US11548938B2 - DbpA antibodies and uses thereof - Google Patents
DbpA antibodies and uses thereof Download PDFInfo
- Publication number
- US11548938B2 US11548938B2 US16/546,113 US201916546113A US11548938B2 US 11548938 B2 US11548938 B2 US 11548938B2 US 201916546113 A US201916546113 A US 201916546113A US 11548938 B2 US11548938 B2 US 11548938B2
- Authority
- US
- United States
- Prior art keywords
- antibody
- seq
- antigen
- cdr
- antibodies
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active, expires
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/12—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from bacteria
- C07K16/1203—Gram-negative bacteria
- C07K16/1207—Gram-negative bacteria from Spirochaetales (O), e.g. Treponema, Leptospira
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/12—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from bacteria
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/0225—Spirochetes, e.g. Treponema, Leptospira, Borrelia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/20—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Spirochaetales (O), e.g. Treponema, Leptospira
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/43504—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56911—Bacteria
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/195—Assays involving biological materials from specific organisms or of a specific nature from bacteria
- G01N2333/20—Assays involving biological materials from specific organisms or of a specific nature from bacteria from Spirochaetales (O), e.g. Treponema, Leptospira
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/26—Infectious diseases, e.g. generalised sepsis
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- Embodiments of the present disclosure relate to the field of zoology and molecular diagnostics. More specifically, embodiments of the present disclosure relate to antibodies that bind specifically to Borrelia antigens, e.g., decorin-binding protein A (DbpA) of Borrelia burgdorferi . The disclosure additionally relates to use of such antibodies or antigen-binding fragments in the detection of DbpA antigens in biological samples for diagnosing diseases mediated by Borrelia sp., e.g., Lyme disease, including, therapy of such diseases.
- DbpA decorin-binding protein A
- Mouse hybridoma cell lines identified herein as clones 5H3, 4G9, and 1D12 have been deposited with the International Depository of Canada, 1015 Arlington Street, Winnipeg, Manitoba, Canada on Aug. 10, 2018, and given the accession numbers of 100818-03, 100818-02, and 100818-01, respectively.
- Lyme disease which is caused by infection with the tick-borne spirochete Borrelia burgdorferi , is a common vector-borne disease in North America (Shapiro et al., N Engl J Med., 370, 1724-1731, 2014).
- North American LD is attributable to B. burgdorferi
- European and in Asian LD may be additionally caused by B. afzelii, B. garinii , and other species related to B. burgdorferi .
- the annual incidence of infection may be as high as 1-3% with a cumulative prevalence as high as 7-15% (Tugwell et al., Ann Intern Med., 127, 1109-1123, 1997).
- the highest incidence was reported in southern Sweden at about 0.46% (Sykes et al., J Public Health ( Oxf ), 39, 74-81, 2017).
- antibiotic therapy e.g., i.v. ceftriaxone followed by oral doxycycline
- oral doxycycline e.g., i.v. ceftriaxone followed by oral doxycycline
- compositions and systems for the diagnosis and therapy of Lyme disease can be easily deployed in point-of-care instruments and systems for the testing of samples for Borrelia antigens with improved sensitivity and specificity compared to existing products.
- VL variable light chain
- FR 1 , FR 2 , and FR 3 each, independently of one another, and independently from the inclusion thereof in the VH or VL chain, comprise antibody framework regions (FR) or are absent; and
- CDR 1 , CDR 2 , and CDR 3 each, independently from one another, comprise antibody complementary determining regions (CDRs),
- CDR H1 comprises a polypeptide comprising, consisting essentially of, or consisting of a polypeptide having at least 80%, 90%, or 95% sequence identity to the amino acid sequence RYWMYW (SEQ ID NO: 1) or DYWIE (SEQ ID NO: 7);
- CDR H2 comprises a polypeptide comprising, consisting essentially of, or consisting of a polypeptide having at least 80%, 90%, or 95% sequence identity to the amino acid sequence RLDPNSGVTKYNEKFKS (SEQ ID NO: 2) or EILPGSGSTKDNERFKG (SEQ ID NO: 8);
- CDR H3 comprises a polypeptide comprising, consisting essentially of, or consisting of a polypeptide having at least 80%, 90%, or 95% sequence identity to the amino acid sequence DDSWYFDV (SEQ ID NO: 3) or REWGYYFDY (SEQ ID NO: 9);
- CDR L1 comprises a polypeptide comprising, consisting essentially of, or consisting of a polypeptide having at least 80%, 90%, or 95% sequence identity to the amino acid sequence QATQDIVKNLN (SEQ ID NO: 4) or KASQDVSTAVA (SEQ ID NO: 10);
- CDR L2 comprises a polypeptide comprising, consisting essentially of, or consisting of a polypeptide having at least 80%, 90%, or 95% sequence identity to the amino acid sequence YATELAE (SEQ ID NO: 5) or IYWASTRHT (SEQ ID NO: 11); and
- CDR L3 comprises a polypeptide comprising, consisting essentially of, or consisting of a polypeptide having at least 80%, 90%, or 95% sequence identity to the amino acid sequence LQFYAFPLT (SEQ ID NO: 6) or QQHYSTPYT (SEQ ID NO: 12).
