mg) to evaluate single-dose safety and tolerability of anti-IL-33 antibody with 3-6 patients in each cohort and an expansion cohort stage consisting of approximately 9-12 patients (for a maximum total of 15 patients) at the maximum tolerated dose (MTD) or maximum tested dose (MTeD) to obtain a minimum of 10 evaluable patients to further characterize safety, tolerability, and pharmacokinetics; and modulation of downstream IL-33 pathway activity.
  • a single-ascending dose stage with 4 planned ITV doses (1 mg, 3 mg, 10 mg, and 20 mg) to evaluate single-dose safety and tolerability of anti-IL-33 antibody with 3-6 patients in each cohort and an expansion cohort stage consisting of approximately 9-12 patients (for a maximum total of 15 patients) at the maximum tolerated dose (MTD) or maximum tested dose (MTeD) to obtain a minimum of 10 evaluable patients to
  • the study is divided into three periods: a screening period lasting up to 28 days, a treatment period consisting of a single day (Day 1) during which anti-IL-33 antibody is administered, and a 12 week follow up period.
  • the duration of study for each patient is 12 weeks, excluding the screening period.
  • the end of the study is defined as the date when the last patient, last visit (LPLV) occurs.
  • This study allows graded exposure to anti-IL-33 antibody with escalation to the next higher dose cohort based on safety and tolerability data for at least 3 patients from the preceding dose cohort(s) after 14 days of follow up has elapsed from the last patient in the cohort.
  • the last cohort i.e., Cohort D or cohort determined to be MTD
  • an additional expansion cohort of 9-12 patients for a total of 15 patients are enrolled to obtain a minimum 10 evaluable patients for further safety, PK, and PD evaluation.
  • Evaluable patients are defined as patients who have received study drug injection, have completed the Week 12 visit, have not taken any prohibited therapy, and have not received any surgical or interventional procedures during the study.
  • This study is initially conducted in approximately 24-33 patients (one study eye per patient). Up to two additional optional cohorts of 15 patients each may be added for a potential total of 63 patients enrolled in the study.
  • the primary objective of this study is to characterize the safety profile associated with anti-IL-33 antibody administration. Statistical summaries are descriptive in nature (e.g., incidence rates, means, and percentiles). Patients are grouped according to treatment received, and any patients who receive any amount of anti-IL-33 antibody is included in the analyses.
  • the primary analysis is safety analyses which include all patients who receive at least 1 dose of study drug, with patients grouped according to treatment received. Ocular and non-ocular adverse events, serious adverse events, and death are summarized separately. Abnormal ocular findings, laboratory test results and vital signs are listed. DLAEs are listed and summarized by study drug dose level and frequency cohorts.
  • Another safety objective is to determine the maximum tolerated dose administered as a single dose on the basis of the following endpoints: (1) frequency, severity, and timing of ocular and non-ocular adverse events including dose-limiting adverse events (DLAEs), serious adverse events, adverse events leading to study discontinuation and adverse events of special interest; (2) frequency, severity, and timing of notable findings in ocular examinations and ocular imaging following anti-IL-33 antibody administration; and (3) frequency, severity, and timing of notable findings in vital signs, physical findings, and clinical laboratory results following anti-IL-33 antibody administration.
  • DLAEs dose-limiting adverse events
  • Another objective is to characterize the PK of anti-IL-33 antibodies in patients with GA secondary to AMD on the basis of the following endpoints: (1) serum concentration of anti-IL-33 at specified timepoints; and (2) aqueous humor concentration of anti-IL-33 antibodies at specified timepoints
  • Another objective for this study is to evaluate the immune response to anti-IL-33 on the basis of the following endpoint: prevalence of anti-drug antibodies (ADAs) at baseline and incidence of ADAs during the study. The immunogenicity of anti-IL-33 antibodies will be assessed by the detection of serum ADAs.
  • PK objectives for this study are to evaluate potential relationships between drug exposure and safety, and drug exposure and exploratory biomarker response following single ITV doses on the basis of the following endpoint: PK exposure (e.g., serum and/or aqueous humor anti-IL-33 antibody concentrations) and safety and/or exploratory biomarker endpoints.
  • endpoint e.g., serum and/or aqueous humor anti-IL-33 antibody concentrations
  • the immunogenicity objective for this study is to evaluate potential effects of ADAs on the basis of the following endpoint: relationship between ADA status and safety, PK, or activity endpoints.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Immunology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Epidemiology (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Endocrinology (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Ophthalmology & Optometry (AREA)
  • Pain & Pain Management (AREA)
  • Rheumatology (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)

Abstract

The invention provides interleukin-33 (IL-33) antibodies and methods of making and using the same, e.g., for treatment of IL-33 mediated disorders (e.g., ocular disorders such as AMD (e.g., geographic atrophy (GA)).

Description

SEQUENCE LISTING
The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Mar. 11, 2021, is named 50474-219003_Sequence_Listing_03.11.21_ST25 and is 68,754 bytes in size.
FIELD OF THE INVENTION
The invention relates to anti-interleukin-33 (IL-33) antibodies, and methods of making and using the same, including for treatment of IL-33-mediated disorders.
BACKGROUND
Age-related macular degeneration (AMD) is the leading cause of irreversible blindness in people aged 50 years or older in the developed world. The majority of the visual loss occurs in the advanced stage of AMD, which has two clinical forms: a non-exudative form, geographic atrophy (GA), which is characterized by loss of photoreceptors, retinal pigment epithelium (RPE), and choriocapillaris, and an exudative or wet form, which is characterized by choroidal neovascularization (CNV). In the early stages of GA, patients typically show minimal changes in central visual acuity (VA). However, while central VA may not yet be affected, patients often still experience significant symptoms from visual dysfunction, such as dense parafoveal scotomas (e.g., leading to difficulties with face recognition), delayed dark adaptation, reduced contrast sensitivity, and a decrease in reading rate. In the later stages, as the GA lesion expands into the fovea, a profound decrease in central VA occurs with a decline in activities of daily living. Moreover, GA is bilateral in most patients with advanced AMD. As such, GA is a significant cause of both moderate and severe central visual loss. At present, there are no approved treatments for GA, and there is a high unmet need with more than five million patients worldwide.
Interleukin-33 (IL-33) is a member of the interleukin-1 (IL-1) cytokine family that is encoded by the IL33 gene, and is expressed in structural cells, such as smooth muscle, epithelial (e.g., retinal pigment epithelium (RPE) cells), endothelial cells (e.g., choroidal endothelial cells), Muller cells, and astrocytes. IL-33 can be induced by inflammatory factors in macrophages and dendritic cells. Cellular stress caused by environmental triggers, such as allergens, toxins, and pathogens, can lead to IL-33 release. For example, IL-33 is released from Muller cells upon phototoxic stress, and induces CCL2 and monocyte-dependent retinal degeneration in preclinical models. Bioavailable IL-33 associates with a heterodimeric IL-33 receptor complex composed of suppression of tumorigenicity 2 (ST2) protein and interleukin-1 receptor accessory protein (IL-1RAcP) to activate the AP-1 and NF-κB pathways through the adaptor protein myeloid differentiation primary response 88 (MyD88) and possibly MyD88-adapter-like (Mal) protein. IL-33 stimulates a number of cell types, including innate type II (ILC2) cells, mast cells, basophils, eosinophils, and dendritic cells, to promote Type 2 immunity.
The IL-33 pathway has been suggested to be involved in various diseases, including ocular diseases (e.g, GA) for which there remains a need to develop improved compositions, and methods for treatment.
SUMMARY
The present invention relates, inter alia, to anti-IL-33 antibodies and methods of making and using the same.
In one aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising a heavy chain variable (VH) domain and a light chain variable (VL) domain, the binding domain comprising the following six complementarity-determining regions (CDRs): (a) a CDR-H1 comprising the amino acid sequence of NYWMT (SEQ ID NO: 1); (b) a CDR-H2 comprising the amino acid sequence of SITYTGGGTYYPDSVKG (SEQ ID NO: 2); (c) a CDR-H3 comprising the amino acid sequence of ANYYYNTYGGFPY (SEQ ID NO: 3); (d) a CDR-L1 comprising the amino acid sequence of LASEGFSNDLA (SEQ ID NO: 4); (e) a CDR-L2 comprising the amino acid sequence of AASRLQD (SEQ ID NO: 5); and (f) a CDR-L3 comprising the amino acid sequence of QQGSKYPLT (SEQ ID NO: 6).
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 7; (b) a VL domain comprising an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 8; or (c) a VH domain as in (a) and a VL domain as in (b).
In some aspects, the VH domain comprises: (a) an FR-H1 comprising the amino acid sequence of EVQLVX1SGX2X3X4X5X6PGX7SX8X9X10SCX11ASGFTFN (SEQ ID NO: 9), wherein X1 is E or Q; X2 is G or A; X3 is G or E; X4 is L or V; X5 is V or K; X6 is Q or K; X7 is G, A, or T; X8 is L or V; X9 is R or K; X10 is L or V; and X11 is A, K, or L; (b) an FR-H2 comprising the amino acid sequence of WX1RQAPGX2GLEWX3X4(SEQ ID NO: 10), wherein X1 is I or V; X2 is K or Q; X3 is V, M, or I; and X4 is A or G; (c) an FR-H3 comprising the amino acid sequence of RX1TX2X3RDX4X5X6X7X8X9YX10X11X12X13SLRX14EDTAX15YYCTR (SEQ ID NO: 11), wherein X1 is F or V; X2 is I or M; X3 is S or T; X4 is D, N, or T; X5 is A or S; X6 is K or T; X7 is S or N; X8 is S or T; X9 is L or V; X10 is L or M; X11 is Q or E; X12 is M or L; X13 is N or S; X14 is A or S; and X15 is V or T; and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
In some aspects, the VH domain comprises: (a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); (b) an FR-H2 comprising the amino acid sequence of WIRQAPGKGLEWVA (SEQ ID NO: 18); (c) an FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
In some aspects, the VH domain comprises the amino acid sequence of SEQ ID NO: 7.
In some aspects, the VH domain comprises: (a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); (b) an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 39); (c) an FR-H3 comprising the amino acid sequence of RFTISRDNAKNSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 40); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
In some aspects, the VH domain comprises the amino acid sequence of SEQ ID NO: 41.
In some aspects, the VH domain comprises: (a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); (b) an FR-H2 comprising the amino acid sequence of WIRQAPGKGLEWIA (SEQ ID NO: 42); (c) an FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
In some aspects, the VH domain comprises the amino acid sequence of SEQ ID NO: 43.
In some aspects, the VH domain comprises: (a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); (b) an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 39); (c) an FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
In some aspects, the VH domain comprises the amino acid sequence of SEQ ID NO: 44.
In some aspects, the VH domain comprises: (a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); (b) an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 39); (c) an FR-H3 comprising the amino acid sequence of RFTISRDDAKNSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 45); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
In some aspects, the VH domain comprises the amino acid sequence of SEQ ID NO: 46.
In some aspects, the VH domain comprises: (a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); (b) an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 39); (c) an FR-H3 comprising the amino acid sequence of RFTISRDNAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 47); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
In some aspects, the VH domain comprises the amino acid sequence of SEQ ID NO: 48.
In some aspects, the VH domain comprises: (a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); (b) an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWIA (SEQ ID NO: 49); (c) an FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
In some aspects, the VH domain comprises the amino acid sequence of SEQ ID NO: 50.
In some aspects, the VH domain comprises: (a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); (b) an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWIA (SEQ ID NO: 49); (c) an FR-H3 comprising the amino acid sequence of RFTISRDDSKSTLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 51); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
In some aspects, the VH domain comprises the amino acid sequence of SEQ ID NO: 52.
In some aspects, the VL domain comprises: (a) an FR-L1 comprising the amino acid sequence of X1IX2X3TQSPX4X5LSX6SX7GX8X9X10X11X12X13C (SEQ ID NO: 13), wherein X1 is D or E; X2 is Q or V; X3 is M or L; X4 is S or A; X5 is S or T; X6 is A or L; X7 is V, P, or L; X8 is D or E; X9 is R or T; X10 is V or A; X11 is T or S; X12 is I or L; and X13 is T, S, or E; (b) an FR-L2 comprising the amino acid sequence of WX1QQKX2GX3X4PX5X6LIY (SEQ ID NO: 14), wherein X1 is Y or F; X2 is P or S; X3 is K or Q; X4 is S or A; X5 is K, R, or Q; and X6 is L or S; (c) an FR-L3 comprising the amino acid sequence of GX1PX2RFSGSGSGTX3FX4LX5ISX6X7X8PEDX9AX10YX11C (SEQ ID NO: 15), wherein X1 is V or I; X2 is S or A; X3 is D or R; X4 is T or S; X5 is T or K; X6 is S or G; X7 is L or M; X8 is Q or E; X9 is F, V, or E; X10 is T, V, or D; and X11 is F or Y; and (d) an FR-L4 comprising the amino acid sequence of FGX1GTKX2EIK (SEQ ID NO: 16), wherein X1 is G or S and X2 is V or L.
In some aspects, the VL domain comprises: (a) an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); (b) an FR-L2 comprising the amino acid sequence of WYQQKPGKSPKLLIY (SEQ ID NO: 22); (c) an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYFC (SEQ ID NO: 23); and (d) an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24).
In some aspects, the VL domain comprises the amino acid sequence of SEQ ID NO: 8.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 7 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 8.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a heavy chain (HC) comprising an amino acid sequence of SEQ ID NO: 25 and (b) a light chain (LC) comprising an amino acid sequence of SEQ ID NO: 26.
In some aspects, the VL domain comprises: (a) an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); (b) an FR-L2 comprising the amino acid sequence of WFQQKPGKAPKSLIY (SEQ ID NO: 53); (c) an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 54); and (d) an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24).
In some aspects, the VL domain comprises the amino acid sequence of SEQ ID NO: 55.
In some aspects, the VL domain comprises: (a) an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); (b) an FR-L2 comprising the amino acid sequence of WYQQKPGKAPKSLIY (SEQ ID NO: 56); (c) an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYFC (SEQ ID NO: 23); and (d) an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24).
In some aspects, the VL domain comprises the amino acid sequence of SEQ ID NO: 57.
In some aspects, the VL domain comprises: (a) an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); (b) an FR-L2 comprising the amino acid sequence of WFQQKPGKAPKSLIY (SEQ ID NO: 53); (c) an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYFC (SEQ ID NO: 23); and (d) an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24).
In some aspects, the VL domain comprises the amino acid sequence of SEQ ID NO: 58.
In some aspects, the VL domain comprises: (a) an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); (b) an FR-L2 comprising the amino acid sequence of WYQQKPGKAPKSLIY (SEQ ID NO: 56); (c) an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 54); and (d) an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24).
In some aspects, the VL domain comprises the amino acid sequence of SEQ ID NO: 59.
In some aspects, the VL domain comprises: (a) an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); (b) an FR-L2 comprising the amino acid sequence of WYQQKPGKSPKLLIY (SEQ ID NO: 22); (c) an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDVATYYC (SEQ ID NO: 60); and (d) an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24).
In some aspects, the VL domain comprises the amino acid sequence of SEQ ID NO: 61.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 41 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 55.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 43 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 55.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 41 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 8.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 43 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 8.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 44 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 8.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 46 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 8.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 48 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 8.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 43 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 57.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 44 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 57.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 46 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 57.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 48 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 57.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 50 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 57.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 43 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 58.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 44 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 58.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 46 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 58.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 48 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 58.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 50 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 58.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 43 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 59.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 44 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 59.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 46 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 59.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 48 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 59.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 50 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 59.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 52 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 61.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 35; (b) a VL domain comprising an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 36; or (c) a VH domain as in (a) and a VL domain as in (b).
In some aspects, the VH domain comprises: (a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGTSLKLSCLASGFTFN (SEQ ID NO: 27); (b) an FR-H2 comprising the amino acid sequence of WIRQAPGKGLEWIA (SEQ ID NO: 28); (c) an FR-H3 comprising the amino acid sequence of RFTISRDDAKSTLYLQMNSLRSEDTATYYCTR (SEQ ID NO: 29); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
In some aspects, the VH domain comprises the amino acid sequence of SEQ ID NO: 35.
In some aspects, the VL domain comprises: (a) an FR-L1 comprising the amino acid sequence of DIQMTQSPASLSASLGETVSIEC (SEQ ID NO: 31); (b) an FR-L2 comprising the amino acid sequence of WYQQKSGKSPQLLIY (SEQ ID NO: 32); (a) an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTRFSLKISGMQPEDEADYFC (SEQ ID NO: 33); and (d) an FR-L4 comprising the amino acid sequence of FGSGTKLEIK (SEQ ID NO: 34).
In some aspects, the VL domain comprises the amino acid sequence of SEQ ID NO: 36.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 35 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 36.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, wherein the antibody comprises a binding domain comprising (a) a heavy chain (HC) comprising an amino acid sequence of SEQ ID NO: 37 and (b) a light chain (LC) comprising an amino acid sequence of SEQ ID NO: 38.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 65; (b) a VL domain comprising an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 69; or (c) a VH domain as in (a) and a VL domain as in (b).
In some aspects, the VH domain comprises: (a) an FR-H1 comprising the amino acid sequence of EVQLVQSGAEVKKPGASVKVSCKASGFTFN (SEQ ID NO: 62); (b) an FR-H2 comprising the amino acid sequence of WVRQAPGQGLEWMG (SEQ ID NO: 63); (c) an FR-H3 comprising the amino acid sequence of RVTMTRDTSTSTVYMELSSLRSEDTAVYYCTR (SEQ ID NO: 64); and (d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
In some aspects, the VH domain comprises the amino acid sequence of SEQ ID NO: 65.
In some aspects, the VL domain comprises: (a) an FR-L1 comprising the amino acid sequence of EIVLTQSPATLSLSPGERATLSC (SEQ ID NO: 66); (b) an FR-L2 comprising the amino acid sequence of WYQQKPGQAPRLLIY (SEQ ID NO: 67); (c) an FR-L3 comprising the amino acid sequence of GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC (SEQ ID NO: 68); and (d) an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24).
In some aspects, the VL domain comprises the amino acid sequence of SEQ ID NO: 69.
In another aspect, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 65 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 69.
In some aspects, the antibody specifically binds human or cyno IL-33.
In some aspects, the antibody specifically binds both human and cyno IL-33.
In some aspects, the antibody specifically binds both human and cyno IL-33 with a KD of about 1 nM or lower.
In some aspects, the antibody specifically binds human IL-33 with a KD between about 100 fM and about 1 nM.
In some aspects, the antibody specifically binds human IL-33 with a KD between about 750 fM and about 300 pM.
In some aspects, the antibody specifically binds human IL-33 with a KD between about 1 pM and about 200 pM.
In some aspects, the antibody specifically binds human IL-33 with a KD of about 118 pM.
In some aspects, the antibody specifically binds human IL-33 with a KD of about 15 pM.
In some aspects, the antibody specifically binds cyno IL-33 with a KD between about 100 fM and about 1 nM.
In some aspects, the antibody specifically binds cyno IL-33 with a KD between about 1 pM and about 500 pM.
In some aspects, the antibody specifically binds cyno IL-33 with a KD between about 20 pM and about 50 pM.
In some aspects, the antibody specifically binds cyno IL-33 with a KD of about 35 pM.
In some aspects, the antibody specifically binds both human and cyno IL-33 with a KD of between about 1 pM and about 500 pM.
In some aspects, the antibody specifically binds both human and cyno IL-33 with a KD of between about 10 pM and about 40 pM.
In some aspects, the antibody is capable of inhibiting the binding of IL-33 to an IL-33 receptor.
In some aspects, the inhibiting is measured using a cell-based blocking assay.
In some aspects, the antibody inhibits binding of human IL-33 to an IL-33 receptor with an IC50 of between about 800 fM and about 100 pM.
In some aspects, the IC50 is between about 1 pM and about 50 pM.
In some aspects, the IC50 is about 31 pM.
In some aspects, the antibody has a viscosity of less than about 5 centipoise (cP) at a concentration of about 180 mg/mL.
In some aspects, the antibody has a viscosity of between about 3 cP and about 5 cP at a concentration of about 180 mg/mL.
In some aspects, the antibody has a viscosity of about 4.6 cP at a concentration of about 180 mg/mL.
In some aspects, the antibody has a turbidity (optical density (OD)) of about 0.5 or lower at a concentration of about 150 mg/ml or higher in phosphate-buffered saline (PBS) pH 7.4.
In some aspects, the antibody has a turbidity (OD) of between about 0.25 and about 0.5 at a concentration of about 150 mg/ml to about 250 mg/ml.
In some aspects, the antibody has a turbidity (OD) of about 0.38 at a concentration of about 200 mg/ml.
In some aspects, the antibody is monoclonal, human, humanized, or chimeric.
In some aspects, the antibody is an antibody fragment that binds IL-33.
In some aspects, the antibody fragment is an Fab, Fab′-SH, Fv, scFv, or (Fab′)2 fragment.
In some aspects, the antibody fragment is an Fab.
In some aspects, the antibody is a full-length antibody.
In some aspects, the antibody is an IgG antibody.
In some aspects, the IgG antibody is an IgG1 antibody.
In some aspects, the IgG antibody is an IgG4 antibody.
In some aspects, the antibody is a monospecific antibody.
In some aspects, the antibody is a multispecific antibody.
In some aspects, the antibody is a bispecific antibody.
In some aspects, the bispecific antibody comprises a second binding domain that binds to a second biological molecule, wherein the second biological molecule is interleukin-13 (IL-13), interleukin-4 (IL-4), interleukin-5 (IL-5), interleukin-17 (IL-17), Factor D, HtrA1, VEGF, or a VEGF receptor.
In another aspect, provided herein is an isolated nucleic acid encoding any one of the antibodies disclosed herein or a set of isolated nucleic acids together encoding the antibody.
In another aspect, provided herein is a vector or a set of vectors comprising any of the isolated nucleic acids or set of isolated nucleic acids disclosed herein.
In another aspect, provided herein is a host cell comprising any one of the vectors or the set of vectors disclosed herein.
In some aspects, the host cell is a mammalian cell.
In some aspects, the mammalian cell is a Chinese hamster ovary (CHO) cell.
In some aspects, the host cell is a prokaryotic cell.
In some aspects, the prokaryotic cell is E. coli.
In another aspect, provided herein is a method of producing an antibody that specifically binds to IL-33, the method comprising culturing any one of the host cells disclosed herein in a culture medium.
In some aspects, the method further comprises recovering the antibody from the host cell or the culture medium.
In another aspect, provided herein is a composition comprising any one of the antibodies disclosed herein.
In some aspects, the composition further comprises a pharmaceutically acceptable carrier, excipient, or diluent.
In some aspects, the composition is a pharmaceutical composition.
In some aspects, the pharmaceutical composition further comprises an ST2 binding antagonist, a Factor D binding antagonist, an HtrA1 binding antagonist, a VEGF antagonist, a tryptase-beta binding antagonist, a chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) binding antagonist, an interleukin-13 (IL-13) binding antagonist, an interleukin-17 (IL-17) binding antagonist, a JAK1 antagonist, and/or an interleukin-5 (IL-5) binding antagonist.
In some aspects, the pharmaceutical composition comprises a Factor D binding antagonist.
In some aspects, the Factor D binding antagonist is an anti-Factor D antibody or an antigen-binding fragment thereof.
In some aspects, the pharmaceutical composition comprises an HtrA1 binding antagonist.
In some aspects, the HtrA1 binding antagonist is an anti-HtrA1 antibody or an antigen-binding fragment thereof.
In some aspects, the pharmaceutical composition comprises a VEGF antagonist.
In some aspects, the VEGF antagonist is an anti-VEGF antibody or an antigen-binding fragment thereof.
In some aspects, the antibody concentration is about 1 mg/mL to about 400 mg/mL.
In some aspects, the antibody concentration is about 150 mg/mL to about 250 mg/mL.
In some aspects, the antibody concentration is about 175 mg/mL to about 225 mg/mL.
In some aspects, the antibody concentration is about 200 mg/mL.
In another aspect, provided herein is any one of the antibodies disclosed herein or any one of the compositions disclosed herein for use as a medicament.
In another aspect, provided herein is any one of the antibodies disclosed herein or any one of the compositions disclosed herein for use in treating an IL-33-mediated disorder.
In some aspects, the IL-33-mediated disorder is an ocular disorder, an inflammatory condition, an immune disorder, a fibrotic disorder, an eosinophilic disorder, an infection, pain, a central nervous system disorder, or a solid tumor.
In some aspects, the ocular disorder is age-related macular degeneration (AMD), retinopathy of the eye, polypoidal choroidal vasculopathy (PCV), diabetic macular edema, dry eye disease, Behcet's disease, retina detachment, glaucoma, uveitis, retinitis pigmentosa, Leber Congenital Amaurosis, Stargardt's disease, traumatic eye injury, or conjunctivitis.
In some aspects, the AMD is geographic atrophy (GA), wet AMD, or dry AMD.
In some aspects, the AMD is GA.
In some aspects, the AMD is intermediate AMD or advanced AMD.
In some aspects, the retinopathy of the eye is diabetic retinopathy (DR) or retinopathy of prematurity (ROP).
In some aspects, the retinopathy of the eye is high-altitude DR.
In some aspects, the conjunctivitis is infectious conjunctivitis or non-infectious conjunctivitis.
In some aspects, the conjunctivitis is allergic conjunctivitis.
In some aspects, the inflammatory condition is asthma, sepsis, septic shock, atopic dermatitis, allergic rhinitis, rheumatoid arthritis, or chronic obstructive pulmonary disease (COPD).
In some aspects, the immune disorder is asthma, rheumatoid arthritis, allergy, anaphylaxis, anaphylactic shock, allergic rhinitis, psoriasis, inflammatory bowel disease (IBD), Crohn's disease, diabetes, or liver disease.
In some aspects, the fibrotic disease is idiopathic pulmonary fibrosis (IPF).
In some aspects, the eosinophilic disorder is an eosinophil-associated gastrointestinal disorder (EGID).
In some aspects, the EGID is eosinophilic esophagitis.
In some aspects, the infection is a helminth infection, a protozoan infection, or a viral infection.
In some aspects, the protozoan infection is a Leishmania major infection.
In some aspects, the viral infection is a respiratory syncytial virus (RSV) infection or an influenza infection.
In some aspects, the pain is inflammatory pain.
In some aspects, the central nervous system disorder is Alzheimer's disease.
In some aspects, the solid tumor is a breast tumor, a colon tumor, a prostate tumor, a lung tumor, a kidney tumor, a liver tumor, a pancreas tumor, a stomach tumor, an intestinal tumor, a brain tumor, a bone tumor, and a skin tumor.
In some aspects, the antibody or composition is used in combination with an ST2 binding antagonist, a Factor D binding antagonist, an HtrA1 binding antagonist, a VEGF antagonist, a tryptase-beta binding antagonist, a CRTH2 binding antagonist, an IL-13 binding antagonist, an IL-17 binding antagonist, a JAK1 antagonist, and/or an IL-5 binding antagonist.
In some aspects, the antibody or composition is used in in combination with a Factor D binding antagonist.
In some aspects, the Factor D binding antagonist is an anti-Factor D antibody or an antigen-binding fragment thereof.
In some aspects, the antibody or composition is used in in combination with an HtrA1 binding antagonist.
In some aspects, the HtrA1 binding antagonist is an anti-HtrA1 antibody or an antigen-binding fragment thereof.
In some aspects, the antibody or composition is used in in combination with a VEGF antagonist.
In some aspects, the VEGF antagonist is an anti-VEGF antibody or an antigen-binding fragment thereof.
In another aspect, provided herein is the use of any one of the antibodies disclosed herein or any one of the compositions disclosed herein in the manufacture of a medicament for treating an IL-33-mediated disorder.
In some aspects, the IL-33-mediated disorder is an ocular disorder, an inflammatory condition, an immune disorder, a fibrotic disorder, an eosinophilic disorder, an infection, pain, a central nervous system disorder, or a solid tumor.
In some aspects, the ocular disorder is AMD, retinopathy of the eye, PCV, diabetic macular edema, dry eye disease, Behcet's disease, retina detachment, glaucoma, uveitis, retinitis pigmentosa, Leber Congenital Amaurosis, Stargardt's disease, traumatic eye injury, or conjunctivitis.
In some aspects, the AMD is GA, wet AMD, or dry AMD.
In some aspects, the AMD is GA.
In some aspects, the AMD is intermediate AMD or advanced AMD.
In some aspects, the retinopathy of the eye is DR or ROP.
In some aspects, the retinopathy of the eye is high-altitude DR.
In some aspects, the conjunctivitis is infectious conjunctivitis or non-infectious conjunctivitis.
In some aspects, the conjunctivitis is allergic conjunctivitis.
In some aspects, the inflammatory condition is asthma, sepsis, septic shock, atopic dermatitis, allergic rhinitis, rheumatoid arthritis, or COPD.
In some aspects, the immune disorder is asthma, rheumatoid arthritis, allergy, anaphylaxis, anaphylactic shock, allergic rhinitis, psoriasis, IBD, Crohn's disease, diabetes, or liver disease.
In some aspects, the fibrotic disease is IPF.
In some aspects, the eosinophilic disorder is an EGID.
In some aspects, the EGID is eosinophilic esophagitis.
In some aspects, the infection is a helminth infection, a protozoan infection, or a viral infection.
In some aspects, the protozoan infection is a Leishmania major infection.
In some aspects, the viral infection is an RSV infection or an influenza infection.
In some aspects, the pain is inflammatory pain.
In some aspects, the central nervous system disorder is Alzheimer's disease.
In some aspects, the solid tumor is a breast tumor, a colon tumor, a prostate tumor, a lung tumor, a kidney tumor, a liver tumor, a pancreas tumor, a stomach tumor, an intestinal tumor, a brain tumor, a bone tumor, and a skin tumor.
In some aspects, the medicament is formulated for use in combination with an ST2 binding antagonist, a Factor D binding antagonist, an HtrA1 binding antagonist, a VEGF antagonist, a tryptase-beta binding antagonist, a CRTH2 binding antagonist, an IL-13 binding antagonist, an IL-17 binding antagonist, a JAK1 antagonist, and/or an IL-5 binding antagonist.
In some aspects, the medicament is formulated for use in combination with a Factor D binding antagonist.
In some aspects, the Factor D binding antagonist is an anti-Factor D antibody or an antigen-binding fragment thereof.
In some aspects, the medicament is formulated for use in combination with an HtrA1 binding antagonist.
In some aspects, the HtrA1 binding antagonist is an anti-HtrA1 antibody or an antigen-binding fragment thereof.
In some aspects, the medicament is formulated for use in combination with a VEGF antagonist.
In some aspects, the VEGF antagonist is an anti-VEGF antibody or an antigen-binding fragment thereof.
In another aspect, provided herein is a method of treating an IL-33-mediated disorder in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of any one of the antibodies disclosed herein or any one of the compositions disclosed herein.
In some aspects, the IL-33-mediated disorder is an ocular disorder, an inflammatory condition, an immune disorder, a fibrotic disorder, an eosinophilic disorder, an infection, pain, a central nervous system disorder, or a solid tumor.
In some aspects, the ocular disorder is AMD, retinopathy of the eye, PCV, diabetic macular edema, dry eye disease, Behcet's disease, retina detachment, glaucoma, uveitis, retinitis pigmentosa, Leber Congenital Amaurosis, Stargardt's disease, traumatic eye injury, or conjunctivitis.
In some aspects, the AMD is GA, wet AMD, or dry AMD.
In some aspects, the AMD is GA.
In some aspects, the AMD is intermediate AMD or advanced AMD.
In some aspects, the retinopathy of the eye is DR or ROP.
In some aspects, the retinopathy of the eye is high-altitude DR.
In some aspects, the conjunctivitis is infectious conjunctivitis or non-infectious conjunctivitis.
In some aspects, the conjunctivitis is allergic conjunctivitis.
In some aspects, the inflammatory condition is asthma, sepsis, septic shock, atopic dermatitis, allergic rhinitis, rheumatoid arthritis, or COPD.
In some aspects, the immune disorder is asthma, rheumatoid arthritis, allergy, anaphylaxis, anaphylactic shock, allergic rhinitis, psoriasis, IBD, Crohn's disease, diabetes, and liver disease.
In some aspects, the fibrotic disease is IPF.
In some aspects, the eosinophilic disorder is an EGID.
In some aspects, the EGID is eosinophilic esophagitis.
In some aspects, the infection is a helminth infection, a protozoan infection, or a viral infection.
In some aspects, the protozoan infection is a Leishmania major infection.
In some aspects, the viral infection is an RSV infection or an influenza infection.
In some aspects, the pain is inflammatory pain.
In some aspects, the solid tumor is a breast tumor, a colon tumor, a prostate tumor, a lung tumor, a kidney tumor, a liver tumor, a pancreas tumor, a stomach tumor, an intestinal tumor, a brain tumor, a bone tumor, and a skin tumor.
In some aspects, the method further comprises administering to the subject an ST2 binding antagonist, a Factor D binding antagonist, an HtrA1 binding antagonist, a VEGF antagonist, a tryptase-beta binding antagonist, a CRTH2 binding antagonist, an IL-13 binding antagonist, an IL-17 binding antagonist, a JAK1 antagonist, and/or an IL-5 binding antagonist.
In some aspects, the method further comprises administering to the subject a Factor D binding antagonist.
In some aspects, the Factor D binding antagonist is anti-Factor D antibody or an antigen-binding fragment thereof.
In some aspects, the method further comprises administering to the subject an HtrA1 binding antagonist.
In some aspects, the HtrA1 binding antagonist is an anti-HtrA1 antibody or an antigen-binding fragment thereof.
In some aspects, the method further comprises administering to the subject a VEGF antagonist.
In some aspects, the VEGF antagonist is an anti-VEGF antibody or an antigen-binding fragment thereof.
In another aspect, provided herein is a method of treating GA in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of any one of the antibodies disclosed herein or any one of the compositions disclosed herein.
In some aspects, the antibody is an Fab fragment.
In some aspects, the antibody or the composition is administered intravitreally, ocularly, intraocularly, juxtasclerally, subtenonly, superchoroidally, topically, intravenously, intramuscularly, intradermally, percutaneously, intraarterially, intraperitoneally, intralesionally, intracranially, intraarticularly, intraprostatically, intrapleurally, intratracheally, intrathecally, intranasally, intravaginally, intrarectally, topically, intratumorally, intraperitoneally, peritoneally, intraventricularly, subcutaneously, subconjunctivally, intravesicularly, mucosally, intrapericardially, intraumbilically, intraorbitally, orally, transdermally, by inhalation, by injection, by eye drop, by implantation, by infusion, by continuous infusion, by localized perfusion bathing target cells directly, by catheter, by lavage, in cremes, or in lipid compositions.
In some aspects, the antibody or the composition is administered intravitreally, ocularly, intraocularly, juxtasclerally, subtenonly, superchoroidally, or topically.
In some aspects, the antibody or the composition is administered intravitreally by injection.
In some aspects, the antibody or the composition is administered topically by eye drop or ointment.
In some aspects, the antibody or the composition is administered by a port delivery device.
In some aspects, the subject is a human.
BRIEF DESCRIPTION OF THE DRAWINGS
FIGS. 1A and 1B are sequence alignments of the heavy chain variable region (VH) and light chain variable region (VL) sequences of the 1E1 hybridoma and 1E1v8 anti-IL-33 antibody clones. Complementarity-determining region (CDR) sequences according to Kabat definition are underlined.
FIGS. 2A and 2B are sequence alignments of the VH and VL sequences of the indicated anti-IL-33 antibody clones. CDR sequences according to Kabat definition are underlined.
FIG. 3A is a network plot showing relationships between clones or bins of anti-IL-33 antibody clones based on blocking activity.
FIG. 3B is a heatmap showing relationships between clones or bins of anti-IL-33 antibody clones based on blocking activity.
FIGS. 3C-3E are a series of graphs showing results of epitope binning using surface plasmon resonance (SPR). The graphs show normalized response as a function of time.
DETAILED DESCRIPTION OF EMBODIMENTS OF THE INVENTION I. Definitions
The term “about” as used herein refers to the usual error range for the respective value readily known to the skilled person in this technical field. Reference to “about” a value or parameter herein includes (and describes) embodiments that are directed to that value or parameter per se.
An “acceptor human framework” for the purposes herein is a framework comprising the amino acid sequence of a light chain variable domain (VL) framework or a heavy chain variable domain (VH) framework derived from a human immunoglobulin framework or a human consensus framework, as defined below. An acceptor human framework “derived from” a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may contain amino acid sequence changes. In some embodiments, the number of amino acid changes are 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less. In some embodiments, the VL acceptor human framework is identical in sequence to the VL human immunoglobulin framework sequence or human consensus framework sequence.
“Affinity” refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, “binding affinity” refers to intrinsic binding affinity which reflects a 1:1 interaction between members of a binding pair (e.g., antibody and antigen). The affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (KD). Affinity can be measured by common methods known in the art, including those described herein. Specific illustrative and exemplary embodiments for measuring binding affinity are described in the following.
An “affinity-matured” antibody is one with one or more alterations in one or more HVRs and/or framework regions which result in an improvement in the affinity of the antibody for antigen, compared to a parent antibody which does not possess those alteration(s). Preferred affinity-matured antibodies will have nanomolar or even picomolar affinities for the target antigen. Affinity-matured antibodies are produced by procedures known in the art. For example, Marks et al. Bio/Technology 10:779-783, 1992 describes affinity maturation by VH and VL domain shuffling. Random mutagenesis of HVR and/or framework residues is described by: Barbas et al. Proc. Nat. Acad. Sci. USA 91:3809-3813, 1994; Schier et al. Gene 169:147-155, 1995; Yelton et al. J. Immunol. 155:1994-2004, 1995; Jackson et al. J. Immunol. 154(7):3310-3319, 1995; and Hawkins et al. J. Mol. Biol. 226:889-896, 1992.
The term “antibody” herein is used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies, including anti-IL-33/anti-IL-13 bispecific antibodies), and antibody fragments so long as they exhibit the desired antigen-binding activity.
The term “interleukin-33 (IL-33),” as used herein, refers to any native IL-33 from any vertebrate source, including mammals such as primates (e.g., humans and cynomolgus monkeys) and rodents (e.g., mice and rats), unless otherwise indicated. IL-33 is also referred to in the art as nuclear factor of high endothelial venules (NF-HEV; see, e.g., Baekkevold et al. Am. J. Pathol. 163(1): 69-79, 2003), DVS27, C9orf26, and interleukin-1 family member 11 (IL-1F11). The term encompasses “full-length,” unprocessed IL-33, as well as any form of IL-33 that results from processing in the cell. Human full-length, unprocessed IL-33 contains 270 amino acids (a.a.) and may also be referred to as IL-331-270. Processed forms of human IL-33 include, for example, IL-3395-270, IL-3399-270, IL-33109-270, IL-33112-270, IL-331-178, and IL-33179-270 (Lefrangais et al. Proc. Natl. Acad. Sci. 109(5):1673-1678, 2012 and Martin, Semin. Immunol. 25: 449-457, 2013). In some embodiments, processed forms of human IL-33, e.g., IL-3395-270, IL-3399-270, IL-33109-270, or other forms processed by proteases such as calpain, proteinase 3, neutrophil elastase, and cathepsin G may have increased biological activity compared to full-length IL-33. The term also encompasses naturally occurring variants of IL-33, for example, splice variants (e.g., the constitutively active splice variant spIL-33 which lacks exon 3, Hong et al. J. Biol. Chem. 286(22):20078-20086, 2011) or allelic variants. IL-33 may be present within a cell (e.g., within the nucleus) or as a secreted cytokine form. Full-length IL-33 protein contains a helix-turn-helix DNA-binding motif including nuclear localization sequence (a.a.1-75 of human IL-33), which includes a chromatin binding motif (a.a. 40-58 of human IL-33). Forms of IL-33 that are processed and secreted lack these N-terminal motifs. The amino acid sequence of an exemplary human IL-33 can be found, for example, under UniProtKB accession number 095760.
By “IL-33 axis” is meant a nucleic acid (e.g., a gene or mRNA transcribed from the gene) or polypeptide that is involved in IL-33 signal transduction. For example, the IL-33 axis may include the ligand IL-33, a receptor (e.g., ST2 and/or IL-1RAcP), adaptor molecules (e.g., MyD88), or proteins that associate with receptor molecules and/or adaptor molecules (e.g., kinases, such as interleukin-1 receptor-associated kinase 1 (IRAK1) and interleukin-1 receptor-associated kinase 4 (IRAK4), or E3 ubiquitin ligases, such as TNF receptor associated factor 6 (TRAF6)).
The terms “interleukin 1 receptor-like 1 (IL1RL1)” and “ST2,” used interchangeably herein, refer to any native ST2 from any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated. ST2 is also referred to in the art as DER4, T1, and FIT-1. The term encompasses “full-length,” unprocessed ST2, as well as any form of ST2 that results from processing in the cell. At least four isoforms of ST2 are known in the art, including soluble (sST2, also known as IL1RL1-a) and transmembrane (ST2L, also known as IL1RL1-b), which arise from differential mRNA expression from a dual promoter system, and ST2V and ST2LV, which arise from alternative splicing, as described below. The domain structure of ST2L includes three extracellular immunoglobulin-like C2 domains, a transmembrane domain, and a cytoplasmic Toll/Interleukin-1 receptor (TIR) domain. sST2 lacks the transmembrane and cytoplasmic domains contained within ST2L and includes a unique 9 amino acid (a.a.) C-terminal sequence (see, e.g., Kakkar et al. Nat. Rev. Drug Disc. 7: 827-840, 2008). sST2 can function as a decoy receptor to inhibit soluble IL-33. The term also encompasses naturally occurring variants of ST2, e.g., splice variants (e.g., ST2V, which lacks the third immunoglobulin motif and has a unique hydrophobic tail, and ST2LV, which lacks the transmembrane domain of ST2L) or allelic variants (e.g., variants that are protective against asthma risk or that confer asthma risk as described herein). The amino acid sequence of an exemplary human ST2 can be found, for example, under UniProtKB accession number Q01638. ST2 is a part of the IL-33 receptor along with the co-receptor protein IL-1RAcP. Binding of IL-33 to ST2 and the co-receptor interleukin-1 receptor accessory protein (IL-1RAcP) forms a 1:1:1 ternary signaling complex to promote downstream signal transduction, as depicted in FIG. 1A (see, e.g., Lingel et al. Structure 17(10): 1398-1410, 2009, and Liu et al. Proc. Natl. Acad. Sci. 110(37): 14918-14924, 2013).
The terms “anti-IL-33 antibody,” an “antibody that binds to IL-33,” and “antibody that specifically binds IL-33” refer to an antibody that is capable of binding IL-33 with sufficient affinity such that the antibody is useful as a therapeutic and/or diagnostic agent in targeting IL-33. In one embodiment, the extent of binding of an anti-IL-33 antibody to an unrelated, non-IL-33 protein is less than about 10% of the binding of the antibody to IL-33 as measured, e.g., by a radioimmunoassay (RIA). In certain embodiments, an antibody that binds to IL-33 has a dissociation constant (KD) of ≤1 μM, ≤100 nM, ≤10 nM, ≤1 nM, ≤0.1 nM, ≤0.01 nM, or ≤0.001 nM (e.g., 10−8 M or less, e.g. from 10−8 M to 10−13 M, e.g., from 10−9 M to 10−13 M). In certain embodiments, an anti-IL-33 antibody binds to an epitope of IL-33 that is conserved among IL-33 from different species.
An “antibody that binds to the same epitope” as a reference antibody refers to an antibody that blocks binding of the reference antibody to its antigen in a competition assay by 50% or more, and conversely, the reference antibody blocks binding of the antibody to its antigen in a competition assay by 50% or more. An exemplary competition assay is provided herein.
“Antibody fragments” comprise a portion of an intact antibody, preferably the antigen binding or variable region of the intact antibody. Examples of antibody fragments include Fab, Fab′, F(ab′)2, and Fv fragments; diabodies; linear antibodies (see U.S. Pat. No. 5,641,870, Example 2; Zapata et al. Protein Eng. 8(10):1057-1062, 1995); single-chain antibody molecules; and multispecific antibodies formed from antibody fragments.
Papain digestion of antibodies produces two identical antigen-binding fragments, called “Fab” fragments, and a residual “Fc” fragment, a designation reflecting the ability to crystallize readily. The Fab fragment consists of an entire L chain along with the variable region domain of the H chain (VH), and the first constant domain of one heavy chain (CH1). Pepsin treatment of an antibody yields a single large F(ab′)2 fragment which roughly corresponds to two disulfide linked Fab fragments having divalent antigen-binding activity and is still capable of cross-linking antigen. Fab′ fragments differ from Fab fragments by having an additional few residues at the carboxy terminus of the C H1 domain including one or more cysteines from the antibody hinge region. Fab′-SH is the designation herein for Fab′ in which the cysteine residue(s) of the constant domains bear a free thiol group. F(ab′)2 antibody fragments originally were produced as pairs of Fab′ fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
The term “Fc region” herein is used to define a C-terminal region of an immunoglobulin heavy chain that contains at least a portion of the constant region. The term includes native sequence Fc regions and variant Fc regions. In one embodiment, a human IgG heavy chain Fc region extends from Cys226, or from Pro230, to the carboxyl-terminus of the heavy chain. However, the C-terminal lysine (Lys447) of the Fc region may or may not be present. Unless otherwise specified herein, numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat et al. Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md., 1991.
“Fv” consists of a dimer of one heavy- and one light-chain variable region domain in tight, noncovalent association. From the folding of these two domains emanate six hypervariable loops (3 loops each from the H and L chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three Hs specific for an antigen) has the ability to recognize and bind antigen, although often at a lower affinity than the entire binding site.
“Single-chain Fv” also abbreviated as “sFv” or “scFv” are antibody fragments that comprise the VH and VL antibody domains connected into a single polypeptide chain. Preferably, the sFv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the sFv to form the desired structure for antigen binding. For a review of sFv, see Pluckthun in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315, 1994.
The term “diabodies” refers to small antibody fragments prepared by constructing sFv fragments (see preceding paragraph) with short linkers (about 5-10 residues) between the VH and VL domains such that inter-chain but not intra-chain pairing of the V domains is achieved, resulting in a bivalent fragment, i.e., fragment having two antigen-binding sites. Bispecific diabodies are heterodimers of two “crossover” sFv fragments in which the VH and VL domains of the two antibodies are present on different polypeptide chains. Diabodies are described more fully in, for example, EP 404,097; WO 93/11161; and Hollinger et al. Proc. Natl. Acad. Sci. USA 90:6444-6448, 1993.
By “binding domain” is meant a part of a compound or a molecule that specifically binds to a target epitope, antigen, ligand, or receptor. Binding domains include but are not limited to antibodies (e.g., monoclonal, polyclonal, recombinant, humanized, and chimeric antibodies), antibody fragments or portions thereof (e.g., Fab fragments, Fab′2, scFv antibodies, SMIP, domain antibodies, diabodies, minibodies, scFv-Fc, affibodies, nanobodies, and VH and/or VL domains of antibodies), receptors, ligands, aptamers, and other molecules having an identified binding partner.
A “blocking” antibody or an “antagonist” antibody is one which inhibits or reduces biological activity of the antigen it binds. Certain blocking antibodies or antagonist antibodies substantially or completely inhibit the biological activity of the antigen.
A “cell-based blocking assay” refers to an assay in which the ability of an antibody to inhibit or reduce the biological activity of the antigen it binds can be measured. For example, a cell-based assay can be used to measure the concentration of antibody required to inhibit a specific biological or biochemical function. In some embodiments, the half maximal inhibitory concentration (IC50) and/or 90% inhibitory concentration (IC90) of an antibody (e.g., an anti-IL-33 antibody disclosed herein) is measured using a cell-based blocking assay. In some embodiments, the cell-based blocking assay is used to determine whether an antibody blocks the interaction between a ligand (e.g., IL-33) and its receptor (e.g., ST2 and/or the coreceptor IL-1RAcP). An exemplary cell-based blocking assay for IL-33 is provided, e.g., in Example 2B of U.S. Pat. No. 10,093,730. Additional exemplary cell-based blocking assays for IL-33 are provided, for example, in Example 8 of U.S. Pat. No. 10,093,730, including primary natural killer (NK) cell assays and primary basophil cell assays.
The “class” of an antibody refers to the type of constant domain or constant region possessed by its heavy chain. There are five major classes of antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2. The heavy chain constant domains that correspond to the different classes of immunoglobulins are called α, δ, ε, γ, and μ, respectively.
Antibody “effector functions” refer to those biological activities attributable to the Fc region (a native sequence Fc region or amino acid sequence variant Fc region) of an antibody, and vary with the antibody isotype. Examples of antibody effector functions include: C1 q binding and complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g., B cell receptor); and B cell activation.
“Antibody-dependent cell-mediated cytotoxicity” or “ADCC” refers to a form of cytotoxicity in which secreted Ig bound onto Fc receptors (FcRs) present on certain cytotoxic cells (e.g., Natural Killer (NK) cells, neutrophils, and macrophages) enable these cytotoxic effector cells to bind specifically to an antigen-bearing target cell and subsequently kill the target cell with cytotoxins. The antibodies “arm” the cytotoxic cells and are absolutely required for such killing. The primary cells for mediating ADCC, NK cells, express FcγRIII only, whereas monocytes express FcγRI, FcγRII, and FcγRIII. FcR expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch et al. Annu. Rev. Immunol. 9:457-492, 1991. To assess ADCC activity of a molecule of interest, an in vitro ADCC assay, such as that described in U.S. Pat. No. 5,500,362 or 5,821,337 can be performed. Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells. Alternatively, or additionally, ADCC activity of the molecule of interest can be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et al. Proc. Natl. Acad. Sci. USA 95:652-656, 1998.
“Fc receptor” or “FcR” describes a receptor that binds to the Fc region of an antibody. The preferred FcR is a native sequence human FcR. Moreover, a preferred FcR is one which binds an IgG antibody (a gamma receptor) and includes receptors of the FcγRI, FcγRII, and FcγRIII subclasses, including allelic variants and alternatively spliced forms of these receptors. FcγRII receptors include FcγRIIA (an “activating receptor”) and FcγRIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof. Activating receptor FcγRIIA contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain. Inhibiting receptor FcγRIIB contains an immunoreceptor tyrosine-based inhibition motif (ITIM) in its cytoplasmic domain (see review M. in Daëron, Annu. Rev. Immunol. 15:203-234, 1997). FcRs are reviewed, for example, in Ravetch et al. Annu. Rev. Immunol. 9:457-492, 1991; Capel et al. Immunomethods 4:25-34, 1994; and de Haas et al. J. Lab. Clin. Med. 126:330-41, 1995. Other FcRs, including those to be identified in the future, are encompassed by the term “FcR” herein. The term also includes the neonatal receptor, FcRn, which is responsible for the transfer of maternal IgGs to the fetus (see, e.g., Guyer et al. J. Immunol. 117:587, 1976; and Kim et al. J. Immunol. 24:249, 1994).
“Human effector cells” are leukocytes which express one or more FcRs and perform effector functions. Preferably, the cells express at least FcγRIII and perform ADCC effector function. Examples of human leukocytes which mediate ADCC include peripheral blood mononuclear cells (PBMC), natural killer (NK) cells, monocytes, cytotoxic T cells, and neutrophils; with PBMCs and NK cells being preferred. The effector cells can be isolated from a native source, e.g., from blood.
“Complement dependent cytotoxicity” or “CDC” refers to the lysis of a target cell in the presence of complement. Activation of the classical complement pathway is initiated by the binding of the first component of the complement system (C1q) to antibodies (of the appropriate subclass) which are bound to their cognate antigen. To assess complement activation, a CDC assay, e.g., as described in Gazzano-Santoro et al. J. Immunol. Methods 202:163, 1996, can be performed.
An “epitope” is the portion of the antigen to which the antibody selectively binds. For a polypeptide antigen, the epitope is generally a peptide portion of about 4-15 amino acid residues.
The terms “full-length antibody,” “intact antibody,” and “whole antibody” are used herein interchangeably to refer to an antibody having a structure substantially similar to a native antibody structure or having heavy chains that contain an Fc region as defined herein.
A “human antibody” is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.
A “human consensus framework” is a framework which represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences. Generally, the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences. Generally, the subgroup of sequences is a subgroup as in Kabat et al. Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91-3242, Bethesda Md., vols. 1-3, 1991. In one embodiment, for the VL, the subgroup is subgroup kappa III or kappa IV as in Kabat et al. supra. In one embodiment, for the VH, the subgroup is subgroup III as in Kabat et al. supra.
“Humanized” forms of non-human (e.g., rodent) antibodies are chimeric antibodies that contain minimal sequence derived from the non-human antibody. For the most part, humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or non-human primate having the desired antibody specificity, affinity, and capability. In some instances, framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore, humanized antibodies can comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence. The humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. For further details, see Jones et al. Nature 321:522-525, 1986; Riechmann et al. Nature 332:323-329, 1988; and Presta, Curr. Op. Struct. Biol. 2:593-596, 1992.
An “immunoconjugate” is an antibody conjugated to one or more heterologous molecule(s), including but not limited to a cytotoxic agent.
The term “isolated” when used to describe the various antibodies disclosed herein, means an antibody that has been identified and separated and/or recovered from a cell or cell culture from which it was expressed. Contaminant components of its natural environment are materials that would typically interfere with diagnostic or therapeutic uses for the polypeptide, and can include enzymes, hormones, and other proteinaceous or non-proteinaceous solutes. In some embodiments, an antibody is purified to greater than 95% or 99% purity as determined by, for example, electrophoretic (e.g., sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE), isoelectric focusing (IEF), capillary electrophoresis) or chromatographic (e.g., ion exchange or reverse phase HPLC) methods. For a review of methods for assessment of antibody purity, see, for example, Flatman et al. J. Chromatogr. B 848:79-87, 2007. In preferred embodiments, the antibody will be purified (1) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (2) to homogeneity by SDS-PAGE under non-reducing or reducing conditions using Coomassie blue or, preferably, silver stain. Isolated antibody includes antibodies in situ within recombinant cells, because at least one component of the polypeptide natural environment will not be present. Ordinarily, however, isolated polypeptide will be prepared by at least one purification step.
The term “monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts. In contrast to polyclonal antibody preparations, which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen. Thus, the modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies to be used in accordance with the present invention may be made by a variety of techniques, including but not limited to the hybridoma method, recombinant DNA methods, phage-display methods, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci, such methods and other exemplary methods for making monoclonal antibodies being described herein.
The term “multispecific antibody” is used in the broadest sense and specifically covers an antibody comprising a heavy chain variable domain (VH) and a light chain variable domain (VL), where the VHVL unit has polyepitopic specificity (i.e., is capable of binding to two different epitopes on one biological molecule or each epitope on a different biological molecule). Such multispecific antibodies include, but are not limited to, full-length antibodies, antibodies having two or more VL and VH domains, antibody fragments such as Fab, Fv, dsFv, scFv, diabodies, bispecific diabodies and triabodies, antibody fragments that have been linked covalently or non-covalently. “Polyepitopic specificity” refers to the ability to specifically bind to two or more different epitopes on the same or different target(s). “Dual specificity” or “bispecificity” refers to the ability to specifically bind to two different epitopes on the same or different target(s). However, in contrast to bispecific antibodies, dual-specific antibodies have two antigen-binding arms that are identical in amino acid sequence and each Fab arm is capable of recognizing two antigens. Dual-specificity allows the antibodies to interact with high affinity with two different antigens as a single Fab or IgG molecule. According to one embodiment, the multispecific antibody in an IgG1 form binds to each epitope with an affinity of 5 μM to 0.001 pM, 3 μM to 0.001 pM, 1 μM to 0.001 pM, 0.5 μM to 0.001 pM or 0.1 μM to 0.001 pM. “Monospecific” refers to the ability to bind only one epitope.
The term “knob-into-hole” or “KnH” technology as used herein refers to the technology directing the pairing of two polypeptides together in vitro or in vivo by introducing a protuberance (knob) into one polypeptide and a cavity (hole) into the other polypeptide at an interface in which they interact. For example, KnHs have been introduced in the Fc:Fc binding interfaces, CL:CH1 interfaces, or VH/VL interfaces of antibodies (see, e.g., US 2011/0287009, US2007/0178552, WO 96/027011, WO 98/050431, and Zhu et al. Protein Science 6:781-788, 1997). In some embodiments, KnHs drive the pairing of two different heavy chains together during the manufacture of multispecific antibodies. For example, multispecific antibodies having KnH in their Fc regions can further comprise single variable domains linked to each Fc region, or further comprise different heavy chain variable domains that pair with similar or different light chain variable domains. KnH technology can also be used to pair two different receptor extracellular domains together or any other polypeptide sequences that comprises different target recognition sequences (e.g., including affibodies, peptibodies, and other Fc fusions).
The term “knob mutation,” as used herein, refers to a mutation that introduces a protuberance (knob) into a polypeptide at an interface in which the polypeptide interacts with another polypeptide. In some embodiments, the other polypeptide has a hole mutation (see e.g., U.S. Pat. Nos. 5,731,168; 5,807,706; 5,821,333; 7,695,936; and 8,216,805, which are each incorporated herein by reference in their entirety).
The term “hole mutation,” as used herein, refers to a mutation that introduces a cavity (hole) into a polypeptide at an interface in which the polypeptide interacts with another polypeptide. In some embodiments, the other polypeptide has a knob mutation (see e.g., U.S. Pat. Nos. 5,731,168; 5,807,706; 5,821,333; 7,695,936; and 8,216,805, which are each incorporated herein by reference in their entirety).
A “naked antibody” refers to an antibody that is not conjugated to a heterologous moiety (e.g., a cytotoxic moiety) or radiolabel. The naked antibody may be present in a pharmaceutical composition.
With regard to the binding of an antibody to a target molecule, the term “specific binding” or “specifically binds” or is “specific for” a particular polypeptide or an epitope on a particular polypeptide target means binding that is measurably different from a non-specific interaction. Specific binding can be measured, for example, by determining binding of a molecule compared to binding of a control molecule. For example, specific binding can be determined by competition with a control molecule that is similar to the target, for example, an excess of non-labeled target. In this case, specific binding is indicated if the binding of the labeled target to a probe is competitively inhibited by excess unlabeled target. The term “specific binding” or “specifically binds to” or is “specific for” a particular polypeptide or an epitope on a particular polypeptide target as used herein can be exhibited, for example, by a molecule having a KD for the target of 10−4 M or lower, alternatively 10−5 M or lower, alternatively 10−6 M or lower, alternatively 10−7 M or lower, alternatively 10−8 M or lower, alternatively 10−9 M or lower, alternatively 10−10 M or lower, alternatively 10−11 M or lower, alternatively 10−12 M or lower or a KD in the range of 10−4 M to 10−6 M or 10−6 M to 10−10 M or 10−7 M to 10−9 M. As will be appreciated by the skilled artisan, affinity and KD values are inversely related. A high affinity for an antigen is measured by a low KD value. In one embodiment, the term “specific binding” refers to binding where a molecule binds to a particular polypeptide or epitope on a particular polypeptide without substantially binding to any other polypeptide or polypeptide epitope.
The term “variable” refers to the fact that certain segments of the variable domains differ extensively in sequence among antibodies. The variable or “V” domain mediates antigen binding and defines specificity of a particular antibody for its particular antigen. However, the variability is not evenly distributed across the 110-amino acid span of the variable domains. Instead, the V regions consist of relatively invariant stretches called framework regions (FRs) of 15-30 amino acids separated by shorter regions of extreme variability called “hypervariable regions” that are each 9-12 amino acids long. The variable domains of native heavy and light chains each comprise four FRs, largely adopting a beta-sheet configuration, connected by three hypervariable regions, which form loops connecting, and in some cases forming part of, the beta-sheet structure. The hypervariable regions in each chain are held together in close proximity by the FRs and, with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Kabat et al. supra). Accordingly, the HVR and FR sequences generally appear in the following sequence in VH (or VL): FR1-H1(L1)-FR2-H2(L2)-FR3-H3(L3)-FR4. The constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody dependent cellular cytotoxicity (ADCC).
The term “hypervariable region,” “HVR,” or “HV,” when used herein refers to the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops. Generally, antibodies comprise six HVRs; three in the VH (H1, H2, H3), and three in the VL (L1, L2, L3). In native antibodies, H3 and L3 display the most diversity of the six HVRs, and H3 in particular is believed to play a unique role in conferring fine specificity to antibodies. See, e.g., Xu et al., Immunity 13:37-45 (2000); Johnson and Wu, in Methods in Molecular Biology 248:1-25 (Lo, ed., Human Press, Totowa, N.J., 2003). Indeed, naturally occurring camelid antibodies consisting of a heavy chain only are functional and stable in the absence of light chain. See, e.g., Hamers-Casterman et al., Nature 363:446-448 (1993); Sheriff et al., Nature Struct. Biol. 3:733-736 (1996).
A number of HVR delineations are in use and are encompassed herein. The Kabat Complementarity Determining Regions (CDRs) are based on sequence variability and are the most commonly used (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)). Chothia refers instead to the location of the structural loops (Chothia and Lesk J. Mol. Biol. 196:901-917 (1987)). The AbM HVRs represent a compromise between the Kabat HVRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody modeling software. The “contact” HVRs are based on an analysis of the available complex crystal structures. The residues from each of these HVRs are noted below.
Loop Kabat AbM Chothia Contact
L1 L24-L34 L24-L34 L26-L32 L30-L36
L2 L50-L56 L50-L56 L50-L52 L46-L55
L3 L89-L97 L89-L97 L91-L96 L89-L96
H1 H31-H35B H26-H35B H26-H32 H30-H35B (Kabat Numbering)
H1 H31-H35 H26-H35 H26-H32 H30-H35 (Chothia Numbering)
H2 H50-H65 H50-H58 H53-H55 H47-H58
H3 H95-H102 H95-H102 H96-H101 H93-H101
HVRs may comprise “extended HVRs” as follows: 24-36 or 24-34 (L1), 46-56 or 50-56 (L2) and 89-97 or 89-96 (L3) in the VL and 26-35 (H1), 50-65 or 49-65 (H2) and 93-102, 94-102, or 95-102 (H3) in the VH. The variable domain residues are numbered according to Kabat et al., supra, for each of these definitions.
“Framework” or “FR” residues are those variable domain residues other than the HVR residues as herein defined.
The term “variable domain residue numbering as in Kabat” or “amino acid position numbering as in Kabat,” and variations thereof, refers to the numbering system used for heavy chain variable domains or light chain variable domains of the compilation of antibodies in Kabat et al. supra. Using this numbering system, the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or HVR of the variable domain. For example, a heavy chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g., residues 82a, 82b, and 82c, etc. according to Kabat) after heavy chain FR residue 82. The Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a “standard” Kabat numbered sequence.
The Kabat numbering system is generally used when referring to a residue in the variable domain (approximately residues 1-107 of the light chain and residues 1-113 of the heavy chain) (e.g., Kabat et al. supra). The “EU numbering system” or “EU index” is generally used when referring to a residue in an immunoglobulin heavy chain constant region (e.g., the EU index reported in Kabat et al. supra). The “EU index as in Kabat” refers to the residue numbering of the human IgG1 EU antibody. Unless stated otherwise herein, references to residue numbers in the variable domain of antibodies means residue numbering by the Kabat numbering system. Unless stated otherwise herein, references to residue numbers in the constant domain of antibodies means residue numbering by the EU numbering system (e.g., see U.S. Provisional Application No. 60/640,323, Figures for EU numbering).
As used herein, “administering” is meant a method of giving a dosage of a compound (e.g., an anti-IL-33 antibody provided herein or a nucleic acid encoding an anti-IL-33 antibody provided herein) or a composition (e.g., a pharmaceutical composition, e.g., a pharmaceutical composition including an anti-IL-33 antibody provided herein) to a subject. The compositions utilized in the methods described herein can be administered, for example, intravitreally, intramuscularly, intravenously, intradermally, percutaneously, intraarterially, intraperitoneally, intralesionally, intracranially, intraarticularly, intraprostatically, intrapleurally, intratracheally, intrathecally, intranasally, intravaginally, intrarectally, topically, intratumorally, peritoneally, subcutaneously, subconjunctivally, intravesicularly, mucosally, intrapericardially, intraumbilically, intraocularly, intraorbitally, orally, topically, transdermally, periocularly, conjunctivally, subtenonly, intracamerally, subretinally, retrobulbarly, intracanalicularly, by inhalation, by injection, by implantation, by infusion, by continuous infusion, by localized perfusion bathing target cells directly, by catheter, by lavage, in cremes, or in lipid compositions. The compositions utilized in the methods described herein can also be administered systemically or locally. The method of administration can vary depending on various factors (e.g., the compound or composition being administered, and the severity of the condition, disease, or disorder being treated).