- the antibody or the antigen-binding fragment comprises the variable heavy chain (VH) and the variable light chain (VL).
- the antibody or the antigen-binding fragment comprises at least 1, at least 2, or all least 3 framework regions (FR).
- the CDR H1 comprises a polypeptide comprising, consisting essentially of, or consisting of a polypeptide having the amino acid sequence RYWMYW (SEQ ID NO: 1) or DYWIE (SEQ ID NO: 7);
- CDR H2 comprises a polypeptide comprising, consisting essentially of, or consisting of a polypeptide having the amino acid sequence RLDPNSGVTKYNEKFKS (SEQ ID NO: 2) or EILPGSGSTKDNERFKG (SEQ ID NO: 8);
- CDR H3 comprises a polypeptide comprising, consisting essentially of, or consisting of a polypeptide having the amino acid sequence DDSWYFDV (SEQ ID NO: 3) or REWGYYFDY (SEQ ID NO: 9);
- CDR L1 comprises a polypeptide comprising, consisting essentially of, or consisting of a polypeptide having the amino acid sequence QATQDIVKNLN (SEQ ID NO: 4) or KASQDVSTAVA
- the disclosure relates to an antibody or an antigen-binding fragment thereof comprising a variable heavy chain (VH) comprising FR H1 -CDR H1 -FR H2 -CDR H2 -FR H3 -CDR H3 and a variable light chain (VL) comprising FR L1 -CDR L1 -FR L2 -CDR L2 -FR L3 -CDR L3 , wherein, FR 1 , FR 2 , and FR 3 , each, independently of one another, comprise antibody framework regions (FR) or are absent; and CDR 1 , CDR 2 , and CDR 3 , each, independently from one another, comprise antibody complementary determining regions (CDRs), wherein CDR H1 comprises a polypeptide comprising, consisting essentially of, or consisting of a polypeptide having at least 80%, 90%, or 95% sequence identity to the amino acid sequence SEQ ID NO: 1 or SEQ ID NO: 7; CDR H2 comprises a polypeptid
- the disclosure relates to one of the foregoing antibodies or antigen-binding fragments thereof comprising at least 1, at least 2, or all least 3 framework regions (FR).
- the disclosure relates to an antibody or an antigen-binding fragment thereof comprising, consisting essentially of, or consisting of the polypeptide sequences set forth in SEQ ID Nos: 1-6 or the polypeptide sequences set forth in SEQ ID NOs: 7-12.
- the disclosure relates to an antibody or an antigen-binding fragment thereof selected from (a) an antibody or an antigen-binding fragment thereof comprising CDR 1-3 of the VH chain comprising SEQ ID NOs: 1-3 and CDR 1-3 of the VL chain comprising SEQ ID NOs: 4-6; and (b) an antibody or an antigen-binding fragment thereof comprising CDR 1-3 of the VH chain comprising SEQ ID NOs: 7-9 and CDR 1-3 of the VL chain comprising SEQ ID NOs: 10-12.
- the disclosure relates to an antibody or an antigen-binding fragment thereof selected from an antibody or an antigen-binding fragment thereof comprising (1) a VH chain comprising the sequence set forth in SEQ ID NO: 33 or a fragment thereof; and (2) a VL chain comprising the sequence set forth in SEQ ID NO: 34 or a fragment thereof.
- the disclosure relates to an antibody or an antigen-binding fragment thereof selected from an antibody or an antigen-binding fragment thereof comprising (1) a VH chain comprising the sequence set forth in SEQ ID NO: 31 or a fragment thereof; and (2) a VL chain comprising the sequence set forth in SEQ ID NO: 32 or a fragment thereof.
- the disclosure relates to an antibody or an antigen-binding fragment thereof which comprises a single chain antibody fragment (scFV), an Fab fragment, or an F(ab′)2 fragment.