The term “asthma” refers herein to a disorder characterized by variable and recurring symptoms, reversible airflow obstruction (e.g., by bronchodilator), and bronchial hyper-responsiveness, which may or may not be associated with underlying inflammation. Asthma may therefore be inflammatory/inflamed asthma or non-inflammatory/non-inflamed asthma. Examples of asthma include allergic asthma, exercise-induced asthma, aspirin sensitive/exacerbated asthma, atopic asthma, severe asthma, mild asthma, moderate to severe asthma, corticosteroid naïve asthma, chronic asthma, corticosteroid resistant asthma, corticosteroid refractory asthma, newly diagnosed and untreated asthma, asthma due to smoking, asthma uncontrolled on corticosteroids, and other asthmas as mentioned in Bousquet et al. J. Allergy Clin. Immunol. 126(5): 926-938, 2010.
A “disorder” or “disease” is any condition that would benefit from treatment with an antibody provided herein. For example, a disorder may be an IL-33-mediated disorder. This includes chronic and acute disorders or diseases including those pathological conditions which predispose the mammal to the disorder in question. Examples of disorders to be treated herein include IL-33-mediated disorders (e.g., asthma, allergic rhinitis, atopic dermatitis, and fibrosis (e.g., pulmonary fibrosis, e.g., idiopathic pulmonary fibrosis)).
The term “IL-33-mediated disorder,” as used herein, refers to any disorder or condition mediated by, or associated with, the IL-33 axis. In some embodiments, IL-33-mediated disorders are associated with excess IL-33 levels or activity in which atypical symptoms may manifest due to the levels or activity of IL-33 locally and/or systemically in the body. Exemplary IL-33-mediated disorders include ocular disorders, inflammatory conditions, immune disorders, fibrotic disorders, eosinophilic disorders, infections, pain, central nervous system disorders, and solid tumors. IL-33-mediated disorders are described, for example, in Liew et al. Nature Reviews Immunology 10: 103-110, 2010, which is incorporated herein by reference in its entirety.
The term “ocular disorder,” as used herein, includes any ocular disorder (also referred to interchangeably herein as “ocular condition”) associated with pathological angiogenesis and/or atrophy. An ocular disorder may be characterized by altered or unregulated proliferation and/or invasion of new blood vessels into the structures of ocular tissues such as the retina or cornea. An ocular disorder may be characterized by atrophy of retinal tissue (photoreceptors and the underlying retinal pigment epithelium (RPE) and choriocapillaris). Non-limiting ocular disorders include, for example, AMD (e.g., wet AMD, dry AMD, intermediate AMD, advanced AMD, and geographic atrophy (GA)), macular degeneration, macular edema, diabetic macular edema (DME) (e.g., focal, non-center DME and diffuse, center-involved DME), retinopathy, diabetic retinopathy (DR) (e.g., proliferative DR (PDR), non-proliferative DR (NPDR), and high-altitude DR), other ischemia-related retinopathies, ROP, retinal vein occlusion (RVO) (e.g., central (CRVO) and branched (BRVO) forms), choroidal neovascularization (CNV) (e.g., myopic CNV), corneal neovascularization, diseases associated with corneal neovascularization, retinal neovascularization, diseases associated with retinal/choroidal neovascularization, central serous retinopathy (CSR), pathologic myopia, von Hippel-Lindau disease, histoplasmosis of the eye, familial exudative vitreoretinopathy (FEVR), Coats' disease, Norrie Disease, retinal abnormalities associated with osteoporosis-pseudoglioma syndrome (OPPG), subconjunctival hemorrhage, rubeosis, ocular neovascular disease, neovascular glaucoma, retinitis pigmentosa (RP), hypertensive retinopathy, retinal angiomatous proliferation, macular telangiectasia, iris neovascularization, intraocular neovascularization, retinal degeneration, cystoid macular edema (CME), vasculitis, papilloedema, retinitis, including but not limited to CMV retinitis, ocular melanoma, retinal blastoma, conjunctivitis (e.g., infectious conjunctivitis and non-infectious (e.g., allergic) conjunctivitis), Leber congenital amaurosis (also known as Leber's congenital amaurosis or LCA), uveitis (including infectious and non-infectious uveitis), choroiditis (e.g., multifocal choroiditis), ocular histoplasmosis, blepharitis, dry eye, traumatic eye injury, Sjëgren's disease, and other ophthalmic diseases wherein the disease or disorder is associated with ocular neovascularization, vascular leakage, and/or retinal edema or retinal atrophy. Additional exemplary ocular disorders include retinoschisis (abnormal splitting of the retina neurosensory layers), diseases associated with rubeosis (neovascularization of the angle) and diseases caused by the abnormal proliferation of fibrovascular or fibrous tissue, including all forms of proliferative vitreoretinopathy.
Exemplary diseases associated with corneal neovascularization include, but are not limited to, epidemic keratoconjunctivitis, vitamin A deficiency, contact lens overwear, atopic keratitis, superior limbic keratitis, terygium keratitis sicca, Sjögren's syndrome, acne rosacea, phylectenulosis, syphilis, Mycobacteria infections, lipid degeneration, chemical burns, bacterial ulcers, fungal ulcers, Herpes simplex infections, Herpes zoster infections, protozoan infections, Kaposi sarcoma, Mooren ulcer, Terrien's marginal degeneration, marginal keratolysis, rheumatoid arthritis, systemic lupus, polyarteritis, trauma, Wegener's sarcoidosis, scleritis, Stevens-Johnson syndrome, periphigoid radial keratotomy, and corneal graph rejection.
Exemplary diseases associated with choroidal neovascularization and defects in the retina vasculature, including increased vascular leak, aneurisms and capillary drop-out include, but are not limited to, diabetic retinopathy, macular degeneration, sickle cell anemia, sarcoid, syphilis, pseudoxanthoma elasticum, Paget's disease, vein occlusion, artery occlusion, carotid obstructive disease, chronic uveitis/vitritis, mycobacterial infections, Lyme's disease, systemic lupus erythematosis, retinopathy of prematurity, retina edema (including macular edema), Eales disease, Behcet's disease, infections causing retinitis or choroiditis (e.g., multifocal choroidits), presumed ocular histoplasmosis, Best's disease (vitelliform macular degeneration), myopia, optic pits, pars planitis, retinal detachment (e.g., chronic retinal detachment), hyperviscosity syndromes, toxoplasmosis, trauma, and post-laser complications.
Exemplary diseases associated with atrophy of retinal tissues (photoreceptors and the underlying RPE) include, but are not limited to, atrophic or nonexudative AMD (e.g., geographic atrophy or advanced dry AMD), macular atrophy (e.g., atrophy associated with neovascularization and/or geographic atrophy), diabetic retinopathy, Stargardt's disease, Sorsby Fundus Dystrophy, retinoschisis, and retinitis pigmentosa.
Exemplary inflammatory conditions include asthma (e.g., allergic asthma, exercise-induced asthma, aspirin sensitive/exacerbated asthma, atopic asthma, severe asthma, mild asthma, moderate to severe asthma, corticosteroid naïve asthma, chronic asthma, corticosteroid resistant asthma, corticosteroid refractory asthma, newly diagnosed and untreated asthma, asthma due to smoking, asthma uncontrolled on corticosteroids, etc.), airway inflammation, airway hyperreactivity, airway hyperresponsiveness, rhinosinusitis, rhinosinusitis with polyps, nasal polyposis, arthritis (e.g., osteoarthritis, rheumatoid arthritis, collagen-induced arthritis, arthritic joints as a result of injury, etc.), eosinophilic inflammation, mast cell-mediated inflammatory diseases, sepsis, septic shock, seronegative enthesopathy and arthropathy (SEA) syndrome, osteoporosis, eosinophilic esophagitis, scleroderma, dermatitis, atopic dermatitis, allergic rhinitis, bullous pemphigoid, chronic urticaria, cartilage inflammation, polymyalgia rheumatic, polyarteritis nodossa, Wegener's granulomatosis, Behcet's disease, myolitis, polymyolitis, dermatomyolitis, dermatomyositis, vasculitis, arteritis, diabetic nephropathy, interstitial cystitis, graft versus host disease (GVHD), gastrointestinal inflammatory conditions (e.g., inflammatory bowel disease (IBD), ulcerative colitis (UC), Crohn's disease (CD), colitis (e.g., colitis caused by environmental insults (e.g., caused by or associated with a therapeutic regimen, such as chemotherapy, radiation therapy, etc.), infectious colitis, ischemic colitis, collagenous or lymphocytic colitis, necrotizing enterocolitis, colitis in conditions such as chronic granulomatous disease or celiac disease, food allergies, gastritis, infectious gastritis or enterocolitis (e.g., Helicobacterpylori-infected chronic active gastritis), and other forms of gastrointestinal inflammation caused by an infectious agent), and inflammatory pulmonary conditions (e.g., chronic obstructive pulmonary disease (COPD), eosinophilic pulmonary inflammation, infection-induced pulmonary conditions (including those associated with viral (e.g., influenza, parainfluenza, rotavirus, human metapneumovirus, and respiratory syncytial virus), bacterial, fungal (e.g., Aspergillus), parasitic, or prion infection, allergen-induced pulmonary conditions, pollutant-induced pulmonary conditions (e.g., asbestosis, silicosis, or berylliosis), gastric aspiration-induced pulmonary conditions, immune dysregulation, inflammatory conditions with genetic predisposition such as cystic fibrosis, physical trauma-induced pulmonary conditions (e.g., ventilator injury), emphysema, bronchitis, sarcoidosis, histiocytosis, lymphangiomyomatosis, acute lung injury, acute respiratory distress syndrome, chronic lung disease, bronchopulmonary dysplasia, pneumonia (e.g., community-acquired pneumonia, nosocomial pneumonia, ventilator-associated pneumonia, viral pneumonia, bacterial pneumonia, and severe pneumonia), airway exacerbations, and acute respiratory distress syndrome (ARDS)).
Exemplary immune disorders include those mediated at least in part by mast cells, such as asthma (e.g., allergic asthma), eczema, itch, allergy, atopic allergy, anaphylaxis, anaphylactic shock, allergic bronchopulmonary aspergillosis, allergic rhinitis, allergic conjunctivitis, as well as autoimmune disorders including rheumatoid arthritis, juvenile rheumatoid arthritis, psoriatic arthritis, pancreatitis, psoriasis, plaque psoriasis, guttate psoriasis, inverse psoriasis, pustular psoriasis, erythrodermic psoriasis, paraneoplastic autoimmune diseases, autoimmune hepatitis, bullous pemphigoid, myasthenia gravis, inflammatory bowel disease, Crohn's disease, ulcerative colitis, celiac disease, thyroiditis (e.g., Graves' disease), Sjogren's syndrome, Guillain-Barre disease, Raynaud's phenomenon, Addison's disease, liver diseases (e.g., primary biliary cirrhosis, primary sclerosing cholangitis, non-alcoholic fatty liver disease, and non-alcoholic steatohepatitis), and diabetes (e.g., type I diabetes).
As used herein, the terms “fibrotic disorder” and “fibrosis” refer to conditions involving formation of excess fibrous connective tissue in an organ or tissue. Exemplary fibrotic disorders include lung fibrosis, liver fibrosis (e.g., fibrosis associated with cirrhosis (e.g., alcohol-induced cirrhosis, viral-induced cirrhosis, post-hepatitis C cirrhosis, and primary biliary cirrhosis), schistosomiasis, cholangitis (e.g., sclerosing cholangitis), and autoimmune-induced hepatitis), kidney fibrosis (e.g., tubulointerstitial fibrosis, scleroderma, diabetic nephritis, and glomerular nephritis), dermal fibrosis (e.g., scleroderma, hypertrophic and keloid scarring, nephrogenic fibrosing dermatopathy, and burns), myelofibrosis, neurofibromatosis, fibroma, intestinal fibrosis, and fibrotic adhesions resulting from surgical procedures), heart fibrosis (e.g., fibrosis associated with myocardial infarction), vascular fibrosis (e.g., fibrosis associated with postangioplasty arterial restenosis and atherosclerosis), eye fibrosis (e.g., fibrosis associated with post-cataract surgery, proliferative vitreoretinopathy, and retro-orbital fibrosis), and bone marrow fibrosis (e.g., idiopathic myelofibrosis and drug-induced myelofibrosis). The fibrosis can be organ-specific or systemic (e.g., systemic sclerosis and fibrosis associated with GVHD).
Examples of lung fibrosis include, for example, lung or pulmonary fibrosis associated with idiopathic pulmonary fibrosis, fibrosis with collagen vascular disease, Hermansky-Pudlak syndrome, adult respiratory distress syndrome, nonspecific interstitial pneumonia, respiratory bronciolitis, sarcoidosis, histiocytosis X, bronchiolitis obliterans, and cryptogenic organizing pneumonia. In one embodiment, the lung fibrosis is idiopathic pulmonary fibrosis.
As used herein, an “eosinophilic disorder” is a disorder associated with excess eosinophil numbers in which atypical symptoms may manifest due to the levels or activity of eosinophils locally or systemically in the body. Eosinophilic disorders include but are not limited to, asthma (including aspirin sensitive asthma, atopic asthma, and severe asthma), eosinophilic inflammation, atopic dermatitis, allergic rhinitis (including seasonal allergic rhinitis), non-allergic rhinitis, chronic eosinophilic pneumonia, allergic bronchopulmonary aspergillosis, celiac disease, Churg-Strauss syndrome (periarteritis nodosa plus atopy), eosinophilic myalgia syndrome, hypereosinophilic syndrome, edematous reactions including episodic angiodema, helminth infections, where eosinophils may have a protective role, onchocercal dermatitis, eosinophil-associated gastrointestinal disorders (EGIDs), including but not limited to, eosinophilic esophagitis, eosinophilic gastritis, eosinophilic gastroenteritis, eosinophilic enteritis and eosinophilic colitis, nasal micropolyposis and polyposis, aspirin intolerance, and obstructive sleep apnea. Eosinophil-derived secretory products have also been associated with the promotion of angiogenesis and connective tissue formation in tumors and the fibrotic responses seen in conditions such as chronic asthma, Crohn's disease, scleroderma and endomyocardial fibrosis (Munitz et al. Allergy 59: 268-275, 2004; Adamko et al. Allergy 60: 13-22, 2005; Oldhoff et al. Allergy 60: 693-696, 2005). Other examples include cancer (e.g., glioblastoma (such as glioblastoma multiforme) and non-Hodgkin's lymphoma (NHL)), atopic dermatitis, allergic rhinitis, inflammatory bowel disease, fibrosis (e.g., pulmonary fibrosis (e.g., idiopathic pulmonary fibrosis (IPF) and pulmonary fibrosis secondary to sclerosis) and hepatic fibrosis), and COPD.
Examples of infection include helminth infection (e.g., nematode infection, such as Trichuris muris infection of mice, which is a model for infection by the human parasite Trichuris trichiura), protozoan infection (e.g., Leishmania major infection), and viral infection (e.g., respiratory syncytial virus infection and influenza virus infection).
Examples of pain include inflammatory pain, hyperalgesia (e.g., mechanical hyperalgesia), allodynia, and hypernociception (e.g., cutaneous and articular hypernociception, which may or may not be antigen-induced).
Examples of central nervous system disorders include subarachnoid hemorrhage, inflammatory diseases of the central nervous system, neurodegenerative diseases (e.g., Alzheimer's disease, experimental autoimmune encephalomyelitis, multiple sclerosis, Parkinson's disease, Huntington's disease), bipolar disorder, and infection of the central nervous system (e.g., viral infection).
Examples of solid tumors include tumors of the colon, breast, prostate, lung, kidney, liver, pancreas, ovary, head and neck, oral cavity, stomach, duodenum, small intestine, large intestine, gastrointestinal tract, anus, gall bladder, labium, nasopharynx, skin, uterus, male genital organ, urinary organs, bladder, and skin. Solid tumors of non-epithelial origin include sarcomas, brain tumors, and bone tumors.
The above list is not all-inclusive, and it will be understood by the skilled artisan that a disease or disorder may fall within various categories. For example, asthma can be categorized in some instances as both an inflammatory disorder and immune disorder and considered by some clinicians to be an autoimmune disorder.
An “IL-33 axis binding antagonist” refers to a molecule that inhibits the interaction of an IL-33 axis binding partner with one or more of its binding partners. As used herein, an IL-33 axis binding antagonist includes IL-33 binding antagonists, ST2 binding antagonists, and IL1RAcP binding antagonists. Exemplary IL-33 axis binding antagonists include anti-IL-33 antibodies and antigen-binding fragments thereof (e.g., anti-IL-33 antibodies such as ANB-020 (AnaptysBio, Inc.) or any of the antibodies described in U.S. Ser. No. 10/093,730, EP1725261, U.S. Pat. No. 8,187,596, WO2011031600, WO2014164959, WO2015099175 or WO2015106080, which are each incorporated herein by reference in their entirety); polypeptides that bind IL-33 and/or its receptor (ST2 and/or IL-1RAcP) and block ligand-receptor interaction (e.g., ST2-Fc proteins, such as those described in WO 2014/152195, which is herein incorporated by reference in its entirety; immunoadhesins, peptibodies, and soluble ST2, or derivatives thereof); anti-IL-33 receptor antibodies (e.g., anti-ST2 antibodies, for example, AMG-282 (Amgen) or STLM15 (Janssen) or any of the anti-ST2 antibodies described in WO 2013/173761 and WO 2013/165894, which are each incorporated herein by reference in their entirety; or ST2-Fc proteins, such as those described in WO 2013/173761; WO 2013/165894; or WO 2014/152195, which are each incorporated herein by reference in their entirety); and IL-33 receptor antagonists, such as small molecule inhibitors, aptamers that bind IL-33, and nucleic acids that hybridize under stringent conditions to IL-33 axis nucleic acid sequences (e.g., short interfering RNAs (siRNA) or clustered regularly interspaced short palindromic repeat RNAs (CRISPR-RNA or crRNA), including single guide RNAs (sgRNAs) having a crRNA and tracrRNA sequence as described in Mali et al. (Science. 339: 823-26, 2013), which is incorporated herein by reference in its entirety).
As used herein, “chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2)” refers to any native CRTH2 from any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated. CRTH2 is also referred to as G protein coupled receptor 44 (GPR44), cluster of differentiation 294 (CD294), DL1R, and DP2. The term encompasses “full-length,” unprocessed CRTH2, as well as any form of CRTH2 that results from processing in the cell. The amino acid sequence of an exemplary human CRTH2 can be found, for example, under UniProtKB accession number Q9Y5Y4.
The term “CRTH2 binding antagonist” refers to a molecule that decreases, blocks, inhibits, abrogates or interferes with signal transduction resulting from the interaction of CRTH2 with one or more of its binding partners, such as prostaglandin D2. Exemplary CRTH2 binding antagonists known in the art include AMG-853, AP768, AP-761, MLN6095, and ACT129968.
The term “interleukin-5 (IL-5),” as used herein, refers to any native IL-5 from any vertebrate source, including mammals such as primates (e.g. humans) and rodents (e.g., mice and rats), unless otherwise indicated. The term encompasses “full-length,” unprocessed IL-5, as well as any form of IL-5 that results from processing in the cell. The term also encompasses naturally occurring variants of IL-5, such as splice variants or allelic variants. The amino acid sequence of an exemplary IL-5 can be found, for example, under UniProtKB accession number P05113.
The term “IL-5 binding antagonist” refers to a molecule that decreases, blocks, inhibits, abrogates or interferes with signal transduction resulting from the interaction of IL-5 with one or more of its binding partners, such as IL-5 receptor, alpha (ILSRA). Exemplary IL-5 binding antagonists that can be used in the methods disclosed herein include, for example, anti-IL-5 antibodies (e.g., mepolizumab and reslizumab) and anti-IL-5R antibodies.
As used herein, “interleukin-13 (IL-13)” refers to any native IL-13 from any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated. IL-13 is a cytokine secreted by many cell types, including T helper type 2 (Th2) cells. The term encompasses “full-length,” unprocessed IL-13, as well as any form of IL-13 that results from processing in the cell. The amino acid sequence of an exemplary human IL-13 can be found, for example, under UniProtKB accession number P35225.
The term “IL-13 binding antagonist” refers to a molecule that decreases, blocks, inhibits, abrogates or interferes with signal transduction resulting from the interaction of IL-13 with one or more of its binding partners, such as IL-4 receptor alpha (IL4Ra), IL-13 receptor alpha1 (IL13RA1) and IL-13 receptor alpha2 (IL13RA2). IL-13 binding antagonists include anti-IL-13 antibodies, for example, lebrikizumab, 228B/C-1, 228A-4, 227-26, and 227-43 (see, for example, U.S. Pat. Nos. 7,674,459; 8,067,199; 8,088,618; 8,318,160; and 8,734,797).
As used herein, “interleukin-17 (IL-17)” refers to any native IL-17 from any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated, and includes family members IL-17A, IL-17B, IL-17C, IL-17D, IL-17E, and IL-17F. The term encompasses “full-length,” unprocessed IL-17, as well as any form of IL-17 that results from processing in the cell. The amino acid sequence of an exemplary human IL-17A can be found, for example, under UniProtKB accession number Q16552. The amino acid sequence of an exemplary human IL-17B can be found, for example, under UniProtKB accession number Q9UHF5. The amino acid sequence of an exemplary human IL-17C can be found, for example, under UniProtKB accession number Q9POM4. The amino acid sequence of an exemplary human IL-17D can be found, for example, under UniProtKB accession number Q8TAD2. The amino acid sequence of an exemplary human IL-17E can be found, for example, under UniProtKB accession number Q9H293. The amino acid sequence of an exemplary human IL-17F can be found, for example, under UniProtKB accession number Q96PD4.
The term “IL-17 binding antagonist” refers to a molecule that decreases, blocks, inhibits, abrogates or interferes with signal transduction resulting from the interaction of IL-17 with one or more of its binding partners, such as interleukin-17 receptor (IL-17R) family member proteins interleukin 17 receptor A (IL17RA), interleukin 17 receptor B (IL17RB), interleukin 17 receptor C (IL17RC), interleukin 17 receptor D (IL17RD), interleukin 17 receptor E (IL17RE), and interleukin 17 receptor E-like (IL17REL). Exemplary IL-17 binding antagonists include, for example, anti-IL-17 antibodies (e.g., ixekizumab (LY2439821) and anti-IL-17R antibodies (e.g., brodalumab (AMG-827)).
The term “Janus kinase 1 (JAK1),” as used herein, refers to any native JAK1 from any vertebrate source, including mammals such as primates (e.g. humans) and rodents (e.g., mice and rats), unless otherwise indicated. The term encompasses “full-length,” unprocessed JAK1 as well as any form of JAK1 that results from processing in the cell. The term also encompasses naturally occurring variants of JAK1, e.g., splice variants or allelic variants. The amino acid sequence of an exemplary JAK1 can be found, for example, under UniProtKB accession number P23458.
The term “JAK1 antagonist,” as used herein, refers to compounds or agents which inhibit or reduce the biological activity of JAK1. Exemplary JAK1 antagonists include small molecule inhibitors (e.g., ruxolitinib, GLPG0634, and GSK2586184).
The term “ST2 binding antagonist” refers to a molecule that inhibits the interaction of an ST2 with IL-33, IL1RAcP, and/or a second ST2 molecule. The ST2 binding antagonist may be a protein, such as an “ST2-Fc protein” that includes an IL-33-binding domain (e.g., all or a portion of an ST2 or IL1RAcP protein) and a multimerizing domain (e.g., an Fc portion of an immunoglobulin, e.g., an Fc domain of an IgG selected from the isotypes IgG1, IgG2, IgG3, and IgG4, as well as any allotype within each isotype group), which are attached to one another either directly or indirectly through a linker (e.g., a serine-glycine (SG) linker, glycine-glycine (GG) linker, or variant thereof (e.g., a SGG, a GGS, an SGS, or a GSG linker)), and includes, but is not limited to, ST2-Fc proteins and variants thereof described in WO 2013/173761, WO 2013/165894, and WO 2014/152195, which are each incorporated herein by reference in their entirety. In some embodiments, a ST2 binding antagonist may be an anti-ST2 antibody, for example, AMG-282 (Amgen) or STLM15 (Janssen) or any of the anti-ST2 antibodies described in WO 2013/173761 and WO 2013/165894.
As used herein, “tryptase-beta” refers to any native tryptase-beta from any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated. As used herein, the term encompasses tryptase beta-1 (encoded by the TPSAB1 gene, which also encodes tryptase alpha-1) and tryptase beta-2 (encoded by the TPSB2 gene). The term encompasses “full-length,” unprocessed tryptase-beta as well as any form of tryptase-beta that results from processing in the cell. The amino acid sequence of an exemplary human tryptase beta-2 can be found, for example, under UniProtKB accession number P20231.
The term “tryptase-beta antagonist,” as used herein, refers to compounds or agents which inhibit or reduce the biological activity of tryptase beta.
As used herein, “Factor D” refers to any native Factor D from any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated. Factor D is also referred to as C3 proactivator convertase, properdin factor D esterase, Factor D (complement), Complement Factor D, CFD, and adipsin. The term encompasses “full-length,” unprocessed Factor D, as well as any form of Factor D that results from processing in the cell. The amino acid sequence of an exemplary human Factor D can be found, for example, under UniProtKB accession number P00746.
The term “Factor D binding antagonist,” as used herein, refers to compounds or agents which inhibit or reduce the biological activity of Factor D. Exemplary Factor D binding antagonists include, for example, small molecule inhibitors and anti-Factor D antibodies, for example, any anti-Factor D antibody described in WO 2007/056227, WO 01/70818, and/or US 2002/0081293, which are each incorporated herein by reference in their entirety. In some embodiments, the anti-Factor D antibody is or is derived from monoclonal antibody 166-32, produced by the hybridoma deposited with the ATCC and designated HB 12476.
The term “High-temperature requirement A serine peptidase 1” or “HtrA1,” as used herein, refers to any native HtrA1 from any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated. HtrA1 is also known in the art as HtrA serine peptidase 1, L56, and Serine protease 11. The term encompasses “full-length,” unprocessed HtrA1 as well as any form of HtrA1 that results from processing in the cell. The term also encompasses naturally occurring variants of HtrA1, e.g., splice variants or allelic variants. The amino acid sequence of an exemplary human HtrA1 can be found, for example, under UniProtKB accession number Q92743.
The term “HtrA1 binding antagonist” as used herein, refers to compounds or agents which inhibit or reduce the biological activity of HtrA1. Exemplary HtrA1 binding antagonists include, for example, small molecule inhibitors and anti-HtrA1 antibodies, for example, any anti-HtrA1 antibody described in U.S. Ser. No. 10/421,822 or U.S. Pat. No. 9,738,727, each of which is incorporated herein by reference in its entirety.
The term “vascular endothelial growth factor” or “VEGF” refers to vascular endothelial growth factor protein A, as exemplified by Swiss Prot Accession Number P15692. The term “VEGF” encompasses the protein having the amino acid sequence exemplified by Swiss Prot Accession Number P15692 as well as homologues and isoforms thereof. The term “VEGF” also encompasses the known isoforms, e.g., splice isoforms of VEGF, e.g., VEGF111, VEGF121, VEGF145, VEGF165, VEGF189, and VEGF206, together with the naturally-occurring allelic and processed forms thereof, including the 110-amino acid human vascular endothelial cell growth factor generated by plasmin cleavage of VEGF165 as described in Ferrara Mol. Biol. Cell. 21:687 (2010), Leung et al., Science, 246:1306 (1989), and Houck et al., Mol. Endocrin., 5:1806 (1991). The term “VEGF” also refers to VEGFs from non-human species such as mouse, rat or primate. Sometimes the VEGF from a specific species are indicated by terms such as hVEGF for human VEGF, mVEGF for murine VEGF, and the like. The term “VEGF” is also used to refer to truncated forms of the polypeptide comprising amino acids 8 to 109 or 1 to 109 of the 165-amino acid human vascular endothelial cell growth factor. Reference to any such forms of VEGF may be identified in the present application, e.g., by “VEGF109,” “VEGF (8-109),” “VEGF (1-109)” or “VEGF165.” The amino acid positions for a “truncated” native VEGF are numbered as indicated in the native VEGF sequence. For example, amino acid position 17 (methionine) in truncated native VEGF is also position 17 (methionine) in native VEGF. The truncated native VEGF has binding affinity for the KDR and Flt-1 receptors comparable to native VEGF. The term “VEGF variant” as used herein refers to a VEGF polypeptide which includes one or more amino acid mutations in the native VEGF sequence. Optionally, the one or more amino acid mutations include amino acid substitution(s). For purposes of shorthand designation of VEGF variants described herein, it is noted that numbers refer to the amino acid residue position along the amino acid sequence of the putative native VEGF (provided in Leung et al., supra and Houck et al., supra). Unless specified otherwise, the term “VEGF” as used herein indicates VEGF-A.
The term “VEGF antagonist,” as used herein, refers to a molecule capable of binding to VEGF, reducing VEGF expression levels, or neutralizing, blocking, inhibiting, abrogating, reducing, or interfering with VEGF biological activities, including, but not limited to, VEGF binding to one or more VEGF receptors, VEGF signaling, and VEGF-mediated angiogenesis and endothelial cell survival or proliferation. For example, a molecule capable of neutralizing, blocking, inhibiting, abrogating, reducing, or interfering with VEGF biological activities can exert its effects by binding to one or more VEGF receptor (VEGFR) (e.g., VEGFR1, VEGFR2, VEGFR3, membrane-bound VEGF receptor (mbVEGFR), or soluble VEGF receptor (sVEGFR)). Included as VEGF antagonists useful in the methods disclosed herein are polypeptides that specifically bind to VEGF, anti-VEGF antibodies and antigen-binding fragments thereof, receptor molecules and derivatives which bind specifically to VEGF thereby sequestering its binding to one or more receptors, fusions proteins (e.g., VEGF-Trap (Regeneron)), and VEGF121-gelonin (Peregrine). VEGF antagonists also include antagonist variants of VEGF polypeptides, antisense nucleobase oligomers complementary to at least a fragment of a nucleic acid molecule encoding a VEGF polypeptide; small RNAs complementary to at least a fragment of a nucleic acid molecule encoding a VEGF polypeptide; ribozymes that target VEGF; peptibodies to VEGF; and VEGF aptamers. VEGF antagonists also include polypeptides that bind to VEGFR, anti-VEGFR antibodies, and antigen-binding fragments thereof, and derivatives which bind to VEGFR thereby blocking, inhibiting, abrogating, reducing, or interfering with VEGF biological activities (e.g., VEGF signaling), or fusions proteins. VEGF antagonists also include nonpeptide small molecules that bind to VEGF or VEGFR and are capable of blocking, inhibiting, abrogating, reducing, or interfering with VEGF biological activities. Thus, the term “VEGF activities” specifically includes VEGF-mediated biological activities of VEGF. In certain embodiments, the VEGF antagonist reduces or inhibits, by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more, the expression level or biological activity of VEGF. In some embodiments, the VEGF inhibited by the VEGF-specific antagonist is VEGF (8-109), VEGF (1-109), or VEGF165.
As used herein VEGF antagonists can include, but are not limited to, anti-VEGFR2 antibodies and related molecules (e.g., ramucirumab, tanibirumab, aflibercept), anti-VEGFR1 antibodies and related molecules (e.g., icrucumab, aflibercept (VEGF Trap-Eye; EYLEA®), and ziv-aflibercept (VEGF Trap; ZALTRAP®)), bispecific VEGF antibodies (e.g., MP-0250, vanucizumab (VEGF-ANG2), and bispecific antibodies disclosed in US 2001/0236388), bispecific antibodies including combinations of two of anti-VEGF, anti-VEGFR1, and anti-VEGFR2 arms, anti-VEGF antibodies (e.g., bevacizumab, sevacizumab, and ranibizumab), and nonpeptide small molecule VEGF antagonists (e.g., pazopanib, axitinib, vandetanib, stivarga, cabozantinib, lenvatinib, nintedanib, orantinib, telatinib, dovitinig, cediranib, motesanib, sulfatinib, apatinib, foretinib, famitinib, and tivozanib).
The terms “anti-VEGF antibody,” an “antibody that binds to VEGF,” and “antibody that specifically binds VEGF” refer to an antibody that is capable of binding VEGF with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting VEGF. In one embodiment, the extent of binding of an anti-VEGF antibody to an unrelated, non-VEGF protein is less than about 10% of the binding of the antibody to VEGF as measured, for example, by a radioimmunoassay (RIA). In certain embodiments, an antibody that binds to VEGF has a dissociation constant (Kd) of ≤1 μM, ≤100 nM, ≤10 nM, ≤1 nM, ≤0.1 nM, ≤0.01 nM, or ≤0.001 nM (e.g. 10−8 M or less, e.g., from 10−8 M to 10−13 M, e.g., from 10−9 M to 10−13 M). In certain embodiments, an anti-VEGF antibody binds to an epitope of VEGF that is conserved among VEGF from different species.
In certain embodiments, the anti-VEGF antibody can be used as a therapeutic agent in targeting and interfering with diseases or conditions wherein the VEGF activity is involved. Also, the antibody may be subjected to other biological activity assays, e.g., in order to evaluate its effectiveness as a therapeutic. Such assays are known in the art and depend on the target antigen and intended use for the antibody. Examples include the HUVEC inhibition assay; tumor cell growth inhibition assays (as described in WO 89/06692, for example); antibody-dependent cellular cytotoxicity (ADCC) and complement-mediated cytotoxicity (CDC) assays (U.S. Pat. No. 5,500,362); and agonistic activity or hematopoiesis assays (see WO 95/27062). An anti-VEGF antibody will usually not bind to other VEGF homologues such as VEGF-B or VEGF-C, nor other growth factors such as PIGF, PDGF, or bFGF. In one embodiment, anti-VEGF antibody is a monoclonal antibody that binds to the same epitope as the monoclonal anti-VEGF antibody A4.6.1 produced by hybridoma ATCC HB 10709. In another embodiment, the anti-VEGF antibody is a recombinant humanized anti-VEGF monoclonal antibody generated according to Presta et al. (1997) Cancer Res. 57:4593-4599, including but not limited to the antibody known as bevacizumab (BV; AVASTIN®).
The anti-VEGF antibody “bevacizumab (BV),” also known as “rhuMAb VEGF” or “AVASTIN®,” is a recombinant humanized anti-VEGF monoclonal antibody generated according to Presta et al. (1997) Cancer Res. 57:4593-4599. It comprises mutated human IgG1 framework regions and antigen-binding complementarity-determining regions from the murine anti-hVEGF monoclonal antibody A.4.6.1 that blocks binding of human VEGF to its receptors. Approximately 93% of the amino acid sequence of bevacizumab, including most of the framework regions, is derived from human IgG1, and about 7% of the sequence is derived from the murine antibody A4.6.1. Bevacizumab has a molecular mass of about 149,000 daltons and is glycosylated. Bevacizumab and other humanized anti-VEGF antibodies are further described in U.S. Pat. No. 6,884,879 issued Feb. 26, 2005, the entire disclosure of which is expressly incorporated herein by reference. Additional preferred antibodies include the G6 or B20 series antibodies (e.g., G6-31, B20-4.1), as described in PCT Application Publication Nos. WO 2005/012359 and WO 2005/044853, which are each incorporated herein by reference in their entirety. For additional preferred antibodies see U.S. Pat. Nos. 7,060,269, 6,582,959, 6,703,020; 6,054,297; WO98/45332; WO 96/30046; WO94/10202; EP 0666868B1; U.S. Patent Application Publication Nos. 2006009360, 20050186208, 20030206899, 20030190317, 20030203409, and 20050112126; and Popkov et al., Journal of Immunological Methods 288:149-164 (2004). Other preferred antibodies include those that bind to a functional epitope on human VEGF comprising of residues F17, M18, D19, Y21, Y25, Q89, 191, K101, E103, and C104 or, alternatively, comprising residues F17, Y21, Q22, Y25, D63, 183, and Q89. Additional anti-VEGF antibodies include anti-VEGF antibodies described in PCT Application Publication No. WO 2009/155724.
The anti-VEGF antibody “ranibizumab” also known as “LUCENTIS®” or “rhuFab V2” is a humanized, affinity-matured anti-human VEGF Fab fragment. Ranibizumab is produced by standard recombinant technology methods in Escherichia coli expression vector and bacterial fermentation. Ranibizumab is not glycosylated and has a molecular mass of ˜48,000 daltons. See WO 98/45331 and US 2003/0190317.
A “chemotherapeutic agent” is a chemical compound useful in the treatment of cancer. Examples of chemotherapeutic agents include alkylating agents such as thiotepa and cyclosphosphamide (CYTOXAN®); alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, triethylenephosphoramide, triethylenethiophosphoramide and trimethylomelamine; acetogenins (especially bullatacin and bullatacinone); delta-9-tetrahydrocannabinol (dronabinol, MARINOL®); beta-lapachone; lapachol; colchicines; betulinic acid; a camptothecin (including the synthetic analogue topotecan (HYCAMTIN®), CPT-11 (irinotecan, CAMPTOSAR®), acetylcamptothecin, scopolectin, and 9-aminocamptothecin); bryostatin; callystatin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogues); podophyllotoxin; podophyllinic acid; teniposide; cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (including the synthetic analogues, KW-2189 and CB1-TM1); eleutherobin; pancratistatin; a sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil, chlornaphazine, chlorophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosoureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, and ranimnustine; antibiotics such as the enediyne antibiotics (e.g., calicheamicin, especially calicheamicin gamma1I and calicheamicin omegaII (see, e.g., Nicolaou et al. Angew. Chem Intl. Ed. Engl., 33: 183-186 (1994)); CDP323, an oral alpha-4 integrin inhibitor; dynemicin, including dynemicin A; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antibiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, caminomycin, carzinophilin, chromomycins, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, doxorubicin (including ADRIAMYCIN®, morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin, doxorubicin HCl liposome injection (DOXIL®), liposomal doxorubicin TLC D-99 (MYOCET®), peglylated liposomal doxorubicin (CAELYX®), and deoxydoxorubicin), epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, porfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate, gemcitabine (GEMZAR®), tegafur (UFTORAL®), capecitabine (XELODA®), an epothilone, and 5-fluorouracil (5-FU); combretastatin; folic acid analogues such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elformithine; elliptinium acetate; an epothilone; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidainine; maytansinoids such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidanmol; nitraerine; pentostatin; phenamet; pirarubicin; losoxantrone; 2-ethylhydrazide; procarbazine; PSK® polysaccharide complex (JHS Natural Products); razoxane; rhizoxin; sizofuran; spirogermanium; tenuazonic acid; triaziquone; 2,2′,2′-trichlorotriethylamine; trichothecenes (especially T-2 toxin, verracurin A, roridin A and anguidine); urethan; vindesine (ELDISINE®, FILDESIN®); dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside (“Ara-C”); thiotepa; taxoid, e.g., paclitaxel (TAXOL), albumin-engineered nanoparticle formulation of paclitaxel (ABRAXANE™), and docetaxel (TAXOTERE®); chloranbucil; 6-thioguanine; mercaptopurine; methotrexate; platinum agents such as cisplatin, oxaliplatin (e.g., ELOXATIN®), and carboplatin; vincas, which prevent tubulin polymerization from forming microtubules, including vinblastine (VELBAN®), vincristine (ONCOVIN®), vindesine (ELDISINE®, FILDESIN®), and vinorelbine (NAVELBINE®); etoposide (VP-16); ifosfamide; mitoxantrone; leucovorin; novantrone; edatrexate; daunomycin; aminopterin; ibandronate; topoisomerase inhibitor RFS 2000; difluoromethylornithine (DMFO); retinoids such as retinoic acid, including bexarotene (TARGRETIN®); bisphosphonates such as clodronate (for example, BONEFOS® or OSTAC®), etidronate (DIDROCAL®), NE-58095, zoledronic acid/zoledronate (ZOMETA®), alendronate (FOSAMAX®), pamidronate (AREDIA®), tiludronate (SKELID®), or risedronate (ACTONEL®); troxacitabine (a 1,3-dioxolane nucleoside cytosine analog); antisense oligonucleotides, particularly those that inhibit expression of genes in signaling pathways implicated in aberrant cell proliferation, such as, for example, PKC-alpha, Raf, H-Ras, and epidermal growth factor receptor (EGFR) (e.g., erlotinib (TARCEVA™)); and VEGF-A that reduce cell proliferation; vaccines such as THERATOPE® vaccine and gene therapy vaccines, for example, ALLOVECTIN® vaccine, LEUVECTIN® vaccine, and VAXID® vaccine; topoisomerase 1 inhibitor (e.g., LURTOTECAN®); rmRH (e.g., ABARELIX®); BAY439006 (sorafenib; Bayer); SU-11248 (sunitinib, SUTENT®, Pfizer); perifosine, COX-2 inhibitor (e.g. celecoxib or etoricoxib), proteosome inhibitor (e.g. PS341); bortezomib (VELCADE®); CCI-779; tipifarnib (R11577); orafenib, ABT510; Bcl-2 inhibitor such as oblimersen sodium (GENASENSE®); pixantrone; EGFR inhibitors; tyrosine kinase inhibitors; serine-threonine kinase inhibitors such as rapamycin (sirolimus, RAPAMUNE®); farnesyltransferase inhibitors such as lonafarnib (SCH 6636, SARASAR™); and pharmaceutically acceptable salts, acids or derivatives of any of the above; as well as combinations of two or more of the above such as CHOP, an abbreviation for a combined therapy of cyclophosphamide, doxorubicin, vincristine, and prednisolone; and FOLFOX, an abbreviation for a treatment regimen with oxaliplatin (ELOXATIN™) combined with 5-FU and leucovorin, and pharmaceutically acceptable salts, acids or derivatives of any of the above; as well as combinations of two or more of the above.
Chemotherapeutic agents as defined herein include “anti-hormonal agents” or “endocrine therapeutics” which act to regulate, reduce, block, or inhibit the effects of hormones that can promote the growth of cancer. They may be hormones themselves, including, but not limited to: anti-estrogens with mixed agonist/antagonist profile, including, tamoxifen (NOLVADEX®), 4-hydroxytamoxifen, toremifene (FARESTON®), idoxifene, droloxifene, raloxifene (EVISTA®), trioxifene, keoxifene, and selective estrogen receptor modulators (SERMs) such as SERM3; pure anti-estrogens without agonist properties, such as fulvestrant (FASLODEX®), and EM800 (such agents may block estrogen receptor (ER) dimerization, inhibit DNA binding, increase ER turnover, and/or suppress ER levels); aromatase inhibitors, including steroidal aromatase inhibitors such as formestane and exemestane (AROMASIN®), and nonsteroidal aromatase inhibitors such as anastrazole (ARIMIDEX®), letrozole (FEMARA®) and aminoglutethimide, and other aromatase inhibitors include vorozole (RIVISOR®), megestrol acetate (MEGASE®), fadrozole, and 4(5)-imidazoles; luteinizing hormone-releaseing hormone agonists, including leuprolide (LUPRON® and ELIGARD®), goserelin, buserelin, and tripterelin; sex steroids, including progestines such as megestrol acetate and medroxyprogesterone acetate, estrogens such as diethylstilbestrol and premarin, and androgens/retinoids such as fluoxymesterone, all transretionic acid and fenretinide; onapristone; anti-progesterones; estrogen receptor down-regulators (ERDs); anti-androgens such as flutamide, nilutamide and bicalutamide; and pharmaceutically acceptable salts, acids or derivatives of any of the above; as well as combinations of two or more of the above.
The term “cytotoxic agent” as used herein refers to a substance that inhibits or prevents a cellular function and/or causes cell death or destruction. Cytotoxic agents include, but are not limited to, radioactive isotopes (e.g., At21, I131, I125, Y90, Re186, Re188, Sm153, Bi212, P32, Pb212 and radioactive isotopes of Lu); chemotherapeutic agents or drugs (e.g., methotrexate, adriamicin, vinca alkaloids (e.g., vincristine, vinblastine, etoposide), doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin or other intercalating agents); growth inhibitory agents; enzymes and fragments thereof such as nucleolytic enzymes; antibiotics; toxins such as small molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, including fragments and/or variants thereof; and the various antitumor or anticancer agents disclosed herein.
A “growth inhibitory agent” when used herein refers to a compound or composition which inhibits growth of a cell either in vitro or in vivo. Thus, the growth inhibitory agent may be one which significantly reduces the percentage of cells in S phase. Examples of growth inhibitory agents include agents that block cell cycle progression (at a place other than S phase), such as agents that induce G1 arrest and M-phase arrest. Classical M-phase blockers include the vincas (e.g., vincristine and vinblastine), taxanes, and topoisomerase II inhibitors such as doxorubicin, epirubicin, daunorubicin, etoposide, and bleomycin. Those agents that arrest G1 also spill over into S-phase arrest, for example, DNA alkylating agents such as tamoxifen, prednisone, dacarbazine, mechlorethamine, cisplatin, methotrexate, 5-fluorouracil, and ara-C. Further information can be found in Mendelsohn et al. eds., The Molecular Basis of Cancer, Chapter 1, entitled “Cell cycle regulation, oncogenes, and antineoplastic drugs” by Murakami et al. (W.B. Saunders, Philadelphia, 1995), e.g., p. 13. The taxanes (paclitaxel and docetaxel) are anticancer drugs both derived from the yew tree. Docetaxel (TAXOTERE®), derived from the European yew, is a semisynthetic analogue of paclitaxel (TAXOL®). Paclitaxel and docetaxel promote the assembly of microtubules from tubulin dimers and stabilize microtubules by preventing depolymerization, which results in the inhibition of mitosis in cells.
An “isolated nucleic acid” refers to a nucleic acid molecule that has been separated from a component of its natural environment. An isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
The term “control sequences” refers to DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism. The control sequences that are suitable for prokaryotes, for example, include a promoter, optionally an operator sequence, and a ribosome binding site. Eukaryotic cells are known to utilize promoters, polyadenylation signals, and enhancers.
The terms “host cell,” “host cell line,” and “host cell culture” are used interchangeably and refer to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells. Host cells include “transformants” and “transformed cells,” which include the primary transformed cell and progeny derived therefrom without regard to the number of passages. Progeny may not be completely identical in nucleic acid content to a parent cell, but may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein. The host cell may be an “isolated host cell,” which refers to a host cell that has been separated from a component of its natural environment.
Nucleic acid is “operably linked” when it is placed into a functional relationship with another nucleic acid sequence. For example, DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation. Generally, “operably linked” means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.
“Percent (%) amino acid sequence identity” with respect to the polypeptide sequences identified herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the polypeptide being compared, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared. For purposes herein, however, % amino acid sequence identity values are generated using the sequence comparison computer program ALIGN-2. The ALIGN-2 sequence comparison computer program was authored by Genentech, Inc. and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087. The ALIGN-2 program is publicly available through Genentech, Inc., South San Francisco, Calif. The ALIGN-2 program should be compiled for use on a UNIX operating system, preferably digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
In situations where ALIGN-2 is employed for amino acid sequence comparisons, the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B (which can alternatively be phrased as a given amino acid sequence A that has or comprises a certain % amino acid sequence identity to, with, or against a given amino acid sequence B) is calculated as follows:
100 times the fraction X/Y
where X is the number of amino acid residues scored as identical matches by the sequence alignment program ALIGN-2 in that program's alignment of A and B, and where Y is the total number of amino acid residues in B. It will be appreciated that where the length of amino acid sequence A is not equal to the length of amino acid sequence B, the % amino acid sequence identity of A to B will not equal the % amino acid sequence identity of B to A. Unless specifically stated otherwise, all % amino acid sequence identity values used herein are obtained as described in the immediately preceding paragraph using the ALIGN-2 computer program.
The amino acid sequences described herein are contiguous amino acid sequences unless otherwise specified.
The term “package insert” is used to refer to instructions customarily included in commercial packages of therapeutic products, that contain information about the indications, usage, dosage, administration, combination therapy, contraindications and/or warnings concerning the use of such therapeutic products.
The term “pharmaceutical composition” refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
A “pharmaceutically acceptable carrier” refers to an ingredient in a pharmaceutical formulation, other than an active ingredient, which is nontoxic to a subject. A pharmaceutically acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer, or preservative.
The term “prodrug” as used in this application refers to a precursor or derivative form of a pharmaceutically active substance that is less cytotoxic to tumor cells compared to the parent drug and is capable of being enzymatically activated or converted into the more active parent form. See, e.g., Wilman, “Prodrugs in Cancer Chemotherapy” Biochemical Society Transactions, 14, pp. 375-382, 615th Meeting Belfast (1986) and Stella et al. “Prodrugs: A Chemical Approach to Targeted Drug Delivery,” Directed Drug Delivery, Borchardt et al. (ed.), pp. 247-267, Humana Press (1985). The prodrugs of this invention include, but are not limited to, phosphate-containing prodrugs, thiophosphate-containing prodrugs, sulfate-containing prodrugs, peptide-containing prodrugs, D-amino acid-modified prodrugs, glycosylated prodrugs, β-lactam-containing prodrugs, optionally substituted phenoxyacetamide-containing prodrugs or optionally substituted phenylacetamide-containing prodrugs, 5-fluorocytosine and other 5-fluorouridine prodrugs which can be converted into the more active cytotoxic free drug. Examples of cytotoxic drugs that can be derivatized into a prodrug form for use in this invention include, but are not limited to, those chemotherapeutic agents described above.
By “reduce or inhibit” is meant the ability to cause an overall decrease preferably of 20% or greater, more preferably of 50% or greater, and most preferably of 75%, 85%, 90%, 95%, or greater. Reduce or inhibit can refer to the symptoms of the disorder being treated, the presence or size of metastases, and/or the size of the primary tumor.
A “subject” is a vertebrate, preferably a mammal, more preferably a human. Mammals include, but are not limited to, farm animals (such as cows, and sheep), sport animals, pets (such as cats, dogs and horses), primates (e.g., humans and non-human primates such as monkeys), and rodents (e.g., mice and rats).
The term “therapeutically effective amount” refers to an amount of a compound (e.g., an anti-IL-33 antibody provided herein (including an antibody fragment, such an Fab fragment) or a nucleic acid encoding an anti-IL-33 antibody provided herein) or a composition (e.g., a pharmaceutical composition, e.g., a pharmaceutical composition including an anti-IL-33 antibody provided herein) to treat a disease or disorder in a subject. In the case of an IL-33-mediated disorder, the therapeutically effective amount of the antibody or antibody fragment (e.g., an anti-IL-33 antibody, including bispecific anti-IL-33 antibodies that bind to IL-33 and a second biological molecule, e.g., IL-13, e.g., bispecific anti-IL-33/anti-IL-13 antibodies) may ameliorate or treat the disease, or prevent, reduce, ameliorate, or treat symptoms associated with the disease. In the case of a proliferative disease (e.g., a solid tumor), the therapeutically effective amount of the antibody or antibody fragment may reduce the number of cancer cells; reduce the primary tumor size; inhibit (i.e., slow to some extent and preferably stop) cancer cell infiltration into peripheral organs; inhibit (i.e., slow to some extent and preferably stop) tumor metastasis; inhibit, to some extent, tumor growth; and/or relieve to some extent one or more of the symptoms associated with the disorder. To the extent the antibody or antibody fragment may prevent growth and/or kill existing cancer cells, it may be cytostatic and/or cytotoxic. For cancer therapy, efficacy in vivo can, for example, be measured by assessing the duration of survival, time to disease progression (TTP), duration of disease free survival (DFS), duration of progression free survival (PFS), the response rates (RR), duration of response, and/or quality of life.
As used herein, “treatment” (and grammatical variations thereof such as “treat” or “treating”) refers to clinical intervention in an attempt to alter the natural course of the individual being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Desirable effects of treatment include, but are not limited to, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis. In some embodiments, antibodies disclosed herein are used to delay development of a disease or to slow the progression of a disease. A patient may be successfully “treated” for asthma if, for example, after receiving an asthma therapy, the patient shows observable and/or measurable reduction in or absence of one or more of the following: recurrent wheezing, coughing, trouble breathing, chest tightness, symptoms that occur or worsen at night, symptoms that are triggered by cold air, exercise or exposure to allergens.
“Tumor”, as used herein, refers to all neoplastic cell growth and proliferation, whether malignant or benign, and all pre-cancerous and cancerous cells and tissues.
The term “vector,” as used herein, is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. One type of vector is a “plasmid”, which refers to a circular double stranded DNA loop into which additional DNA segments may be ligated. Another type of vector is a phage vector. Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as “recombinant expression vectors” (or simply, “recombinant vectors” or “expression vectors”). In general, expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. In the present specification, “plasmid” and “vector” may be used interchangeably.
The term “turbidity,” as used herein, refers to the cloudiness or haziness of a liquid due to suspended insoluble particles. Turbidity can be assessed by measuring the optical density (OD) of a liquid sample, e.g., using a spectrophotometer.
The term “viscosity,” as used herein, refers to a measure of a fluid's resistance to deformation at a given rate. The SI unit of dynamic viscosity is the pascal-second (Pa·s), but is also commonly expressed as centipoise (cP), which is equal to one millipascal-second (mPa·s).
II. Compositions and Methods
In one aspect, the invention is based, at least in part, on improved antibodies that bind to IL-33. The antibodies provided herein have unexpectedly advantageous properties, including high stability (including under conditions of chemical and light stress) and reduced oxidation compared to existing anti-IL-33 antibodies. For example, the antibodies disclosed herein may lack a tryptophan residue in CDR-H3 that can result in decreased stability due to oxidation. Moreover, the antibodies provided herein also bind to human and cynomolgus monkey (cyno) IL-33 with high affinity and inhibitory activity, e.g., as assessed using surface plasmon resonance (SPR) and in cell-based blocking assays (e.g., using HEK-BLUE™ cells), respectively. Further, the antibodies provided herein have low viscosity at high protein concentrations and high solubility. Antibodies disclosed herein are useful, e.g., for the treatment of IL-33-mediated disorders. The unexpectedly favorable properties described above (including improved stability with reduced oxidation, high solubility, and the ability to be formulated at high concentration with low viscosity) are particularly advantageous in the context of ocular administration, e.g., for treatment of ocular disorders (e.g., AMD (e.g., GA)). For example, in the context of GA, without wishing to be bound by any theory, targeted inhibition of IL-33 signaling in the eye may protect photoreceptors and RPE in the area bordering GA lesions, e.g., by limiting the influx of inflammatory mononuclear phagocytes.
A. Exemplary Anti-IL-33 Antibodies
In one example, provided herein is an anti-IL-33 antibody that includes at least one, two, three, four, five, or six CDRs selected from: (a) CDR-H1 comprising the amino acid sequence of NYWMT (SEQ ID NO: 1); (b) CDR-H2 comprising the amino acid sequence of SITYTGGGTYYPDSVKG (SEQ ID NO: 2); (c) CDR-H3 comprising the amino acid sequence of ANYYYNTYGGFPY (SEQ ID NO: 3); (d) CDR-L1 comprising the amino acid sequence of LASEGFSNDLA (SEQ ID NO: 4); (e) CDR-L2 comprising the amino acid sequence of AASRLQD (SEQ ID NO: 5); and (f) CDR-L3 comprising the amino acid sequence of QQGSKYPLT (SEQ ID NO: 6), or a combination of one or more of the above CDRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity) to any one of SEQ ID NOs: 1-6. For example, in some instances, the anti-IL-33 antibody includes at least one, two, three, four, five, or six CDRs selected from: (a) CDR-H1 comprising the amino acid sequence of NYWMT (SEQ ID NO: 1); (b) CDR-H2 comprising the amino acid sequence of SITYTGGGTYYPDSVKG (SEQ ID NO: 2); (c) CDR-H3 comprising the amino acid sequence of ANYYYNTYGGFPY (SEQ ID NO: 3); (d) CDR-L1 comprising the amino acid sequence of LASEGFSNDLA (SEQ ID NO: 4); (e) CDR-L2 comprising the amino acid sequence of AASRLQD (SEQ ID NO: 5); and (f) CDR-L3 comprising the amino acid sequence of QQGSKYPLT (SEQ ID NO: 6).
In another example, provided herein is an anti-IL-33 antibody that includes (a) a VH domain comprising an amino acid sequence having at least 90% sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, the amino acid sequence of SEQ ID NO: 7; (b) a VL domain comprising an amino acid sequence having at least 90% sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, the amino acid sequence of SEQ ID NO: 8; or (c) a VH domain as in (a) and a VL domain as in (b).
Any of the anti-IL-33 antibodies provided herein may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVX1SGX2X3X4X5X6PGX7SX8X9X10SCX11ASGFTFN (SEQ ID NO: 9), wherein X1 is E or Q; X2 is G or A; X3 is G or E; X4 is L or V; X5 is V or K; X6 is Q or K; X7 is G, A, or T; X8 is L or V; X9 is R or K; X10 is L or V; and X11 is A, K, or L; an FR-H2 comprising the amino acid sequence of WX1RQAPGX2GLEWX3X4 (SEQ ID NO: 10), wherein X1 is I or V; X2 is K or Q; X3 is V, M, or I; and X4 is A or G; an FR-H3 comprising the amino acid sequence of RX1TX2X3RDX4X5X6X7X8X9YX10X11X12X13SLRX14EDTAX15YYCTR (SEQ ID NO: 11), wherein X1 is F or V; X2 is I or M; X3 is S or T; X4 is D, N, or T; X5 is A or S; X6 is K or T; X7 is S or N; X8 is S or T; X9 is L or V; X10 is L or M; X11 is Q or E; X12 is M or L; X13 is N or S; X14 is A or S; and X15 is V or T; and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity) to any one of SEQ ID NOs: 9-12.
For example, in some instances, the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WIRQAPGKGLEWVA (SEQ ID NO: 18); an FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity) to any one of SEQ ID NOs: 12 and 17-19. In some instances, the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WIRQAPGKGLEWVA (SEQ ID NO: 18); an FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12). In some embodiments, the VH domain comprises the amino acid sequence of SEQ ID NO: 7.
In another example, in some instances, the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 39); an FR-H3 comprising the amino acid sequence of RFTISRDNAKNSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 40); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity) to any one of SEQ ID NOs: 12, 17, 39, and 40. In some instances, the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 39); an FR-H3 comprising the amino acid sequence of RFTISRDNAKNSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 40); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12). In some embodiments, the VH domain comprises the amino acid sequence of SEQ ID NO: 41.
In another example, in some instances, the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WIRQAPGKGLEWIA (SEQ ID NO: 42); an FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity) to any one of SEQ ID NOs: 12, 17, 19, and 42. In some instances, the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WIRQAPGKGLEWIA (SEQ ID NO: 42); an FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12). In some instances, the VH domain comprises the amino acid sequence of SEQ ID NO: 43.
In another example, in some instances, the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 39); an FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity) to any one of SEQ ID NOs: 12, 17, 19, and 39. In some instances, the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 39); an FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12). In some instances, the VH domain comprises the amino acid sequence of SEQ ID NO: 44.
In another example, in some instances, the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 39); an FR-H3 comprising the amino acid sequence of RFTISRDDAKNSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 45); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity) to any one of SEQ ID NOs: 12, 17, 39, and 45. In some instances, the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 39); an FR-H3 comprising the amino acid sequence of RFTISRDDAKNSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 45); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12). In some embodiments, the VH domain comprises the amino acid sequence of SEQ ID NO: 46.
In another example, in some instances, the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 39); an FR-H3 comprising the amino acid sequence of RFTISRDNAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 47); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity) to any one of SEQ ID NOs: 12, 17, 39, and 47. In some instances, the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 39); an FR-H3 comprising the amino acid sequence of RFTISRDNAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 47); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12). In some embodiments, the VH domain comprises the amino acid sequence of SEQ ID NO: 48.
In another example, in some instances, the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWIA (SEQ ID NO: 49); an FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity) to any one of SEQ ID NOs: 12, 17, 19 and 49. In some instances, the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWIA (SEQ ID NO: 49); an FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12). In some instances, the VH domain comprises the amino acid sequence of SEQ ID NO: 50.
In another example, in some instances, the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWIA (SEQ ID NO: 49); an FR-H3 comprising the amino acid sequence of RFTISRDDSKSTLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 51); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity) to any one of SEQ ID NOs: 12, 17, 49, and 51. In some instances, the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); an FR-H2 comprising the amino acid sequence of WVRQAPGKGLEWIA (SEQ ID NO: 49); an FR-H3 comprising the amino acid sequence of RFTISRDDSKSTLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 51); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12). In some instances, the VH domain comprises the amino acid sequence of SEQ ID NO: 52.
Any of the anti-IL-33 antibodies provided herein may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of X1IX2X3TQSPX4X5LSX6SX7GX8X9X10X11X12X13C (SEQ ID NO: 13), wherein X1 is D or E; X2 is Q or V; X3 is M or L; X4 is S or A; X5 is S or T; X6 is A or L; X7 is V, P, or L; X8 is D or E; X9 is R or T; X10 is V or A; X11 is T or S; X12 is I or L; and X13 is T, S, or E; an FR-L2 comprising the amino acid sequence of WX1QQKX2GX3X4PX5X6LIY (SEQ ID NO: 14), wherein X1 is Y or F; X2 is P or S; X3 is K or Q; X4 is S or A; X5 is K, R, or Q; and X6 is L or S; an FR-L3 comprising the amino acid sequence of GX1PX2RFSGSGSGTX3FX4LX5ISX6X7X8PEDX9AX10YX11C (SEQ ID NO: 15), wherein X1 is V or I; X2 is S or A; X3 is D or R; X4 is T or S; X5 is T or K; X6 is S or G; X7 is L or M; X8 is Q or E; X9 is F, V, or E; X10 is T, V, or D; and X11 is F or Y; and an FR-L4 comprising the amino acid sequence of FGX1GTKX2EIK (SEQ ID NO: 16), wherein X1 is G or S and X2 is V or L, or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity) to any one of SEQ ID NOs: 13-16. In some instances, the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of X1IX2X3TQSPX4X5LSX6SX7GX8X9X10X11X12X13C (SEQ ID NO: 13), wherein X1 is D or E; X2 is Q or V; X3 is M or L; X4 is S or A; X5 is S or T; X6 is A or L; X7 is V, P, or L; X8 is D or E; X9 is R or T; X10 is V or A; X11 is T or S; X12 is I or L; and X13 is T, S, or E; an FR-L2 comprising the amino acid sequence of WX1QQKX2GX3X4PX5X6LIY (SEQ ID NO: 14), wherein X1 is Y or F; X2 is P or S; X3 is K or Q; X4 is S or A; X5 is K, R, or Q; and X6 is L or S; an FR-L3 comprising the amino acid sequence of GX1PX2RFSGSGSGTX3FX4LX5ISX6X7X8PEDX9AX10YX11C (SEQ ID NO: 15), wherein X1 is V or I; X2 is S or A; X3 is D or R; X4 is T or S; X5 is T or K; X6 is S or G; X7 is L or M; X8 is Q or E; X9 is F, V, or E; X10 is T, V, or D; and X11 is F or Y; and an FR-L4 comprising the amino acid sequence of FGX1GTKX2EIK (SEQ ID NO: 16), wherein X1 is G or S and X2 is V or L.
For example, in some instances, the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); an FR-L2 comprising the amino acid sequence of WYQQKPGKSPKLLIY (SEQ ID NO: 22); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYFC (SEQ ID NO: 23); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity) to any one of SEQ ID NOs: 21-24. In some instances, the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); an FR-L2 comprising the amino acid sequence of WYQQKPGKSPKLLIY (SEQ ID NO: 22); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYFC (SEQ ID NO: 23); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24). In some instances, the VL domain comprises the amino acid sequence of SEQ ID NO: 8.
For instance, the anti-IL-33 antibody may include (a) CDR-H1 comprising the amino acid sequence of NYWMT (SEQ ID NO: 1); (b) CDR-H2 comprising the amino acid sequence of SITYTGGGTYYPDSVKG (SEQ ID NO: 2); (c) CDR-H3 comprising the amino acid sequence of ANYYYNTYGGFPY (SEQ ID NO: 3); (d) CDR-L1 comprising the amino acid sequence of LASEGFSNDLA (SEQ ID NO: 4); (e) CDR-L2 comprising the amino acid sequence of AASRLQD (SEQ ID NO: 5); and (f) CDR-L3 comprising the amino acid sequence of QQGSKYPLT (SEQ ID NO: 6). In some instances, the anti-IL-33 antibody comprises (a) a heavy chain variable (VH) domain comprising an amino acid sequence having at least 90% sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, SEQ ID NO: 7; (b) a light chain variable (VL) domain comprising an amino acid sequence having at least 90% sequence (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, SEQ ID NO: 8; or (c) a VH domain as in (a) and a VL domain as in (b). In some instances, the anti-IL-33 antibody includes the following heavy chain framework regions: FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17); FR-H2 comprising the amino acid sequence of WIRQAPGKGLEWVA (SEQ ID NO: 18); FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12). In some instances, the anti-IL-33 antibody includes the following light chain framework regions: FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); FR-L2 comprising the amino acid sequence of WYQQKPGKSPKLLIY (SEQ ID NO: 22); FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYFC (SEQ ID NO: 23); and FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24). In some instances, the anti-IL-33 antibody includes a binding domain comprising (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 7 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 8. In some instances, the exemplary anti-IL-33 antibody is 1E1v8.
For example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 7 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 8.
In another example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a heavy chain (HC) comprising an amino acid sequence of SEQ ID NO: 25 and (b) a light chain (LC) comprising an amino acid sequence of SEQ ID NO: 26.
In another example, in some instances, the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); an FR-L2 comprising the amino acid sequence of WFQQKPGKAPKSLIY (SEQ ID NO: 53); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 54); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity) to any one of SEQ ID NOs: 21, 24, 53, and 54. In some instances, the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); an FR-L2 comprising the amino acid sequence of WFQQKPGKAPKSLIY (SEQ ID NO: 53); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 54); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24). In some instances, the VL domain comprises the amino acid sequence of SEQ ID NO: 55.
In another example, in some instances, the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); an FR-L2 comprising the amino acid sequence of WYQQKPGKAPKSLIY (SEQ ID NO: 56); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYFC (SEQ ID NO: 23); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity) to any one of SEQ ID NOs: 21, 23, 24 and 56. In some instances, the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); an FR-L2 comprising the amino acid sequence of WYQQKPGKAPKSLIY (SEQ ID NO: 56); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYFC (SEQ ID NO: 23); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24). In some instances, the VL domain comprises the amino acid sequence of SEQ ID NO: 57.
In another example, in some instances, the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); an FR-L2 comprising the amino acid sequence of WFQQKPGKAPKSLIY (SEQ ID NO: 53); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYFC (SEQ ID NO: 23); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity) to any one of SEQ ID NOs: 21, 23, 24, and 53. In some instances, the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); an FR-L2 comprising the amino acid sequence of WFQQKPGKAPKSLIY (SEQ ID NO: 53); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYFC (SEQ ID NO: 23); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24). In some instances, the VL domain comprises the amino acid sequence of SEQ ID NO: 58.
In another example, in some instances, the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); an FR-L2 comprising the amino acid sequence of WYQQKPGKAPKSLIY (SEQ ID NO: 56); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 54); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity) to any one of SEQ ID NOs: 21, 24, 54 and 56. In some instances, the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); an FR-L2 comprising the amino acid sequence of WYQQKPGKAPKSLIY (SEQ ID NO: 56); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 54); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24). In some instances, the VL domain comprises the amino acid sequence of SEQ ID NO: 59.
In another example, in some instances, the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); an FR-L2 comprising the amino acid sequence of WYQQKPGKSPKLLIY (SEQ ID NO: 22); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDVATYYC (SEQ ID NO: 60); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity) to any one of SEQ ID NOs: 21, 22, 24, and 60. In some instances, the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21); an FR-L2 comprising the amino acid sequence of WYQQKPGKSPKLLIY (SEQ ID NO: 22); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDVATYYC (SEQ ID NO: 60); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24). In some instances, the VL domain comprises the amino acid sequence of SEQ ID NO: 61.
For example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 41 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 55.
In another example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 43 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 55.
In another example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 41 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 8.
In another example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 43 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 8.
In another example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 44 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 8.
In another example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 46 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 8.
In another example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 48 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 8.
In another example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 43 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 57.
In another example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 44 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 57.
In another example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 46 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 57.
In another example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 48 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 57.
In another example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 50 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 57.
In another example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 43 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 58.
In another example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 44 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 58.
In another example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 46 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 58.
In another example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 48 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 58.
In another example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 50 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 58.
In another example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 43 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 59.
In another example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 44 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 59.
In another example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 46 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 59.
In another example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 48 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 59.
In another example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 50 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 59.
In another example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 52 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 61.
In another example, provided herein is an anti-IL-33 antibody that includes (a) a VH domain comprising an amino acid sequence having at least 90% sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, the amino acid sequence of SEQ ID NO: 35; (b) a VL domain comprising an amino acid sequence having at least 90% sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, the amino acid sequence of SEQ ID NO: 36; or (c) a VH domain as in (a) and a VL domain as in (b).
In another example, in some instances, the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGTSLKLSCLASGFTFN (SEQ ID NO: 27); an FR-H2 comprising the amino acid sequence of WIRQAPGKGLEWIA (SEQ ID NO: 28); an FR-H3 comprising the amino acid sequence of RFTISRDDAKSTLYLQMNSLRSEDTATYYCTR (SEQ ID NO: 29); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity) to any one of SEQ ID NOs: 12, 27, 28, and 29. In some instances, the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGTSLKLSCLASGFTFN (SEQ ID NO: 27); an FR-H2 comprising the amino acid sequence of WIRQAPGKGLEWIA (SEQ ID NO: 28); an FR-H3 comprising the amino acid sequence of RFTISRDDAKSTLYLQMNSLRSEDTATYYCTR (SEQ ID NO: 29); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12). In some instances, the VH domain comprises the amino acid sequence of SEQ ID NO: 35.
In another example, in some instances, the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPASLSASLGETVSIEC (SEQ ID NO: 31); an FR-L2 comprising the amino acid sequence of WYQQKSGKSPQLLIY (SEQ ID NO: 32); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTRFSLKISGMQPEDEADYFC (SEQ ID NO: 33); and an FR-L4 comprising the amino acid sequence of FGSGTKLEIK (SEQ ID NO: 34), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity) to any one of SEQ ID NOs: 31-34. In some instances, the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of DIQMTQSPASLSASLGETVSIEC (SEQ ID NO: 31); an FR-L2 comprising the amino acid sequence of WYQQKSGKSPQLLIY (SEQ ID NO: 32); an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTRFSLKISGMQPEDEADYFC (SEQ ID NO: 33); and an FR-L4 comprising the amino acid sequence of FGSGTKLEIK (SEQ ID NO: 34). In some instances, the VL domain comprises the amino acid sequence of SEQ ID NO: 36.
For example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 35 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 36.
For example, provided herein is an isolated antibody that specifically binds IL-33, wherein the antibody comprises (a) a heavy chain (HC) comprising an amino acid sequence of SEQ ID NO: 37 and (b) a light chain (LC) comprising an amino acid sequence of SEQ ID NO: 38.
In another example, provided herein is an anti-IL-33 antibody that includes (a) a VH domain comprising an amino acid sequence having at least 90% sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, the amino acid sequence of SEQ ID NO: 65; (b) a VL domain comprising an amino acid sequence having at least 90% sequence identity (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, the amino acid sequence of SEQ ID NO: 69; or (c) a VH domain as in (a) and a VL domain as in (b).
In another example, in some instances, the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVQSGAEVKKPGASVKVSCKASGFTFN (SEQ ID NO: 62); an FR-H2 comprising the amino acid sequence of WVRQAPGQGLEWMG (SEQ ID NO: 63); an FR-H3 comprising the amino acid sequence of RVTMTRDTSTSTVYMELSSLRSEDTAVYYCTR (SEQ ID NO: 64); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity) to any one of SEQ ID NOs: 12 and 62-64. In some instances, the anti-IL-33 antibody may include one, two, three, or four of the following heavy chain framework regions: an FR-H1 comprising the amino acid sequence of EVQLVQSGAEVKKPGASVKVSCKASGFTFN (SEQ ID NO: 62); an FR-H2 comprising the amino acid sequence of WVRQAPGQGLEWMG (SEQ ID NO: 63); an FR-H3 comprising the amino acid sequence of RVTMTRDTSTSTVYMELSSLRSEDTAVYYCTR (SEQ ID NO: 64); and an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12). In some instances, the VH domain comprises the amino acid sequence of SEQ ID NO: 65.
In another example, in some instances, the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of EIVLTQSPATLSLSPGERATLSC (SEQ ID NO: 66); an FR-L2 comprising the amino acid sequence of WYQQKPGQAPRLLIY (SEQ ID NO: 67); an FR-L3 comprising the amino acid sequence of GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC (SEQ ID NO: 68); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24), or a combination of one or more of the above FRs and/or one or more variants thereof having at least about 80% sequence identity (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity) to any one of SEQ ID NOs: 24 and 66-68. In some instances, the anti-IL-33 antibody may include one, two, three, or four of the following light chain framework regions: an FR-L1 comprising the amino acid sequence of EIVLTQSPATLSLSPGERATLSC (SEQ ID NO: 66); an FR-L2 comprising the amino acid sequence of WYQQKPGQAPRLLIY (SEQ ID NO: 67); an FR-L3 comprising the amino acid sequence of GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC (SEQ ID NO: 68); and an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24). In some instances, the VL domain comprises the amino acid sequence of SEQ ID NO: 69.
For example, provided herein is an isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises (a) a VH domain comprising an amino acid sequence of SEQ ID NO: 65 and (b) a VL domain comprising an amino acid sequence of SEQ ID NO: 69.
Any of the antibodies provided herein may specifically bind human or cynomolgus monkey (cyno) IL-33. In some instances, the antibody specifically binds both human and cyno IL-33. In certain instances, an anti-IL-33 antibody provided herein specifically binds both human and cyno IL-33 with a KD of 100 nM or lower (e.g., 100 nM or lower, 10 nM or lower, 1 nM or lower, 100 pM or lower, 10 pM or lower, 1 pM or lower, or 0.1 pM or lower).
In some instances, the antibody specifically binds human IL-33 with a KD of 1 nM or lower (e.g., 1 nm or lower, 100 pM or lower, 10 pM or lower, 1 pM or lower, or 0.1 pM or lower). For example, in some instances, the antibody specifically binds human IL-33 with a KD between 100 fM and 1 nM. For example, in some instances, the antibody specifically binds human IL-33 with a KD between 100 fM and 1 nM. In another example, in some instances, the antibody specifically binds human IL-33 with a KD between 750 fM and 300 pM. In another example, in some instances, the antibody specifically binds human IL-33 with a KD between 1 pM and 200 pM. In some instances, the antibody specifically binds human IL-33 with a KD of 118 pM. In other instances, the antibody specifically binds human IL-33 with a KD of 15 pM.
In some instances, the antibody specifically binds cyno IL-33 with a KD of 1 nM or lower (e.g., 1 nm or lower, 100 pM or lower, 10 pM or lower, 1 pM or lower, or 0.1 pM or lower). For example, in some instances, the antibody specifically binds cyno IL-33 with a KD between 100 fM and 1 nM. In another example, in some instances, the antibody specifically binds cyno IL-33 with a KD between 1 pM and 500 pM. In another example, in some instances, the antibody specifically binds cyno IL-33 with a KD between 20 pM and 50 pM. In some instances, the antibody specifically binds cyno IL-33 with a KD of 35 pM.
In certain instances, the antibody specifically binds both human and cyno IL-33 with a KD of 1 nM or lower (e.g., 1 nm or lower, 100 pM or lower, 10 pM or lower, 1 pM or lower, or 0.1 pM or lower). For example, in some instances, the antibody specifically binds both human and cyno IL-33 with a KD of between 1 pM and 500 pM. In some instances, the antibody specifically binds both human and cyno IL-33 with a KD of between 10 pM and 40 pM.
For example, in some instances, the antibody specifically binds human IL-33 with a KD of between about 1 pM and about 1 nM (e.g., between about 1 pM and about 900 pM, between about 1 pM and about 800 pM, between about 1 pM and about 700 pM, between about 1 pM and about 600 pM, between about 1 pM and about 500 pM, between about 1 pM and about 400 pM, between about 1 pM and about 300 pM, between about 1 pM and about 200 pM, between about 1 pM and about 190 pM, between about 1 pM and about 180 pM, between about 1 pM and about 170 pM, between about 1 pM and about 160 pM, between about 1 pM and about 150 pM, between about 1 pM and about 140 pM, between about 1 pM and about 130 pM, between about 1 pM and about 120 pM, between about 1 pM and about 110 pM, between about 1 pM and about 100 pM, between about 1 pM and about 90 pM, between about 1 pM and about 80 pM, between about 1 pM and about 70 pM, between about 1 pM and about 60 pM, between about 1 pM and about 50 pM, between about 1 pM and about 40 pM, between about 1 pM and about 30 pM, between about 1 pM and about 20 pM, or between about 1 pM and about 10 pM). In some instances, the antibody specifically binds human IL-33 with a KD of between about 1 pM and about 250 pM (e.g., between about 1 pM and about 250 pM, between about 1 pM and about 225 pM, between about 1 pM and about 200 pM, between about 1 pM and about 190 pM, between about 1 pM and about 180 pM, between about 1 pM and about 170 pM, between about 1 pM and about 160 pM, between about 1 pM and about 150 pM, between about 1 pM and about 140 pM, between about 1 pM and about 130 pM, between about 1 pM and about 120 pM, between about 1 pM and about 110 pM, between about 1 pM and about 100 pM, between about 1 pM and about 90 pM, between about 1 pM and about 80 pM, between about 1 pM and about 70 pM, between about 1 pM and about 60 pM, between about 1 pM and about 50 pM, between about 1 pM and about 40 pM, between about 1 pM and about 30 pM, between about 1 pM and about 20 pM, or between about 1 pM and about 10 pM). In some instances, the antibody specifically binds human IL-33 with a KD of between about 50 pM and about 180 pM (e.g., about 50 pM, about 60 pM, about 70 pM, about 80 pM, about 90 pM, about 100 pM, about 110 pM, about 120 pM, about 130 pM, about 140 pM, about 150 pM, about 160 pM, or about 180 pM). In some instances, the antibody specifically binds human IL-33 with a KD of 118 pM. In other instances, the antibody specifically binds human IL-33 with a KD of 15 pM. Any of the preceding KD values may be determined by surface plasmon resonance, for example, as described herein (see, e.g., the Examples, including Examples 4, 6, and 7).
In some instances, the antibody specifically binds human IL-33 with a KD of about 400 pM or lower at 25° C. For example, in some instances, the antibody specifically binds human IL-33 with a KD of about 390 pM or lower, about 380 pM or lower, about 375 pM or lower, about 350 pM or lower, about 325 pM or lower, about 300 pM or lower, about 275 pM or lower, about 250 pM or lower, about 250 pM or lower, about 225 pM or lower, about 200 pM or lower, about 175 pM or lower, about 150 pM or lower, about 130 pM or lower, about 125 pM or lower, about 100 pM or lower, about 75 pM or lower, about 50 pM or lower, about 25 pM or lower, about 20 pM or lower at 25° C., about 15 pM or lower at 25° C., about 10 pM or lower at 25° C., or about 5 pM or lower at 25° C. In some instances, the antibody specifically binds human IL-33 with a KD of about 1 pM to about 150 pM (e.g., about 1 pM, about 5 pM, about 10 pM, about 15 pM, about 20 pM, about 30 pM, about 40 pM, about 50 pM, about 60 pM, about 70 pM, about 80 pM, about 90 pM, about 100 pM, about 110 pM, about 120 pM, about 130 pM, about 140 pM, or about 150 pM) at 25° C. In some instances, the antibody specifically binds human IL-33 with a KD of about 15 pM at 25° C. The antibody may be a Fab fragment. In some instances, any of the preceding KD values may be determined by surface plasmon resonance, for example, as described herein (see, e.g., the Examples, including Examples 4, 6, and 7).
In some instances, the antibody specifically binds human IL-33 with a KD of about 400 pM or lower at 37° C. For example, in some instances, the antibody specifically binds human IL-33 with a KD of about 390 pM or lower, about 380 pM or lower, about 375 pM or lower, about 350 pM or lower, about 325 pM or lower, about 300 pM or lower, about 275 pM or lower, about 250 pM or lower, about 250 pM or lower, about 225 pM or lower, about 200 pM or lower, about 175 pM or lower, about 150 pM or lower, about 130 pM or lower, about 125 pM or lower, about 100 pM or lower, about 75 pM or lower, about 50 pM or lower, about 25 pM or lower, about 20 pM or lower, about 15 pM or lower, about 10 pM or lower, or about 5 pM or lower at 37° C. In some instances, the antibody specifically binds human IL-33 with a KD of about 1 pM to about 150 pM (e.g., about 1 pM, about 5 pM, about 10 pM, about 15 pM, about 20 pM, about 30 pM, about 40 pM, about 50 pM, about 60 pM, about 70 pM, about 80 pM, about 90 pM, about 100 pM, about 110 pM, about 120 pM, about 130 pM, about 140 pM, or about 150 pM) at 37° C. In some instances, the antibody specifically binds human IL-33 with a KD of about 15 pM at 37° C. The antibody may be a Fab fragment. In some instances, any of the preceding KD values may be determined by surface plasmon resonance, for example, as described herein (see, e.g., the Examples, including Examples 4, 6, and 7).
In some instances, the antibody specifically binds cyno IL-33 with a KD of between about 1 pM and about 1 nM (e.g., between about 1 pM and about 900 pM, between about 1 pM and about 800 pM, between about 1 pM and about 700 pM, between about 1 pM and about 600 pM, between about 1 pM and about 500 pM, between about 1 pM and about 400 pM, between about 1 pM and about 300 pM, between about 1 pM and about 200 pM, between about 1 pM and about 190 pM, between about 1 pM and about 180 pM, between about 1 pM and about 170 pM, between about 1 pM and about 160 pM, between about 1 pM and about 150 pM, between about 1 pM and about 140 pM, between about 1 pM and about 130 pM, between about 1 pM and about 120 pM, between about 1 pM and about 110 pM, between about 1 pM and about 100 pM, between about 1 pM and about 90 pM, between about 1 pM and about 80 pM, between about 1 pM and about 70 pM, between about 1 pM and about 60 pM, between about 1 pM and about 50 pM, between about 1 pM and about 40 pM, between about 1 pM and about 30 pM, between about 1 pM and about 20 pM, or between about 1 pM and about 10 pM). In some instances, the antibody specifically binds cyno IL-33 with a KD of between about 100 pM and about 750 pM (e.g., between about 100 pM and about 750 pM, between about 200 pM and about 750 pM, between about 225 pM and about 750 pM, between about 250 pM and about 750 pM, between about 265 pM and about 750 pM, between about 275 pM and about 750 pM, between about 300 pM and about 750 pM, between about 325 pM and about 750 pM, between about 350 pM and about 750 pM, between about 375 pM and about 750 pM, between about 400 pM and about 750 pM, between about 425 pM and about 750 pM, between about 450 pM and about 750 pM, between about 475 pM and about 750 pM, between about 500 pM and about 750 pM, between about 525 pM and about 750 pM, between about 550 pM and about 750 pM, between about 575 pM and about 750 pM, between about 600 pM and about 750 pM, between about 650 pM and about 750 pM, or between about 250 pM and about 650 pM). In some instances, any of the preceding KD values may be determined by surface plasmon resonance, for example, as described herein (see, e.g., the Examples, including Examples 4, 6, and 7).
In some instances, the antibody specifically binds cyno IL-33 with a KD of about 400 pM or lower at 25° C. For example, in some instances, the antibody specifically binds cyno IL-33 with a KD of about 390 pM or lower, about 380 pM or lower, about 375 pM or lower, about 350 pM or lower, about 325 pM or lower, about 300 pM or lower, about 275 pM or lower, about 250 pM or lower, about 250 pM or lower, about 225 pM or lower, about 200 pM or lower, about 175 pM or lower, about 150 pM or lower, about 130 pM or lower, about 125 pM or lower, about 100 pM or lower, about 75 pM or lower, about 50 pM or lower, about 25 pM or lower, about 20 pM or lower at 25° C., about 15 pM or lower at 25° C., about 10 pM or lower at 25° C., or about 5 pM or lower at 25° C. In some instances, the antibody specifically binds cyno IL-33 with a KD of about 1 pM to about 150 pM (e.g., about 1 pM, about 5 pM, about 10 pM, about 15 pM, about 20 pM, about 30 pM, about 40 pM, about 50 pM, about 60 pM, about 70 pM, about 80 pM, about 90 pM, about 100 pM, about 110 pM, about 120 pM, about 130 pM, about 140 pM, or about 150 pM) at 25° C. In some instances, the antibody specifically binds cyno IL-33 with a KD of about 22 pM at 25° C. The antibody may be a Fab fragment. In some instances, any of the preceding KD values may be determined by surface plasmon resonance, for example, as described herein (see, e.g., the Examples, including Examples 4, 6, and 7).
In some instances, the antibody specifically binds cyno IL-33 with a KD of about 400 pM or lower at 37° C. For example, in some instances, the antibody specifically binds cyno IL-33 with a KD of about 390 pM or lower, about 380 pM or lower, about 375 pM or lower, about 350 pM or lower, about 325 pM or lower, about 300 pM or lower, about 275 pM or lower, about 250 pM or lower, about 250 pM or lower, about 225 pM or lower, about 200 pM or lower, about 175 pM or lower, about 150 pM or lower, about 130 pM or lower, about 125 pM or lower, about 100 pM or lower, about 75 pM or lower, about 50 pM or lower, about 25 pM or lower, about 20 pM or lower, about 15 pM or lower, about 10 pM or lower, or about 5 pM or lower at 37° C. In some instances, the antibody specifically binds cyno IL-33 with a KD of about 1 pM to about 150 pM (e.g., about 1 pM, about 5 pM, about 10 pM, about 15 pM, about 20 pM, about 30 pM, about 40 pM, about 50 pM, about 60 pM, about 70 pM, about 80 pM, about 90 pM, about 100 pM, about 110 pM, about 120 pM, about 130 pM, about 140 pM, or about 150 pM) at 37° C. In some instances, the antibody specifically binds cyno IL-33 with a KD of about 34 pM at 37° C. The antibody may be a Fab fragment. In some instances, any of the preceding KD values may be determined by surface plasmon resonance, for example, as described herein (see, e.g., the Examples, including Examples 4, 6, and 7).
In some instances, an anti-IL-33 antibody provided herein is capable of inhibiting the binding of IL-33 to an IL-33 receptor. In some instances, the inhibiting is measured using a cell-based blocking assay. In some instances, the antibody inhibits the binding of human IL-33 to an IL-33 receptor with a half-maximal inhibitory concentration (IC50) of between about 750 fM and about 250 pM (e.g., between about 750 fM and about 250 pM, between about 1 pM and about 250 pM, between about 1 pM and about 100 pM, between about 1 pM and about 50 pM, between about 1 pM and about 10 pM, or between about 1 pM and about 5 pM). In some instances, the antibody inhibits the binding of human IL-33 to an IL-33 receptor with an IC50 of about 50 pM or below (e.g., about 50 pM or below, about 40 pM or below, about 30 pM or below, about 20 pM or below, about 15 pM or below, about 10 pM or below, about 9 pM or below, about 8 pM or below, about 7 pM or below, about 6 pM or below, about 5 pM or below, about 4 pM or below, about 3 pM or below, about 2.5 pM or below, about 2 pM or below, about 1 pM or below, about 900 fM or below, about 800 fM or below, or about 750 fM or below). In some instances, the antibody inhibits the binding of human IL-33 to an IL-33 receptor with an IC50 of between about 1 pM and about 50 pM. In some instances, the antibody inhibits the binding of human IL-33 to an IL-33 receptor with an IC50 of about 31 pM. In some instances, the inhibiting is measured using a cell-based blocking assay using HEK-BLUE™ cells, for example, as described herein (see, e.g., the Examples, including Examples 3 and 6).
In some instances, the antibody inhibits the binding of cyno IL-33 to an IL-33 receptor with an IC50 of between about 1 nM and about 10 nM (e.g., between about 1 nM and about 10 nM, between about 1 nM and about 9 nM, between about 1 nM and about 8 nM, between about 1 nM and about 7 nM, between about 1 nM and about 6 nM, between about 1 nM and about 5 nM, between about 1 nM and about 4 nM, or between about 1 nM and about 3 nM). In some instances, the inhibiting is measured using a cell-based blocking assay using HEK-BLUE™ cells, for example, as described herein (see, e.g., the Examples, including Examples 3 and 6).
Any of the antibodies provided herein may have a viscosity of less than about 10 centipoise (cP), e.g., at a concentration of about 100 mg/mL, about 110 mg/mL, about 120 mg/mL, about 130 mg/mL, about 140 mg/mL, about 150 mg/mL, about 160 mg/mL, about 170 mg/mL, about 180 mg/mL, about 190 mg/mL, about 200 mg/mL, about 210 mg/mL, about 220 mg/mL, about 230 mg/mL, about 240 mg/mL, about 250 mg/mL, about 260 mg/mL, about 270 mg/mL, about 280 mg/mL, about 290 mg/mL, about 300 mg/mL, about 310 mg/mL, about 320 mg/mL, about 330 mg/mL, about 340 mg/mL, about 350 mg/mL, about 360 mg/mL, about 370 mg/mL, about 380 mg/mL, about 390 mg/mL, or about 400 mg/mL.
For example, in some instances, the antibody has a viscosity of less than about 10 cP, less than about 9.5 cP, less than about 9 cP, less than about 8.5 cP, less than about 8 cP, less than about 7.5 cP, less than about 7 cP, less than about 6.5 cP, less than about 6 cP, less than about 5.5 cP, less than about 5 cP, less than about 4.5 cP, less than about 4 cP, less than about 3.5 cP, less than about 3 cP, less than about 2.5 cP, less than about 2 cP, less than about 1.5 cP, less than about 1 cP, or less than about 0.5 cP, e.g., at a concentration of about 100 mg/mL, about 110 mg/mL, about 120 mg/mL, about 130 mg/mL, about 140 mg/mL, about 150 mg/mL, about 160 mg/mL, about 170 mg/mL, about 180 mg/mL, about 190 mg/mL, about 200 mg/mL, about 210 mg/mL, about 220 mg/mL, about 230 mg/mL, about 240 mg/mL, about 250 mg/mL, about 260 mg/mL, about 270 mg/mL, about 280 mg/mL, about 290 mg/mL, about 300 mg/mL, about 310 mg/mL, about 320 mg/mL, about 330 mg/mL, about 340 mg/mL, about 350 mg/mL, about 360 mg/mL, about 370 mg/mL, about 380 mg/mL, about 390 mg/mL, or about 400 mg/mL. In some instances, the antibody has a viscosity of less than about 10 cP, less than about 9.5 cP, less than about 9 cP, less than about 8.5 cP, less than about 8 cP, less than about 7.5 cP, less than about 7 cP, less than about 6.5 cP, less than about 6 cP, less than about 5.5 cP, less than about 5 cP, less than about 4.5 cP, less than about 4 cP, less than about 3.5 cP, less than about 3 cP, less than about 2.5 cP, less than about 2 cP, less than about 1.5 cP, less than about 1 cP, or less than about 0.5 cP, e.g., at a concentration of about 180 mg/mL.
For example, in some instances, an antibody provided herein may have a viscosity of less than about 5 cP, e.g., at a concentration of about 100 mg/mL or higher (e.g., about 100 mg/mL, about 110 mg/mL, about 120 mg/mL, about 130 mg/mL, about 140 mg/mL, about 150 mg/mL, about 160 mg/mL, about 170 mg/mL, about 180 mg/mL, about 190 mg/mL, about 200 mg/mL, about 210 mg/mL, about 220 mg/mL, about 230 mg/mL, about 240 mg/mL, about 250 mg/mL, about 260 mg/mL, about 270 mg/mL, about 280 mg/mL, about 290 mg/mL, about 300 mg/mL, about 310 mg/mL, about 320 mg/mL, about 330 mg/mL, about 340 mg/mL, about 350 mg/mL, about 360 mg/mL, about 370 mg/mL, about 380 mg/mL, about 390 mg/mL, or about 400 mg/mL). In some instances, the antibody has a viscosity of between about 0.5 cP and about 5 cP, between about 0.5 cP and about 4.5 cP, between about 0.5 cP and about 4 cP, between about 0.5 cP and about 3.5 cP, between about 0.5 cP and about 3 cP, between about 0.5 cP and about 2.5 cP, between about 0.5 cP and about 2 cP, between about 0.5 cP and about 1.5 cP, between about 0.5 cP and about 1 cP, between about 1 cP and about 5 cP, between about 1 cP and about 4.5 cP, between about 1 cP and about 4 cP, between about 1 cP and about 3.5 cP, between about 1 cP and about 3 cP, between about 1 cP and about 2.5 cP, between about 1 cP and about 2 cP, between about 1 cP and about 1.5 cP, between about 1.5 cP and about 5 cP, between about 1.5 cP and about 4.5 cP, between about 1.5 cP and about 4 cP, between about 1.5 cP and about 3.5 cP, between about 1.5 cP and about 3 cP, between about 1.5 cP and about 2.5 cP, between about 1.5 cP and about 2 cP, between about 2 cP and about 5 cP, between about 2 cP and about 4.5 cP, between about 2 cP and about 4 cP, between about 2 cP and about 3.5 cP, between about 2 cP and about 3 cP, between about 2 cP and about 2.5 cP, between about 2.5 cP and about 5 cP, between about 2.5 cP and about 4.5 cP, between about 2.5 cP and about 4 cP, between about 2.5 cP and about 3.5 cP, between about 2.5 cP and about 3 cP, between about 3 cP and about 5 cP, between about 3 cP and about 4.5 cP, between about 3 cP and about 4 cP, between about 3 cP and about 3.5 cP, between about 3.5 cP and about 5 cP, between about 3.5 cP and about 4.5 cP, between about 3.5 cP and about 4 cP, between about 4 cP and about 5 cP, between about 4 cP and about 4.5 cP, or between about 4.5 cP and about 5 cP, e.g., at a concentration of about 100 mg/mL, about 110 mg/mL, about 120 mg/mL, about 130 mg/mL, about 140 mg/mL, about 150 mg/mL, about 160 mg/mL, about 170 mg/mL, about 180 mg/mL, about 190 mg/mL, about 200 mg/mL, about 210 mg/mL, about 220 mg/mL, about 230 mg/mL, about 240 mg/mL, about 250 mg/mL, about 260 mg/mL, about 270 mg/mL, about 280 mg/mL, about 290 mg/mL, about 300 mg/mL, about 310 mg/mL, about 320 mg/mL, about 330 mg/mL, about 340 mg/mL, about 350 mg/mL, about 360 mg/mL, about 370 mg/mL, about 380 mg/mL, about 390 mg/mL, or about 400 mg/mL.
In some instances, the antibody has a viscosity of between about 0.5 cP and about 5 cP, between about 0.5 cP and about 4.5 cP, between about 0.5 cP and about 4 cP, between about 0.5 cP and about 3.5 cP, between about 0.5 cP and about 3 cP, between about 0.5 cP and about 2.5 cP, between about 0.5 cP and about 2 cP, between about 0.5 cP and about 1.5 cP, between about 0.5 cP and about 1 cP, between about 1 cP and about 5 cP, between about 1 cP and about 4.5 cP, between about 1 cP and about 4 cP, between about 1 cP and about 3.5 cP, between about 1 cP and about 3 cP, between about 1 cP and about 2.5 cP, between about 1 cP and about 2 cP, between about 1 cP and about 1.5 cP, between about 1.5 cP and about 5 cP, between about 1.5 cP and about 4.5 cP, between about 1.5 cP and about 4 cP, between about 1.5 cP and about 3.5 cP, between about 1.5 cP and about 3 cP, between about 1.5 cP and about 2.5 cP, between about 1.5 cP and about 2 cP, between about 2 cP and about 5 cP, between about 2 cP and about 4.5 cP, between about 2 cP and about 4 cP, between about 2 cP and about 3.5 cP, between about 2 cP and about 3 cP, between about 2 cP and about 2.5 cP, between about 2.5 cP and about 5 cP, between about 2.5 cP and about 4.5 cP, between about 2.5 cP and about 4 cP, between about 2.5 cP and about 3.5 cP, between about 2.5 cP and about 3 cP, between about 3 cP and about 5 cP, between about 3 cP and about 4.5 cP, between about 3 cP and about 4 cP, between about 3 cP and about 3.5 cP, between about 3.5 cP and about 5 cP, between about 3.5 cP and about 4.5 cP, between about 3.5 cP and about 4 cP, between about 4 cP and about 5 cP, between about 4 cP and about 4.5 cP, or between about 4.5 cP and about 5 cP, e.g., at a concentration of about 180 mg/mL.
In particular instances, the antibody may have a viscosity of about 4.6 cP at a concentration of about 180 mg/mL.
Any of the antibodies provided herein may have a turbidity (OD) of about 1 or lower, e.g., at a concentration of about 100 mg/mL or higher (e.g., about 100 mg/mL or higher, about 110 mg/mL or higher, about 120 mg/mL or higher, about 130 mg/mL or higher, about 140 mg/mL or higher, about 140 mg/mL or higher, about 150 mg/mL or higher, about 160 mg/mL or higher, about 170 mg/mL or higher, about 180 mg/mL or higher, about 190 mg/mL or higher, about 200 mg/mL or higher, about 210 mg/mL or higher, about 220 mg/mL or higher, about 230 mg/mL or higher, about 240 mg/mL or higher, about 250 mg/mL or higher, about 260 mg/mL or higher, about 270 mg/mL or higher, about 280 mg/mL or higher, about 290 mg/mL or higher, about 300 mg/mL or higher, about 310 mg/mL or higher, about 320 mg/mL or higher, about 330 mg/mL or higher, about 340 mg/mL or higher, about 350 mg/mL or higher, about 360 mg/mL or higher, about 370 mg/mL or higher, about 380 mg/mL or higher, about 390 mg/mL or higher, or about 400 mg/mL or higher), e.g., in any suitable buffer (e.g., phosphate-buffered saline (PBS) pH 7.4). For example, any of the antibodies provided herein may have a turbidity (optical density (OD)) of about 0.5 or lower, about 0.45 or lower, about 0.4 or lower, about 0.35 or lower, about 0.3 or lower, about 0.25 or lower, about 0.2 or lower, about 0.15 or lower, about 0.1 or lower, or about 0.05 or lower, e.g., at a concentration of about 100 mg/mL or higher (e.g., about 100 mg/mL or higher, about 110 mg/mL or higher, about 120 mg/mL or higher, about 130 mg/mL or higher, about 140 mg/mL or higher, about 140 mg/mL or higher, about 150 mg/mL or higher, about 160 mg/mL or higher, about 170 mg/mL or higher, about 180 mg/mL or higher, about 190 mg/mL or higher, about 200 mg/mL or higher, about 210 mg/mL or higher, about 220 mg/mL or higher, about 230 mg/mL or higher, about 240 mg/mL or higher, about 250 mg/mL or higher, about 260 mg/mL or higher, about 270 mg/mL or higher, about 280 mg/mL or higher, about 290 mg/mL or higher, about 300 mg/mL or higher, about 310 mg/mL or higher, about 320 mg/mL or higher, about 330 mg/mL or higher, about 340 mg/mL or higher, about 350 mg/mL or higher, about 360 mg/mL or higher, about 370 mg/mL or higher, about 380 mg/mL or higher, about 390 mg/mL or higher, or about 400 mg/mL or higher), e.g., in any suitable buffer (e.g., phosphate-buffered saline (PBS) pH 7.4).
In some instances, any of the antibodies provided herein may have a turbidity (OD) of between about 0.05 and about 0.5, between about 0.1 and about 0.5, between about 0.15 and about 0.5, between about 0.2 and about 0.5, between about 0.25 and about 0.5, between about 0.3 and about 0.5, between about 0.35 and about 0.5, between about 0.4 and about 0.5, between about 0.45 and about 0.5, between about 0.05 and about 0.45, between about 0.1 and about 0.45, between about 0.15 and about 0.45, between about 0.2 and about 0.45, between about 0.25 and about 0.45, between about 0.3 and about 0.45, between about 0.35 and about 0.45, between about 0.4 and about 0.45, between about 0.05 and about 0.4, between about 0.1 and about 0.4, between about 0.15 and about 0.4, between about 0.2 and about 0.4, between about 0.25 and about 0.4, between about 0.3 and about 0.4, between about 0.35 and about 0.4, between about 0.05 and about 0.35, between about 0.1 and about 0.35, between about 0.15 and about 0.35, between about 0.2 and about 0.35, between about 0.25 and about 0.35, between about 0.3 and about 0.35, between about 0.05 and about 0.3, between about 0.1 and about 0.3, between about 0.15 and about 0.3, between about 0.2 and about 0.3, between about 0.25 and about 0.3, between about 0.05 and about 0.25, between about 0.1 and about 0.25, between about 0.15 and about 0.25, between about 0.2 and about 0.25, between about 0.05 and about 0.2, between about 0.1 and about 0.2, between about 0.15 and about 0.2, between about 0.05 and about 0.15, between about 0.1 and about 0.15, or between about 0.05 and about 0.1, e.g., at a concentration of about 100 mg/mL or higher (e.g., about 100 mg/mL or higher, about 110 mg/mL or higher, about 120 mg/mL or higher, about 130 mg/mL or higher, about 140 mg/mL or higher, about 140 mg/mL or higher, about 150 mg/mL or higher, about 160 mg/mL or higher, about 170 mg/mL or higher, about 180 mg/mL or higher, about 190 mg/mL or higher, about 200 mg/mL or higher, about 210 mg/mL or higher, about 220 mg/mL or higher, about 230 mg/mL or higher, about 240 mg/mL or higher, about 250 mg/mL or higher, about 260 mg/mL or higher, about 270 mg/mL or higher, about 280 mg/mL or higher, about 290 mg/mL or higher, about 300 mg/mL or higher, about 310 mg/mL or higher, about 320 mg/mL or higher, about 330 mg/mL or higher, about 340 mg/mL or higher, about 350 mg/mL or higher, about 360 mg/mL or higher, about 370 mg/mL or higher, about 380 mg/mL or higher, about 390 mg/mL or higher, or about 400 mg/mL or higher), e.g., in any suitable buffer (e.g., phosphate-buffered saline (PBS) pH 7.4).
In some instances, any of the antibodies provided herein may have a turbidity (OD) of between about 0.05 and about 0.5, between about 0.1 and about 0.5, between about 0.15 and about 0.5, between about 0.2 and about 0.5, between about 0.25 and about 0.5, between about 0.3 and about 0.5, between about 0.35 and about 0.5, between about 0.4 and about 0.5, between about 0.45 and about 0.5, between about 0.05 and about 0.45, between about 0.1 and about 0.45, between about 0.15 and about 0.45, between about 0.2 and about 0.45, between about 0.25 and about 0.45, between about 0.3 and about 0.45, between about 0.35 and about 0.45, between about 0.4 and about 0.45, between about 0.05 and about 0.4, between about 0.1 and about 0.4, between about 0.15 and about 0.4, between about 0.2 and about 0.4, between about 0.25 and about 0.4, between about 0.3 and about 0.4, between about 0.35 and about 0.4, between about 0.05 and about 0.35, between about 0.1 and about 0.35, between about 0.15 and about 0.35, between about 0.2 and about 0.35, between about 0.25 and about 0.35, between about 0.3 and about 0.35, between about 0.05 and about 0.3, between about 0.1 and about 0.3, between about 0.15 and about 0.3, between about 0.2 and about 0.3, between about 0.25 and about 0.3, between about 0.05 and about 0.25, between about 0.1 and about 0.25, between about 0.15 and about 0.25, between about 0.2 and about 0.25, between about 0.05 and about 0.2, between about 0.1 and about 0.2, between about 0.15 and about 0.2, between about 0.05 and about 0.15, between about 0.1 and about 0.15, or between about 0.05 and about 0.1, e.g., at a concentration of about 150 mg/mL or higher, e.g., in any suitable buffer (e.g., phosphate-buffered saline (PBS) pH 7.4).
In some instances, any of the antibodies provided herein may have a turbidity (OD) of between about 0.25 and about 0.5 at a concentration of about 150 mg/mL to about 250 mg/mL.
In particular instances, the antibody has a turbidity (OD) of about 0.38 at a concentration of about 200 mg/mL.
In some instances, any of the anti-IL-33 antibodies described herein (e.g., described above or below) may have one or more (e.g., 1, 2, 3, 4, or 5) of the following features: (i) the antibody specifically binds human IL-33 with a KD of between about 1 pM and about 200 pM; (ii) the antibody specifically binds cyno IL-33 with a KD of between about 1 pM and about 200 pM; (iii) the antibody inhibits the binding of human IL-33 to an IL-33 receptor (e.g., ST2 and/or IL-1RAcP) with an IC50 of between about 1 pM and about 250 pM, for example, in a cell-based blocking assay using HEK-BLUE™ cells; (iv) the antibody has a viscosity of between about 3 cP and about 5 cP at a concentration of about 180 mg/mL; and/or (v) the antibody has a turbidity (OD) of between about 0.25 and about 0.5 at a concentration of about 150 mg/ml to about 250 mg/ml. In some instances, any of the anti-IL-33 antibodies described herein may have one of the preceding features. In some instances, any of the anti-IL-33 antibodies described herein may have two of the preceding features. In some instances, any of the anti-IL-33 antibodies described herein may have three of the preceding features. In some instances, any of the anti-IL-33 antibodies described herein may have four of the preceding features. In some instances, any of the anti-IL-33 antibodies described herein may have all five of the preceding features.
Any of the anti-IL-33 antibodies provided herein may be a monoclonal antibody, including a chimeric, humanized, or human antibody.
Any of the anti-IL-33 antibodies provided herein may be an antibody fragment, e.g., a Fv, Fab, Fab′, scFv, diabody, or F(ab′)2 fragment. In particular instances, the antibody fragment is an Fab fragment.
In other instances, any of the anti-IL-33 antibodies provided herein may be a full-length antibody, e.g., an intact IgG1 antibody, an intact IgG4 antibody, or other antibody class or isotype as defined herein. In some instances, the antibody is an IgG4 antibody that comprises a mutation in the hinge region. In some instances, the mutation is a substitution mutation. In some instances, the substitution mutation is at amino acid residue S228 (EU numbering). In some instances, the substitution mutation is an S228P mutation.
Any of the anti-IL-33 antibodies provided herein may be a monospecific antibody. In other instances, any of the anti-IL-33 antibodies provided herein may be a multispecific antibody (e.g., a bispecific antibody). In some instances, the bispecific antibody comprises a second binding domain that binds to a second biological molecule, wherein the second biological molecule is interleukin-13 (IL-13), interleukin-4 (IL-4), interleukin-5 (IL-5), interleukin-17 (IL-17), Factor D, HtrA1, VEGF, or a VEGF receptor.
In a further aspect, any of the anti-IL-33 antibodies disclosed herein may incorporate any of the features, singly or in combination, as described in Sections 1-7 below:
1. Antibody Affinity
In certain embodiments, an antibody provided herein has a dissociation constant (KD) of ≤1 μM, ≤100 nM, ≤10 nM, ≤1 nM, ≤0.1 nM, ≤0.01 nM, ≤1 pM, or ≤0.1 pM (e.g., 10−6 M or less, e.g., from 10−6 M to 10−9 M or less, e.g., from 10−9 M to 10−13 M or less).
In one embodiment, KD is measured by a radiolabeled antigen binding assay (RIA). In one embodiment, an RIA is performed with the Fab version of an antibody of interest and its antigen. For example, solution binding affinity of Fabs for antigen is measured by equilibrating Fab with a minimal concentration of (125I)-labeled antigen in the presence of a titration series of unlabeled antigen, then capturing bound antigen with an anti-Fab antibody-coated plate (see, e.g., Chen et al. J. Mol. Biol. 293:865-881, 1999). To establish conditions for the assay, MICROTITER® multi-well plates (Thermo Scientific) are coated overnight with 5 pg/mL of a capturing anti-Fab antibody (Cappel Labs) in 50 mM sodium carbonate (pH 9.6), and subsequently blocked with 2% (w/v) bovine serum albumin in PBS for two to five hours at room temperature (approximately 23° C.). In a non-adsorbent plate (NUNC™ #269620), 100 pM or 26 pM [125I]-antigen are mixed with serial dilutions of a Fab of interest (e.g., consistent with assessment of the anti-VEGF antibody, Fab-12, in Presta et al. Cancer Res. 57:4593-4599, 1997). The Fab of interest is then incubated overnight; however, the incubation may continue for a longer period (e.g., about 65 hours) to ensure that equilibrium is reached. Thereafter, the mixtures are transferred to the capture plate for incubation at room temperature (e.g., for one hour). The solution is then removed and the plate washed eight times with 0.1% polysorbate 20 (TWEEN®-20) in PBS. When the plates have dried, 150 μL/well of scintillant (MICROSCINT-20™; Packard) is added, and the plates are counted on a TOPCOUNT™ gamma counter (Packard) for ten minutes. Concentrations of each Fab that give less than or equal to 20% of maximal binding are chosen for use in competitive binding assays.
According to another embodiment, KD is measured using a BIACORE® surface plasmon resonance assay. For example, an assay using a BIACORE®-2000 or a BIACORE®-3000 (BIAcore, Inc.) is performed at 25° C. with immobilized antigen CM5 chips at ˜10 response units (RU). In one embodiment, carboxymethylated dextran biosensor chips (CM5, BIACORE, Inc.) are activated with N-ethyl-N′-(3-dimethylaminopropyl)-carbodiimide hydrochloride (EDC) and N-hydroxysuccinimide (NHS) according to the supplier's instructions. Antigen is diluted with 10 mM sodium acetate, pH 4.8, to 5 μg/ml (˜0.2 μM) before injection at a flow rate of 5 μL/minute to achieve approximately 10 response units (RU) of coupled protein. Following the injection of antigen, 1 M ethanolamine is injected to block unreacted groups. For kinetics measurements, two-fold serial dilutions of Fab (0.78 nM to 500 nM) are injected in phosphate buffered saline (PBS) with 0.05% polysorbate 20 (TWEEN®-20) surfactant (PBST) at 25° C. at a flow rate of approximately 25 μL/min. Association rates (kon) and dissociation rates (koff) are calculated using a simple one-to-one Langmuir binding model (BIACORE® Evaluation Software version 3.2) by simultaneously fitting the association and dissociation sensorgrams. The equilibrium dissociation constant (KD) is calculated as the ratio koff/kon. See, for example, Chen et al. (J. Mol. Biol. 293:865-881, 1999). If the on-rate exceeds 106 M−1s−1 by the surface plasmon resonance assay above, then the on-rate can be determined by using a fluorescent quenching technique that measures the increase or decrease in fluorescence emission intensity (excitation=295 nm; emission=340 nm, 16 nm band-pass) at 25° C. of a 20 nM anti-antigen antibody (Fab form) in PBS, pH 7.2, in the presence of increasing concentrations of antigen as measured in a spectrometer, such as a stop-flow equipped spectrophometer (Aviv Instruments) or a 8000-series SLM-AMINCO™ Spectrophotometer (ThermoSpectronic) with a stirred cuvette.
2. Antibody Fragments
Any of the antibodies provided herein may be an antibody fragment (e.g., an antigen-binding (e.g., IL-33-binding) antibody fragment). Antibody fragments include, but are not limited to, Fab, Fab′, Fab′-SH, F(ab′)2, Fv, and scFv fragments, and other fragments described below. In certain instances, the antibody fragment is an Fab. For a review of certain antibody fragments, see Hudson et al. Nat. Med. 9:129-134 (2003). For a review of scFv fragments, see, e.g., Pluckthun, in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., (Springer-Verlag, New York), pp. 269-315 (1994); see also WO 93/16185; and U.S. Pat. Nos. 5,571,894 and 5,587,458. For discussion of Fab and F(ab′)2 fragments comprising salvage receptor binding epitope residues and having increased in vivo half-life, see U.S. Pat. No. 5,869,046.
Diabodies are antibody fragments with two antigen-binding sites that may be bivalent or bispecific. See, for example, EP 404,097; WO 1993/01161; Hudson et al. Nat. Med. 9:129-134, 2003; and Hollinger et al. Proc. Nat. Acad. Sci. USA 90: 6444-6448, 1993. Triabodies and tetrabodies are also described in Hudson et al. Nat. Med. 9:129-134, 2003.
Single-domain antibodies are antibody fragments comprising all or a portion of the heavy chain variable domain or all or a portion of the light chain variable domain of an antibody. In certain embodiments, a single-domain antibody is a human single-domain antibody (see, e.g., U.S. Pat. No. 6,248,516 B1).
Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant host cells (e.g., E. coli or phage), as described herein.
3. Chimeric and Humanized Antibodies
In certain embodiments, an antibody provided herein is a chimeric antibody. Certain chimeric antibodies are described, e.g., in U.S. Pat. No. 4,816,567; and Morrison et al. Proc. Nat. Acad. Sci. USA, 81:6851-6855, 1984). In one example, a chimeric antibody comprises a non-human variable region (e.g., a variable region derived from a mouse, rat, hamster, rabbit, or non-human primate, such as a monkey) and a human constant region. In a further example, a chimeric antibody is a “class switched” antibody in which the class or subclass has been changed from that of the parent antibody. Chimeric antibodies include antigen-binding fragments thereof.
In certain embodiments, a chimeric antibody is a humanized antibody. Typically, a non-human antibody is humanized to reduce immunogenicity to humans, while retaining the specificity and affinity of the parental non-human antibody. Generally, a humanized antibody comprises one or more variable domains in which HVRs (or portions thereof) are derived from a non-human antibody, and FRs (or portions thereof) are derived from human antibody sequences. A humanized antibody optionally will also comprise at least a portion of a human constant region. In some embodiments, some FR residues in a humanized antibody are substituted with corresponding residues from a non-human antibody (e.g., the antibody from which the HVR residues are derived), for example, to restore or improve antibody specificity or affinity.
Humanized antibodies and methods of making them are reviewed, for example, in Almagro et al. Front. Biosci. 13:1619-1633, 2008, and are further described, e.g., in Riechmann et al. Nature 332:323-329, 1988; Queen et al. Proc. Natl. Acad. Sci. USA 86:10029-10033, 1989; U.S. Pat. Nos. 5,821,337, 7,527,791, 6,982,321, and 7,087,409; Kashmiri et al. Methods 36:25-34, 2005 (describing specificity determining region (SDR) grafting); Padlan, Mol. Immunol. 28:489-498, 1991 (describing “resurfacing”); Dall'Acqua et al. Methods 36:43-60, 2005 (describing “FR shuffling”); and Osbourn et al. Methods 36:61-68, 2005 and Klimka et al. Br. J. Cancer, 83:252-260, 2000 (describing the “guided selection” approach to FR shuffling).
Human framework regions that may be used for humanization include but are not limited to: framework regions selected using the “best-fit” method (see, e.g., Sims et al. J. Immunol. 151:2296, 1993); framework regions derived from the consensus sequence of human antibodies of a particular subgroup of light or heavy chain variable regions (see, e.g., Carter et al. Proc. Nat. Acad. Sci. USA, 89:4285, 1992; and Presta et al. J. Immunol., 151:2623, 1993); human mature (somatically mutated) framework regions or human germline framework regions (see, e.g., Almagro et al. Front. Biosci. 13:1619-1633, 2008); and framework regions derived from screening FR libraries (see, e.g., Baca et al. J. Biol. Chem. 272:10678-10684, 1997 and Rosok et al. J. Biol. Chem. 271:22611-22618, 1996).
4. Human Antibodies
In certain embodiments, an antibody provided herein is a human antibody. Human antibodies can be produced using various techniques known in the art. Human antibodies are described generally in van Dijk et al. Curr. Opin. Pharmacol. 5:368-74, 2001 and Lonberg, Curr. Opin. Immunol. 20:450-459, 2008.
Human antibodies may be prepared by administering an immunogen to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge. Such animals typically contain all or a portion of the human immunoglobulin loci, which replace the endogenous immunoglobulin loci, or which are present extrachromosomally or integrated randomly into the animal's chromosomes. In such transgenic mice, the endogenous immunoglobulin loci have generally been inactivated. For review of methods for obtaining human antibodies from transgenic animals, see Lonberg, Nat. Biotech. 23:1117-1125, 2005. See also, for example, U.S. Pat. Nos. 6,075,181 and 6,150,584 describing XENOMOUSE™ technology; U.S. Pat. No. 5,770,429 describing HUMAB® technology; U.S. Pat. No. 7,041,870 describing K-M MOUSE® technology, and U.S. Patent Application Publication No. US 2007/0061900, describing VELOCIMOUSE® technology. Human variable regions from intact antibodies generated by such animals may be further modified, e.g., by combining with a different human constant region.
Human antibodies can also be made by hybridoma-based methods. Human myeloma and mouse-human heteromyeloma cell lines for the production of human monoclonal antibodies have been described. (See, e.g., Kozbor J. Immunol. 133:3001, 1984; Brodeur et al. Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987); and Boerner et al. J. Immunol. 147: 86, 1991). Human antibodies generated via human B-cell hybridoma technology are also described in Li et al. Proc. Natl. Acad. Sci. USA, 103:3557-3562, 2006. Additional methods include those described, for example, in U.S. Pat. No. 7,189,826 (describing production of monoclonal human IgM antibodies from hybridoma cell lines) and Ni, Xiandai Mianyixue, 26(4):265-268, 2006 (describing human-human hybridomas). Human hybridoma technology (Trioma technology) is also described in Vollmers et al. Histology and Histopathology 20(3):927-937, 2005 and Vollmers et al. Methods and Findings in Experimental and Clinical Pharmacology 27(3):185-91, 2005.
Human antibodies may also be generated by isolating Fv clone variable domain sequences selected from human-derived phage display libraries. Such variable domain sequences may then be combined with a desired human constant domain. Techniques for selecting human antibodies from antibody libraries are described below.
5. Library-Derived Antibodies
Antibodies disclosed herein may be isolated by screening combinatorial libraries for antibodies with the desired activity or activities. For example, a variety of methods are known in the art for generating phage display libraries and screening such libraries for antibodies possessing the desired binding characteristics. Such methods are reviewed, e.g., in Hoogenboom et al. in Methods in Molecular Biology 178:1-37 (O'Brien et al., ed., Human Press, Totowa, N.J., 2001) and further described, e.g., in the McCafferty et al. Nature 348:552-554, 1990; Clackson et al. Nature 352: 624-628, 1991; Marks et al. J. Mol. Biol. 222: 581-597, 1992; Marks et al. in Methods in Molecular Biology 248:161-175 (Lo, ed., Human Press, Totowa, N.J., 2003); Sidhu et al. J. Mol. Biol. 338(2): 299-310, 2004; Lee et al. J. Mol. Biol. 340(5): 1073-1093, 2004; Fellouse, Proc. Natl. Acad. Sci. USA 101(34):12467-12472, 2004; and Lee et al. J. Immunol. Methods 284(1-2): 119-132, 2004.
In certain phage display methods, repertoires of VH and VL genes are separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be screened for antigen-binding phage as described in Winter et al. Ann. Rev. Immunol., 12: 433-455, 1994. Phage typically display antibody fragments, either as single-chain Fv (scFv) fragments or as Fab fragments. Libraries from immunized sources provide high-affinity antibodies to the immunogen without the requirement of constructing hybridomas. Alternatively, the naive repertoire can be cloned (e.g., from human) to provide a single source of antibodies to a wide range of non-self and also self antigens without any immunization as described by Griffiths et al. EMBO J. 12: 725-734, 1993. Finally, naive libraries can also be made synthetically by cloning unrearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable HVR3 regions and to accomplish rearrangement in vitro, as described by Hoogenboom et al. J. Mol. Biol., 227: 381-388, 1992. Patent publications describing human antibody phage libraries include, for example: U.S. Pat. No. 5,750,373, and US Patent Publication Nos. 2005/0079574, 2005/0119455, 2005/0266000, 2007/0117126, 2007/0160598, 2007/0237764, 2007/0292936, and 2009/0002360.
Antibodies or antibody fragments isolated from human antibody libraries are considered human antibodies or human antibody fragments herein.
6. Multispecific Antibodies
In certain embodiments, an antibody provided herein is a multispecific antibody, for example, a bispecific antibody. Multispecific antibodies are monoclonal antibodies that have binding specificities for at least two different sites. In certain embodiments, bispecific antibodies may bind to two different epitopes of IL-33. In certain embodiments, one of the binding specificities is for IL-33 and the other is for any other antigen (e.g., a second biological molecule, e.g., IL-13, IL-4, IL-5, IL-17, Factor D, HtrA1, VEGF, or a VEGF receptor). Accordingly, the bispecific antibody may have binding specificity for IL-33 and IL-13; IL-33 and IL-4; IL-33 and IL-5; IL-33 and IL-17; IL-33 and Factor D; IL-33 and HtrA1; IL-33 and VEGF; or IL-33 and a VEGF receptor (e.g., VEGFR1, VEGFR2, VEGFR3, membrane-bound VEGF receptor (mbVEGFR), or soluble VEGF receptor (sVEGFR)). In some instances, the bispecific antibody may have binding specificity for IL-33 and Factor D. In other instances, the bispecific antibody may have binding specificity for IL-33 and HtrA1. In yet other instances, the bispecific antibody may have binding specificity for IL-33 and VEGF. In other instances, the bispecific antibody may have binding specificity for IL-33 and a VEGF receptor. In particular, the bispecific antibody may have binding specificity for IL-33 and IL-13. Bispecific antibodies can be prepared as full-length antibodies or antibody fragments.
Techniques for making multispecific antibodies include, but are not limited to, recombinant co-expression of two immunoglobulin heavy chain-light chain pairs having different specificities (see Milstein et al. Nature 305: 537, 1983; WO 93/08829; and Traunecker et al. EMBO J. 10: 3655, 1991), and “knob-in-hole” engineering (see, e.g., U.S. Pat. No. 5,731,168). Multi-specific antibodies may also be made by engineering electrostatic steering effects for making antibody Fc-heterodimeric molecules (WO 2009/089004A1); cross-linking two or more antibodies or fragments (see, e.g., U.S. Pat. No. 4,676,980, and Brennan et al. Science, 229: 81, 1985); using leucine zippers to produce bispecific antibodies (see, e.g., Kostelny et al. J. Immunol., 148(5):1547-1553, 1992); using “diabody” technology for making bispecific antibody fragments (see, e.g., Hollinger et al. Proc. Natl. Acad. Sci. USA 90:6444-6448, 1993); and using single-chain Fv (scFv) dimers (see, e.g. Gruber et al. J. Immunol. 152:5368, 1994); and preparing trispecific antibodies as described, e.g., in Tutt et al. J. Immunol. 147: 60, 1991.
Engineered antibodies with three or more functional antigen binding sites, including “Octopus antibodies,” are also included herein (see, e.g. US 2006/0025576A1).
The antibody or fragment herein also includes a “Dual Acting Fab” or “DAF” comprising an antigen binding site that binds to IL-33 as well as another, different antigen (see, US 2008/0069820, for example).
Knobs-into-Holes
The use of knobs-into-holes as a method of producing multispecific antibodies is described, e.g., in U.S. Pat. No. 5,731,168, WO2009/089004, US2009/0182127, US2011/0287009, Marvin and Zhu, Acta Pharmacol. Sin. (2005) 26(6):649-658, and Kontermann (2005) Acta Pharmacol. Sin., 26:1-9. A brief nonlimiting discussion is provided below.
A “protuberance” refers to at least one amino acid side chain which projects from the interface of a first polypeptide and is therefore positionable in a compensatory cavity in the adjacent interface (i.e., the interface of a second polypeptide) so as to stabilize the heteromultimer, and thereby favor heteromultimer formation over homomultimer formation, for example. The protuberance may exist in the original interface or may be introduced synthetically (e.g., by altering nucleic acid encoding the interface). In some embodiments, a nucleic acid encoding the interface of the first polypeptide is altered to encode the protuberance. To achieve this, the nucleic acid encoding at least one “original” amino acid residue in the interface of the first polypeptide is replaced with nucleic acid encoding at least one “import” amino acid residue which has a larger side chain volume than the original amino acid residue. It will be appreciated that there can be more than one original and corresponding import residue. The side chain volumes of the various amino residues are shown, for example, in Table 1 of US 2011/0287009 or Table 1 of U.S. Pat. No. 7,642,228.
In some embodiments, import residues for the formation of a protuberance are naturally occurring amino acid residues selected from arginine (R), phenylalanine (F), tyrosine (Y) and tryptophan (W). In some embodiments, an import residue is tryptophan or tyrosine. In some embodiments, the original residue for the formation of the protuberance has a small side chain volume, such as alanine, asparagine, aspartic acid, glycine, serine, threonine, or valine. See, for example, U.S. Pat. No. 7,642,228.
A “cavity” refers to at least one amino acid side chain which is recessed from the interface of a second polypeptide and therefore accommodates a corresponding protuberance on the adjacent interface of a first polypeptide. The cavity may exist in the original interface or may be introduced synthetically (e.g., by altering nucleic acid encoding the interface). In some embodiments, nucleic acid encoding the interface of the second polypeptide is altered to encode the cavity. To achieve this, the nucleic acid encoding at least one “original” amino acid residue in the interface of the second polypeptide is replaced with DNA encoding at least one “import” amino acid residue which has a smaller side chain volume than the original amino acid residue. It will be appreciated that there can be more than one original and corresponding import residue. In some embodiments, import residues for the formation of a cavity are naturally occurring amino acid residues selected from alanine (A), serine (S), threonine (T), and valine (V). In some embodiments, an import residue is serine, alanine, or threonine. In some embodiments, the original residue for the formation of the cavity has a large side chain volume, such as tyrosine, arginine, phenylalanine, or tryptophan.
The protuberance is “positionable” in the cavity which means that the spatial location of the protuberance and cavity on the interface of a first polypeptide and second polypeptide respectively and the sizes of the protuberance and cavity are such that the protuberance can be located in the cavity without significantly perturbing the normal association of the first and second polypeptides at the interface. Since protuberances such as Tyr, Phe, and Trp do not typically extend perpendicularly from the axis of the interface and have preferred conformations, the alignment of a protuberance with a corresponding cavity may, in some instances, rely on modeling the protuberance/cavity pair based upon a three-dimensional structure such as that obtained by X-ray crystallography or nuclear magnetic resonance (NMR). This can be achieved using widely accepted techniques in the art.
In some embodiments, a knob mutation in an IgG1 constant region is T366W. In some embodiments, a hole mutation in an IgG1 constant region comprises one or more mutations selected from T366S, L368A, and Y407V. In some embodiments, a hole mutation in an IgG1 constant region comprises T366S, L368A, and Y407V.
In some embodiments, a knob mutation in an IgG4 constant region is T366W. In some embodiments, a hole mutation in an IgG4 constant region comprises one or more mutations selected from T366S, L368A, and Y407V. In some embodiments, a hole mutation in an IgG4 constant region comprises T366S, L368A, and Y407V.
7. Antibody Variants
In certain embodiments, amino acid sequence variants of the antibodies provided herein are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibody. Amino acid sequence variants of an antibody may be prepared by introducing appropriate modifications into the nucleotide sequence encoding the antibody, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final construct possesses the desired characteristics, for example, antigen-binding.
a) Substitution, Insertion, and Deletion Variants
In certain embodiments, antibody variants having one or more amino acid substitutions are provided. Sites of interest for substitutional mutagenesis include the HVRs and FRs. Conservative substitutions are shown in Table A under the heading of “preferred substitutions.” More substantial changes are provided in Table A under the heading of “exemplary substitutions,” and as further described below in reference to amino acid side chain classes. Amino acid substitutions may be introduced into an antibody of interest and the products screened for a desired activity, e.g., retained/improved antigen binding, decreased immunogenicity, or improved ADCC or CDC.
TABLE A
Original Exemplary Preferred
Residue Substitutions Substitutions
Ala (A) Val; Leu; Ile Val
Arg (R) Lys; Gin; Asn Lys
Asn (N) Gln; His; Asp, Lys; Arg Gln
Asp (D) Glu; Asn Glu
Cys (C) Ser; Ala Ser
Gln (Q) Asn; Glu Asn
Glu (E) Asp; Gln Asp
Gly (G) Ala Ala
His (H) Asn; Gln; Lys; Arg Arg
Ile (I) Leu; Val; Met; Ala; Phe; Norleucine Leu
Leu (L) Norleucine; Ile; Val; Met; Ala; Phe Ile
Lys (K) Arg; Gln; Asn Arg
Met (M) Leu; Phe; Ile Leu
Phe (F) Trp; Leu; Val; Ile; Ala; Tyr Tyr
Pro (P) Ala Ala
Ser (S) Thr Thr
Thr (T) Val; Ser Ser
Trp (W) Tyr; Phe Tyr
Tyr (Y) Trp; Phe; Thr; Ser Phe
Val (V) Ile; Leu; Met; Phe; Ala; Norleucine Leu

Amino acids may be grouped according to common side-chain properties:
(1) hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile;
(2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gin;
(3) acidic: Asp, Glu;
(4) basic: His, Lys, Arg;
(5) residues that influence chain orientation: Gly, Pro;
(6) aromatic: Trp, Tyr, Phe.
Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
One type of substitutional variant involves substituting one or more HVR (e.g., CDR) residues of a parent antibody (e.g., a humanized or human antibody). Generally, the resulting variant(s) selected for further study will have modifications (e.g., improvements) in certain biological properties (e.g., increased affinity, reduced immunogenicity) relative to the parent antibody and/or will have substantially retained certain biological properties of the parent antibody. An exemplary substitutional variant is an affinity matured antibody, which may be conveniently generated, for example, using phage display-based affinity maturation techniques such as those described herein. Briefly, one or more HVR residues are mutated and the variant antibodies displayed on phage and screened for a particular biological activity (e.g., binding affinity).
Alterations (e.g., substitutions) may be made in HVRs (e.g., CDRs), e.g., to improve antibody affinity. Such alterations may be made in HVR “hotspots,” i.e., residues encoded by codons that undergo mutation at high frequency during the somatic maturation process (see, e.g., Chowdhury, Methods Mol. Biol. 207:179-196, 2008), and/or residues that contact antigen, with the resulting variant VH or VL being tested for binding affinity. Affinity maturation by constructing and reselecting from secondary libraries has been described, e.g., in Hoogenboom et al. in Methods in Molecular Biology 178:1-37 (O'Brien et al. ed., Human Press, Totowa, N.J., 2001). In some embodiments of affinity maturation, diversity is introduced into the variable genes chosen for maturation by any of a variety of methods (e.g., error-prone PCR, chain shuffling, or oligonucleotide-directed mutagenesis). A secondary library is then created. The library is then screened to identify any antibody variants with the desired affinity. Another method to introduce diversity involves HVR-directed approaches, in which several HVR residues (e.g., 4-6 residues at a time) are randomized. HVR residues involved in antigen binding may be specifically identified, e.g., using alanine scanning mutagenesis or modeling. HVR-H3 and HVR-L3 in particular are often targeted.
In certain embodiments, substitutions, insertions, or deletions may occur within one or more HVRs (e.g., CDRs) so long as such alterations do not substantially reduce the ability of the antibody to bind antigen. For example, conservative alterations (e.g., conservative substitutions as provided herein) that do not substantially reduce binding affinity may be made in HVRs. Such alterations may, for example, be outside of antigen contacting residues in the HVRs. In certain embodiments of the variant VH and VL sequences provided above, each HVR either is unaltered, or contains no more than one, two or three amino acid substitutions.
A useful method for identification of residues or regions of an antibody that may be targeted for mutagenesis is called “alanine scanning mutagenesis” as described by Cunningham et al. Science 244:1081-1085, 1989. In this method, a residue or group of target residues (e.g., charged residues such as Arg, Asp, His, Lys, and Glu) are identified and replaced by a neutral or negatively charged amino acid (e.g., Ala or polyalanine) to determine whether the interaction of the antibody with antigen is affected. Further substitutions may be introduced at the amino acid locations demonstrating functional sensitivity to the initial substitutions. Alternatively, or additionally, a crystal structure of an antigen-antibody complex to identify contact points between the antibody and antigen. Such contact residues and neighboring residues may be targeted or eliminated as candidates for substitution. Variants may be screened to determine whether they contain the desired properties.
Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminal insertions include an antibody with an N-terminal methionyl residue. Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody to an enzyme (e.g., for ADEPT) or a polypeptide which increases the serum half-life of the antibody.
b) Glycosylation Variants
In certain embodiments, an antibody provided herein is altered to increase or decrease the extent to which the antibody is glycosylated. Addition or deletion of glycosylation sites to an antibody may be conveniently accomplished by altering the amino acid sequence such that one or more glycosylation sites is created or removed.
Where the antibody comprises an Fc region, the carbohydrate attached thereto may be altered. Native antibodies produced by mammalian cells typically comprise a branched, biantennary oligosaccharide that is generally attached by an N-linkage to Asn297 of the CH2 domain of the Fc region. See, for example, Wright et al. TIBTECH 15:26-32, 1997. The oligosaccharide may include various carbohydrates, for example, mannose, N-acetyl glucosamine (GlcNAc), galactose, and sialic acid, as well as a fucose attached to a GlcNAc in the “stem” of the biantennary oligosaccharide structure. In some embodiments, modifications of the oligosaccharide in an antibody disclosed herein may be made in order to create antibody variants with certain improved properties.
In one embodiment, antibody variants are provided having a carbohydrate structure that lacks fucose attached (directly or indirectly) to an Fc region. For example, the amount of fucose in such antibody may be from 1% to 80%, from 1% to 65%, from 5% to 65% or from 20% to 40%. The amount of fucose is determined by calculating the average amount of fucose within the sugar chain at Asn297, relative to the sum of all glycostructures attached to Asn 297 (e. g. complex, hybrid and high mannose structures) as measured by MALDI-TOF mass spectrometry, as described in WO 2008/077546, for example. Asn297 refers to the asparagine residue located at about position 297 in the Fc region (Eu numbering of Fc region residues); however, Asn297 may also be located about ±3 amino acids upstream or downstream of position 297, i.e., between positions 294 and 300, due to minor sequence variations in antibodies. Such fucosylation variants may have improved ADCC function. See, e.g., US Patent Publication Nos. 2003/0157108 and 2004/0093621. Examples of publications related to “defucosylated” or “fucose-deficient” antibody variants include: US 2003/0157108; WO 2000/61739; WO 2001/29246; US 2003/0115614; US 2002/0164328; US 2004/0093621; US 2004/0132140; US 2004/0110704; US 2004/0110282; US 2004/0109865; WO 2003/085119; WO 2003/084570; WO 2005/035586; WO 2005/035778; WO 2005/053742; WO 2002/031140; Okazaki et al. J. Mol. Biol. 336:1239-1249, 2004; Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614, 2004. Examples of cell lines capable of producing defucosylated antibodies include Lec13 CHO cells deficient in protein fucosylation (Ripka et al. Arch. Biochem. Biophys. 249:533-545, 1986; US 2003/0157108; and WO 2004/056312 A1, especially at Example 11), and knockout cell lines, such as alpha-1,6-fucosyltransferase gene, FUT8, knockout CHO cells (see, e.g., Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614, 2004; Kanda et al. Biotechnol. Bioeng. 94(4):680-688, 2006; and WO 2003/085107).
Antibodies variants are further provided with bisected oligosaccharides, e.g., in which a biantennary oligosaccharide attached to the Fc region of the antibody is bisected by GlcNAc. Such antibody variants may have reduced fucosylation and/or improved ADCC function. Examples of such antibody variants are described, e.g., in WO 2003/011878; U.S. Pat. No. 6,602,684; and US 2005/0123546. Antibody variants with at least one galactose residue in the oligosaccharide attached to the Fc region are also provided. Such antibody variants may have improved CDC function. Such antibody variants are described, e.g., in WO 1997/30087; WO 1998/58964; and WO 1999/22764.
c) Fc Region Variants
In certain embodiments, one or more amino acid modifications may be introduced into the Fc region of an antibody provided herein, thereby generating an Fc region variant. The Fc region variant may comprise a human Fc region sequence (e.g., a human IgG1, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification (e.g. a substitution) at one or more amino acid positions.
In certain embodiments, the invention contemplates an antibody variant that possesses some but not all effector functions, which make it a desirable candidate for applications in which the half-life of the antibody in vivo is important yet certain effector functions (such as complement and ADCC) are unnecessary or deleterious. In vitro and/or in vivo cytotoxicity assays can be conducted to confirm the reduction/depletion of CDC and/or ADCC activities. For example, Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks FcγR binding (hence likely lacking ADCC activity), but retains FcRn binding ability. The primary cells for mediating ADCC, NK cells, express Fc(RIII only, whereas monocytes express Fc(RI, Fc(RII and Fc(RIII. FcR expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch et al. Annu. Rev. Immunol. 9:457-492, 1991. Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest is described in U.S. Pat. No. 5,500,362 (see, e.g. Hellstrom et al. Proc. Natl. Acad. Sci. USA 83:7059-7063, 1986 and Hellstrom et al. Proc. Natl. Acad. Sci. USA 82:1499-1502, 1985; U.S. Pat. No. 5,821,337 (see Bruggemann et al. J. Exp. Med. 166:1351-1361, 1987). Alternatively, non-radioactive assays methods may be employed (see, for example, ACTI™ non-radioactive cytotoxicity assay for flow cytometry (CellTechnology, Inc. Mountain View, Calif.; and CYTOTOX 96® non-radioactive cytotoxicity assay (Promega, Madison, Wis.). Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells. Alternatively, or additionally, ADCC activity of the molecule of interest may be assessed in vivo, for example, in an animal model such as that disclosed in Clynes et al. Proc. Natl. Acad. Sci. USA 95:652-656, 1998. C1q binding assays may also be carried out to confirm that the antibody is unable to bind C1q and hence lacks CDC activity. See, e.g., C1q and C3c binding ELISA in WO 2006/029879 and WO 2005/100402. To assess complement activation, a CDC assay may be performed (see, e.g., Gazzano-Santoro et al. J. Immunol. Methods 202:163, 1996; Cragg et al. Blood 101:1045-1052, 2003; and Cragg et al. Blood 103:2738-2743, 2004). FcRn binding and in vivo clearance/half-life determinations can also be performed using methods known in the art (see, e.g., Petkova et al. Intl. Immunol. 18(12):1759-1769, 2006).
Antibodies with reduced effector function include those with substitution of one or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Pat. No. 6,737,056). Such Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called “DANA” Fc mutant with substitution of residues 265 and 297 to alanine (U.S. Pat. No. 7,332,581).
Certain antibody variants with improved or diminished binding to FcRs are described. (See, e.g., U.S. Pat. No. 6,737,056; WO 2004/056312; and Shields et al. J. Biol. Chem. 9(2): 6591-6604, 2001).
In certain embodiments, an antibody variant comprises an Fc region with one or more amino acid substitutions which improve ADCC, e.g., substitutions at positions 298, 333, and/or 334 of the Fc region (EU numbering of residues).
In some embodiments, alterations are made in the Fc region that result in altered (i.e., either improved or diminished) C1q binding and/or Complement Dependent Cytotoxicity (CDC), for example, as described in U.S. Pat. No. 6,194,551, WO 99/51642, and Idusogie et al. J. Immunol. 164: 4178-4184, 2000.
Antibodies with increased half-lives and improved binding to the neonatal Fc receptor (FcRn), which is responsible for the transfer of maternal IgGs to the fetus (Guyer et al. J. Immunol. 117:587, 1976 and Kim et al. J. Immunol. 24:249, 1994), are described in US2005/0014934. Those antibodies comprise an Fc region with one or more substitutions therein which improve binding of the Fc region to FcRn. Such Fc variants include those with substitutions at one or more of Fc region residues: 238, 256, 265, 272, 286, 303, 305, 307, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 or 434, e.g., substitution of Fc region residue 434 (U.S. Pat. No. 7,371,826).
See also Duncan et al. Nature 322:738-40, 1988; U.S. Pat. Nos. 5,648,260 and 5,624,821; and WO 94/29351 concerning other examples of Fc region variants.
d) Cysteine Engineered Antibody Variants
In certain embodiments, it may be desirable to create cysteine engineered antibodies, for example, “thioMAbs,” in which one or more residues of an antibody are substituted with cysteine residues. In particular embodiments, the substituted residues occur at accessible sites of the antibody. By substituting those residues with cysteine, reactive thiol groups are thereby positioned at accessible sites of the antibody and may be used to conjugate the antibody to other moieties, such as drug moieties or linker-drug moieties, to create an immunoconjugate, as described further herein. In certain embodiments, any one or more of the following residues may be substituted with cysteine: V205 (Kabat numbering) of the light chain; A118 (EU numbering) of the heavy chain; and S400 (EU numbering) of the heavy chain Fc region. Cysteine engineered antibodies may be generated as described, e.g., in U.S. Pat. No. 7,521,541.
e) Antibody Derivatives
In certain embodiments, an antibody provided herein may be further modified to contain additional nonproteinaceous moieties that are known in the art and readily available. The moieties suitable for derivatization of the antibody include but are not limited to water soluble polymers. Non-limiting examples of water soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1, 3-dioxolane, poly-1,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran or poly(n-vinyl pyrrolidone)polyethylene glycol, propropylene glycol homopolymers, prolypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols (e.g., glycerol), polyvinyl alcohol, and mixtures thereof. Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water. The polymer may be of any molecular weight, and may be branched or unbranched. The number of polymers attached to the antibody may vary, and if more than one polymer is attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody to be improved, whether the antibody derivative will be used in a therapy under defined conditions, etc.
In another embodiment, conjugates of an antibody and nonproteinaceous moiety that may be selectively heated by exposure to radiation are provided. In one embodiment, the nonproteinaceous moiety is a carbon nanotube (Kam et al. Proc. Natl. Acad. Sci. USA 102: 11600-11605, 2005). The radiation may be of any wavelength, and includes, but is not limited to, wavelengths that do not harm ordinary cells, but which heat the nonproteinaceous moiety to a temperature at which cells proximal to the antibody-nonproteinaceous moiety are killed.
B. Recombinant Methods and Compositions
Antibodies may be produced using recombinant methods and compositions, for example, as described in U.S. Pat. No. 4,816,567. In one embodiment, isolated nucleic acid encoding an anti-IL-33 antibody described herein is provided. Such nucleic acid may encode an amino acid sequence comprising the VL and/or an amino acid sequence comprising the VH of the antibody (e.g., the light and/or heavy chains of the antibody). In a further embodiment, one or more vectors (e.g., expression vectors) comprising such nucleic acid are provided. In a further embodiment, a host cell comprising such nucleic acid is provided. In one such embodiment, a host cell comprises (e.g., has been transformed with): (1) a vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and an amino acid sequence comprising the VH of the antibody, or (2) a first vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and a second vector comprising a nucleic acid that encodes an amino acid sequence comprising the VH of the antibody. In one embodiment, the host cell is eukaryotic, for example, a Chinese Hamster Ovary (CHO) cell, 293 cell, or lymphoid cell (e.g., Y0, NS0, Sp20 cell). In one embodiment, a method of making an anti-IL-33 antibody is provided, wherein the method comprises culturing a host cell comprising a nucleic acid encoding the antibody, as provided above, under conditions suitable for expression of the antibody, and optionally recovering the antibody from the host cell (or host cell culture medium).
For recombinant production of an anti-IL-33 antibody, nucleic acid encoding an antibody, for example, as described above, is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell. Such nucleic acid may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells described herein. For example, antibodies may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed. For expression of antibody fragments and polypeptides in bacteria, see, for example, U.S. Pat. Nos. 5,648,237, 5,789,199, and 5,840,523. (See also Charlton, Methods in Molecular Biology, Vol. 248 (B. K. C. Lo, ed., Humana Press, Totowa, N.J., 2003), pp. 245-254, describing expression of antibody fragments in E. coli.) After expression, the antibody may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for antibody-encoding vectors, including fungi and yeast strains whose glycosylation pathways have been “humanized,” resulting in the production of an antibody with a partially or fully human glycosylation pattern. See Gerngross Nat. Biotech. 22:1409-1414, 2004 and Li et al. Nat. Biotech. 24:210-215, 2006.
Suitable host cells for the expression of glycosylated antibody are also derived from multicellular organisms (invertebrates and vertebrates). Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells.
Plant cell cultures can also be utilized as hosts. See, for example, U.S. Pat. Nos. 5,959,177, 6,040,498, 6,420,548, 7,125,978, and 6,417,429 (describing PLANTIBODIES™ technology for producing antibodies in transgenic plants).
Vertebrate cells may also be used as hosts. For example, mammalian cell lines that are adapted to grow in suspension may be useful. Other examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293 cells as described, e.g., in Graham et al. J. Gen Virol. 36:59, 1977); baby hamster kidney cells (BHK); mouse sertoli cells (TM4 cells as described, e.g., in Mather Biol. Reprod. 23:243-251, 1980); monkey kidney cells (CV1); African green monkey kidney cells (VERO-76); human cervical carcinoma cells (HELA); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3A); human lung cells (W138); human liver cells (Hep G2); mouse mammary tumor (MMT 060562); TRI cells, as described, e.g., in Mather et al., Annals N.Y. Acad. Sci. 383:44-68, 1982; MRC 5 cells; and FS4 cells. Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR CHO cells (Urlaub et al. Proc. Natl. Acad. Sci. USA 77:4216, 1980); and myeloma cell lines such as Y0, NS0 and Sp2/0. For a review of certain mammalian host cell lines suitable for antibody production, see, e.g., Yazaki et al. Methods in Molecular Biology, Vol. 248 (B. K. C. Lo, ed., Humana Press, Totowa, N.J.), pp. 255-268, 2003.
C. Assays
Anti-IL-33 antibodies provided herein may be identified, screened for, or characterized for their physical/chemical properties and/or biological activities by various assays known in the art.
1. Binding Assays and Other Assays
In one aspect, an anti-IL-33 antibody disclosed herein is tested for its antigen-binding activity, for example, by known methods such as ELISA, Western blot, and the like.
In another aspect, competition assays may be used to identify an antibody that competes with an anti-IL-33 antibody disclosed herein for binding to IL-33. In certain embodiments, such a competing antibody binds to the same epitope (e.g., a linear or a conformational epitope) that is bound by an anti-IL-33 antibody disclosed herein. Detailed exemplary methods for mapping an epitope to which an antibody binds are provided in Morris “Epitope Mapping Protocols,” in Methods in Molecular Biology Vol. 66 (Humana Press, Totowa, N.J.), 1996.
In an exemplary competition assay, immobilized IL-33 is incubated in a solution comprising a first labeled antibody that binds to IL-33 and a second unlabeled antibody that is being tested for its ability to compete with the first antibody for binding to IL-33. The second antibody may be present in a hybridoma supernatant. As a control, immobilized IL-33 is incubated in a solution comprising the first labeled antibody but not the second unlabeled antibody. After incubation under conditions permissive for binding of the first antibody to IL-33, excess unbound antibody is removed, and the amount of label associated with immobilized IL-33 is measured. If the amount of label associated with immobilized IL-33 is substantially reduced in the test sample relative to the control sample, then that indicates that the second antibody is competing with the first antibody for binding to IL-33. See Harlow et al. Antibodies: A Laboratory Manual Ch. 14 (Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y.), 1988.
2. Activity Assays
In one aspect, assays are provided for identifying anti-IL-33 antibodies thereof having biological activity. Biological activity may include, for example, binding to IL-33 (e.g., IL-33 in the blood stream), or a peptide fragment thereof, either in vivo, in vitro, or ex vivo. In other embodiments, biological activity may include blocking or neutralizing IL-33, or preventing IL-33 from binding to a ligand, for example, a receptor (e.g., the IL-33 receptor ST2 and/or IL-1RAcP). In some embodiments, biological activity may include binding to site 1 on IL-33 and blocking of binding to the IL-33 receptor (i.e., ST2 and/or IL-1RAcP). Antibodies having such biological activity in vivo and/or in vitro are also provided. In certain embodiments, an antibody disclosed herein is tested for such biological activity. In some embodiments, an anti-IL-33 antibody disclosed herein is tested for inhibition in a cell-based IL-33 blocking assay. In some embodiments, an anti-IL-33 antibody disclosed herein is tested for inhibition of IL-33-induced reporter activity in a cell-based blocking assay (e.g., an IL-33 HEK-BLUE™ cell-based assay as described herein (see, e.g., Examples 3 and 6)). In some embodiments, an antibody disclosed herein is tested for inhibition of an IL-33 activity in primary cells, for example, in a primary NK cell assay (see, e.g., Example 8, Section C of WO 2016/077381) or a primary basophil assay (see, e.g., Example 8, Section D of WO 2016/077381). In some embodiments, an antibody disclosed herein is tested for inhibiting the binding of IL-33 to an IL-33 receptor in a competitive binding ELISA (see, e.g., Example 8, Section F of WO 2016/077381).
D. Immunoconjugates
The invention also provides immunoconjugates comprising an anti-IL-33 antibody provided herein conjugated to one or more cytotoxic agents, such as chemotherapeutic agents or drugs, growth inhibitory agents, toxins (e.g., protein toxins, enzymatically active toxins of bacterial, fungal, plant, or animal origin, or fragments thereof), or radioactive isotopes.
In one embodiment, an immunoconjugate is an antibody-drug conjugate (ADC) in which an antibody is conjugated to one or more drugs, including but not limited to a maytansinoid (see U.S. Pat. Nos. 5,208,020, 5,416,064 and European Patent EP 0 425 235 B1); an auristatin such as monomethylauristatin drug moieties DE and DF (MMAE and MMAF) (see U.S. Pat. Nos. 5,635,483 and 5,780,588, and 7,498,298); a dolastatin; a calicheamicin or derivative thereof (see U.S. Pat. Nos. 5,712,374, 5,714,586, 5,739,116, 5,767,285, 5,770,701, 5,770,710, 5,773,001, and 5,877,296; Hinman et al. Cancer Res. 53:3336-3342, 1993; and Lode et al. Cancer Res. 58:2925-2928, 1998); an anthracycline such daunomycin or doxorubicin (see Kratz et al. Current Med. Chem. 13:477-523, 2006; Jeffrey et al. Bioorganic & Med. Chem. Letters 16:358-362, 2006; Torgov et al. Bioconj. Chem. 16:717-721, 2005; Nagy et al. Proc. Natl. Acad. Sci. USA 97:829-834, 2000; Dubowchik et al. Bioorg. & Med. Chem. Letters 12:1529-1532, 2002; King et al. J. Med. Chem. 45:4336-4343, 2002; and U.S. Pat. No. 6,630,579); methotrexate; vindesine; a taxane such as docetaxel, paclitaxel, larotaxel, tesetaxel, and ortataxel; a trichothecene; and CC1065.
In another embodiment, an immunoconjugate comprises an antibody as described herein conjugated to an enzymatically active toxin or fragment thereof, including but not limited to diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), Momordica charantia inhibitor, curcin, crotin, Sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes.
In another embodiment, an immunoconjugate comprises an antibody as described herein conjugated to a radioactive atom to form a radioconjugate. A variety of radioactive isotopes are available for the production of radioconjugates. Examples include At211, I131, I125, Y90, Re186, Re188, Sm153, Bi212, P32, Pb212 and radioactive isotopes of Lu. When the radioconjugate is used for detection, it may comprise a radioactive atom for scintigraphic studies, for example technetium-99m (tc99m) or I123, or a spin label for nuclear magnetic resonance (NMR) imaging (also known as magnetic resonance imaging, mri), such as iodine-123 again, iodine-131, indium-111, fluorine-19, carbon-13, nitrogen-15, oxygen-17, gadolinium, manganese or iron.
Conjugates of an antibody and cytotoxic agent may be made using a variety of bifunctional protein coupling agents such as N-succinimidyl-3-(2-pyridyldithio) propionate (SPDP), succinimidyl-4-(N-maleimidomethyl) cyclohexane-1-carboxylate (SMCC), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCl), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as toluene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1,5-difluoro-2,4-dinitrobenzene). For example, a ricin immunotoxin can be prepared as described in Vitetta et al. Science 238:1098, 1987. Carbon-14-labeled 1-isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody. See WO 94/11026. The linker may be a “cleavable linker” facilitating release of a cytotoxic drug in the cell. For example, an acid-labile linker, peptidase-sensitive linker, photolabile linker, dimethyl linker or disulfide-containing linker (see, e.g., Chari et al. Cancer Res. 52:127-131, 1992; U.S. Pat. No. 5,208,020) may be used.
The immunoconjugates or ADCs herein expressly contemplate, but are not limited to such conjugates prepared with cross-linker reagents including, but not limited to, BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, MPBH, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, sulfo-EMCS, sulfo-GMBS, sulfo-KMUS, sulfo-MBS, sulfo-SIAB, sulfo-SMCC, and sulfo-SMPB, and SVSB (succinimidyl-(4-vinylsulfone)benzoate) which are commercially available (e.g., from Pierce Biotechnology, Inc., Rockford, Ill., U.S.A.).
E. Methods and Compositions for Diagnostics and Detection
In certain embodiments, any of the anti-IL-33 antibodies provided herein is useful for detecting the presence of IL-33 in a biological sample. The term “detecting” as used herein encompasses quantitative or qualitative detection. In certain embodiments, a biological sample comprises a cell or tissue, such as smooth muscle, epithelial cells, endothelial cells, blood, blood cells (e.g., macrophages, innate type II (ILC2) cells, mast cells, basophils, eosinophils, and dendritic cells), central nervous system cells (e.g., glia cells), or eye cells (e.g., retinal cells (e.g., Muller cells or retinal pigment epithelium (RPE) cells) and vascular endothelial cells of the eye).
In one embodiment, an anti-IL-33 antibody for use in a method of diagnosis or detection is provided. In a further aspect, a method of detecting the presence of IL-33 in a biological sample is provided. In certain embodiments, the method comprises contacting the biological sample with an anti-IL-33 antibody as described herein under conditions permissive for binding of the anti-IL-33 antibody to IL-33, and detecting whether a complex is formed between the anti-IL-33 antibody and IL-33. Such method may be an in vitro or in vivo method. In one embodiment, an anti-IL-33 antibody is used to select subjects eligible for therapy with an anti-IL-33 antibody, for example, where IL-33 is a biomarker for selection of patients.
Exemplary disorders that may be diagnosed using an antibody disclosed herein include IL-33-mediated disorders, including, for example, ocular disorders (e.g., age-related macular degeneration (AMD) or retinopathy of the eye), inflammatory conditions (e.g., asthma, sepsis, septic shock, atopic dermatitis, allergic rhinitis, rheumatoid arthritis, and chronic obstructive pulmonary disease (COPD)), immune disorders (e.g., asthma, rheumatoid arthritis, allergy, atopic allergy, anaphylaxis, anaphylactic shock, allergic rhinitis, psoriasis, inflammatory bowel disease (IBD), Crohn's disease, diabetes, and liver disease), fibrotic disorders (e.g., pulmonary fibrosis (e.g., idiopathic pulmonary fibrosis), eosinophilic disorders (e.g., eosinophil-associated gastrointestinal disorders (EGIDs) including eosinophilic esophagitis), infections (e.g., helminth infections, protozoan infections, and viral infections), pain (e.g., inflammatory pain), central nervous system disorders (e.g., Alzheimer's disease), and solid tumors (e.g., breast, colon, prostate, lung, kidney, liver, pancreas, stomach, intestinal, brain, bone, and skin tumors). In some instances, the ocular disorder that may be diagnosed using an antibody disclosed herein includes AMD (e.g., wet AMD, dry AMD, intermediate AMD, advanced AMD, and geographic atrophy (GA)), retinopathy (e.g., diabetic retinopathy (DR), retinopathy of prematurity (ROP), and high-altitude DR), polypoidal choroidal vasculopathy (PCV), diabetic macular edema, dry eye disease, Behcet's disease, retina detachment, glaucoma, uveitis (e.g., infectious and non-infectious uveitis), retinitis pigmentosa, Leber Congenital Amaurosis, Stargardt's disease, traumatic eye injury, and conjunctivitis (e.g., infectious conjunctivitis, non-infectious conjunctivitis, and allergic conjunctivitis).
In some instances, the ocular disorder includes AMD (including wet AMD, dry AMD, and GA), retinopathy (e.g., DR and ROP), PCV, diabetic macular edema, dry eye disease, Behcet's disease, allergic conjunctivitis, and retina detachment.
In other instances, the ocular disorder includes intermediate AMD, advanced AMD, glaucoma, uveitis (e.g., infectious and non-infectious uveitis), retinitis pigmentosa, Leber Congenital Amaurosis, Stargardt's disease, high-altitude diabetic retinopathy, traumatic eye injury, and conjunctivitis (e.g., infectious conjunctivitis and non-infectious conjunctivitis).
In certain embodiments, labeled anti-IL-33 antibodies are provided. Labels include, but are not limited to, labels or moieties that are detected directly (such as fluorescent, chromophoric, electron-dense, chemiluminescent, and radioactive labels), as well as moieties, such as enzymes or ligands, that are detected indirectly, e.g., through an enzymatic reaction or molecular interaction. Exemplary labels include, but are not limited to, the radioisotopes 32P, 14C, 125I, 3H, and 131I, fluorophores such as rare earth chelates or fluorescein and its derivatives, rhodamine and its derivatives, dansyl, umbelliferone, luceriferases, e.g., firefly luciferase and bacterial luciferase (U.S. Pat. No. 4,737,456), luciferin, 2,3-dihydrophthalazinediones, horseradish peroxidase (HRP), alkaline phosphatase, β-galactosidase, glucoamylase, lysozyme, saccharide oxidases, e.g., glucose oxidase, galactose oxidase, and glucose-6-phosphate dehydrogenase, heterocyclic oxidases such as uricase and xanthine oxidase, coupled with an enzyme that employs hydrogen peroxide to oxidize a dye precursor such as HRP, lactoperoxidase, or microperoxidase, biotin/avidin, spin labels, bacteriophage labels, stable free radicals, and the like.
F. Pharmaceutical Formulations
Pharmaceutical formulations of an anti-IL-33 antibody disclosed herein are prepared by mixing such antibody having the desired degree of purity with one or more optional pharmaceutically acceptable carriers (see, e.g., Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed., 1980), in the form of lyophilized formulations or aqueous solutions. Pharmaceutically acceptable carriers are generally nontoxic to recipients at the dosages and concentrations employed, and include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g., Zn-protein complexes); and/or non-ionic surfactants such as polyethylene glycol (PEG). Exemplary pharmaceutically acceptable carriers herein further include interstitial drug dispersion agents such as soluble neutral-active hyaluronidase glycoproteins (sHASEGP), for example, human soluble PH-20 hyaluronidase glycoproteins, such as rHuPH20 (HYLENEX®, Baxter International, Inc.). Certain exemplary sHASEGPs and methods of use, including rHuPH20, are described in US Patent Publication Nos. 2005/0260186 and 2006/0104968. In one aspect, a sHASEGP is combined with one or more additional glycosaminoglycanases such as chondroitinases.
Exemplary lyophilized antibody formulations are described in U.S. Pat. No. 6,267,958. Aqueous antibody formulations include those described in U.S. Pat. No. 6,171,586 and WO 2006/044908, the latter formulations including a histidine-acetate buffer.
The formulation herein may also contain more than one active ingredients as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other. For example, it may be desirable to further provide an ST2 binding antagonist, a complement pathway inhibitor (e.g., a Factor D binding antagonist), an HtrA1 binding antagonist, a VEGF antagonist, a tryptase-beta binding antagonist, a chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) binding antagonist, an interleukin-13 (IL-13) binding antagonist, an interleukin-17 (IL-17) binding antagonist, a JAK1 antagonist, and/or an interleukin-5 (IL-5) binding antagonist. In some instances, the complement pathway inhibitor is a Factor D binding antagonist. In some instances, the Factor D binding antagonist is an anti-Factor D antibody or an antigen-binding fragment thereof, for example, as described below in Section G, “Therapeutic Methods and Compositions.” In some instances, the HtrA1 binding antagonist is an anti-HtrA1 antibody or an antigen-binding fragment thereof, for example, as described below in Section G, “Therapeutic Methods and Compositions.” In some instances, the anti-HtrA1 antibody fragment is an Fab, Fab′-SH, Fv, scFv, or an (Fab′)2 fragment. In some instances, the anti-Factor D antibody fragment is an Fab, Fab′-SH, Fv, scFv, or an (Fab′)2 fragment. In some instances, the VEGF antagonist is an anti-VEGF antibody or an antigen-binding fragment thereof, for example, as described below in Section G, “Therapeutic Methods and Compositions.” In some instances, the anti-VEGF antibody fragment is an Fab, Fab′-SH, Fv, scFv, or an (Fab′)2 fragment. In some instances, the VEGF antagonist is an anti-VEGF receptor antibody or an antigen-binding fragment thereof. In some instances, the anti-VEGF receptor antibody fragment is an Fab, Fab′-SH, Fv, scFv, or an (Fab′)2 fragment. Such active ingredients are suitably present in combination in amounts that are effective for the purpose intended.
Active ingredients may be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions. Such techniques are disclosed in Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed., 1980.
Sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g., films, or microcapsules.
For delivery to the eye (ophthalmic delivery), an antibody disclosed herein may be combined, for example, with ophthalmologically acceptable preservatives, co-solvents, surfactants, viscosity enhancers, penetration enhancers, buffers, sodium chloride, and/or water. Preservatives may be included, for example, to inhibit microbial contamination during use. Suitable preservatives include: edetate disodium, methyl paraben, propyl paraben, sorbic acid, phenylethyl alcohol, chlorobutanol, polyquaternium-1, or other agents known in the art. Such preservatives are typically employed at a level of from 0.001 to 1.0% w/v. In some instances, a pharmaceutical formulation disclosed herein does not include a preservative. In certain instances, compositions intended to be administered topically to the eye may be formulated as eye drops or eye ointments. In some instances, the total amount of antibody will be about 0.001 to 1.0% (w/w), for example, about 0.01 to about 1.0% (w/w), of such a formulation.
The formulations to be used for in vivo administration are generally sterile. Sterility may be readily accomplished, for example, by filtration through sterile filtration membranes.
An anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein) can be formulated in a polymeric formulation.
Any suitable concentration of any of the antibodies disclosed herein may be used in the compositions (e.g., pharmaceutical compositions). For example, the concentration of an antibody in a composition disclosed herein may range, for example, from about 1 mg/mL to about 400 mg/mL (e.g., about 1 mg/mL to about 400 mg/mL, about 1 mg/mL to about 375 mg/mL, about 1 mg/mL to about 350 mg/mL, about 1 mg/mL to about 325 mg/mL, about 1 mg/mL to about 300 mg/mL, about 1 mg/mL to about 275 mg/mL, about 1 mg/mL to about 250 mg/mL, about 1 mg/mL to about 225 mg/mL, about 1 mg/mL to about 200 mg/mL, about 1 mg/mL to about 175 mg/mL, about 1 mg/mL to about 150 mg/mL, about 1 mg/mL to about 125 mg/mL, about 1 mg/mL to about 100 mg/mL, about 1 mg/mL to about 75 mg/mL, about 1 mg/mL to about 50 mg/mL, about 1 mg/mL to about 25 mg/mL, about 25 mg/mL to about 350 mg/mL, about 25 mg/mL to about 325 mg/mL, about 25 mg/mL to about 300 mg/mL, about 25 mg/mL to about 275 mg/mL, about 25 mg/mL to about 250 mg/mL, about 25 mg/mL to about 225 mg/mL, about 25 mg/mL to about 200 mg/mL, about 25 mg/mL to about 175 mg/mL, about 25 mg/mL to about 150 mg/mL, about 25 mg/mL to about 125 mg/mL, about 25 mg/mL to about 100 mg/mL, about 25 mg/mL to about 75 mg/mL, about 25 mg/mL to about 50 mg/mL, about 50 mg/mL to about 350 mg/mL, about 50 mg/mL to about 325 mg/mL, about 50 mg/mL to about 300 mg/mL, about 50 mg/mL to about 275 mg/mL, about 50 mg/mL to about 250 mg/mL, about 50 mg/mL to about 225 mg/mL, about 50 mg/mL to about 200 mg/mL, about 50 mg/mL to about 175 mg/mL, about 50 mg/mL to about 150 mg/mL, about 50 mg/mL to about 125 mg/mL, about 50 mg/mL to about 100 mg/mL, about 50 mg/mL to about 75 mg/mL, about 75 mg/mL to about 350 mg/mL, about 75 mg/mL to about 325 mg/mL, about 75 mg/mL to about 300 mg/mL, about 75 mg/mL to about 275 mg/mL, about 75 mg/mL to about 250 mg/mL, about 75 mg/mL to about 225 mg/mL, about 75 mg/mL to about 200 mg/mL, about 75 mg/mL to about 175 mg/mL, about 75 mg/mL to about 150 mg/mL, about 75 mg/mL to about 125 mg/mL, about 75 mg/mL to about 100 mg/mL, about 100 mg/mL to about 350 mg/mL, about 100 mg/mL to about 325 mg/mL, about 100 mg/mL to about 300 mg/mL, about 100 mg/mL to about 275 mg/mL, about 100 mg/mL to about 250 mg/mL, about 100 mg/mL to about 225 mg/mL, about 100 mg/mL to about 200 mg/mL, about 100 mg/mL to about 175 mg/mL, about 100 mg/mL to about 150 mg/mL, about 100 mg/mL to about 125 mg/mL, or about 150 mg/mL to about 175 mg/mL. In some instances, the antibody is at a concentration of about 50 mg/mL to about 300 mg/mL (e.g., about 50 mg/mL, about 60 mg/mL, about 70 mg/mL, about 80 mg/mL, about 90 mg/mL, about 100 mg/mL, about 110 mg/mL, about 120 mg/mL, about 130 mg/mL, about 140 mg/mL, about 150 mg/mL, about 160 mg/mL, about 170 mg/mL, about 180 mg/mL, about 190 mg/mL, about 200 mg/mL, about 210 mg/mL, about 220 mg/mL, about 230 mg/mL, about 240 mg/mL, about 250 mg/mL, about 260 mg/mL, about 270 mg/mL, about 280 mg/mL, about 290 mg/mL, or about 300 mg/mL. In some instances, the antibody is at a concentration of about 175 mg/mL to about 225 mg/mL (e.g., about 175 mg/mL, about 176 mg/mL, about 177 mg/mL, about 178 mg/mL about 179 mg/mL, about 180 mg/mL, about 181 mg/mL, about 182 mg/mL, about 183 mg/mL, about 184 mg/mL, about 185 mg/mL, about 186 mg/mL, about 187 mg/mL, about 188 mg/mL, about 189 mg/mL, about 190 mg/mL, about 191 mg/mL, about 192 mg/mL, about 193 mg/mL, about 194 mg/mL, about 195 mg/mL, about 196 mg/mL, about 197 mg/mL, about 198 mg/mL, about 199 mg/mL, about 200 mg/mL, about 201 mg/mL, about 202 mg/mL, about 203 mg/mL, about 204 mg/mL, about 205 mg/mL, about 206 mg/mL, about 207 mg/mL, about 208 mg/mL, about 209 mg/mL, about 210 mg/mL, about 211 mg/mL, about 212 mg/mL, about 213 mg/mL, about 214 mg/mL, about 215 mg/mL, about 216 mg/mL, about 217 mg/mL, about 218 mg/mL, about 219 mg/mL, about 220 mg/mL, about 221 mg/mL, about 222 mg/mL, about 223 mg/mL, about 224 mg/mL, or about 225 mg/mL. In particular instances, the antibody concentration is about 200 mg/mL.
G. Therapeutic Methods and Compositions
Any of the anti-IL-33 antibodies disclosed herein may be used in therapeutic methods.
The invention provides an IL-33 axis binding antagonist for use as a medicament. In one aspect, an anti-IL-33 antibody for use as a medicament is provided. In further aspects, an anti-IL-33 antibody for use in treating IL-33-mediated disorders is provided. In certain embodiments, an anti-IL-33 antibody for use in a method of treatment is provided. In certain embodiments, the invention provides an anti-IL-33 antibody for use in a method of treating an individual having an IL-33-mediated disorder comprising administering to the individual an effective amount of the anti-IL-33 antibody. In one such embodiment, the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, for example, as described below. An “individual” according to any of the above embodiments is preferably a human.
The invention provides an IL-33 axis binding antagonist in the manufacture or preparation of a medicament. In a further aspect, the invention provides for the use of an anti-IL-33 antibody in the manufacture or preparation of a medicament. In one embodiment, the medicament is for treatment of an IL-33-mediated disorder. In a further embodiment, the medicament is for use in a method of treating IL-33-mediated disorder comprising administering to an individual having IL-33-mediated disorder an effective amount of the medicament. In one such embodiment, the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, e.g., as described below. An “individual” according to any of the above embodiments may be a human.
In a further aspect, the invention provides a method for treating an IL-33-mediated disorder. In some instances, the method comprises administering the individual having such an IL-33-mediated disorder an effective amount of an IL-33 axis binding antagonist. In one embodiment, the method comprises administering to an individual having such IL-33-mediated disorder an effective amount of an anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein). In one such embodiment, the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, as described below. An “individual” according to any of the above embodiments may be a human.
In a further aspect, the invention provides pharmaceutical formulations comprising any of the anti-IL-33 antibodies provided herein, e.g., for use in any of the above therapeutic methods. In one embodiment, a pharmaceutical formulation comprises any of the anti-IL-33 antibodies provided herein and a pharmaceutically acceptable carrier. In another embodiment, a pharmaceutical formulation comprises any of the anti-IL-33 antibodies provided herein and at least one additional therapeutic agent, for example, as described below.
In any of the preceding aspects, the IL-33 mediated disorder may be an ocular disorder, an inflammatory condition, an immune disorder, a fibrotic disorder, an eosinophilic disorder, an infection, pain, a central nervous system disorder, or a solid tumor. For example, in some instances, an inflammatory condition may be asthma, airway hyperresponsiveness, airway inflammation, sepsis, septic shock, atopic dermatitis, allergic rhinitis, rheumatoid arthritis, or chronic obstructive pulmonary disease (COPD). In some instances, an immune disorder may be asthma, rheumatoid arthritis, allergy, atopic allergy, anaphylaxis, anaphylactic shock, allergic rhinitis, psoriasis, inflammatory bowel disease (IBD), Crohn's disease, diabetes, or liver disease. In some instances, the fibrotic disease may be idiopathic pulmonary fibrosis (IPF). In some instances, the eosinophilic disorder may be an eosinophil-associated gastrointestinal disorder (EGID). In some instances, the EGID may be eosinophilic esophagitis. In some instances, the infection may be a helminth infection, a protozoan infection, or a viral infection. In some instances, the protozoan infection may be Leishmania major infection. In some instances, the viral infection may be respiratory syncytial virus (RSV) infection or influenza infection. In some instances, the pain may be inflammatory pain. In some instances, the central nervous system disorder may be Alzheimer's disease. In some instances, the solid tumor may be a breast tumor, colon tumor, prostate tumor, lung tumor, kidney tumor, liver tumor, pancreas tumor, stomach tumor, intestinal tumor, brain tumor, bone tumor, or skin tumor. In particular instances, the IL-33-mediated disorder may be asthma, allergic rhinitis, atopic dermatitis, COPD, eosinophilic esophagitis, or pulmonary fibrosis (e.g., IPF). For example, in some instances, the IL-33-mediated disorder is asthma. In other instances, the IL-33-mediated disorder is pulmonary fibrosis (e.g., IPF).
In some instances of any of the preceding aspects, the IL-33-mediated disorder may be an ocular disorder (e.g., any ocular disorder disclosed herein). Non-limiting ocular disorders include, for example, AMD (e.g., wet AMD, dry AMD, intermediate AMD, advanced AMD, and geographic atrophy (GA)), macular degeneration, macular edema, DME (e.g., focal, non-center DME and diffuse, center-involved DME), retinopathy, diabetic retinopathy (DR) (e.g., proliferative DR (PDR), non-proliferative DR (NPDR), and high-altitude DR), other ischemia-related retinopathies, ROP, retinal vein occlusion (RVO) (e.g., central (CRVO) and branched (BRVO) forms), CNV (e.g., myopic CNV), corneal neovascularization, diseases associated with corneal neovascularization, retinal neovascularization, diseases associated with retinal/choroidal neovascularization, central serous retinopathy (CSR), pathologic myopia, von Hippel-Lindau disease, histoplasmosis of the eye, FEVR, Coats' disease, Norrie Disease, retinal abnormalities associated with osteoporosis-pseudoglioma syndrome (OPPG), subconjunctival hemorrhage, rubeosis, ocular neovascular disease, neovascular glaucoma, retinitis pigmentosa (RP), hypertensive retinopathy, retinal angiomatous proliferation, macular telangiectasia, iris neovascularization, intraocular neovascularization, retinal degeneration, cystoid macular edema (CME), vasculitis, papilloedema, retinitis, including but not limited to CMV retinitis, ocular melanoma, retinal blastoma, conjunctivitis (e.g., infectious conjunctivitis and non-infectious (e.g., allergic) conjunctivitis), Leber congenital amaurosis (also known as Leber's congenital amaurosis or LCA), uveitis (including infectious and non-infectious uveitis), choroiditis (e.g., multifocal choroiditis), ocular histoplasmosis, blepharitis, dry eye, traumatic eye injury, Sjögren's disease, and other ophthalmic diseases wherein the disease or disorder is associated with ocular neovascularization, vascular leakage, and/or retinal edema or retinal atrophy. Additional exemplary ocular disorders include retinoschisis (abnormal splitting of the retina neurosensory layers), diseases associated with rubeosis (neovascularization of the angle) and diseases caused by the abnormal proliferation of fibrovascular or fibrous tissue, including all forms of proliferative vitreoretinopathy.
Exemplary diseases associated with corneal neovascularization include, but are not limited to, epidemic keratoconjunctivitis, vitamin A deficiency, contact lens overwear, atopic keratitis, superior limbic keratitis, terygium keratitis sicca, Sjëgren's syndrome, acne rosacea, phylectenulosis, syphilis, Mycobacteria infections, lipid degeneration, chemical burns, bacterial ulcers, fungal ulcers, Herpes simplex infections, Herpes zoster infections, protozoan infections, Kaposi sarcoma, Mooren ulcer, Terrien's marginal degeneration, marginal keratolysis, rheumatoid arthritis, systemic lupus, polyarteritis, trauma, Wegener's sarcoidosis, scleritis, Stevens-Johnson syndrome, periphigoid radial keratotomy, and corneal graph rejection.
Exemplary diseases associated with choroidal neovascularization and defects in the retina vasculature, including increased vascular leak, aneurisms and capillary drop-out include, but are not limited to, diabetic retinopathy, macular degeneration, sickle cell anemia, sarcoid, syphilis, pseudoxanthoma elasticum, Paget's disease, vein occlusion, artery occlusion, carotid obstructive disease, chronic uveitis/vitritis, mycobacterial infections, Lyme's disease, systemic lupus erythematosis, retinopathy of prematurity, retina edema (including macular edema), Eales disease, Behcet's disease, infections causing retinitis or choroiditis (e.g., multifocal choroidits), presumed ocular histoplasmosis, Best's disease (vitelliform macular degeneration), myopia, optic pits, pars planitis, retinal detachment (e.g., chronic retinal detachment), hyperviscosity syndromes, toxoplasmosis, trauma, and post-laser complications.
Exemplary diseases associated with atrophy of retinal tissues (photoreceptors and the underlying RPE) include, but are not limited to, atrophic or nonexudative AMD (e.g., geographic atrophy or advanced dry AMD), macular atrophy (e.g., atrophy associated with neovascularization and/or geographic atrophy), diabetic retinopathy, Stargardt's disease, Sorsby Fundus Dystrophy, retinoschisis and retinitis pigmentosa.
In some instances, the ocular disorder includes AMD (including wet AMD, dry AMD, and GA), retinopathy (e.g., DR and ROP), PCV, diabetic macular edema, dry eye disease, Behcet's disease, allergic conjunctivitis, and retina detachment.
In other instances, the ocular disorder includes intermediate AMD, advanced AMD, glaucoma, uveitis (e.g., infectious and non-infectious uveitis), retinitis pigmentosa, Leber Congenital Amaurosis, Stargardt's disease, high-altitude diabetic retinopathy, traumatic eye injury, and conjunctivitis (e.g., infectious conjunctivitis and non-infectious conjunctivitis).
For example, the invention provides a method of treating an ocular disorder in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of an anti-IL-33 antibody, for example, an anti-IL-33 antibody disclosed herein. In some instances, the ocular disorder may be selected from the group consisting of age-related macular degeneration (AMD), including wet AMD, dry AMD, intermediate AMD, advanced AMD, and geographic atrophy (GA)), retinopathy (e.g., diabetic retinopathy (DR), retinopathy of prematurity (ROP), and high-altitude DR), polypoidal choroidal vasculopathy (PCV), diabetic macular edema, dry eye disease, Behcet's disease, retina detachment, glaucoma, uveitis (e.g., infectious and non-infectious uveitis), retinitis pigmentosa, Leber Congenital Amaurosis (also known as Leber's congenital amaurosis), Stargardt's disease, traumatic eye injury, and conjunctivitis (e.g., infectious conjunctivitis, non-infectious conjunctivitis, and allergic conjunctivitis). In some instances, the ophthalmologic disorder includes AMD (including wet AMD, dry AMD, and GA), retinopathy (e.g., DR and ROP), PCV, diabetic macular edema, dry eye disease, Behcet's disease, allergic conjunctivitis, and retina detachment. In other instances, the ocular disorder includes intermediate AMD, advanced AMD, glaucoma, uveitis (e.g., infectious and non-infectious uveitis), retinitis pigmentosa, Leber Congenital Amaurosis, Stargardt's disease, high-altitude diabetic retinopathy, traumatic eye injury, and conjunctivitis (e.g., infectious conjunctivitis and non-infectious conjunctivitis).
An anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein) can be used either alone or in combination with other agents in a therapy. For instance, an anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein) may be co-administered with at least one additional therapeutic agent. In certain embodiments, an additional therapeutic agent is an ST2 binding antagonist, a complement pathway inhibitor (e.g., a Factor D binding antagonist), an HtrA1 binding antagonist, a VEGF antagonist, a tryptase-beta binding antagonist, a chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) binding antagonist, an interleukin-13 (IL-13) binding antagonist, an interleukin-17 (IL-17) binding antagonist, a JAK1 antagonist, and/or an interleukin-5 (IL-5) binding antagonist. In some embodiments, an additional therapeutic agent is a chemotherapeutic agent, an anti-hormonal agent, a cytotoxic agent, a growth inhibitory agent, or combinations thereof.
An anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein) for use in any of the methods described herein can be formulated in a polymeric formulation.
For example, in certain embodiments, any of the preceding methods further comprises administering one or more additional compounds. In certain embodiments, the anti-IL-33 antibody or polymeric formulation is administered simultaneously with the additional compound(s). In certain embodiments, the anti-IL33 antibody or polymeric formulation is administered before or after the additional compound(s). In certain embodiments, the additional compound binds to a second biological molecule selected from the group consisting of IL-1β; IL-6; IL-6R; IL-13; IL-13R; PDGF; angiopoietin; Ang2; Tie2; S1P; integrins αvβ3, αvβ5, and α5β1; betacellulin; apelin/APJ; erythropoietin; complement factor D; TNFα; HtrA1; a VEGF receptor; ST-2 receptor; and proteins genetically linked to AMD risk, such as complement pathway components C2, factor B, factor H, CFHR3, C3b, C5, C5a, and C3a; HtrA1; ARMS2; TIMP3; HLA; interleukin-8 (IL-8); CX3CR1; TLR3; TLR4; CETP; LIPC; COL10A1; and TNFRSF10A. In certain embodiments, the additional compound is an antibody or antigen-binding fragment thereof. In certain embodiments according to (or as applied to) any of the embodiments above, the ocular disorder is an intraocular neovascular disease selected from the group consisting of proliferative retinopathies, choroidal neovascularization (CNV), age-related macular degeneration (AMD), diabetic and other ischemia-related retinopathies, diabetic macular edema, pathological myopia, von Hippel-Lindau disease, histoplasmosis of the eye, retinal vein occlusion (RVO), including CRVO and BRVO, corneal neovascularization, retinal neovascularization, and retinopathy of prematurity (ROP). For example, in some instances, the additional compound is a bispecific antibody (e.g., an anti-VEGF/anti-Ang2 bispecific antibody, such as RG-7716 or any bispecific anti-VEGF/anti-Ang2 bispecific antibody disclosed in WO 2010/069532 or WO 2016/073157 or a variant thereof. In another example, in some instances, the additional compound is an anti-IL-6 antibody, for example, EBI-031 (Eleven Biotherapeutics; see, e.g., WO 2016/073890), siltuximab (SYLVANT®), olokizumab, clazakizumab, sirukumab, elsilimomab, OPR-003, MEDI5117, PF-04236921, or a variant thereof. In a still further example, in some instances, the additional compound is an anti-IL-6R antibody, for example, tocilizumab (ACTEMRA®) (see, e.g., WO 1992/019579), sarilumab, ALX-0061, SA237, or a variant thereof.
In some instances, an antibody of the invention, and/or polymeric formulation thereof, may be administered in combination with at least one additional therapeutic agent for treatment of an ocular disorder, for example, an ocular disorder described herein (e.g., AMD (e.g., wet AMD), DME, DR, RVO, or GA). Exemplary additional therapeutic agents for combination therapy for treatment of ocular disorders include, without limitation, anti-angiogenic agents, such as VEGF antagonists, including, for example, anti-VEGF antibodies (e.g., the anti-VEGF Fab LUCENTIS® (ranibizumab)), soluble receptor fusion proteins (e.g., the recombinant soluble receptor fusion protein EYLEA® (aflibercept, also known as VEGF Trap Eye; Regeneron/Aventis)), aptamers (e.g., the anti-VEGF pegylated aptamer MACUGEN® (pegaptanib sodium; NeXstar Pharmaceuticals/OSI Pharmaceuticals)), and VEGFR tyrosine kinase inhibitors (e.g., 4-(4-bromo-2-fluoroanilino)-6-methoxy-7-(1-methylpiperidin-4-ylmethoxy)quinazoline (ZD6474), 4-(4-fluoro-2-methylindol-5-yloxy)-6-methoxy-7-(3-pyrrolidin-1-ylpropoxy)quinazoline (AZD2171), vatalanib (PTK787), semaxaminib (SU5416; SUGEN), and SUTENT® (sunitinib)); Tryptophanyl-tRNA synthetase (TrpRS); squalamine; RETAANE® (anecortave acetate for depot suspension; Alcon, Inc.); Combretastatin A4 Prodrug (CA4P); MIFEPREX® (mifepristone-ru486); subtenon triamcinolone acetonide; intravitreal crystalline triamcinolone acetonide; matrix metalloproteinase inhibitors (e.g., Prinomastat (AG3340; Pfizer)); fluocinolone acetonide (including fluocinolone intraocular implant; Bausch & Lomb/Control Delivery Systems); linomide; inhibitors of integrin β3 function; angiostatin, and combinations thereof. These and other therapeutic agents that can be administered in combination with an antibody of the invention are described, for example, in U.S. Patent Application No. US 2014/0017244, which is incorporated herein by reference in its entirety.
Further examples of additional therapeutic agents that can be used in combination with an antibody of the invention, and/or polymeric formulation thereof, for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA), include, but are not limited to, VISUDYNE® (verteporfin; a light-activated drug that is typically used in conjunction with photodynamic therapy with a non-thermal laser), PKC412, Endovion (NS 3728; NeuroSearch A/S), neurotrophic factors (e.g., glial derived neurotrophic factor (GDNF) and ciliary neurotrophic factor (CNTF)), diltiazem, dorzolamide, PHOTOTROP®, 9-cis-retinal, eye medication (e.g., phospholine iodide, echothiophate, or carbonic anhydrase inhibitors), veovastat (AE-941; AEterna Laboratories, Inc.), Sirna-027 (AGF-745; Sima Therapeutics, Inc.), neurotrophins (including, by way of example only, NT-4/5, Genentech), Cand5 (Acuity Pharmaceuticals), INS-37217 (Inspire Pharmaceuticals), integrin antagonists (including those from Jerini AG and Abbott Laboratories), EG-3306 (Ark Therapeutics Ltd.), BDM-E (BioDiem Ltd.), thalidomide (as used, for example, by EntreMed, Inc.), cardiotrophin-1 (Genentech), 2-methoxyestradiol (Allergan/Oculex), DL-8234 (Toray Industries), NTC-200 (Neurotech), tetrathiomolybdate (University of Michigan), LYN-002 (Lynkeus Biotech), microalgal compound (Aquasearch/Albany, Mera Pharmaceuticals), D-9120 (Celltech Group plc), ATX-S10 (Hamamatsu Photonics), TGF-beta 2 (Genzyme/Celtrix), tyrosine kinase inhibitors (e.g., those from Allergan, SUGEN, or Pfizer), NX-278-L (NeXstar Pharmaceuticals/Gilead Sciences), Opt-24 (OPTIS France SA), retinal cell ganglion neuroprotectants (Cogent Neurosciences), N-nitropyrazole derivatives (Texas A&M University System), KP-102 (Krenitsky Pharmaceuticals), cyclosporin A, therapeutic agents used in photodynamic therapy (e.g., VISUDYNE®; receptor-targeted PDT, Bristol-Myers Squibb, Co.; porfimer sodium for injection with PDT; verteporfin, QLT Inc.; rostaporfin with PDT, Miravent Medical Technologies; talaporfin sodium with PDT, Nippon Petroleum; and motexafin lutetium, Pharmacyclics, Inc.), antisense oligonucleotides (including, by way of example, products tested by Novagali Pharma SA and ISIS-13650, Ionis Pharmaceuticals), and combinations thereof.
An antibody of the invention, and/or polymeric formulation thereof, may be administered in combination with a therapy or surgical procedure for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA), including, for example, laser photocoagulation (e.g., panretinal photocoagulation (PRP)), drusen lasering, macular hole surgery, macular translocation surgery, implantable miniature telescopes, PHI-motion angiography (also known as micro-laser therapy and feeder vessel treatment), proton beam therapy, microstimulation therapy, retinal detachment and vitreous surgery, scleral buckle, submacular surgery, transpupillary thermotherapy, photosystem I therapy, use of RNA interference (RNAi), extracorporeal rheopheresis (also known as membrane differential filtration and rheotherapy), microchip implantation, stem cell therapy, gene replacement therapy, ribozyme gene therapy (including gene therapy for hypoxia response element, Oxford Biomedica; Lentipak, Genetix; and PDEF gene therapy, GenVec), photoreceptor/retinal cells transplantation (including transplantable retinal epithelial cells, Diacrin, Inc.; retinal cell transplant, e.g., Astellas Pharma US, Inc., ReNeuron, CHA Biotech), acupuncture, and combinations thereof.
In some instances, an antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with an anti-angiogenic agent for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA). Any suitable anti-angiogenic agent can be used in combination with an antibody of the invention, including, but not limited to, those listed by Carmeliet et al. Nature 407:249-257, 2000. In some embodiments, the anti-angiogenic agent is a VEGF antagonist, including, but not limited to, an anti-VEGF antibody (e.g., the anti-VEGF Fab LUCENTIS® (ranibizumab), RTH-258 (formerly ESBA-1008, an anti-VEGF single-chain antibody fragment; Novartis), or a bispecific anti-VEGF antibody (e.g., an anti-VEGF/anti-angiopoeitin 2 bispecific antibody such as RG-7716; Roche)), a soluble recombinant receptor fusion protein (e.g., EYLEA® (aflibercept)), a VEGF variant, a soluble VEGFR fragment, an aptamer capable of blocking VEGF (e.g., pegaptanib) or VEGFR, a neutralizing anti-VEGFR antibody, a small molecule inhibitor of VEGFR tyrosine kinases, an anti-VEGF DARPin® (e.g., abicipar pegol, Molecular Partners AG/Allergan), a small interfering RNAs which inhibits expression of VEGF or VEGFR, a VEGFR tyrosine kinase inhibitor (e.g., 4-(4-bromo-2-fluoroanilino)-6-methoxy-7-(1-methylpiperidin-4-ylmethoxy)quinazoline (ZD6474), 4-(4-fluoro-2-methylindol-5-yloxy)-6-methoxy-7-(3-pyrrolidin-1-ylpropoxy)quinazoline (AZD2171), vatalanib (PTK787), semaxaminib (SU5416; SUGEN), and SUTENT® (sunitinib)), and combinations thereof. In some instances, the bispecific anti-IL-33 antibody binds to a therapeutic agent targeting a second biological molecule, including but not limited to IL-1p; IL-6; IL-6R; PDGF (e.g., PDGF-BB); angiopoietin; angiopoietin 2; Tie2; S1P; integrins αvβ3, αvβ5, and α5β1; betacellulin; apelin/APJ; erythropoietin; complement factor D; TNFα; HtrA1; a VEGF receptor (e.g., VEGFR1, VEGFR2, VEGFR3, mbVEGFR, or sVEGFR); ST-2 receptor; and proteins genetically linked to age-related macular degeneration (AMD) risk, such as complement pathway components C2, factor B, factor H, CFHR3, C3b, C5, C5a, and C3a; HtrA1; ARMS2; TIMP3; HLA; IL-8; CX3CR1; TLR3; TLR4; CETP; LIPC; COL10A1; and TNFRSF10A. For example, in some instances, the additional compound is a bispecific antibody (e.g., an anti-VEGF/anti-Ang2 bispecific antibody, such as RG-7716 or any bispecific anti-VEGF/anti-Ang2 bispecific antibody disclosed in WO 2010/069532 or WO 2016/073157 or a variant thereof).
Other suitable anti-angiogenic agents that may be administered in combination with an antibody of the invention, and/or polymeric formulation thereof, for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA) include corticosteroids, angiostatic steroids, anecortave acetate, angiostatin, endostatin, tyrosine kinase inhibitors, matrix metalloproteinase (MMP) inhibitors, insulin-like growth factor-binding protein 3 (IGFBP3), stromal derived factor (SDF-1) antagonists (e.g., anti-SDF-1 antibodies), pigment epithelium-derived factor (PEDF), gamma-secretase, Delta-like ligand 4, integrin antagonists, hypoxia-inducible factor (HIF)-1α antagonists, protein kinase CK2 antagonists, agents that inhibit stem cell (e.g., endothelial progenitor cell) homing to the site of neovascularization (e.g., an anti-vascular endothelial cadherin (CD-144) antibody and/or an anti-SDF-1 antibody), and combinations thereof.
In a further example, in some instances, an antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with an agent that has activity against neovascularization for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA), such as an anti-inflammatory drug, a mammalian target of rapamycin (mTOR) inhibitor (e.g., rapamycin, AFINITOR® (everolimus), and TORISEL® (temsirolimus)), cyclosporine, a tumor necrosis factor (TNF) antagonist (e.g., an anti-TNFα antibody or antigen-binding fragment thereof (e.g., infliximab, adalimumab, certolizumab pegol, and golimumab) or a soluble receptor fusion protein (e.g., etanercept)), an anti-complement agent, a nonsteroidal anti-inflammatory agent (NSAID), or combinations thereof.
In a still further example, in some instances, an antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with an agent that is neuroprotective and can potentially reduce the progression of dry AMD to wet AMD, such as the class of drugs called the “neurosteroids,” which include drugs such as dehydroepiandrosterone (DHEA) (brand names: PRASTERA™ and FIDELIN®), dehydroepiandrosterone sulfate, and pregnenolone sulfate.
Any suitable AMD therapeutic agent can be administered as an additional therapeutic agent in combination with an antibody of the invention, and/or polymeric formulation thereof, for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA), including, but not limited to, a VEGF antagonist, for example, an anti-VEGF antibody (e.g., LUCENTIS® (ranibizumab), RTH-258 (formerly ESBA-1008, an anti-VEGF single-chain antibody fragment; Novartis), or a bispecific anti-VEGF antibody (e.g., an anti-VEGF/anti-angiopoeitin 2 bispecific antibody such as RG-7716; Roche)), a soluble VEGF receptor fusion protein (e.g., EYLEA® (aflibercept)), an anti-VEGF DARPin® (e.g., abicipar pegol; Molecular Partners AG/Allergan), or an anti-VEGF aptamer (e.g., MACUGEN® (pegaptanib sodium)); a platelet-derived growth factor (PDGF) antagonist, for example, an anti-PDGF antibody, an anti-PDGFR antibody (e.g., REGN2176-3), an anti-PDGF-BB pegylated aptamer (e.g., FOVISTA®; Ophthotech/Novartis), a soluble PDGFR receptor fusion protein, or a dual PDGF/VEGF antagonist (e.g., a small molecule inhibitor (e.g., DE-120 (Santen) or X-82 (TyrogeneX)) or a bispecific anti-PDGF/anti-VEGF antibody)); VISUDYNE® (verteporfin) in combination with photodynamic therapy; an antioxidant; a complement system antagonist, for example, a complement factor C5 antagonist (e.g., a small molecule inhibitor (e.g., ARC-1905; Opthotech) or an anti-C5 antibody (e.g., LFG-316; Novartis), a properdin antagonist (e.g., an anti-properdin antibody, e.g., CLG-561; Alcon), or a complement factor D antagonist (e.g., an anti-complement factor D antibody, e.g., lampalizumab; Roche)); a C3 blocking peptide (e.g., APL-2, Appellis); a visual cycle modifier (e.g., emixustat hydrochloride); squalamine (e.g., OHR-102; Ohr Pharmaceutical); vitamin and mineral supplements (e.g., those described in the Age-Related Eye Disease Study 1 (AREDS1; zinc and/or antioxidants) and Study 2 (AREDS2; zinc, antioxidants, lutein, zeaxanthin, and/or omega-3 fatty acids)); a cell-based therapy, for example, NT-501 (Renexus); PH-05206388 (Pfizer), huCNS-SC cell transplantation (StemCells), CNTO-2476 (umbilical cord stem cell line; Janssen), OpRegen (suspension of RPE cells; Cell Cure Neurosciences), or MA09-hRPE cell transplantation (Ocata Therapeutics); a tissue factor antagonist (e.g., hl-con1; Iconic Therapeutics); an alpha-adrenergic receptor agonist (e.g., brimonidine tartrate; Allergan); a peptide vaccine (e.g., S-646240; Shionogi); an amyloid beta antagonist (e.g., an anti-beta amyloid monoclonal antibody, e.g., GSK-933776); an S1P antagonist (e.g., an anti-S1P antibody, e.g., iSONEP™; Lpath Inc); a ROBO4 antagonist (e.g., an anti-ROBO4 antibody, e.g., DS-7080a; Daiichi Sankyo); a lentiviral vector expressing endostatin and angiostatin (e.g., RetinoStat); and any combination thereof. In some instances, AMD therapeutic agents (including any of the preceding AMD therapeutic agents) can be co-formulated. For example, the anti-PDGFR antibody REGN2176-3 can be co-formulated with aflibercept (EYLEA®). In some instances, such a co-formulation can be administered in combination with an antibody of the invention. In some instances, the ocular disorder is AMD (e.g., wet AMD).
An antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with LUCENTIS® (ranibizumab) for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA). In some instances, the ocular disorder is AMD (e.g., wet AMD). In some instances, the ocular disorder is GA.
An antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with EYLEA® (aflibercept) for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA). In some instances, the ocular disorder is AMD (e.g., wet AMD). In some instances, the ocular disorder is GA.
An antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with MACUGEN® (pegaptanib sodium) for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA). In some instances, the ocular disorder is AMD (e.g., wet AMD). In some instances, the ocular disorder is GA.
An antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with VISUDYNE® (verteporfin) in combination with photodynamic therapy for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA). In some instances, the ocular disorder is AMD (e.g., wet AMD). In some instances, the ocular disorder is GA.
An antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with a PDGF antagonist for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA). Exemplary PDGF antagonists which may be used in combination with an antibody of the invention include an anti-PDGF antibody, an anti-PDGFR antibody, a small molecule inhibitor (e.g., squalamine), an anti-PDGF-B pegylated aptamer such as FOVISTA® (E10030; Ophthotech/Novartis), or a dual PDGF/VEGF antagonist (e.g., a small molecule inhibitor (e.g., DE-120 (Santen) or X-82 (TyrogeneX)) or a bispecific anti-PDGF/anti-VEGF antibody). For example, FOVISTA® can be administered as an adjunct therapy to an antibody of the invention. OHR-102 can be administered in combination with VEGF antagonists such as LUCENTIS® or EYLEA®. In some embodiments, an antibody of the invention can be administered in combination with OHR-102, LUCENTIS®, and/or EYLEA®. In some instances, the ocular disorder is AMD (e.g., wet AMD). In some instances, the ocular disorder is GA.
An antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with RTH-258 for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA). RTH-258 can be administered, for example, by intravitreal injection or eye infusion. In some instances, the ocular disorder is AMD (e.g., wet AMD). In some instances, the ocular disorder is GA.
An antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with RTH-258 for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA). RTH-258 can be administered, for example, by intravitreal injection or eye infusion. In some instances, the ocular disorder is AMD (e.g., wet AMD). In some instances, the ocular disorder is GA.
An antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with abicipar pegol for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA). In some instances, the ocular disorder is AMD (e.g., wet AMD). In some instances, the ocular disorder is GA.
Any suitable DME and/or DR therapeutic agent can be administered in combination with an antibody of the invention, and/or polymeric formulation thereof, for treatment of an ocular disorder (e.g., AMD, DME, DR, RVO, or GA), including, but not limited, to a VEGF antagonist (e.g., LUCENTIS® or EYLEA®), a corticosteroid (e.g., a corticosteroid implant (e.g., OZURDEX® (dexamethasone intravitreal implant) or ILUVIEN® (fluocinolone acetonide intravitreal implant)) or a corticosteroid formulated for administration by intravitreal injection (e.g., triamcinolone acetonide)), or combinations thereof. In some instances, the ocular disorder is DME and/or DR.
An antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with LUCENTIS® (ranibizumab) for treatment of DME and/or DR (e.g., NPDR or PDR).
An antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with EYLEA® (aflibercept) for treatment of DME and/or DR (e.g., NPDR or PDR).
An antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with OZURDEX® (dexamethasone intravitreal implant) for treatment of DME and/or DR.
An antibody of the invention, and/or polymeric formulation thereof, can be administered in combination with ILUVIEN® (dexamethasone intravitreal implant) for treatment of DME and/or DR.
In some cases, the TAO/PRN treatment regimen or TAE treatment regimen may be used to administer an AMD therapeutic agent (e.g., ranibizumab or aflibercept) in combination with an antibody of the invention, and/or polymeric formulation thereof. In some instances, the ocular disorder is AMD (e.g., wet AMD). In some instances, the ocular disorder is GA.
Such combination therapies noted above encompass combined administration (where two or more therapeutic agents are included in the same or separate formulations), and separate administration, in which case, administration of the antibody of the invention can occur prior to, simultaneously, and/or following, administration of the additional therapeutic agent or agents. In one embodiment, administration of the anti-IL33 antibody, or polymeric formulation and administration of an additional therapeutic agent occur within about one, two, three, four, or five months, or within about one, two or three weeks, or within about one, two, three, four, five, or six days, of each other.
In other examples, an anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein) may be co-administered with an anti-IL-13 antibody, e.g., for the treatment of an inflammatory disorder, such as, for example, asthma, airway hyperresponsiveness, airway inflammation, sepsis, septic shock, atopic dermatitis, allergic rhinitis, rheumatoid arthritis, or chronic obstructive pulmonary disease (COPD), or a fibrotic disorder, such as, for example, idiopathic pulmonary fibrosis (IPF). In an exemplary embodiment, anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein) may be co-administered with an anti-IL-13 antibody for treatment of asthma.
Any of the anti-IL-33 antibodies described herein may be administered in combination with an additional IL-33 axis binding antagonist. In some instances, the additional IL-33 axis binding antagonist is anti-IL-33 antibody such as ANB-020 (AnaptyxBio Inc.) or any of the antibodies described in WO2014164959, EP1725261, U.S. Pat. No. 8,187,569, WO2011031600, WO2015099175 or WO2015106080 (which are each incorporated herein by reference in their entirety); an anti-ST2 antibody such as AMG-282 (Amgen) or STLM15 (Janssen), or any of the antibodies described in WO2013173761 or WO2013165894 (which are each incorporated herein by reference in their entirety); or a ST2-Fc protein and variants thereof such as those described in WO 2013/173761, WO 2013/165894, or WO 2014/152195 (which are each incorporated herein by reference in their entirety).
In another example, an anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein) may be co-administered with a complement pathway inhibitor. In some instances, a complement pathway inhibitor may be an inhibitor of the alternative complement pathway (e.g., Factor D, properdin, Factor B, Factor Ba, and Factor Bb) or the classical complement pathway (e.g., C3a, C5, C5a, C5b, C6, C7, C8, C9, and C5b-9). In some instances, the complement pathway inhibitor may be any complement pathway inhibitor described in WO 2007/056227, which is incorporated herein by reference in its entirety. In some instances, the complement pathway inhibitor may be a Factor D binding antagonist. In particular instances, a Factor D binding antagonist may an anti-Factor D antibody or an antigen-binding fragment thereof, for example, any Factor D antibody described in WO 2007/056227, WO 01/70818, and/or US 2002/0081293, which are each incorporated herein by reference in their entirety. As a non-limiting example, in some instances, the anti-Factor D antibody may comprise an amino acid sequence having at least 70% sequence identity (e.g., 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, the monoclonal antibody 166-32 produced from the hybridoma deposited with the American Type Culture Collection (ATCC) and designated HB12476. In some instances, the anti-Factor D antibody is a humanized derivative of monoclonal antibody 166-32. In some embodiments, the anti-Factor D antibody binds to the same epitope as monoclonal antibody 166-32. In some instances, the anti-Factor D antibody is an antibody fragment derived from monoclonal antibody 166-32. In some instances, the antibody fragment derived from monoclonal antibody 166-32 is an Fab, Fab′-SH, Fv, scFv, or an (Fab′)2 fragment. In some embodiments, the antibody fragment derived from monoclonal antibody 166-32 is an Fab.
In another example, an anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein) may be co-administered with an HtrA1 binding antagonist. In some instances, the HtrA1 binding antagonist may be an anti-HtrA1 antibody or an antigen-binding fragment thereof. Any of the anti-HtrA1 antibodies or antigen-binding fragments thereof known in the art and/or described herein may be used. For example, in some instances, the anti-HtrA1 antibody is an anti-HtrA1 antibody described in U.S. Ser. No. 10/421,822 or U.S. Pat. No. 9,738,727. In some instances, the anti-HtrA1 antibody fragment is an Fab, Fab′-SH, Fv, scFv, or an (Fab′)2 fragment. In some embodiments, the anti-HtrA1 antibody fragment is an Fab.
In another example, an anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein) may be co-administered with a VEGF antagonist. In some instances, the VEGF antagonist may be an anti-VEGF antibody or an antigen-binding fragment thereof. Any of the anti-VEGF antibodies or antigen-binding fragments thereof known in the art and/or described herein may be used. For example, in some instances, the anti-VEGF antibody is bevacizumab (AVASTIN®) or ranibizumab (LUCENTIS®). In some instances, the anti-VEGF antibody fragment is an Fab, Fab′-SH, Fv, scFv, or an (Fab′)2 fragment. In some embodiments, the anti-VEGF antibody fragment is an Fab.
In some instances, the anti-VEGF antibody or antigen-binding fragment thereof is or is derived from any anti-VEGF antibody described in WO 2005/044853, which is incorporated herein by reference in its entirety. For example, in some instances, the anti-VEGF antibody is or is derived from a G6 series antibody (e.g., G6, G6-8, G6-23, G6-23.1, G6-23.2, or G6-31) or a B20 series antibody (e.g., B20, B20-4, or B20-4.1). In some embodiments, the anti-VEGF antibody is a humanized derivative of any of the preceding antibodies. In some embodiments, the anti-VEGF antibody is an antibody fragment derived from any of the preceding antibodies. In some embodiments, the antibody fragment is an Fab, Fab′-SH, Fv, scFv, or an (Fab′)2 fragment. In some embodiments, the antibody fragment is an Fab.
In another aspect, the invention provides a method of treating geographic atrophy in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of an anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein) and a therapeutically effective amount of a Factor D binding antagonist. In some instances, the Factor D binding antagonist may be an anti-Factor D antibody or an antigen-binding fragment thereof, for example, any Factor D antibody described in WO 2007/056227, WO 01/70818, and/or US 2002/0081293. For example, in some instances, the anti-Factor D antibody may comprise an amino acid sequence having at least 70% sequence identity (e.g., 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity) to, or the sequence of, the monoclonal antibody 166-32 produced from the hybridoma deposited with the American Type Culture Collection (ATCC) and designated HB12476. In some instances, the anti-Factor D antibody is a humanized derivative of monoclonal antibody 166-32. In some embodiments, the anti-Factor D antibody binds to the same epitope as monoclonal antibody 166-32. In some instances, the anti-Factor D antibody is an antibody fragment derived from monoclonal antibody 166-32. In some instances, the antibody fragment derived from monoclonal antibody 166-32 is an Fab, Fab′-SH, Fv, scFv, or an (Fab′)2 fragment. In some embodiments, the antibody fragment derived from monoclonal antibody 166-32 is an Fab.
In another aspect, the invention provides a method of treating GA, AMD (wet or dry), DR, PCV, or ROP in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of an anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein) and a therapeutically effective amount of a HtrA1 binding antagonist. In some instances, the HtrA1 binding antagonist may be an anti-HtrA1 antibody or an antigen-binding fragment thereof, for example, any HtrA1 antibody described in U.S. Ser. No. 10/421,822 or U.S. Pat. No. 9,738,727. In some instances, the anti-HtrA1 antibody is an antibody fragment. In some instances, the antibody fragment is an Fab, Fab′-SH, Fv, scFv, or an (Fab′)2 fragment. In some embodiments, the antibody fragment derived is an Fab.
In some embodiments, an additional therapeutic agent is an asthma therapy, as described below. Moderate asthma is currently treated with a daily inhaled anti-inflammatory-corticosteroid or mast cell inhibitor such as cromolyn sodium or nedocromil plus an inhaled beta2-agonist as needed (3-4 times per day) to relieve breakthrough symptoms or allergen- or exercise-induced asthma. Exemplary inhaled corticosteroids include QVAR®, PULMICORT®, SYMBICORT®, AEROBID®, FLOVENT®, FLONASE®, ADVAIR®, and AZMACORT®. Additional asthma therapies include long acting bronchial dilators (LABD). In certain embodiments, the LABD is a long-acting beta-2 agonist (LABA), leukotriene receptor antagonist (LTRA), long-acting muscarinic antagonist (LAMA), theophylline, or oral corticosteroids (OCS). Exemplary LABDs include SYMBICORT®, ADVAIR®, BROVANA®, FORADIL®, PERFOROMIST™ and SEREVENT®.
Such combination therapies noted above encompass combined administration (where two or more therapeutic agents are included in the same or separate formulations), and separate administration, in which case, administration of the antibody disclosed herein can occur prior to, simultaneously, and/or following, administration of the additional therapeutic agent or agents. In one embodiment, administration of the anti-IL-33 antibody and administration of an additional therapeutic agent occur within about one month, or within about one, two or three weeks, or within about one, two, three, four, five, or six days, of each other. Antibodies disclosed herein can also be used in combination with radiation therapy.
An anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein) (and any additional therapeutic agent) can be administered by any suitable means, including parenteral, intrapulmonary, and intranasal, and, if desired for local treatment, intralesional administration. Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration. In some instances, an anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein) may be administered intravitreally, intramuscularly, intravenously, intradermally, percutaneously, intraarterially, intraperitoneally, intralesionally, intracranially, intraarticularly, intraprostatically, intrapleurally, intratracheally, intrathecally, intranasally, intravaginally, intrarectally, topically, intratumorally, peritoneally, subcutaneously, subconjunctivally, intravesicularly, mucosally, intrapericardially, intraumbilically, intraocularly, intraorbitally, orally, topically, transdermally, periocularly, conjunctivally, subtenonly, intracamerally, subretinally, retrobulbarly, intracanalicularly, by inhalation, by injection, by implantation, by infusion, by continuous infusion, by localized perfusion bathing target cells directly, by catheter, by lavage, in cremes, or in lipid compositions. The compositions utilized in the methods described herein can also be administered systemically or locally. Dosing can be by any suitable route, for example, by injections, such as intravenous or subcutaneous injections, depending in part on whether the administration is brief or chronic. Various dosing schedules including but not limited to single or multiple administrations over various time-points, bolus administration, and pulse infusion are contemplated herein.
In some instances, an anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein) may be administered directly to the eye by ocular tissue injection, for example, using intravitreal, intraocular, periocular, conjunctival, subconjunctival, subtenon, intracameral, subretinal, retrobulbar, or intracanalicular injections; by direct application to the eye, for example, using a catheter or other placement device (e.g., a retinal pellet, intraocular insert, suppository or an implant comprising a porous, non-porous, or gelatinous material); by topical ocular drops or ointments; or by a slow-release device in the cul-de-sac or implanted adjacent to the sclera (transscleral) or in the sclera (intrascleral) or within the eye. Intracameral injection may be through the cornea into the anterior chamber to allow the agent to reach the trabecular meshwork. Intracanalicular injection may be into the venous collector channels draining Schlemm's canal or into Schlemm's canal.
Antibodies disclosed herein would be formulated, dosed, and administered in a fashion consistent with good medical practice. Factors for consideration in this context include the particular disorder being treated, the particular mammal being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the agent, the method of administration, the scheduling of administration, and other factors known to medical practitioners. The antibody need not be, but is optionally formulated with one or more agents currently used to prevent or treat the disorder in question. The effective amount of such other agents depends on the amount of antibody present in the formulation, the type of disorder or treatment, and other factors discussed above. These are generally used in the same dosages and with administration routes as described herein, or about from 1 to 99% of the dosages described herein, or in any dosage and by any route that is empirically/clinically determined to be appropriate.
For the prevention or treatment of disease, the appropriate dosage of an antibody disclosed herein (when used alone or in combination with one or more other additional therapeutic agents) will depend on the type of disease to be treated, the type of antibody, the severity and course of the disease, whether the antibody is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the antibody, and the discretion of the attending physician. The antibody is suitably administered to the patient at one time or over a series of treatments. Depending on the type and severity of the disease, about 1 μg/kg to 15 mg/kg (e.g., 0.1 mg/kg to 10 mg/kg) of antibody can be an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion. One typical daily dosage might range from about 1 μg/kg to 100 mg/kg or more, depending on the factors mentioned above. For repeated administrations over several days or longer, depending on the condition, the treatment would generally be sustained until a desired suppression of disease symptoms occurs. One exemplary dosage of the antibody would be in the range from about 0.05 mg/kg to about 10 mg/kg. Thus, one or more doses of about 0.5 mg/kg, 2.0 mg/kg, 4.0 mg/kg or 10 mg/kg (or any combination thereof) may be administered to the patient. Such doses may be administered intermittently, e.g. every week, every two weeks, every three weeks, or every four weeks (e.g., such that the patient receives from about two to about twenty, or e.g., about six doses of the antibody). For example, a dose may be administered once per month, (e.g., by subcutaneous injection). An initial higher loading dose, followed by one or more lower doses may be administered. However, other dosage regimens may be useful. The progress of this therapy is easily monitored by conventional techniques and assays.
It is understood that any of the above formulations or therapeutic methods may be carried out using an immunoconjugate disclosed herein in place of or in addition to an anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein).
H. Articles of Manufacture
In another aspect, an article of manufacture containing materials useful for the treatment, prevention and/or diagnosis of the disorders described above is provided. The article of manufacture may include an anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein). The article of manufacture comprises a container and a label or package insert on or associated with the container. Suitable containers include, for example, bottles, vials, syringes, IV solution bags, etc. The containers may be formed from a variety of materials such as glass or plastic. The container holds a composition which is by itself or combined with another composition effective for treating, preventing and/or diagnosing the condition and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). At least one active agent in the composition is an antibody disclosed herein. The label or package insert indicates that the composition is used for treating the condition of choice. Moreover, the article of manufacture may comprise (a) a first container with a composition contained therein, wherein the composition comprises an antibody disclosed herein; and (b) a second container with a composition contained therein, wherein the composition comprises a further cytotoxic or otherwise therapeutic agent. The article of manufacture in this embodiment disclosed herein may further comprise a package insert indicating that the compositions can be used to treat a particular condition. Alternatively, or additionally, the article of manufacture may further comprise a second (or third) container comprising a pharmaceutically acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
It is understood that any of the above articles of manufacture may include an immunoconjugate disclosed herein in place of or in addition to an anti-IL-33 antibody (e.g., any anti-IL-33 antibody disclosed herein).
III. EXAMPLES
The following are examples of methods and compositions of the invention. It is understood that various other embodiments may be practiced, given the general description provided above.
Example 1: Development and Characterization of Rat Anti-Human IL-33 Hybridoma Antibody 1E1
Sprague Dawley rats (Charles River, Hollister, Calif.) were immunized with 100 ag/animal for the first dose and 50 μg/animal for rest of the boosts with human IL-33 divided among sites: intraperitoneal (i.p.), subcutaneous (s.c.) at base of tail, s.c. at nape of neck, and s.c. in both hocks, with Toll-like receptor cocktail adjuvant including monophosphoryl lipid A (MPL) (Sigma-Aldrich, St. Louis, Mo.), polyinosinic:polycytidylic acid (Poly (I:C)), R848, and CpG oligodexoxynucleotide (CpG) (InvivoGen, San Diego, Calif.) for the first dose. Multiple lymph nodes were harvested from each rat two days after the last immunization and pooled. The lymphocytes were enriched for B cells using biotinylated anti-rat CD4 (Clone OX-35), biotinylated anti-rat CD8a (Clone OX-8), biotinylated anti-rat 11 b/c (Clone OX42), biotinylated anti-rat CD161 (Clone 10/78), and biotinylated anti-rat granulocyte marker (Clone HIS48) antibodies (BD Biosciences), followed by magnetic separation (Miltenyi Biotec, San Diego, Calif.) using streptavidin beads. The B cells were further enriched by using anti-rat IgM (Clone G53-238, BD Biosciences) and followed by magnetic separation (Miltenyi Biotec, San Diego, Calif.) using streptavidin beads. IgM depleted B-cells were fused with Sp2ab mouse myeloma cells (Abeome, Athens, Ga.) via electrofusion (Harvard Apparatus, Holliston, Mass.). Fused cells were incubated at 37° C., 7% CO2, overnight in CLONACELL™-HY Medium C (StemCell Technologies, Vancouver, BC, Canada), before centrifugation and resuspension in CLONACELL™-HY Medium E (StemCell Technologies) supplemented with hypoxanthine and thymidine (HAT) (Sigma-Aldrich) and plating into 6-well plates and incubation to allow growth at 37° C., 7% CO2. Four days after plating, hybridomas were stained with anti-rat IgG (goat polyclonal, Jackson ImmunoResearch) conjugated to ALEXA FLUOR® 488 dye, cynomolgus monkey (cyno) IL-33 conjugated to ALEXA FLUOR® 643 dye (Novus Biological) and human IL-33 conjugated to phycoerythrin (PE) (Novus Biological) and sorted for IgG+/human IL-33+ cells/cyno IL-33+ hybridoma cells using a FACSARIA™ III sorter (BD, Franklin Lakes, N.J.). These cells were individually deposited into 96-well plates containing CLONACELL™-HY Medium E (StemCell Technologies). After culturing the cells for 7 days, supernatant was screened by enzyme-linked immunosorbent assay (ELISA) against IL-33. IgG+ hybridomas demonstrating binding to human IL-33 and cyno IL-33 by ELISA were scaled-up and supernatants were harvested and purified by protein G (GAMMABIND™ Plus, GE Healthcare, Pittsburgh, Pa.) for functional testing and further characterization.
Rat hybridoma derived anti-IL-33 antibodies of interest were cloned using standard molecular cloning techniques. Clones were formatted into human IgG vectors for transient expression in CHO cells using standard protocols and purified using MABSELECT SURE™ (GE).
Example 2: ELISA Screening for Anti-Human/Cyno IL-33 Antibodies
Hybridoma clones generated as described above were tested for binding to human IL-33 in an ELISA format. 384 well NUNC MAXISORB® plates (Thermo Scientific Nunc 384-well MAXISORB®, Cat. No. 464718) were coated with 50 μl of IL-33 at 1 μg/ml in coating buffer (50 mM carbonate, pH 9.6) overnight at 4° C. Plates were then blocked with ELISA diluent buffer (100 μl/well for 1 h). Hybridoma supernatants or purified hybridoma antibody diluted in ELISA diluent buffer were added to blocked plates (50 μl/well) and allowed to incubate at room temperature for 30 min. Plates were washed 3 times with wash buffer (phosphate-buffered saline (PBS), 0.05 % TWEEN® 20, 20× stock HYCLONE™ SH3A649-01) before adding secondary antibody, goat-anti-rat IgG-HRP (Bethyl A110-236P, diluted 1:5000). Following a 30 min incubation, plates were washed again three times with wash buffer before being developed with BIOFX™ 3,3′,5,5′-tetramethylbenzidine (TMB) substrate (TMBW-1000-01) for 5 min. Reactions were stopped using BIOFX™ Stop reagent (LBSP-1000-01). Plates were read at 650 nm for absorbance.
Example 3: Cell-Based IL-33 Neutralization Assay
The IL-33 neutralization activity of anti-IL-33 antibodies as obtained from methods described above were determined by a cell-based assay. HEK-BLUE™ IL-33 cells (InvivoGen, Cat. No. hkb-hlL-33) were grown and treated according to manufacturer's supplied protocol. Serial dilutions of anti-IL-33 purified hybridoma antibodies were preincubated for 1 h at 37° C. with human IL-33 (160 pM), cyno IL-33 (300 pM) or mutant human IL-33 (14 pM) in test medium. Premixed antibody and IL-33 was added to the cells and incubated at 37° C. in a CO2 incubator for 20-24 h. QUANTI-BLUE™ alkaline phosphatase detection medium (Invivogen, Cat. No. rep-qb2) was prepared according to manufacturer's protocol. QUANTI-BLUE™ (40 μl) was added to a flat9 bottom 384 well plate (Thermo Scientific NUNC™ 384-well MAXISORB™, Cat. No. 464718) and 10 μl of cell supernatant was added. After 1 h incubation at 37° C., secreted embryonic alkaline phosphatase (SEAP) levels were determined using a spectrophotometer at 620-655 nm. IC50 values generated by GENEDATA SCREENER® software are shown in Table 1 below. The amino acid sequences of the heavy chain variable region and light chain variable region of 1E1 are shown in FIGS. 1A and 1B, respectively.
TABLE 1
IL-33 neutralization activity of
hybridoma derived clone 1E1
IC50 (M)
Human IL-33 3.6E−11
Cyno IL-33 1.6E−10
Example 4: Characterization of Anti-IL-33 Hybridoma-Derived Clones by Surface Plasmon Resonance (SPR)
An array-based SPR imaging system (CFM/IBIS, CARTERRA® USA) was used to analyze binding kinetics and epitope bin a panel of anti-IL-33 monoclonal antibodies. Purified hybridoma antibodies were diluted at 10 μg/mi in 10 mM sodium acetate buffer pH 4.5. Using amine coupling, antibodies were directly immobilized onto a SPR sensorprism CMD 200M chip (XanTec Bioanalytics, Germany) using a Continuous Flow Microspotter (CARTERRA®, USA) to create an array of antibodies. For both kinetics and binning experiments, the IBIS MX96 SPR imager (SPRi) (CARTERRA®, USA) was used to evaluate binding to the immobilized antibodies and the experiments were performed at 25° C. in a running buffer of 10 mM 4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid (HEPES), pH 7.4, 150 mM NaCl, 3 mM EDTA, and 0.005% TWEEN®20 (HBS-TE). For kinetics analysis, IL-33 was injected for a time of 3 min and allowed to disassociate for a time of 10 min. The surface was regenerated between cycles with 10 mM glycine pH 1.7. Concentration series starting at 300 nM with a 1:3 dilution of human, cyno, rat, murine and oxidized human IL-33 were used for the study. The binding data was processed using Scrubber (BioLogic Software). For antibody binning, human IL-33 was first injected for 4 min at 100 nM and was followed by a second 4 min injection of purified antibody at 10 μg/mi in a running buffer of HBS-TE. The surface was regenerated between cycles with 10 mM glycine pH 1.7. The binding data was processed using Epitope Binning software tool (CARTERRA®, USA).
The binding kinetics of top anti-IL-33 antibodies were measured using SPR on a BIACORE® T200 instrument (GE Healthcare). A CM5 Series S sensorchip was coated with anti-rat Fc (Jackson) to create a capture surface. Antibody binding was measured to human, cyno, rat, mouse and oxidized IL-33 (His-tagged) using a concentration series starting with 50 nM with 1:3 dilutions. Sensorgrams for binding of cytokine were recorded using an injection time of 2 min with a flow rate of 30 μl/min, at a temperature of 25° C., and with a running buffer of 10 mM HEPES, pH 7.4, 150 mM NaCl, 3 mM EDTA, and 0.005% TWEEN®20. After injection, disassociation of the IL-33 from the antibody was monitored for 10 min in running buffer. The surface was regenerated between binding cycles with a 30μ injection of 10 mM glycine HCl pH 1.7. After subtraction of a blank which contained running buffer only, sensorgrams observed for cytokine binding to anti-IL-33 antibody were analyzed using a 1:1 Langmuir binding model with software supplied by the manufacturer to calculate the kinetics and binding constants. Kinetic constants from clone 1E1 are provided in Table 2 below.
TABLE 2
Kinetic constants for clone 1E1 binding to different forms of IL-33
ka (1/Ms) kd (1/s) KD (M)
Human IL-33 1.08E6 2.28E−5  2.1E−11
Cyno IL-33 0.57E6 2.24E−5 3.92E−11
Rat IL-33 0.14E6 2.19E−4 1.6E−9
Mouse IL-33 5.68E4 2.13E−3 37.4E−9 
Oxidized No binding
Human IL-33
Example 5: Humanization of Anti-IL-33 Antibodies
Humanization variants were generated by grafting the light chain and heavy chain CDRs from rat anti-IL-33 clone 1E1 into the closest matching human frameworks. Residues at Vernier positions were allowed to toggle between rat and human. A matrix of light chain and heavy chain variants in a human IgG1 backbone were transiently expressed small scale in EXPI293F™ cells and purified using MABSELECT SURE™ antibody purification resin (GE). Variants 1E1v1-1E1v23 (see Table 3 below) were analyzed for binding to cytokine and functional activity. The amino acid sequences of the heavy chain variable region and light chain variable region of these variants are shown in FIGS. 2A and 2B, respectively.
Example 6: Characterization of Humanized Anti-IL-33 Antibodies
A protein A sensorchip (GE Healthcare) was used following manufacturer provided protocols to capture humanized anti-IL-33 antibodies using a BIACORE® T200 instrument (GE). Antibody binding was measured to human IL-33 (His-tagged) using multi-cycle kinetics. Sensorgrams for binding of IL-33 were recorded using an injection time of 2 min with a flow rate of 30 μl/min, at a temperature of 25° C., and with a running buffer of 10 mM HEPES, pH 7.4, 150 mM NaCl, 3 mM EDTA, and 0.005% TWEEN620. After injection, disassociation of IL-33 from the antibody was monitored for 10 min in running buffer. The surface was regenerated between binding cycles with a 30 μl injection of 10 mM Glycine HCl pH 1.5. After subtraction of a blank which contained running buffer only, sensorgrams observed for cytokine binding to anti-IL-33 antibody were analyzed using a 1:1 Langmuir binding model with software supplied by the manufacturer to calculate the kinetics and binding constants. Kinetic constants from these data (n=2) are provided in Table 3 below.
The IL-33 neutralization activity of selected anti-IL-33 1E1 humanization variants were determined by a HEK-BLUE™ IL-33 cell-based assay (InvivoGen, Cat. No. hkb-hlL-33). The assay was performed as described above using human IL-33 (160 pM). IC50 values generated by GENEDATA SCREENER® software are shown in Table 3 below.
TABLE 3
Kinetic constants and neutralization activity for 1E1 variants
KD (nM) IC50 (M)
ch1E1 1.485E−10 ± 0.02 2.90E−11
1E1v1 2.955E−10 ± 0.12
1E1v2 2.025E−10 ± 0.26
1E1v3  1.49E−10 ± 0.14
1E1v4  1.54E−10 ± 0.17 3.11E−11
1E1v5  1.44E−10 ± 0.18
1E1v6  1.32E−10 ± 0.18
1E1v7 1.445E−10 ± 0.15
1E1v8 1.185E−10 ± 0.18 3.11E−11
1E1v9  1.29E−10 ± 0.14 3.05E−11
1E1v10  1.21E−10 ± 0.14
1E1v11  1.23E−10 ± 0.13
1E1v12 1.625E−10 ± 0.21 2.44E−11
1E1v13 1.395E−10 ± 0.23 2.98E−11
1E1v14  1.63E−10 ± 0.31
1E1v15  1.95E−10 ± 0.23
1E1v16  1.79E−10 ± 0.20
1E1v17 2.855E−10 ± 0.43
1E1v18 1.725E−10 ± 0.06
1E1v19 1.315E−10 ± 0.16 3.19E−11
1E1v20 1.275E−10 ± 0.05 3.44E−11
1E1v21 1.555E−10 ± 0.22 3.10E−11
1E1v22 1.465E−10 ± 0.16
1E1v23  1.51E−10 ± 0.13
The 1E1v8 variant was reformatted into a human IgG1 Fab construct and expressed in E. coli. Bacteria were lysed following expression and Fab was purified using GAMMABIND™ Plus sepharose (GE) following standard methods. A secondary purification step was performed using a HITRAP® sepharose high performance (SP HP) column (GE) to obtain final protein.
Example 7: Characterization of Anti-IL-33 1E1v8 Fab by SPR
The binding kinetics of the 1E1v8 Fab were measured using SPR on a BIACORE® 8k instrument (GE Healthcare). 1E1v8 Fab was directly immobilized on 4 different flow cells of a CM5 Series S sensorchip at low density using amine coupling. Antibody fragment binding was measured to human and cyno IL-33 (His-tagged) using a concentration series starting with 50 nM with 1:3 dilutions. Sensorgrams for binding of IL-33 were recorded using an injection time of 2 min with a flow rate of 100 μl/min, at a temperature of 25° C. or 35° C., and with a running buffer of 10 mM HEPES, pH 7.4, 150 mM NaCl, 3 mM EDTA, and 0.005% TWEEN®20. After injection, disassociation of the IL-33 from the antibody was monitored for 30 min in running buffer. The surface was regenerated between binding cycles with a 30 μl injection of 10 mM glycine HCl pH 1.7. After subtraction of a blank which contained running buffer only, sensorgrams observed for cytokine binding to anti-IL-33 antibody were analyzed using a 1:1 Langmuir binding model with software supplied by the manufacturer to calculate the kinetics and binding constants. Kinetic constants from these data are provided in Table 4 below.
TABLE 4
Kinetic constants for 1E1v8 human Fab binding to human and cyno IL-33
Temperature
Cytokine (° C.) ka (1/Ms) kd (1/s) KD (M)
Human IL- 25 6.84E+05 ± 9.99E−06 ± 1.47E−11 ±
33 0.34 1.25 0.25
Human IL- 35 8.58E+05 ± 1.26E−05 ± 1.48E−11 ±
33 0.80 0.17 0.28
Cyno IL-33 25 3.54E+05 ± 7.85E−06 ± 2.23E−11 ±
0.22 0.34 0.22
Cyno IL-33 35 5.27E+05 ± 1.82E−05 ± 3.45E−11 ±
0.22 0.34 0.22
Example 8: Molecular Assessment of 1E1v8 (and 10C12)
Molecular assessment (MA) analysis was performed on 1E1v8 (Fab) for stability properties. Briefly, the 1E1v8 Fab was tested for stress under chemical conditions with AAPH (2,2-azobis(2-amidinopropane) dihydrochloride), a small molecule known to generate free radicals (see, e.g., Ji et al., J. Pharm. Sci. 98(12):4485-4500, 2009), as well as under thermal conditions at varying pH (a two-week thermal stress test at 40° C., pH 5.5) (see, e.g., Zhang et al., J. Chromatography A 1272:56-64, 2013). Additional details regarding the MA stress conditions and analysis for these experiments are described below in the materials and methods section.
Table 5 shows results of MA analysis for 1E1v8 Fab.
TABLE 5
MA Properties of 1E1v8 Fab
Stress 1E1v8 Fab
Thermal D56G57 in CDR-L2 is stable (no change in isomerization
Stress (Low was observed (1.9% in t = 0 and 1.9% in t = 2 wk))
Con His- N30N31 in CDR-H1 is stable (no change in deamidation
Acetate, pH was observed (0.1% in t = 0 and 0.1% in t = 2 wk))
5.5) N31Y32 in CDR-H1 is stable (no observable deamidation
at t = 2 wk)
D61S62 in CDR-H2 is stable (no change in isomerization
was observed (0.9% in t = 0 and 0.9% in t = 2 wk))
N96Y97 in CDR-H3 is stable (no observable deamidation
at t = 2 wk)
N100T100a in CDR-H3 is stable (no observable
deamidation at t = 2 wk)
AAPH M34 in CDR-H1 is stable
Stress (20 W33 in CDR-H1 is stable
mM His (−2.3% decrease in M34 and W33 oxidation was observed
acetate pH (7.6% in control and 5.3% in AAPH stressed)
5.5)
Size Monomer loss (0.8%) is acceptable (loss of monomer is
likely buffer related)
Charge Main peak loss (9.4%) is acceptable
LC/MS Masses are as expected with no change upon stress
It is noted that the prior art antibody 10C12 (10C12.38.H6.87Y.581, Fab) had similarly been analyzed for stability and shown to exhibit extensive oxidation of the CDR-H3 W100 residue as shown in Table 6. Efforts to solve the instability due to oxidation of the CDR-H3 W1100 residue by substitution of this residue with other amino acids were unsuccessful as such substitutions resulted in significantly decreases in binding to IL-33. Accordingly, a new and separate antibody generation was needed and resulted in the design and generation of the 1E1v8 Fab.
TABLE 6
MA Properties of 10C12.38.H6.87Y.581 Fab
Stress 10C12.38.H6.87Y.581 Fab
Thermal D58Y59 in CDR-H2 is stable (no change in
Stress (Low isomerization was observed
Con His- (0.1% in t = 0 and 0.1% in t = 2 wk))
Acetate, pH D61S62 in CDR-H2 is stable (no observable
5.5) isomerization)
N96Y97 in CDR-H3 is stable (no observable
deamidation)
AAPH M34 in CDR-H1 is stable (0.8% increase in oxidation
Stress (20 was observed (0.5% in control and 1.3% in
mM His AAPH stressed)
acetate pH W100 in CDR-H3 is unstable (73.4% increase in
5.5) oxidation (0.8% in control and 74.2% in
AAPH stressed)
Size Monomer loss (0.0%) is acceptable at t = 2 wk
Charge Main peak loss (0.5%) is acceptable at t = 2 wk
LC/MS Masses are as expected with no change upon stress
Materials and Methods
To test the chemical stability of CDR sequence motifs, both oxidative and accelerated thermal stress were performed. Oxidatively stressed samples were prepared by incubating 1 mM 2,2′-azobis (2-amidinopropane) dihydrochloride (AAPH) with 1.25 mg of antibody in low-ionic histidine-acetate, pH 5.5, for 16 h at 40° C. After 16 h, AAPH was quenched by adding to the solution a 20:1 excess of methionine (Met) to AAPH. Control samples were spiked with water instead of AAPH. Control and stress samples were buffer-exchanged prior to analysis. For thermal stress, antibody samples were incubated at 1 mg/mL and 150 mg/mL in low-ionic buffer, pH 5.5, for 2 weeks at 40° C. or PBS, pH 7.4, for 2 weeks at 37° C. Control samples were stored at −70° C.
Ultra-high-performance liquid chromatography-high resolution mass spectrometry (UHPLC-HRMS) analysis was performed as follows. Tryptic digests were analyzed using an ACQUITY® H-Class UHPLC (Waters) coupled to a Q EXACTIVE™ (Thermo Fisher) mass spectrometer (MS). Separation of a 10 μg injection was performed on an ACQUITY® UPLC Peptide CSH C18 column (Waters) with 1.7 μm, 130 Å particles running a flow rate of 0.2 mL/min at 77° C. Mobile phase A was water, and mobile phase B was acetonitrile, each containing 0.1% formic acid. The gradient was as follows: 2 min of 1% mobile phase B, 5 min of 1-13% mobile phase B, 35 min of 13-35% mobile phase B, 2 min of 35-95% mobile phase B, 2 min of 95% mobile phase B. MS data were collected in positive ion mode using a Top 8 data-dependent scan mode with resolution set to 35 000 for MS scans and 17 500 for MS2 scans. Dynamic exclusion was turned off, and the precursor scan range was set at 200-2000 m/z. External calibration of the instrument was conducted prior to sample analysis. Data were processed using instrument vendor software specific for biopharmaceutical characterization.
Relative quantitation of the chemical sequence motif was generated by integrating the extracted ion chromatograms of the monoisotopic m/z using the two most abundant charge states for the native tryptic peptide and its modified counterpart. The modified peptide peak area was divided by the sum of the modified and native peak areas and multiplied by 100 to obtain the percent modification for each chemical sequence motif. The percent change in deamidation of asparagine (N) residues, isomerization of aspartic acid (D) residues, and hydrolysis at asparagine-proline/aspartic acid-proline (NP/DP) bonds was measured following accelerated thermal stress in histidine-acetate and PBS buffers. The percent change in oxidation of methionine (M) and tryptophan (W) residues was measured following oxidative stress.
Example 9: Viscosity/Solubility Method
Viscosity measurements of the 1E1v8 Fab were performed on a Anton Paar Modular Compact Rheometer MCR502 using a CP20-0.3 measuring cone with a 20 mm diameter and 0.3 angle and a P-PTD 200/56/AIR lower plate with a 56 mm diameter. Samples went through shear-rate sweeps ramping from 10 to 10,000 s−1. The reported value is the average of 2-3 shear rate sweeps of a sample at 1,000 s−1 at 25° C. with increasing protein concentration ranging from 4-177 mg/ml in 20 mM histidine acetate, 150 mM NaCl, 240 mM sucrose at pH 5.5. Table 7 shows viscosity results of the 1E1v8 Fab, and Table 8 shows solubility results of the 1E1v8 Fab.
TABLE 7
Viscosity results of 1E1v8 Fab
Concentration
(mg/mL) Viscosity (cP)
0 1
108.52 3.5
154.88 3.74
180.24 4.6

The sample appeared clear; no visible particulates were observed.
TABLE 8
Solubility results of 1E1v8 Fab
Sample Turbidity (OD)
PBS pH 7.4 0.021
1E1v8 Fab 0.192
Again, the 1E1v8 Fab proved to have properties superior to those of the prior 10C12 antibody, which had lower viscosity at 188 mg/mL and had higher turbidity as compared to 1E1v8, as shown in Tables 9 and 10.
TABLE 9
Viscosity results of 10C12 Fab
Concentration Viscosity
(mg/mL) (cP)
0 1
102 1.61
155 3.16
188 5.56
TABLE 10
Solubility results of 1E1v8 Fab
Sample Turbidity (OD)
PBS pH 7.4 0.017
10C12 Fab 0.383
Example 10: Generation and Expression of Anti-IL-33 Antibodies and Fabs
Anti-IL-33 antibodies obtained from available sequences were reformatted into a human IgG1 Fab and human IgG1 constructs. The huIgG1 Fabs were expressed in E. coli. Bacteria were lysed following expression and Fab was purified using GAMMABIND® Plus Sepharose (GE) following standard methods. A secondary purification step was performed using a HITRAP® SP HP column (GE) to obtain final protein. The human IgG1s were expressed transiently in EXPI293F® cells and purified using MABSELECT SURE™ (GE).
Example 11: Antibody Binning Using SPR
An array-based SPR imaging system (CFM/IBIS, CARTERRA®, USA) was used to epitope bin a panel of anti-IL-33 monoclonal antibodies (see Table 11). Anti-IL-33 antibodies 10C12 and 4G12 are described in U.S. Pat. No. 10,093,730. Purified monoclonal antibodies were diluted at 10 μg/ml in 10 mM sodium acetate buffer pH 4.5. Using amine coupling, antibodies were directly immobilized onto a SPR sensorprism CMD 200M chip (XanTec Bioanalytics, Germany) using a Continuous Flow Microspotter (CARTERRA®, USA) to create an array of antibodies. For binning experiments, the IBIS MX96 SPRi (CARTERRA®, USA) was used to evaluate binding to the immobilized antibodies and the experiments were performed at 25′C in a running buffer of 10 mM HEPES, pH 7.4, 150 mM NaCl, 3 mM EDTA, and 0.005% TWEEN®20 (HBS-TE). For antibody binning, human IL-33 was first injected for 4 min at 100 nM and was followed by a second 4 min injection of purified antibody at 10 μg/ml in a running buffer of HBS-TE. The surface was regenerated between cycles with 10 mM glycine pH 1.7. The binding data was processed using Epitope Binning software tool (CARTERRA®, USA) and the results are shown in FIGS. 3A-3E.
Example 12: Results of Antibody Binning Using SPR
Anti-IL-33 monoclonal antibodies that were directly immobilized onto a sensorprism chip via amine coupling were binned against each other to assess overlapping epitopes. After human IL-33 was allowed to bind to the immobilized antibodies, each antibody was injected in solution one at a time to evaluate whether it was able to still bind to antigen or if it was blocked by antigen bound to the immobilized antibodies. For all antibodies, binding/binning data was collected from immobilization on the chip surface and also when injected in solution. Relationships between clones or bins of clones based on blocking activity and shown in the form of network plots and a heatmap (FIGS. 3A and 3B). Clones 1E1v8, 10C12, RG18, and 158LS all directly blocked each other and showed similar blocking activity when compared to other antibodies (FIG. 3C). Additionally, they blocked and were blocked by clones 4G12 and Ab43. Clones 4G12 and Ab43 showed different blocking activity because they also block RG3 and 3F110 (FIG. 3D). Clone 640087-7B only blocked and is blocked by clones RG3 and 3F110 (FIG. 3E).
TABLE 11
Antibody Clones used in Epitope Binning Analysis
Antibody Name HC or VH LC or VL
(reference) SEQ ID NO SEQ ID NO
1E1v8 25 26
RG18 76 77
(WO 2014/164959)
158LS 70 71
(WO 2017/187307)
Ab43 72 73
(WO 2018/081075)
RG3 74 75
(WO 2014/164959)
3F10 80 81
640087-7B 78 79
(WO 2016/156440)
Example 13: Clinical Study of Anti-IL-33
The following Phase 1a, multicenter, open label, single dose, dose escalation study investigates the ocular and systemic safety, tolerability, pharmacokinetics (PK), and immunogenicity of intravitreal (IVT) injections of anti-IL-33 antibody in patients with GA secondary to AMD.
Patients, male or female, who are at least 50 years of age, have a best corrected visual acuity (BCVA) in the range of Snellen 20/125-20/400, and have a GA lesion area of at least 0.5 disc area, inclusive, are eligible. Site investigators are qualified ophthalmologists. Only one eye may be chosen as the study eye. If both eyes are eligible, the eye with the worse vision (i.e., worse visual acuity (VA) and/or least function as determined by the investigator and patient) will be selected for the study treatment (study eye). Each patient must satisfy all eligibility criteria at both the screening and the Day 1 visit (i.e., when the patient is enrolled into the study and when study drug is administered). In addition, images taken at the screening visit (i.e., color fundus photographs, fluorescein angiogram, and spectral domain optical coherence tomography) must be received by the central reading center for evaluation by the Day 1 visit.
Eligible patients are sequentially enrolled into cohorts. Each cohort is administered at gradually ascending dose levels with 1 sentinel patient at each level to ensure only 1 active patient is dosed initially at any dose level. Use of a sentinel patient at each level is to ensure that at most, 1 active patient is dosed for the first time at any dose level. Eligible patients are dosed with the study drug on Day 1, which will occur within 28 days of screening.
This study consists of two stages: a single-ascending dose stage with 4 planned ITV doses (1 mg, 3 mg, 10 mg, and 20 mg) to evaluate single-dose safety and tolerability of anti-IL-33 antibody with 3-6 patients in each cohort and an expansion cohort stage consisting of approximately 9-12 patients (for a maximum total of 15 patients) at the maximum tolerated dose (MTD) or maximum tested dose (MTeD) to obtain a minimum of 10 evaluable patients to further characterize safety, tolerability, and pharmacokinetics; and modulation of downstream IL-33 pathway activity.
The study is divided into three periods: a screening period lasting up to 28 days, a treatment period consisting of a single day (Day 1) during which anti-IL-33 antibody is administered, and a 12 week follow up period. The duration of study for each patient is 12 weeks, excluding the screening period. The end of the study is defined as the date when the last patient, last visit (LPLV) occurs.
This study allows graded exposure to anti-IL-33 antibody with escalation to the next higher dose cohort based on safety and tolerability data for at least 3 patients from the preceding dose cohort(s) after 14 days of follow up has elapsed from the last patient in the cohort. In the last cohort (i.e., Cohort D or cohort determined to be MTD) after safety and tolerability has been assessed in at least 3 patients, an additional expansion cohort of 9-12 patients for a total of 15 patients are enrolled to obtain a minimum 10 evaluable patients for further safety, PK, and PD evaluation. Evaluable patients are defined as patients who have received study drug injection, have completed the Week 12 visit, have not taken any prohibited therapy, and have not received any surgical or interventional procedures during the study.
This study is initially conducted in approximately 24-33 patients (one study eye per patient). Up to two additional optional cohorts of 15 patients each may be added for a potential total of 63 patients enrolled in the study.
The primary objective of this study is to characterize the safety profile associated with anti-IL-33 antibody administration. Statistical summaries are descriptive in nature (e.g., incidence rates, means, and percentiles). Patients are grouped according to treatment received, and any patients who receive any amount of anti-IL-33 antibody is included in the analyses. The primary analysis is safety analyses which include all patients who receive at least 1 dose of study drug, with patients grouped according to treatment received. Ocular and non-ocular adverse events, serious adverse events, and death are summarized separately. Abnormal ocular findings, laboratory test results and vital signs are listed. DLAEs are listed and summarized by study drug dose level and frequency cohorts.
Another safety objective is to determine the maximum tolerated dose administered as a single dose on the basis of the following endpoints: (1) frequency, severity, and timing of ocular and non-ocular adverse events including dose-limiting adverse events (DLAEs), serious adverse events, adverse events leading to study discontinuation and adverse events of special interest; (2) frequency, severity, and timing of notable findings in ocular examinations and ocular imaging following anti-IL-33 antibody administration; and (3) frequency, severity, and timing of notable findings in vital signs, physical findings, and clinical laboratory results following anti-IL-33 antibody administration.
Another objective is to characterize the PK of anti-IL-33 antibodies in patients with GA secondary to AMD on the basis of the following endpoints: (1) serum concentration of anti-IL-33 at specified timepoints; and (2) aqueous humor concentration of anti-IL-33 antibodies at specified timepoints Another objective for this study is to evaluate the immune response to anti-IL-33 on the basis of the following endpoint: prevalence of anti-drug antibodies (ADAs) at baseline and incidence of ADAs during the study. The immunogenicity of anti-IL-33 antibodies will be assessed by the detection of serum ADAs.
The PK objectives for this study are to evaluate potential relationships between drug exposure and safety, and drug exposure and exploratory biomarker response following single ITV doses on the basis of the following endpoint: PK exposure (e.g., serum and/or aqueous humor anti-IL-33 antibody concentrations) and safety and/or exploratory biomarker endpoints.
The immunogenicity objective for this study is to evaluate potential effects of ADAs on the basis of the following endpoint: relationship between ADA status and safety, PK, or activity endpoints.
Other Embodiments
Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, the descriptions and examples should not be construed as limiting the scope of the invention. The disclosures of all patent and scientific literature cited herein are expressly incorporated in their entirety by reference.

Claims (27)

What is claimed is:
1. An isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising a heavy chain variable (VH) domain and a light chain variable (VL) domain, the binding domain comprising the following six complementarity-determining regions (CDRs):
(a) a CDR-H1 comprising the amino acid sequence of NYWMT (SEQ ID NO: 1);
(b) a CDR-H2 comprising the amino acid sequence of SITYTGGGTYYPDSVKG (SEQ ID NO: 2);
(c) a CDR-H3 comprising the amino acid sequence of ANYYYNTYGGFPY (SEQ ID NO: 3);
(d) a CDR-L1 comprising the amino acid sequence of LASEGFSNDLA (SEQ ID NO: 4);
(e) a CDR-L2 comprising the amino acid sequence of AASRLQD (SEQ ID NO: 5); and
(f) a CDR-L3 comprising the amino acid sequence of QQGSKYPLT (SEQ ID NO: 6).
2. The antibody of claim 1, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 7; (b) a VL domain comprising an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 8; or (c) a VH domain as in (a) and a VL domain as in (b).
3. The antibody of claim 1, wherein the VH domain comprises:
(a) an FR-H1 comprising the amino acid sequence of EVQLVX1SGX2X3X4X5X6PGX7SX8X9X10SCX11ASGFTFN (SEQ ID NO: 9), wherein X1 is E or Q; X2 is G or A; X3 is G or E; X4 is L or V; X5 is V or K; X6 is Q or K; X7 is G, A, or T; X8 is L or V; X9 is R or K; X10 is L or V; and X11 is A, K, or L;
(b) an FR-H2 comprising the amino acid sequence of WX1RQAPGX2GLEWX3X4 (SEQ ID NO: 10), wherein X1 is I or V; X2 is K or Q; X3 is V, M, or I; and X4 is A or G;
(c) an FR-H3 comprising the amino acid sequence of RX1TX2X3RDX4X5X6X7X8X9YX10X11X12X13SLRX14EDTAX15YYCTR (SEQ ID NO: 11), wherein X1 is F or V; X2 is I or M; X3 is S or T; X4 is D, N, or T; X5 is A or S; X6 is K or T; X7 is S or N; X8 is S or T; X9 is L or V; X10 is L or M; X11 is Q or E; X12 is M or L; X13 is N or S; X14 is A or S; and X15 is V or T; and
(d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
4. The antibody of claim 1, wherein the VH domain comprises:
(a) an FR-H1 comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFN (SEQ ID NO: 17);
(b) an FR-H2 comprising the amino acid sequence of WIRQAPGKGLEWVA (SEQ ID NO: 18);
(c) an FR-H3 comprising the amino acid sequence of RFTISRDDAKSSLYLQMNSLRAEDTAVYYCTR (SEQ ID NO: 19); and
(d) an FR-H4 comprising the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 12).
5. The antibody of claim 1, wherein the VH domain comprises the amino acid sequence of SEQ ID NO: 7.
6. The antibody of claim 1, wherein the VL domain comprises:
(a) an FR-L1 comprising the amino acid sequence of X1IX2X3TQSPX4X5LSX6SX7GX8X9X10X11X12X13C (SEQ ID NO: 13), wherein X1 is D or E; X2 is Q or V; X3 is M or L; X4 is S or A; X5 is S or T; X6 is A or L; X7 is V, P, or L; X8 is D or E; X9 is R or T; X10 is V or A; X11 is T or S; X12 is I or L; and X13 is T, S, or E;
(b) an FR-L2 comprising the amino acid sequence of WX1QQKX2GX3X4PX5X6LIY (SEQ ID NO: 14), wherein X1 is Y or F; X2 is P or S; X3 is K or Q; X4 is S or A; X5 is K, R, or Q; and X6 is L or S;
(c) an FR-L3 comprising the amino acid sequence of GX1PX2RFSGSGSGTX3FX4LX5ISX6X7X8PEDX9AX10YX11C (SEQ ID NO: 15), wherein X1 is V or I; X2 is S or A; X3 is D or R; X4 is T or S; X5 is T or K; X6 is S or G; X7 is L or M; X8 is Q or E; X9 is F, V, or E; X10 is T, V, or D; and X11 is F or Y; and
(d) an FR-L4 comprising the amino acid sequence of FGX1GTKX2EIK (SEQ ID NO: 16), wherein X1 is G or S and X2 is V or L.
7. The antibody of claim 1, wherein the VL domain comprises:
(a) an FR-L1 comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 21);
(b) an FR-L2 comprising the amino acid sequence of WYQQKPGKSPKLLIY (SEQ ID NO: 22);
(c) an FR-L3 comprising the amino acid sequence of GVPSRFSGSGSGTDFTLTISSLQPEDFATYFC (SEQ ID NO: 23); and
(d) an FR-L4 comprising the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 24).
8. The antibody of claim 1, wherein the VL domain comprises the amino acid sequence of SEQ ID NO: 8.
9. The antibody of claim 1, wherein the antibody comprises:
(i) a binding domain comprising (a) a VH domain comprising an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 35; (b) a VL domain comprising an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 36; or (c) a VH domain as in (a) and a VL domain as in (b);
(ii) a binding domain comprising (a) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 37 and (b) a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 38; or
(iii) a binding domain comprising (a) a VH domain comprising an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 65; (b) a VL domain comprising an amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 69; or (c) a VH domain as in (a) and a VL domain as in (b).
10. The antibody of claim 1, wherein:
(i) the antibody specifically binds both human and cynomolgus monkey (cyno) interleukin-33 (IL-33) with a KD of about 1 nM or lower;
(ii) the antibody inhibits the binding of human IL-33 to an IL-33 receptor with a 50% inhibitory concentration (IC50) of between about 800 fM and about 100 pM; or
(iii) the antibody specifically binds both human and cyno IL-33 with a KD of about 1 nM or lower and inhibits the binding of human IL-33 to an IL-33 receptor with an IC50 of between about 800 fM and about 100 pM.
11. The antibody of claim 1, wherein:
(i) the antibody has a viscosity of less than about 5 centipoise (cP) at a concentration of about 180 mg/mL in phosphate-buffered saline (PBS) pH 7.4;
(ii) the antibody has an optical density (OD) of about 0.5 or lower at a concentration of about 150 mg/mL or higher in phosphate-buffered saline (PBS) pH 7.4; or
(iii) the antibody has a viscosity of less than about 5 cP at a concentration of about 180 mg/mL and an OD of about 0.5 or lower at a concentration of about 150 mg/mL or higher in PBS pH 7.4.
12. The antibody of claim 1, wherein the antibody is monoclonal, human, humanized, or chimeric.
13. The antibody of claim 1, wherein the antibody is an antibody fragment that binds IL-33.
14. The antibody of claim 13, wherein the antibody fragment is an Fab, Fab′-SH, Fv, scFv, or (Fab′)2 fragment.
15. The antibody of claim 1, wherein the antibody is a monospecific antibody.
16. The antibody of claim 1, wherein the antibody is a multispecific antibody.
17. The antibody of claim 16, wherein the antibody is a bispecific antibody.
18. A pharmaceutical composition comprising the antibody of claim 1 and a pharmaceutically acceptable carrier, excipient, or diluent.
19. The antibody of claim 1, wherein the antibody is an Fab.
20. The antibody of claim 1, wherein the antibody is an IgG1 antibody.
21. An isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a VH domain comprising the amino acid sequence of SEQ ID NO: 7 and (b) a VL domain comprising the amino acid sequence of SEQ ID NO: 8.
22. The antibody of claim 21, wherein the antibody is an Fab.
23. The antibody of claim 21, wherein the antibody is an IgG1 antibody.
24. A pharmaceutical composition comprising the antibody of claim 21 and a pharmaceutically acceptable carrier, excipient, or diluent.
25. An isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises a binding domain comprising (a) a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 25 and (b) a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 26.
26. A pharmaceutical composition comprising the antibody of claim 25 and a pharmaceutically acceptable carrier, excipient, or diluent.
27. An isolated antibody that specifically binds IL-33, or an antigen-binding fragment thereof, wherein the antibody comprises:
(i) a binding domain comprising (a) a VH domain comprising the amino acid sequence of SEQ ID NO: 41 and (b) a VL domain comprising the amino acid sequence of SEQ ID NO: 55;
(ii) a binding domain comprising (a) a VH domain comprising the amino acid sequence of SEQ ID NO: 43 and (b) a VL domain comprising the amino acid sequence of SEQ ID NO: 55;
(iii) a binding domain comprising (a) a VH domain comprising the amino acid sequence of SEQ ID NO: 41 and (b) a VL domain comprising the amino acid sequence of SEQ ID NO: 8;
(iv) a binding domain comprising (a) a VH domain comprising the amino acid sequence of SEQ ID NO: 43 and (b) a VL domain comprising the amino acid sequence of SEQ ID NO: 8;
(v) a binding domain comprising (a) a VH domain comprising the amino acid sequence of SEQ ID NO: 44 and (b) a VL domain comprising the amino acid sequence of SEQ ID NO: 8;
(vi) a binding domain comprising (a) a VH domain comprising the amino acid sequence of SEQ ID NO: 46 and (b) a VL domain comprising the amino acid sequence of SEQ ID NO: 8;
(vii) a binding domain comprising (a) a VH domain comprising the amino acid sequence of SEQ ID NO: 48 and (b) a VL domain comprising the amino acid sequence of SEQ ID NO: 8;
(viii) a binding domain comprising (a) a VH domain comprising the amino acid sequence of SEQ ID NO: 43 and (b) a VL domain comprising the amino acid sequence of SEQ ID NO: 57;
(ix) a binding domain comprising (a) a VH domain comprising the amino acid sequence of SEQ ID NO: 44 and (b) a VL domain comprising the amino acid sequence of SEQ ID NO: 57;
(x) a binding domain comprising (a) a VH domain comprising the amino acid sequence of SEQ ID NO: 46 and (b) a VL domain comprising the amino acid sequence of SEQ ID NO: 57;
(xi) a binding domain comprising (a) a VH domain comprising the amino acid sequence of SEQ ID NO: 48 and (b) a VL domain comprising the amino acid sequence of SEQ ID NO: 57;
(xii) a binding domain comprising (a) a VH domain comprising the amino acid sequence of SEQ ID NO: 50 and (b) a VL domain comprising the amino acid sequence of SEQ ID NO: 57;
(xiii) a binding domain comprising (a) a VH domain comprising the amino acid sequence of SEQ ID NO: 43 and (b) a VL domain comprising the amino acid sequence of SEQ ID NO: 58;
(xiv) a binding domain comprising (a) a VH domain comprising the amino acid sequence of SEQ ID NO: 44 and (b) a VL domain comprising the amino acid sequence of SEQ ID NO: 58;
(xv) a binding domain comprising (a) a VH domain comprising the amino acid sequence of SEQ ID NO: 46 and (b) a VL domain comprising the amino acid sequence of SEQ ID NO: 58;
(xvi) a binding domain comprising (a) a VH domain comprising the amino acid sequence of SEQ ID NO: 48 and (b) a VL domain comprising the amino acid sequence of SEQ ID NO: 58;
(xvii) a binding domain comprising (a) a VH domain comprising the amino acid sequence of SEQ ID NO: 50 and (b) a VL domain comprising the amino acid sequence of SEQ ID NO: 58;
(xviii) a binding domain comprising (a) a VH domain comprising the amino acid sequence of SEQ ID NO: 43 and (b) a VL domain comprising the amino acid sequence of SEQ ID NO: 59;
(xix) a binding domain comprising (a) a VH domain comprising the amino acid sequence of SEQ ID NO: 44 and (b) a VL domain comprising the amino acid sequence of SEQ ID NO: 59;
(xx) a binding domain comprising (a) a VH domain comprising the amino acid sequence of SEQ ID NO: 46 and (b) a VL domain comprising the amino acid sequence of SEQ ID NO: 59;
(xxi) a binding domain comprising (a) a VH domain comprising the amino acid sequence of SEQ ID NO: 48 and (b) a VL domain comprising the amino acid sequence of SEQ ID NO: 59;
(xxii) a binding domain comprising (a) a VH domain comprising the amino acid sequence of SEQ ID NO: 50 and (b) a VL domain comprising the amino acid sequence of SEQ ID NO: 59; or
(xxiii) a binding domain comprising (a) a VH domain comprising the amino acid sequence of SEQ ID NO: 52 and (b) a VL domain comprising the amino acid sequence of SEQ ID NO: 61.
US17/199,810 2020-03-13 2021-03-12 Anti-interleukin-33 antibodies and uses thereof Active 2041-06-22 US11760797B2 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
US17/199,810 US11760797B2 (en) 2020-03-13 2021-03-12 Anti-interleukin-33 antibodies and uses thereof
US18/364,185 US20240092887A1 (en) 2020-03-13 2023-08-02 Anti-interleukin-33 antibodies and uses thereof

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
US202062989526P 2020-03-13 2020-03-13
US202063022080P 2020-05-08 2020-05-08
US17/199,810 US11760797B2 (en) 2020-03-13 2021-03-12 Anti-interleukin-33 antibodies and uses thereof

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US18/364,185 Division US20240092887A1 (en) 2020-03-13 2023-08-02 Anti-interleukin-33 antibodies and uses thereof

Publications (2)

Publication Number Publication Date
US20210284725A1 US20210284725A1 (en) 2021-09-16
US11760797B2 true US11760797B2 (en) 2023-09-19

Family

ID=75439466

Family Applications (2)

Application Number Title Priority Date Filing Date
US17/199,810 Active 2041-06-22 US11760797B2 (en) 2020-03-13 2021-03-12 Anti-interleukin-33 antibodies and uses thereof
US18/364,185 Pending US20240092887A1 (en) 2020-03-13 2023-08-02 Anti-interleukin-33 antibodies and uses thereof

Family Applications After (1)

Application Number Title Priority Date Filing Date
US18/364,185 Pending US20240092887A1 (en) 2020-03-13 2023-08-02 Anti-interleukin-33 antibodies and uses thereof

Country Status (16)

Country Link
US (2) US11760797B2 (en)
EP (1) EP4118114A1 (en)
JP (2) JP7767298B2 (en)
KR (1) KR20220152262A (en)
CN (1) CN115605507A (en)
AU (1) AU2021236306A1 (en)
BR (1) BR112022018254A2 (en)
CA (1) CA3174680A1 (en)
CL (1) CL2022002429A1 (en)
CO (1) CO2022014150A2 (en)
CR (1) CR20220461A (en)
IL (1) IL296256A (en)
MX (1) MX2022011156A (en)
PE (1) PE20230252A1 (en)
PH (1) PH12022552371A1 (en)
WO (1) WO2021183849A1 (en)

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20240052871A (en) 2016-04-27 2024-04-23 애브비 인코포레이티드 Methods of treatment of diseases in which il-13 activity is detrimental using anti-il-13 antibodies
JP7767298B2 (en) * 2020-03-13 2025-11-11 ジェネンテック, インコーポレイテッド Anti-interleukin-33 antibodies and uses thereof
IL310926B2 (en) * 2021-08-27 2025-04-01 Medimmune Ltd Treatment of chronic obstructive pulmonary disease with an anti-interleukin-33 antibody
JP2024544885A (en) 2021-11-10 2024-12-05 ジェネンテック, インコーポレイテッド Anti-interleukin-33 antibodies and uses thereof
IL315208A (en) * 2022-02-24 2024-10-01 Sinomab Bioscience Ltd Bispecific binding proteins against alarmins and their uses
AU2023227442A1 (en) * 2022-03-03 2024-09-12 Pfizer Inc. Multispecific antibodies and uses thereof
JP7668943B2 (en) * 2023-08-30 2025-04-25 ファイザー・インク Multispecific antibodies and uses thereof
WO2026067832A1 (en) * 2024-09-30 2026-04-02 深圳市小分子新药创新中心有限公司 Anti-il-33 single-domain antibody and derivative thereof

Citations (102)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1989006692A1 (en) 1988-01-12 1989-07-27 Genentech, Inc. Method of treating tumor cells by inhibiting growth factor receptor function
WO1992019579A1 (en) 1991-04-26 1992-11-12 Aristech Chemical Corporation Manufacture of neopentyl glycol (i)
WO1994010202A1 (en) 1992-10-28 1994-05-11 Genentech, Inc. Vascular endothelial cell growth factor antagonists
WO1995027062A1 (en) 1994-04-04 1995-10-12 Genentech, Inc. Agonist antibodies against the flk2/flt3 receptor and uses thereof
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
WO1996027603A1 (en) 1995-03-03 1996-09-12 Millennium Pharmaceuticals, Inc. Compositions and methods for the treatment and diagnosis of immune disorders
WO1996030046A1 (en) 1995-03-30 1996-10-03 Genentech, Inc. Vascular endothelial cell growth factor antagonists
WO1998045332A2 (en) 1997-04-07 1998-10-15 Genentech, Inc. Humanized antibodies and methods for forming humanized antibodies
WO1998045331A2 (en) 1997-04-07 1998-10-15 Genentech, Inc. Anti-vegf antibodies
US6054297A (en) 1991-06-14 2000-04-25 Genentech, Inc. Humanized antibodies and methods for making them
WO2001021641A1 (en) 1999-09-24 2001-03-29 Millennium Pharmaceuticals, Inc. Compositions and methods for the diagnosis and treatment of immune disorders
WO2001070817A1 (en) 2000-03-21 2001-09-27 Medical & Biological Laboratories Co., Ltd. Monoclonal antibody and method and kit for the immunoassay of soluble human st2 with the use of the same
WO2001070818A1 (en) 2000-03-23 2001-09-27 Tanox, Inc. Anti-c2/c2a inhibitors of complement activation
US20020081293A1 (en) 1998-02-20 2002-06-27 Tanox, Inc., Delaware Corporation Inhibitors of complement activation
US6582959B2 (en) 1991-03-29 2003-06-24 Genentech, Inc. Antibodies to vascular endothelial cell growth factor
US20030190317A1 (en) 1997-04-07 2003-10-09 Genentech, Inc. Anti-VEGF antibodies
US20030206899A1 (en) 1991-03-29 2003-11-06 Genentech, Inc. Vascular endothelial cell growth factor antagonists
US6703020B1 (en) 1999-04-28 2004-03-09 Board Of Regents, The University Of Texas System Antibody conjugate methods for selectively inhibiting VEGF
WO2005012359A2 (en) 2003-08-01 2005-02-10 Genentech, Inc. Anti-vegf antibodies
US6884879B1 (en) 1997-04-07 2005-04-26 Genentech, Inc. Anti-VEGF antibodies
WO2005044853A2 (en) 2003-11-01 2005-05-19 Genentech, Inc. Anti-vegf antibodies
WO2005062967A2 (en) 2003-12-23 2005-07-14 Tanox, Inc. Novel anti-il 13 antibodies and uses thereof
US20050186208A1 (en) 2003-05-30 2005-08-25 Genentech, Inc. Treatment with anti-VEGF antibodies
WO2005079844A2 (en) 2004-02-17 2005-09-01 Schering Corporation Use for interleukin-33 (il33) and the il-33 receptor complex
US20060009360A1 (en) 2004-06-25 2006-01-12 Robert Pifer New adjuvant composition
US20070042978A1 (en) 2002-12-19 2007-02-22 Jean-Philippe Girard Nf-hev compositions and methods of use
WO2007056227A2 (en) 2005-11-04 2007-05-18 Genentech, Inc. Use of complement pathway inhibitors to treat ocular diseases
WO2007127749A2 (en) 2006-04-24 2007-11-08 Critical Care Diagnostics, Inc. Predicting mortality and detecting severe disease
WO2007130627A2 (en) 2006-05-04 2007-11-15 The Brigham And Women's Hospital, Inc. Il-33 in the treatment and diagnosis of diseases and disorders
WO2007131031A2 (en) 2006-05-02 2007-11-15 Critical Care Diagnostics, Inc. Diagnosis of pulmonary and/or cardiovascular disease
WO2007140205A2 (en) 2006-05-24 2007-12-06 Biogen Idec Ma Inc. Methods of treating fibrosis
WO2007143295A2 (en) 2006-04-27 2007-12-13 Critical Care Diagnostics, Inc. Interleukin-33 (il-33) for the diagnosis and prognosis of cardiovascular disease
WO2008066443A1 (en) 2006-11-28 2008-06-05 Theravac Pharmaceuticals Ab Il-33 vaccine for the treatment of inflammatory conditions with a strong th2 component
WO2008132709A1 (en) 2007-04-26 2008-11-06 Provost, Fellows And Scholars Of The College Of The Holy And Undivided Trinity Of Queen Elizabeth, Near Dublin Products for altering il-33 activity and methods therefor
WO2008144610A1 (en) 2007-05-18 2008-11-27 Medimmune, Llc Il-33 in inflammatory disease
WO2009053098A1 (en) 2007-10-26 2009-04-30 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. Inhibitors of caspase i-dependent cytokines in the treatment of neurodegenerative disorders
US7560530B1 (en) 2006-07-20 2009-07-14 Schering Corporation IL-33 receptor
WO2009120899A2 (en) 2008-03-26 2009-10-01 Cellerant Therapeutics, Inc. G coupled protein receptors associated with myelogenous haematological proliferative disorders and uses thereof
WO2009155724A2 (en) 2008-06-25 2009-12-30 Esbatech, An Alcon Biomedical Research Unit Llc Stable and soluble antibodies inhibiting vegf
WO2010069532A1 (en) 2008-12-16 2010-06-24 F. Hoffmann-La Roche Ag Antibodies against human angiopoietin 2
WO2010087972A2 (en) 2009-01-29 2010-08-05 Abbott Laboratories Il-1 binding proteins
WO2010102251A2 (en) 2009-03-05 2010-09-10 Abbott Laboratories Il-17 binding proteins
US20110045501A1 (en) 2008-01-08 2011-02-24 Irene Bosch St2-based dengue fever diagnostic
WO2011031600A1 (en) 2009-09-10 2011-03-17 Schering Corporation Use of il-33 antagonists to treat fibrotic disease
WO2011047266A1 (en) 2009-10-15 2011-04-21 Abbott Laboratories Il-1 binding proteins
US20110165063A1 (en) 2009-01-29 2011-07-07 Abbott Laboratories Il-1 binding proteins
US20110236388A1 (en) 2010-03-26 2011-09-29 Monika Baehner Bispecific, bivalent anti-vegf/anti-ang-2 antibodies
WO2011143562A2 (en) 2010-05-14 2011-11-17 Abbott Laboratories Il-1 binding proteins
WO2012055891A1 (en) 2010-10-29 2012-05-03 F. Hoffmann-La Roche Ag Murine model of inflammation with il33 n-terminal domain deletion
US8187569B2 (en) 2006-02-14 2012-05-29 Exxonmobil Chemical Patents Inc. Process for manufacturing molecular sieve of MFS framework type and its use
WO2012083132A2 (en) 2010-12-16 2012-06-21 Genentech, Inc. Diagnosis and treatments relating to th2 inhibition
WO2012088094A2 (en) 2010-12-21 2012-06-28 Abbott Laboratories Il-1 binding proteins
WO2012103240A2 (en) 2011-01-25 2012-08-02 Eleven Biotherapeutics, Inc. Receptor binding agents
WO2012113927A1 (en) 2011-02-24 2012-08-30 Centre National De La Recherche Scientifique (Cnrs) Novel superactive il-33 fragments, and uses thereof
WO2012145209A2 (en) 2011-04-21 2012-10-26 Rockefeller University (The) Anti-inflammatory agents
WO2013014208A2 (en) 2011-07-27 2013-01-31 Glaxo Group Limited Antigen binding constructs
US20130287777A1 (en) 2012-04-30 2013-10-31 Janssen Biotech, Inc. ST2L Antagonists and Methods of Use
WO2013173761A2 (en) 2012-05-18 2013-11-21 Amgen Inc. St2 antigen binding proteins
US20140017244A1 (en) 2012-07-13 2014-01-16 Roche Glycart Ag Bispecific Anti-VEGF/Anti-ANG-2 Antibodies and their use in the Treatment of Ocular Vascular Diseases
WO2014062621A1 (en) 2012-10-15 2014-04-24 Stc.Unm Treatment of autophagy-based disorders and related pharmaceutical compositions, diagnostic and screening assays and kits
WO2014072446A1 (en) 2012-11-08 2014-05-15 INSERM (Institut National de la Santé et de la Recherche Médicale) Method for inducing il-2-free proliferation of gamma delta t cells
WO2014090800A1 (en) 2012-12-10 2014-06-19 Vib Vzw Novel interleukin-33 inhibitors
WO2014126277A1 (en) 2013-02-14 2014-08-21 건국대학교 산학협력단 Composition of novel interleukin-33 receptor and binding protein, and use thereof
WO2014128254A1 (en) 2013-02-22 2014-08-28 University Of Eastern Finland (Kuopion Kampus) Il-33 and treatment of neurodegenerative diseases
WO2014152195A1 (en) 2013-03-15 2014-09-25 Regeneron Pharmaceuticals, Inc. Il-33 antagonists and uses thereof
WO2014164959A2 (en) 2013-03-13 2014-10-09 Regeneron Pharmaceuticals, Inc. Anti-il-33 antibodies and uses thereof
WO2014178392A1 (en) 2013-05-01 2014-11-06 学校法人兵庫医科大学 Atopic dermatitis model animal and use thereof
WO2015042521A1 (en) 2013-09-20 2015-03-26 University Of Virginia Patent Foundation Compositions and methods for treatment of autoimmune and inflammatory diseases and disorders
WO2015054012A1 (en) 2013-10-07 2015-04-16 The Trustees Of The University Of Pennsylvania Vaccines with interleukin-33 as an adjuvant
WO2015061441A1 (en) 2013-10-23 2015-04-30 Genentech, Inc. Methods of diagnosing and treating eosinophilic disorders
WO2015077888A1 (en) 2013-11-28 2015-06-04 University Of Manitoba Idr peptide compositions and use thereof for treatment of th2-dysregulated inflammatory conditions
WO2015099175A1 (en) 2013-12-26 2015-07-02 田辺三菱製薬株式会社 Human anti-il-33 neutralizing monoclonal antibody
WO2015106080A2 (en) 2014-01-10 2015-07-16 Anaptysbio, Inc. Antibodies directed against interleukin-33 (il-33)
WO2015132602A1 (en) 2014-03-05 2015-09-11 Cantargia Ab Anti human interleukin-1 receptor accessory protein (il1 rap) antibodies and uses thereof
WO2015143343A2 (en) 2014-03-21 2015-09-24 The Brigham And Women's Hospital, Inc. Methods and compositions for treatment of immune-related diseases or disorders and/or therapy monitoring
WO2015164354A1 (en) 2014-04-21 2015-10-29 The Childen's Hospital Of Philadelphia Compositions and methods for treating cytokine-related disorders
WO2015179918A1 (en) 2014-05-27 2015-12-03 The University Of Queensland Modulation of cellular stress
WO2016020502A1 (en) 2014-08-06 2016-02-11 Cantargia Ab Novel antibodies and uses thereof
US9309319B2 (en) 2011-02-23 2016-04-12 Hoffmann-La Roche Inc. Antibodies against human IL33R and uses thereof
WO2016073157A1 (en) 2014-11-06 2016-05-12 Genentech, Inc. Anti-ang2 antibodies and methods of use thereof
WO2016073890A1 (en) 2014-11-07 2016-05-12 Eleven Biotherapeutics, Inc. Improved il-6 antibodies
WO2016077366A1 (en) 2014-11-10 2016-05-19 Genentec, Inc. Therapeutic and diagnostic methods for il-33-mediated disorders
WO2016077381A1 (en) 2014-11-10 2016-05-19 Genentech, Inc. Anti-interleukin-33 antibodies and uses thereof
US20160145344A1 (en) 2014-10-20 2016-05-26 University Of Southern California Murine and human innate lymphoid cells and lung inflammation
WO2016085832A1 (en) 2014-11-24 2016-06-02 Albert Einstein College Of Medicine, Inc. Peptides for blocking il1rap protein-protein interaction and uses thereof for treatment of disease
WO2016090250A1 (en) 2014-12-04 2016-06-09 The University Of North Carolina At Chapel Hill Compositions and methods for preventing and treating graft versus host disease
WO2016122865A1 (en) 2015-01-30 2016-08-04 Salk Institute For Biological Studies Compositions and methods for treating age-related diabetes and related disorders
WO2016138590A1 (en) 2015-03-03 2016-09-09 Wilfred Jefferies Modulation of cancer immunity with type 2 innate lymphoid cells, interleukin 33, and/or interferon induced protein 44
WO2016140921A1 (en) 2015-03-02 2016-09-09 180 Therapeutics Lp Method of treating a localized fibrotic disorder using an il-33 antagonist
WO2016149276A1 (en) 2015-03-16 2016-09-22 Genentech, Inc. Methods of detecting and quantifying il-13 and uses in diagnosing and treating th2-associated diseases
WO2016156440A1 (en) 2015-03-31 2016-10-06 Medimmune Limited A novel il33 form, mutated forms of il33, antibodies, assays and methods of using the same
EP2734222B1 (en) 2011-07-18 2016-10-19 Critical Care Diagnostics, Inc. Methods of treating cardiovascular diseases and predicting the efficacy of exercise therapy
US9523696B2 (en) 2012-08-16 2016-12-20 Critical Care Diagnostics, Inc. Methods for predicting risk of developing hypertension
WO2016207304A2 (en) 2015-06-26 2016-12-29 Mab Discovery Gmbh Monoclonal anti-il-1racp antibodies
WO2017009750A1 (en) 2015-07-10 2017-01-19 The Hong Kong University Of Science And Technology Methods and compositions for treating neurodegenerative and neuroinflammatory conditions
WO2017021814A1 (en) 2015-07-31 2017-02-09 Pontificia Universidad Católica De Chile Use of il-3, il-33, and il-12p40 for characterization of the respiratory infections by syncytial respiratory virus
US20170096483A1 (en) 2015-10-06 2017-04-06 Regeneron Pharmaceuticals, Inc. Biomarkers Related to Interleukin-33 (IL-33)-Mediated Diseases and Uses Thereof
US9738727B2 (en) 2011-10-14 2017-08-22 Genentech, Inc. Anti-HtrA1 antibodies and methods of use
WO2017187307A1 (en) 2016-04-27 2017-11-02 Pfizer Inc. Anti-il-33 antibodies, compositions, methods and uses thereof
WO2018081075A1 (en) 2016-10-28 2018-05-03 Eli Lilly And Company Anti-il-33 antibodies and uses thereof
US10421822B2 (en) 2015-10-30 2019-09-24 Genetech, Inc. Anti-HtrA1 antibodies and methods of use thereof
WO2021183849A1 (en) * 2020-03-13 2021-09-16 Genentech, Inc. Anti-interleukin-33 antibodies and uses thereof

Family Cites Families (96)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4737456A (en) 1985-05-09 1988-04-12 Syntex (U.S.A.) Inc. Reducing interference in ligand-receptor binding assays
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
US6548640B1 (en) 1986-03-27 2003-04-15 Btg International Limited Altered antibodies
EP0307434B2 (en) 1987-03-18 1998-07-29 Scotgen Biopharmaceuticals, Inc. Altered antibodies
US5770701A (en) 1987-10-30 1998-06-23 American Cyanamid Company Process for preparing targeted forms of methyltrithio antitumor agents
US5606040A (en) 1987-10-30 1997-02-25 American Cyanamid Company Antitumor and antibacterial substituted disulfide derivatives prepared from compounds possessing a methyl-trithio group
ES2052027T5 (en) 1988-11-11 2005-04-16 Medical Research Council IMMUNOGLOBULINE VARIABLE DOMAIN SEQUENCE CLONING.
DE3920358A1 (en) 1989-06-22 1991-01-17 Behringwerke Ag BISPECIFIC AND OLIGO-SPECIFIC, MONO- AND OLIGOVALENT ANTI-BODY CONSTRUCTS, THEIR PRODUCTION AND USE
CA2026147C (en) 1989-10-25 2006-02-07 Ravi J. Chari Cytotoxic agents comprising maytansinoids and their therapeutic use
US5208020A (en) 1989-10-25 1993-05-04 Immunogen Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
US5959177A (en) 1989-10-27 1999-09-28 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
US6150584A (en) 1990-01-12 2000-11-21 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6075181A (en) 1990-01-12 2000-06-13 Abgenix, Inc. Human antibodies derived from immunized xenomice
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
ES2113940T3 (en) 1990-12-03 1998-05-16 Genentech Inc ENRICHMENT METHOD FOR PROTEIN VARIANTS WITH ALTERED UNION PROPERTIES.
US5571894A (en) 1991-02-05 1996-11-05 Ciba-Geigy Corporation Recombinant antibodies specific for a growth factor receptor
ATE255131T1 (en) 1991-06-14 2003-12-15 Genentech Inc HUMANIZED HEREGULIN ANTIBODIES
GB9114948D0 (en) 1991-07-11 1991-08-28 Pfizer Ltd Process for preparing sertraline intermediates
CA2116774C (en) 1991-09-19 2003-11-11 Paul J. Carter Expression in e. coli antibody fragments having at least a cysteine present as a free thiol. use for the production of bifunctional f(ab') 2 antibodies
FI941572L (en) 1991-10-07 1994-05-27 Oncologix Inc Combination and method of use of anti-erbB-2 monoclonal antibodies
WO1993008829A1 (en) 1991-11-04 1993-05-13 The Regents Of The University Of California Compositions that mediate killing of hiv-infected cells
DE69233528T2 (en) 1991-11-25 2006-03-16 Enzon, Inc. Process for the preparation of multivalent antigen-binding proteins
WO1993016185A2 (en) 1992-02-06 1993-08-19 Creative Biomolecules, Inc. Biosynthetic binding protein for cancer marker
DE69303494T2 (en) 1992-11-13 1997-01-16 Idec Pharma Corp THERAPEUTIC USE OF CHIMERIC AND LABELED ANTIBODIES AGAINST HUMAN B LYMPHOCYTIC LIMITED DIFFERENTIATION ANTIQUES FOR THE TREATMENT OF B CELL LYMPHOMA
US5635483A (en) 1992-12-03 1997-06-03 Arizona Board Of Regents Acting On Behalf Of Arizona State University Tumor inhibiting tetrapeptide bearing modified phenethyl amides
US5780588A (en) 1993-01-26 1998-07-14 Arizona Board Of Regents Elucidation and synthesis of selected pentapeptides
JPH08511420A (en) 1993-06-16 1996-12-03 セルテック・セラピューテイクス・リミテッド Body
US5773001A (en) 1994-06-03 1998-06-30 American Cyanamid Company Conjugates of methyltrithio antitumor agents and intermediates for their synthesis
US5789199A (en) 1994-11-03 1998-08-04 Genentech, Inc. Process for bacterial production of polypeptides
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
US5840523A (en) 1995-03-01 1998-11-24 Genetech, Inc. Methods and compositions for secretion of heterologous polypeptides
US5641870A (en) 1995-04-20 1997-06-24 Genentech, Inc. Low pH hydrophobic interaction chromatography for antibody purification
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
US5714586A (en) 1995-06-07 1998-02-03 American Cyanamid Company Methods for the preparation of monomeric calicheamicin derivative/carrier conjugates
US5712374A (en) 1995-06-07 1998-01-27 American Cyanamid Company Method for the preparation of substantiallly monomeric calicheamicin derivative/carrier conjugates
US6267958B1 (en) 1995-07-27 2001-07-31 Genentech, Inc. Protein formulation
GB9603256D0 (en) 1996-02-16 1996-04-17 Wellcome Found Antibodies
DK0979281T3 (en) 1997-05-02 2005-11-21 Genentech Inc Process for the preparation of multispecific antibodies with heteromultimers and common components
US6171586B1 (en) 1997-06-13 2001-01-09 Genentech, Inc. Antibody formulation
CA2293829C (en) 1997-06-24 2011-06-14 Genentech, Inc. Methods and compositions for galactosylated glycoproteins
US6040498A (en) 1998-08-11 2000-03-21 North Caroline State University Genetically engineered duckweed
DE69840412D1 (en) 1997-10-31 2009-02-12 Genentech Inc METHODS AND COMPOSITIONS CONTAINING GLYCOPROTEIN GLYCOR FORMS
US6610833B1 (en) 1997-11-24 2003-08-26 The Institute For Human Genetics And Biochemistry Monoclonal human natural antibodies
ES2375931T3 (en) 1997-12-05 2012-03-07 The Scripps Research Institute HUMANIZATION OF ANTIBODY MURINO.
IL138608A0 (en) 1998-04-02 2001-10-31 Genentech Inc Antibody variants and fragments thereof
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
AU3657899A (en) 1998-04-20 1999-11-08 James E. Bailey Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
KR100940380B1 (en) 1999-01-15 2010-02-02 제넨테크, 인크. Polypeptide Variants with Altered Effector Function
PT1176195E (en) 1999-04-09 2013-07-18 Kyowa Hakko Kirin Co Ltd Method for controlling the activity of immunologically functional molecule
PT1222292E (en) 1999-10-04 2005-11-30 Medicago Inc METHOD FOR REGULATING THE TRANSCRIPTION OF EXOGENEOUS GENES IN THE PRESENCE OF NITROGEN
US7125978B1 (en) 1999-10-04 2006-10-24 Medicago Inc. Promoter for regulating expression of foreign genes
CA2388245C (en) 1999-10-19 2012-01-10 Kyowa Kirin Co., Ltd. The use of serum-free adapted rat cells for producing heterologous polypeptides
EP1240319A1 (en) 1999-12-15 2002-09-18 Genentech, Inc. Shotgun scanning, a combinatorial method for mapping functional protein epitopes
ES2274823T3 (en) 1999-12-29 2007-06-01 Immunogen, Inc. COTOTOXIC AGENTS THAT INCLUDE DOXORRUBICINAS AND DAUNORRUBICINAS AND ITS THERAPEUTIC USE.
AU2001247616B2 (en) 2000-04-11 2007-06-14 Genentech, Inc. Multivalent antibodies and uses therefor
US7064191B2 (en) 2000-10-06 2006-06-20 Kyowa Hakko Kogyo Co., Ltd. Process for purifying antibody
DK2314686T4 (en) 2000-10-06 2023-08-21 Kyowa Kirin Co Ltd Cells that form antibody complexes
US6946292B2 (en) 2000-10-06 2005-09-20 Kyowa Hakko Kogyo Co., Ltd. Cells producing antibody compositions with increased antibody dependent cytotoxic activity
US6596541B2 (en) 2000-10-31 2003-07-22 Regeneron Pharmaceuticals, Inc. Methods of modifying eukaryotic cells
IL155977A0 (en) 2000-11-30 2003-12-23 Medarex Inc Transgenic transchromosomal rodents for making human antibodies
NZ581474A (en) 2001-08-03 2011-04-29 Glycart Biotechnology Ag Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity
KR100988949B1 (en) 2001-10-25 2010-10-20 제넨테크, 인크. Glycoprotein Composition
US20040093621A1 (en) 2001-12-25 2004-05-13 Kyowa Hakko Kogyo Co., Ltd Antibody composition which specifically binds to CD20
AU2003236017B2 (en) 2002-04-09 2009-03-26 Kyowa Kirin Co., Ltd. Drug containing antibody composition
CA2481837A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. Production process for antibody composition
US20040110704A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Cells of which genome is modified
EP1502603A4 (en) 2002-04-09 2006-12-13 Kyowa Hakko Kogyo Kk MEDICAMENT CONTAINING ANTIBODY COMPOSITION APPROPRIATE TO PATIENT SUFFERING FROM POLYMORPHISM FC gammma RIIIA
US20040259150A1 (en) 2002-04-09 2004-12-23 Kyowa Hakko Kogyo Co., Ltd. Method of enhancing of binding activity of antibody composition to Fcgamma receptor IIIa
AU2003236020B2 (en) 2002-04-09 2009-03-19 Kyowa Hakko Kirin Co., Ltd. Cell with depression or deletion of the activity of protein participating in GDP-fucose transport
CA2488441C (en) 2002-06-03 2015-01-27 Genentech, Inc. Synthetic antibody phage libraries
US7361740B2 (en) 2002-10-15 2008-04-22 Pdl Biopharma, Inc. Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis
EP1944320A1 (en) 2002-12-16 2008-07-16 Genentech, Inc. Immunoglobulin variants and uses thereof
US20050079574A1 (en) 2003-01-16 2005-04-14 Genentech, Inc. Synthetic antibody phage libraries
US7871607B2 (en) 2003-03-05 2011-01-18 Halozyme, Inc. Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminoglycanases
AU2004279742A1 (en) 2003-10-08 2005-04-21 Kyowa Hakko Kirin Co., Ltd. Fused protein composition
JPWO2005035778A1 (en) 2003-10-09 2006-12-21 協和醗酵工業株式会社 Method for producing antibody composition using RNA that suppresses function of α1,6-fucosyltransferase
PT1692182E (en) 2003-11-05 2010-05-13 Roche Glycart Ag Cd20 antibodies with increased fc receptor binding affinity and effector function
EP3434275A1 (en) 2003-11-06 2019-01-30 Seattle Genetics, Inc. Assay for cancer cells based on the use of auristatin conjugates with antibodies
JPWO2005053742A1 (en) 2003-12-04 2007-06-28 協和醗酵工業株式会社 Medicament containing antibody composition
CA2561686C (en) 2004-03-31 2014-12-02 Genentech, Inc. Humanized anti-tgf-beta antibodies
US7785903B2 (en) 2004-04-09 2010-08-31 Genentech, Inc. Variable domain library and uses
PT1737891E (en) 2004-04-13 2013-04-16 Hoffmann La Roche Anti-p-selectin antibodies
TWI309240B (en) 2004-09-17 2009-05-01 Hoffmann La Roche Anti-ox40l antibodies
ES2579805T3 (en) 2004-09-23 2016-08-16 Genentech, Inc. Antibodies and conjugates engineered with cysteine
JO3000B1 (en) 2004-10-20 2016-09-05 Genentech Inc Antibody Formulations.
EP1957531B1 (en) 2005-11-07 2016-04-13 Genentech, Inc. Binding polypeptides with diversified and consensus vh/vl hypervariable sequences
WO2007064919A2 (en) 2005-12-02 2007-06-07 Genentech, Inc. Binding polypeptides with restricted diversity sequences
CA2651567A1 (en) 2006-05-09 2007-11-22 Genentech, Inc. Binding polypeptides with optimized scaffolds
WO2007147901A1 (en) 2006-06-22 2007-12-27 Novo Nordisk A/S Production of bispecific antibodies
DK2059533T3 (en) 2006-08-30 2013-02-25 Genentech Inc MULTI-SPECIFIC ANTIBODIES
US20080226635A1 (en) 2006-12-22 2008-09-18 Hans Koll Antibodies against insulin-like growth factor I receptor and uses thereof
CN100592373C (en) 2007-05-25 2010-02-24 群康科技(深圳)有限公司 Liquid crystal display panel driving device and driving method thereof
EP3663318A1 (en) 2008-01-07 2020-06-10 Amgen Inc. Method for making antibody fc-heterodimeric molecules using electrostatic steering effects
CA2796633C (en) 2010-04-23 2020-10-27 Genentech, Inc. Production of heteromultimeric proteins

Patent Citations (151)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
WO1989006692A1 (en) 1988-01-12 1989-07-27 Genentech, Inc. Method of treating tumor cells by inhibiting growth factor receptor function
US20030206899A1 (en) 1991-03-29 2003-11-06 Genentech, Inc. Vascular endothelial cell growth factor antagonists
US6582959B2 (en) 1991-03-29 2003-06-24 Genentech, Inc. Antibodies to vascular endothelial cell growth factor
WO1992019579A1 (en) 1991-04-26 1992-11-12 Aristech Chemical Corporation Manufacture of neopentyl glycol (i)
US6054297A (en) 1991-06-14 2000-04-25 Genentech, Inc. Humanized antibodies and methods for making them
WO1994010202A1 (en) 1992-10-28 1994-05-11 Genentech, Inc. Vascular endothelial cell growth factor antagonists
EP0666868B1 (en) 1992-10-28 2002-04-03 Genentech, Inc. Use of anti-VEGF antibodies for the treatment of cancer
WO1995027062A1 (en) 1994-04-04 1995-10-12 Genentech, Inc. Agonist antibodies against the flk2/flt3 receptor and uses thereof
US6204371B1 (en) 1995-03-03 2001-03-20 Millennium Pharmaceuticals, Inc. Compositions and methods for the treatment and diagnosis of immune disorders
US20030158399A1 (en) 1995-03-03 2003-08-21 Millennium Pharmaceuticals, Inc. Compositions and methods for the treatment and diagnosis of immune disorders
US6156887A (en) 1995-03-03 2000-12-05 Millennium Pharmaceuticals, Inc. Compositions and methods for the treatment and diagnosis of immune disorders
WO1996027603A1 (en) 1995-03-03 1996-09-12 Millennium Pharmaceuticals, Inc. Compositions and methods for the treatment and diagnosis of immune disorders
US7172750B2 (en) 1995-03-03 2007-02-06 Millennium Pharmaceuticals, Inc. Compositions and methods for the treatment and diagnosis of immune disorders
US6288218B1 (en) 1995-03-03 2001-09-11 Douglas Adam Levinson Compositions and methods for the treatment and diagnosis of immune disorders
US6562343B1 (en) 1995-03-03 2003-05-13 Millennium Pharmaceuticals, Inc. Compositions and methods for the treatment and diagnosis of immune disorders
US6084083A (en) 1995-03-03 2000-07-04 Milennium Pharmaceuticals, Inc. Compositions and methods for the treatment and diagnosis of immune disorders
US6414117B1 (en) 1995-03-03 2002-07-02 Millennium Pharmaceuticals, Inc. Compositions and methods for the treatment and diagnosis of immune disorders
WO1996030046A1 (en) 1995-03-30 1996-10-03 Genentech, Inc. Vascular endothelial cell growth factor antagonists
WO1998045331A2 (en) 1997-04-07 1998-10-15 Genentech, Inc. Anti-vegf antibodies
US20050112126A1 (en) 1997-04-07 2005-05-26 Genentech, Inc. Anti-VEGF antibodies
WO1998045332A2 (en) 1997-04-07 1998-10-15 Genentech, Inc. Humanized antibodies and methods for forming humanized antibodies
US6884879B1 (en) 1997-04-07 2005-04-26 Genentech, Inc. Anti-VEGF antibodies
US20030190317A1 (en) 1997-04-07 2003-10-09 Genentech, Inc. Anti-VEGF antibodies
US7060269B1 (en) 1997-04-07 2006-06-13 Genentech, Inc. Anti-VEGF antibodies
US20020081293A1 (en) 1998-02-20 2002-06-27 Tanox, Inc., Delaware Corporation Inhibitors of complement activation
US6703020B1 (en) 1999-04-28 2004-03-09 Board Of Regents, The University Of Texas System Antibody conjugate methods for selectively inhibiting VEGF
WO2001021641A1 (en) 1999-09-24 2001-03-29 Millennium Pharmaceuticals, Inc. Compositions and methods for the diagnosis and treatment of immune disorders
WO2001070817A1 (en) 2000-03-21 2001-09-27 Medical & Biological Laboratories Co., Ltd. Monoclonal antibody and method and kit for the immunoassay of soluble human st2 with the use of the same
WO2001070818A1 (en) 2000-03-23 2001-09-27 Tanox, Inc. Anti-c2/c2a inhibitors of complement activation
US20070042978A1 (en) 2002-12-19 2007-02-22 Jean-Philippe Girard Nf-hev compositions and methods of use
US20050186208A1 (en) 2003-05-30 2005-08-25 Genentech, Inc. Treatment with anti-VEGF antibodies
WO2005012359A2 (en) 2003-08-01 2005-02-10 Genentech, Inc. Anti-vegf antibodies
WO2005044853A2 (en) 2003-11-01 2005-05-19 Genentech, Inc. Anti-vegf antibodies
US7674459B2 (en) 2003-12-23 2010-03-09 Genentech, Inc. Treatment of cancer with a novel anti-IL13 monoclonal antibody
WO2005062967A2 (en) 2003-12-23 2005-07-14 Tanox, Inc. Novel anti-il 13 antibodies and uses thereof
US8734797B2 (en) 2003-12-23 2014-05-27 Genentech, Inc. Anti-IL13 antibodies and uses thereof
US8067199B2 (en) 2003-12-23 2011-11-29 Genentech, Inc. Anti-IL13 antibodies and uses thereof
US8088618B2 (en) 2003-12-23 2012-01-03 Genentech, Inc. Anti-IL 13 antibodies and uses thereof
US8318160B2 (en) 2003-12-23 2012-11-27 Genentech, Inc. Treatment of cancer with novel anti-IL13 monoclonal antibodies
WO2005079844A2 (en) 2004-02-17 2005-09-01 Schering Corporation Use for interleukin-33 (il33) and the il-33 receptor complex
EP1725261B1 (en) 2004-02-17 2011-01-26 Schering Corporation Use of agonists and antagonists of interleukin-33 (il-33)
US9970944B2 (en) 2004-02-17 2018-05-15 Merck Sharp & Dohme Corp. Methods of modulating cytokine activity; related reagents
US20060009360A1 (en) 2004-06-25 2006-01-12 Robert Pifer New adjuvant composition
WO2007056227A2 (en) 2005-11-04 2007-05-18 Genentech, Inc. Use of complement pathway inhibitors to treat ocular diseases
US8187569B2 (en) 2006-02-14 2012-05-29 Exxonmobil Chemical Patents Inc. Process for manufacturing molecular sieve of MFS framework type and its use
WO2007127749A2 (en) 2006-04-24 2007-11-08 Critical Care Diagnostics, Inc. Predicting mortality and detecting severe disease
WO2007143295A2 (en) 2006-04-27 2007-12-13 Critical Care Diagnostics, Inc. Interleukin-33 (il-33) for the diagnosis and prognosis of cardiovascular disease
WO2007131031A2 (en) 2006-05-02 2007-11-15 Critical Care Diagnostics, Inc. Diagnosis of pulmonary and/or cardiovascular disease
WO2007130627A2 (en) 2006-05-04 2007-11-15 The Brigham And Women's Hospital, Inc. Il-33 in the treatment and diagnosis of diseases and disorders
WO2007140205A2 (en) 2006-05-24 2007-12-06 Biogen Idec Ma Inc. Methods of treating fibrosis
US7560530B1 (en) 2006-07-20 2009-07-14 Schering Corporation IL-33 receptor
US20140105887A1 (en) 2006-07-20 2014-04-17 Merck Sharp & Dohme Corp. Methods for modulating il-33 activity
US20120207752A1 (en) 2006-07-20 2012-08-16 Schering Corporation Methods for modulating il-33 activity
US8187596B1 (en) 2006-07-20 2012-05-29 Schering Corporation Method of treating asthma or allergy by administering an IL-33 receptor antibody
WO2008066443A1 (en) 2006-11-28 2008-06-05 Theravac Pharmaceuticals Ab Il-33 vaccine for the treatment of inflammatory conditions with a strong th2 component
WO2008132709A1 (en) 2007-04-26 2008-11-06 Provost, Fellows And Scholars Of The College Of The Holy And Undivided Trinity Of Queen Elizabeth, Near Dublin Products for altering il-33 activity and methods therefor
US20100260770A1 (en) 2007-05-18 2010-10-14 Medimmune, Llc Il-33 in inflammatory disease
WO2008144610A1 (en) 2007-05-18 2008-11-27 Medimmune, Llc Il-33 in inflammatory disease
WO2009053098A1 (en) 2007-10-26 2009-04-30 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. Inhibitors of caspase i-dependent cytokines in the treatment of neurodegenerative disorders
US20110045501A1 (en) 2008-01-08 2011-02-24 Irene Bosch St2-based dengue fever diagnostic
EP2271672B1 (en) 2008-03-26 2015-11-11 Cellerant Therapeutics, Inc. Immunoglobulin and/or toll-like receptor proteins associated with myelogenous haematological proliferative disorders and uses thereof
WO2009120899A2 (en) 2008-03-26 2009-10-01 Cellerant Therapeutics, Inc. G coupled protein receptors associated with myelogenous haematological proliferative disorders and uses thereof
WO2009120903A9 (en) 2008-03-26 2010-02-18 Cellerant Therapeutics, Inc. Cytokine receptors associated with myelogenous haematological proliferative disorders and uses thereof
WO2009155724A2 (en) 2008-06-25 2009-12-30 Esbatech, An Alcon Biomedical Research Unit Llc Stable and soluble antibodies inhibiting vegf
WO2010069532A1 (en) 2008-12-16 2010-06-24 F. Hoffmann-La Roche Ag Antibodies against human angiopoietin 2
US20110165063A1 (en) 2009-01-29 2011-07-07 Abbott Laboratories Il-1 binding proteins
WO2010087972A2 (en) 2009-01-29 2010-08-05 Abbott Laboratories Il-1 binding proteins
WO2010102251A2 (en) 2009-03-05 2010-09-10 Abbott Laboratories Il-17 binding proteins
WO2011031600A1 (en) 2009-09-10 2011-03-17 Schering Corporation Use of il-33 antagonists to treat fibrotic disease
EP2475388B1 (en) 2009-09-10 2017-11-08 Merck Sharp & Dohme Corp. Use of il-33 antagonists to treat fibrotic disease
WO2011047266A1 (en) 2009-10-15 2011-04-21 Abbott Laboratories Il-1 binding proteins
US20110236388A1 (en) 2010-03-26 2011-09-29 Monika Baehner Bispecific, bivalent anti-vegf/anti-ang-2 antibodies
WO2011143562A2 (en) 2010-05-14 2011-11-17 Abbott Laboratories Il-1 binding proteins
WO2012055891A1 (en) 2010-10-29 2012-05-03 F. Hoffmann-La Roche Ag Murine model of inflammation with il33 n-terminal domain deletion
JP2014506321A (en) 2010-12-16 2014-03-13 ジェネンテック, インコーポレイテッド Diagnosis and treatment related to TH2 inhibition
WO2012083132A2 (en) 2010-12-16 2012-06-21 Genentech, Inc. Diagnosis and treatments relating to th2 inhibition
WO2012088094A2 (en) 2010-12-21 2012-06-28 Abbott Laboratories Il-1 binding proteins
WO2012103240A2 (en) 2011-01-25 2012-08-02 Eleven Biotherapeutics, Inc. Receptor binding agents
US9309319B2 (en) 2011-02-23 2016-04-12 Hoffmann-La Roche Inc. Antibodies against human IL33R and uses thereof
WO2012113927A1 (en) 2011-02-24 2012-08-30 Centre National De La Recherche Scientifique (Cnrs) Novel superactive il-33 fragments, and uses thereof
WO2012145209A2 (en) 2011-04-21 2012-10-26 Rockefeller University (The) Anti-inflammatory agents
EP2734222B1 (en) 2011-07-18 2016-10-19 Critical Care Diagnostics, Inc. Methods of treating cardiovascular diseases and predicting the efficacy of exercise therapy
WO2013014208A2 (en) 2011-07-27 2013-01-31 Glaxo Group Limited Antigen binding constructs
JP2014523746A (en) 2011-07-27 2014-09-18 グラクソ グループ リミテッド Anti-VEGF single variable domain fused with FC domain
US9738727B2 (en) 2011-10-14 2017-08-22 Genentech, Inc. Anti-HtrA1 antibodies and methods of use
US9212227B2 (en) 2012-04-30 2015-12-15 Janssen Biotech, Inc. ST2L antibody antagonists for the treatment of ST2L-mediated inflammatory pulmonary conditions
WO2013165894A3 (en) 2012-04-30 2014-03-27 Janssen Biotech, Inc. St2l antagonists and methods of use
WO2013165894A2 (en) 2012-04-30 2013-11-07 Janssen Biotech, Inc. St2l antagonists and methods of use
US20170066831A1 (en) 2012-04-30 2017-03-09 Janssen Biotech, Inc. ST2L Antagonists and Methods of Use
US20130336980A1 (en) 2012-04-30 2013-12-19 Janssen Biotech, Inc. ST2L Antagonists and Methods of Use
US20130287777A1 (en) 2012-04-30 2013-10-31 Janssen Biotech, Inc. ST2L Antagonists and Methods of Use
US9090694B2 (en) 2012-04-30 2015-07-28 Janssen Biotech, Inc. ST2L antibody antagonists
WO2013173761A2 (en) 2012-05-18 2013-11-21 Amgen Inc. St2 antigen binding proteins
US20140017244A1 (en) 2012-07-13 2014-01-16 Roche Glycart Ag Bispecific Anti-VEGF/Anti-ANG-2 Antibodies and their use in the Treatment of Ocular Vascular Diseases
US9523696B2 (en) 2012-08-16 2016-12-20 Critical Care Diagnostics, Inc. Methods for predicting risk of developing hypertension
WO2014062621A1 (en) 2012-10-15 2014-04-24 Stc.Unm Treatment of autophagy-based disorders and related pharmaceutical compositions, diagnostic and screening assays and kits
WO2014072446A1 (en) 2012-11-08 2014-05-15 INSERM (Institut National de la Santé et de la Recherche Médicale) Method for inducing il-2-free proliferation of gamma delta t cells
WO2014090800A1 (en) 2012-12-10 2014-06-19 Vib Vzw Novel interleukin-33 inhibitors
WO2014126277A1 (en) 2013-02-14 2014-08-21 건국대학교 산학협력단 Composition of novel interleukin-33 receptor and binding protein, and use thereof
WO2014128254A1 (en) 2013-02-22 2014-08-28 University Of Eastern Finland (Kuopion Kampus) Il-33 and treatment of neurodegenerative diseases
US10000564B2 (en) 2013-03-13 2018-06-19 Regeneron Pharmaceuticals, Inc. Methods of treating an inflammatory condition or sensitivity to an allergen with anti-IL-33 antibodies
US20180251542A1 (en) 2013-03-13 2018-09-06 Regeneron Pharmaceuticals, Inc. Anti-IL-33 Antibodies and Uses Thereof
EP2970460B1 (en) 2013-03-13 2020-04-29 Regeneron Pharmaceuticals, Inc. Anti-il-33 antibodies and uses thereof
WO2014164959A2 (en) 2013-03-13 2014-10-09 Regeneron Pharmaceuticals, Inc. Anti-il-33 antibodies and uses thereof
US9453072B2 (en) 2013-03-13 2016-09-27 Regeneron Pharmaceuticals, Inc. Anti-IL-33 antibodies
WO2014152195A1 (en) 2013-03-15 2014-09-25 Regeneron Pharmaceuticals, Inc. Il-33 antagonists and uses thereof
WO2014178392A1 (en) 2013-05-01 2014-11-06 学校法人兵庫医科大学 Atopic dermatitis model animal and use thereof
WO2015042521A1 (en) 2013-09-20 2015-03-26 University Of Virginia Patent Foundation Compositions and methods for treatment of autoimmune and inflammatory diseases and disorders
WO2015054012A1 (en) 2013-10-07 2015-04-16 The Trustees Of The University Of Pennsylvania Vaccines with interleukin-33 as an adjuvant
US20160235838A1 (en) 2013-10-07 2016-08-18 The Trustees Of The University Of Pennsylvania Vaccines With Interleukin-33 As An Adjuvant
WO2015061441A1 (en) 2013-10-23 2015-04-30 Genentech, Inc. Methods of diagnosing and treating eosinophilic disorders
WO2015077888A1 (en) 2013-11-28 2015-06-04 University Of Manitoba Idr peptide compositions and use thereof for treatment of th2-dysregulated inflammatory conditions
US9758578B2 (en) 2013-12-26 2017-09-12 Mitsubishi Tanabe Pharma Corporation Human anti-IL-33 neutralizing monoclonal antibody
EP3088517A1 (en) 2013-12-26 2016-11-02 Mitsubishi Tanabe Pharma Corporation Human anti-il-33 neutralizing monoclonal antibody
WO2015099175A1 (en) 2013-12-26 2015-07-02 田辺三菱製薬株式会社 Human anti-il-33 neutralizing monoclonal antibody
US20170283494A1 (en) 2013-12-26 2017-10-05 Mitsubishi Tanabe Pharma Corporation Human anti-il-33 neutralizing monoclonal antibody
EP3092253B1 (en) 2014-01-10 2021-03-17 AnaptysBio, Inc. Antibodies directed against interleukin-33 (il-33)
US10836820B2 (en) 2014-01-10 2020-11-17 Anaptysbio, Inc. Method of treating inflammatory disorder with antibodies directed against interleukin-33 (IL-33)
WO2015106080A2 (en) 2014-01-10 2015-07-16 Anaptysbio, Inc. Antibodies directed against interleukin-33 (il-33)
US10059764B2 (en) 2014-01-10 2018-08-28 Anaptysbio, Inc. Antibodies directed against interleukin-33 (IL-33) and methods of making and using
WO2015132602A1 (en) 2014-03-05 2015-09-11 Cantargia Ab Anti human interleukin-1 receptor accessory protein (il1 rap) antibodies and uses thereof
WO2015143343A2 (en) 2014-03-21 2015-09-24 The Brigham And Women's Hospital, Inc. Methods and compositions for treatment of immune-related diseases or disorders and/or therapy monitoring
WO2015164354A1 (en) 2014-04-21 2015-10-29 The Childen's Hospital Of Philadelphia Compositions and methods for treating cytokine-related disorders
WO2015179918A1 (en) 2014-05-27 2015-12-03 The University Of Queensland Modulation of cellular stress
WO2016020502A1 (en) 2014-08-06 2016-02-11 Cantargia Ab Novel antibodies and uses thereof
US20160145344A1 (en) 2014-10-20 2016-05-26 University Of Southern California Murine and human innate lymphoid cells and lung inflammation
WO2016073157A1 (en) 2014-11-06 2016-05-12 Genentech, Inc. Anti-ang2 antibodies and methods of use thereof
WO2016073890A1 (en) 2014-11-07 2016-05-12 Eleven Biotherapeutics, Inc. Improved il-6 antibodies
US10093730B2 (en) 2014-11-10 2018-10-09 Genentech, Inc. Anti-interleukin-33 antibodies and uses thereof
US20160168640A1 (en) 2014-11-10 2016-06-16 Genentech, Inc. Therapeutic and diagnostic methods for il-33-mediated disorders
US10723795B2 (en) 2014-11-10 2020-07-28 Genentech, Inc. Anti-interleukin-33 antibodies and uses thereof
WO2016077366A1 (en) 2014-11-10 2016-05-19 Genentec, Inc. Therapeutic and diagnostic methods for il-33-mediated disorders
WO2016077381A1 (en) 2014-11-10 2016-05-19 Genentech, Inc. Anti-interleukin-33 antibodies and uses thereof
US20210002361A1 (en) 2014-11-10 2021-01-07 Genentech, Inc. Anti-interleukin-33 antibodies and uses thereof
US20180171405A1 (en) 2014-11-10 2018-06-21 Genentech, Inc. Therapeutic and diagnostic methods for il-33-mediated disorders
WO2016085832A1 (en) 2014-11-24 2016-06-02 Albert Einstein College Of Medicine, Inc. Peptides for blocking il1rap protein-protein interaction and uses thereof for treatment of disease
WO2016090250A1 (en) 2014-12-04 2016-06-09 The University Of North Carolina At Chapel Hill Compositions and methods for preventing and treating graft versus host disease
WO2016122865A1 (en) 2015-01-30 2016-08-04 Salk Institute For Biological Studies Compositions and methods for treating age-related diabetes and related disorders
WO2016140921A1 (en) 2015-03-02 2016-09-09 180 Therapeutics Lp Method of treating a localized fibrotic disorder using an il-33 antagonist
WO2016138590A1 (en) 2015-03-03 2016-09-09 Wilfred Jefferies Modulation of cancer immunity with type 2 innate lymphoid cells, interleukin 33, and/or interferon induced protein 44
WO2016149276A1 (en) 2015-03-16 2016-09-22 Genentech, Inc. Methods of detecting and quantifying il-13 and uses in diagnosing and treating th2-associated diseases
WO2016156440A1 (en) 2015-03-31 2016-10-06 Medimmune Limited A novel il33 form, mutated forms of il33, antibodies, assays and methods of using the same
WO2016207304A2 (en) 2015-06-26 2016-12-29 Mab Discovery Gmbh Monoclonal anti-il-1racp antibodies
WO2017009750A1 (en) 2015-07-10 2017-01-19 The Hong Kong University Of Science And Technology Methods and compositions for treating neurodegenerative and neuroinflammatory conditions
WO2017021814A1 (en) 2015-07-31 2017-02-09 Pontificia Universidad Católica De Chile Use of il-3, il-33, and il-12p40 for characterization of the respiratory infections by syncytial respiratory virus
US20170096483A1 (en) 2015-10-06 2017-04-06 Regeneron Pharmaceuticals, Inc. Biomarkers Related to Interleukin-33 (IL-33)-Mediated Diseases and Uses Thereof
US10421822B2 (en) 2015-10-30 2019-09-24 Genetech, Inc. Anti-HtrA1 antibodies and methods of use thereof
WO2017187307A1 (en) 2016-04-27 2017-11-02 Pfizer Inc. Anti-il-33 antibodies, compositions, methods and uses thereof
WO2018081075A1 (en) 2016-10-28 2018-05-03 Eli Lilly And Company Anti-il-33 antibodies and uses thereof
WO2021183849A1 (en) * 2020-03-13 2021-09-16 Genentech, Inc. Anti-interleukin-33 antibodies and uses thereof

Non-Patent Citations (57)

* Cited by examiner, † Cited by third party
Title
Adamko et al., "The rise of the phoenix: the expanding role of the eosinophil in health and disease," Allergy. 60(1):13-22 (2005).
Akhabir et al., "Lung expression quantitative trait loci data set identifies important functional polymorphisms in the asthma-associated IL1RL1 region," J Allergy Clin Immunol. 134(3):729-31 (2014).
Alves-Filho et al., "Interleukin-33 attenuates sepsis by enhancing neutrphil influx to the site of infection," Nat Med. 16(6):708-12 (2010) (6 pages).
Askmyr et al., "Selective killing of candidate AML stem cells by antibody targeting of IL1RAP," Blood. 121(18):3709-13 (2013).
Baekkevold et al., "Molecular characterization of NF-HEV, a nuclear factor preferentially expressed in human high endothelial venules," Am J Pathol. 163(1):69-79 (2003).
Bonilla et al., "The Alarmin Interleukin-33 Drives Protective Antiviral CD8+ T Cell Responses," Science. 335(6071):984-9 (2012) (7 pages).
Bousquet et al., "Uniform definition of asthma severity, control, and exacerbations: document presented for the World Health Organization Consultation on Severe Asthma," J Allergy Clin Immunol. 126(5):926-38 (2010).
Brown et al., "Tolerance of single, but not multiple, amino acid replacements in antibody VH CDR2: a means of minimizing B cell wastage from somatic hypermutation?" J Immunol. 156(9):3285-91 (1996).
Cairns, "Inhibitors of mast cell tryptase beta as therapeutics for the treatment of asthma and inflammatory disorders," Pulm Pharmacol Ther. 18(1):55-66 (2005).
Carmeliet et al., "Angiogenesis in cancer and other diseases," Nature. 407(6801):249-57 (2000).
Casset et al., "A peptide mimetic of an anti-CD4 monoclonal antibody by rational design," Biochem Biophys Res Commun. 307(1):198-205 (2003).
Chen et al., "Selection and analysis of an optimized anti-VEGF antibody: crystal structure of an affinity-matured Fab in complex with antigen," J Mol Biol. 293(4):865-81 (1999).
Clare et al., Eye (2022) 36:266-272; https://doi.org/10.1038/s41433-021-01725-5. *
Ferrara et al., "Binding to the extracellular matrix and proteolytic processing: two key mechanisms regulating vascular endothelial growth factor action," Mol Biol Cell. 21(5):687-90 (2010).
Fournié et al., "The Pro-tumorigenic IL-33 Involved in Antitumor Immunity: A Yin and Yang Cytokine," Front Immunol. 9:2506 (2018) (9 pages).
Hamzaoui et al., "Induced sputum levels of IL-33 and soluble ST2 in young asthmatic children," J Asthma. 50(8):803-9 (2013).
Ho et al., "Common genetic variation at the IL1RL1 locus regulates IL-33/ST2 signaling," J Clin Invest. 123(10):4208-18 (2013).
Hong et al., "Identification of constitutively active interleukin 33 (IL-33) splice variant," J Biol Chem. 286(22):20078-86 (2011).
Houck et al., "The Vascular Endothelial Growth Factor Family: Identification of a Fourth Molecular Species and Characterization of Alternative Splicing of RNA," Mol Endocrinol. 5(12):1806-14 (1991).
International Preliminary Report on Patentability for International Patent Application No. PCT/US2021/022057, dated Sep. 6, 2022 (7 pages).
International Search Report and Written Opinion for International Patent Application No. PCT/US2021/022057, dated Jun. 16, 2021 (16 pages).
Ito et al., "ST2: the biomarker at the heart of GVHD severity," Blood. 125(1):10-1 (2015).
Jang et al., "Interleukin-33 and Mast Cells Bridge Innate and Adaptive Immunity: From the Allergologist's Perspective," Int Neurourol J. 19(3):142-50 (2015).
Ji et al., "Methionine, tryptophan, and histidine oxidation in a model protein, PTH: mechanisms and stabilization," J Pharm Sci. 98(12):4485-500 (2009).
Kakkar et al., "The IL-33/ST2 pathway: therapeutic target and novel biomarker," Nat Rev Drug Discov. 7(10):827-40 (2008).
Kim et al., "Anti-IL-33 antibody has a therapeutic effect in a murine model of allergic rhinitis," Allergy. 67(2):183-90 (2012).
Lefrançais et al., "IL-33 is processed into mature bioactive forms by neutrophil elastase and cathepsin G," Proc Natl Acad Sci U S A. 109(5):1673-8 (2012).
Leung et al., "Vascular endothelial growth factor is a secreted angiogenic mitogen," Science. 246(4935):1306-9 (1989).
Li et al., "IL-33 neutralization suppresses lupus disease in lupus-prone mice," Inflammation. 37(3):824-32 (2014).
Liew et al., "Disease-associated functions of IL-33: the new kid in the IL-1 family," Nat Rev Immunol. 10(2):103-10 (2010).
Liew et al., "Interleukin-33 in health and disease," Nat Rev Immunol. 16(11):676-89 (2016).
Lingel et al., "The structure of interleukin-33 and its interaction with the ST2 and IL-1RAcP receptors—insight into heterotrimeric interleukin-1 signaling complexes," available in PMC Oct. 14, 2010, published in final edited form as: Structure. 17(10):1398-410 (2009) (24 pages).
Liu et al., "Anti-IL-33 antibody treatment inhibits airway inflammation in a murine model of allergic asthma," Biochem Biophys Res Commun. 386(1):181-5 (2009).
Liu et al., "Structural insights into the interaction of IL-33 with its receptors," Proc Natl Acad Sci U S A. 110(37):14918-23 (2013).
Lu et al., "Interleukin-33 prevents the development of autoimmune diabetes in NOD mice," Int Immunopharmacol. 70:9-15 (2019).
Mali et al., "RNA-Guided Human Genome Engineering via Cas9," available in PMC Aug. 15, 2013, published in final edited form as: Science. 339(6121):823-6 (2013) (8 pages).
Martin et al., "Special aspects of interleukin-33 and the IL-33 receptor complex," Semin Immunol. 25(6):449-57 (2013).
Matsumoto, "Serum periostin: a novel biomarker for asthma management," Allergol Int. 63(2):153-60 (2014).
Munitz et al., "Eosinophils: ‘new’ roles for ‘old’ cells," Allergy. 59(3):268-75 (2004).
Nabe, "Interleukin (IL)-33: new therapeutic target for atopic diseases," J Pharmacol Sci. 126(2):85-91 (2014).
O'Donnell et al., "An antitumorigenic role for the IL-33 receptor, ST2L, in colon cancer," Br J Cancer. 114(1):37-43 (2016).
Oldhoff et al., "Anti-IL-5 recombinant humanized monoclonal antibody (mepolizumab) for the treatment of atopic dermatitis," Allergy. 60(5):693-6 (2005).
Paul, Chapter 9: Structure and Function of Immunoglobulins, Fundamental Immunology, Third Edition. Raven Press Ltd., 292-295 (1993) (6 pages).
Popkov et al., "Human/mouse cross-reactive anti-VEGF receptor 2 recombinant antibodies selected from an immune b9 allotype rabbit antibody library," J Immunol Methods. 288(1-2):149-64 (2004).
Presta et al., "Humanization of an anti-vascular endothelial growth factor monoclonal antibody for the therapy of solid tumors and other disorders," Cancer Res. 57(20):4593-9 (1997).
Qiu et al., "Anti-interleukin-33 inhibits cigarette smoke-induced lung inflammation in mice," Immunology. 138(1):76-82 (2013).
Ramirez-Carrozzi et al., "Functional analysis of protective IL1RL1 variants associated with asthma risk," J Allergy Clin Immunol. 135(4):1080-3.e3 (2015) (7 pages).
Sakai et al., "Interleukin-33 Is Hepatoprotective During Liver Ischemia/Reperfusion in Mice," Hepatology. 56(4):1468-78 (2012).
Sanofi Jun. 21, 2019 Press Release "Sanofi and Regeneron announce positive topline Phase 2 results for IL-33 antibody in asthma" [downloaded Dec. 10, 2019]. *
Sedhom et al., "Neutralisation of the interleukin-33/ST2 pathway ameliorates experimental colitis through enhancement of mucosal healing in mice," Gut. 62(12):1714-23 (2013) (11 pages).
Sotos et al., "The transitivity misconception of Pearson's correlation coefficient," Statistics Education Research Journal 8(2):33-55 (2009).
Vo et al., "Comparison study of IL-33 gene expression in haplogroup H, J, L, and K cybrids," Invest Ophthalmol Vis Sci. 54(15):4988 (2013) (Abstract only) (2 pages).
Wechsler et al., N Engl J Med 2021;385:1656-68. DOI: 10.1056/NEJMoa2024257, updated Oct. 28, 2021. *
Xi et al., "IL-33 amplifies an innate immune response in the degenerating retina," J Exp Med. 213(2):189-207 (2016).
Xia et al., "Increased IL-33 expression in chronic obstructive pulmonary disease," Am J Physiol Lung Cell Mol Physiol. 308(7):L619-L627 (2015).
Yuan et al., "Construction of human nonimmune library and selection of scFvs against IL-33," Appl Biochem Biotechnol. 167(3):498-509 (2012).
Zhang et al., "Improving pH gradient cation-exchange chromatography of monoclonal antibodies by controlling ionic strength," J Chromatogr A. 1272:56-64 (2013).

Also Published As

Publication number Publication date
TW202144410A (en) 2021-12-01
JP7767298B2 (en) 2025-11-11
PH12022552371A1 (en) 2023-12-18
EP4118114A1 (en) 2023-01-18
CO2022014150A2 (en) 2022-11-08
WO2021183849A1 (en) 2021-09-16
CA3174680A1 (en) 2021-09-16
WO2021183849A8 (en) 2021-11-11
US20210284725A1 (en) 2021-09-16
JP2023517345A (en) 2023-04-25
JP2026031968A (en) 2026-02-25
KR20220152262A (en) 2022-11-15
AU2021236306A1 (en) 2022-09-15
CL2022002429A1 (en) 2023-03-03
MX2022011156A (en) 2022-10-13
BR112022018254A2 (en) 2022-10-25
PE20230252A1 (en) 2023-02-07
US20240092887A1 (en) 2024-03-21
CN115605507A (en) 2023-01-13
CR20220461A (en) 2022-10-21
IL296256A (en) 2022-11-01

Similar Documents

Publication Publication Date Title
US11725050B2 (en) Anti-interleukin-33 antibodies and uses thereof
US20240092887A1 (en) Anti-interleukin-33 antibodies and uses thereof
JP7472056B2 (en) Humanized affinity matured antibodies against FcRH5 and methods of use
US10941199B2 (en) Anti-CD79b antibodies and methods of use
KR102279524B1 (en) Anti-TIGIT antibodies and methods of use thereof
CA2992602A1 (en) Optimized variants of anti-vegf antibodies
RU2844840C1 (en) Anti-interleukin-33 antibodies and use thereof
TWI921325B (en) Anti-interleukin-33 antibodies and uses thereof
HK40087352A (en) Anti-interleukin-33 antibodies and uses thereof
HK1243440B (en) Anti-interleukin-33 antibodies and uses thereof

Legal Events

Date Code Title Description
FEPP Fee payment procedure

Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY

AS Assignment

Owner name: GENENTECH, INC., CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:NAKAMURA, GERALD R.;SESHASAYEE, DHAYA;CAMPAGNE, MENNO VAN LOOKEREN;AND OTHERS;REEL/FRAME:055728/0478

Effective date: 20200731

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

AS Assignment

Owner name: GENENTECH, INC., CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:WU, JIA;REEL/FRAME:060583/0130

Effective date: 20220715

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

AS Assignment

Owner name: GENENTECH, INC., CALIFORNIA

Free format text: CORRECTIVE ASSIGNMENT TO CORRECT THE 8TH INVENTOR'S NAME PREVIOUSLY RECORDED AT REEL: 055728 FRAME: 0478. ASSIGNOR(S) HEREBY CONFIRMS THE ASSIGNMENT;ASSIGNORS:NAKAMURA, GERALD R.;SESHASAYEE, DHAYA;VAN LOOKEREN CAMPAGNE, MENNO;AND OTHERS;REEL/FRAME:061570/0622

Effective date: 20200731

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS

STPP Information on status: patent application and granting procedure in general

Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT VERIFIED

STCF Information on status: patent grant

Free format text: PATENTED CASE