- scFV single chain antibody fragment
- Fab fragment
- F(ab′)2 fragment fragment
- the disclosure relates to an antibody or an antigen-binding fragment thereof which comprises (a) the structure FR H1 -CDR H1 -FR H2 -CDR H2 -FR H3 -CDR H3 -L-FR L1 -CDR L1 -FR L2 -CDR L2 -FR L3 -CDR L3 ; or (b) the structure FR L1 -CDR L1 -FR L2 -CDR L2 -FR L3 -CDR L3 -L-FR H1 -CDR H1 -FR H2 -CDR H2 -FR H3 -CDR H3 ; wherein, L is a linker or absent; FR 1 , FR 2 , and FR 3 , are each, independently of one another, antibody framework regions (FR) or absent; and CDR 1 , CDR 2 , and CDR 3 , each, independently from one another, comprise antibody complementary determining regions (CDRs) whose meaning
- the disclosure relates to an antibody or an antigen-binding fragment thereof which comprises the structure FR H1 -CDR H1 -FR H2 -CDR H2 -FR H3 -CDR H3 -L-FR L1 -CDR L1 -FR L2 -CDR L2 -FR L3 -CDR L3 ; wherein, L is a linker or absent; FR 1 , FR 2 , and FR 3 , are each, independently of one another, antibody framework regions (FR) or absent; and CDR 1 , CDR 2 , and CDR 3 , each, independently from one another, comprise antibody complementary determining regions (CDRs) whose meanings are provided above.
- L is a linker or absent
- FR 1 , FR 2 , and FR 3 are each, independently of one another, antibody framework regions (FR) or absent
- CDR 1 , CDR 2 , and CDR 3 each, independently from one another, comprise antibody complementary determining regions (CDRs)
- the disclosure relates to an antibody or an antigen-binding fragment thereof which binds to a polypeptide comprising at least 80%, at least 90%, at least 95% or at least 99% sequence identity to a polypeptide comprising, consisting essentially of, or consisting of the amino acid sequence set forth in SEQ ID NO: 77, or an immunogenic fragment thereof, where SEQ ID NO: 77 is SSGLTGATKIRLERSAKDITDEIDAIKKDAALKGVNFDAFKDKKTGSGVSENPFILEAKV RATTVAEKFVIAIEEEATKLKETGSSGEFSAMYDLMFEVSKPLQKLGIQEMTKTVSDAAE ENPPTTAQGVLEIAKKMREKLQRVHTKNYCTLKKKENSTFTDEKCKNN (SEQ ID NO: 77).
- the disclosure relates to an antibody or an antigen-binding fragment of the foregoing or following paragraphs, wherein the antibody further comprises a signal peptide and optionally a label, e.g., a detectable label.
- the disclosure relates to a composition
- a composition comprising an antibody or an antigen-binding fragment of the foregoing or following paragraphs, and a carrier.
- the disclosure relates to a pharmaceutical composition
- a pharmaceutical composition comprising an antibody or an antigen-binding fragment of the foregoing or following paragraphs, and a pharmaceutically acceptable carrier.
- the disclosure relates to a kit comprising, in one or more packages, an antibody or an antigen-binding fragment of the foregoing or following paragraphs, and a container, optionally together with instructions for using the kit.
- the disclosure relates to an antibody or an antigen-binding fragment of the foregoing or following paragraphs, which is not a naturally-occurring antibody or an antigen-binding fragment thereof.
- the disclosure relates to an antibody or an antigen-binding fragment of the foregoing or following paragraphs, which is a synthetic or a recombinant antibody or an antigen-binding fragment thereof.
- the disclosure relates to an antibody or an antigen-binding fragment of the foregoing or following paragraphs, which is a chimeric or humanized antibody or an antigen-binding fragment thereof.
- the disclosure relates to an antibody or an antigen-binding fragment of the foregoing or following paragraphs, which is an immunoglobulin G (IgG), immunoglobulin M (IgM), immunoglobulin A (IgA), immunoglobulin D (IgD), or immunoglobulin E (IgE) or an antigen-binding fragment thereof, preferably a chimeric IgG, IgM, IgE, IgA, IgD or IgE.
- IgG immunoglobulin G
- IgM immunoglobulin M
- IgA immunoglobulin A
- IgD immunoglobulin D
- IgE immunoglobulin E
- the disclosure relates to an antibody or an antigen-binding fragment of the foregoing or following paragraphs, which is a chimeric IgM antibody or an antigen-binding fragment thereof.
- the disclosure relates to a fusion protein comprising an antibody or an antibody-binding fragment thereof of the foregoing or following paragraphs and a heterologous protein.
- the disclosure relates to an article comprising an antibody or an antibody-binding fragment thereof of the foregoing or following paragraphs and a surface.
- the disclosure relates to an article comprising an antibody or an antibody-binding fragment thereof of the foregoing or following paragraphs and a surface which is a well, a nitrocellulose membrane, a test strip, a microbead or a microchip.
- the disclosure relates to a method of detecting DbpA antigen in a biological sample, comprising contacting the sample with an antibody or an antigen-binding fragment thereof of the foregoing or following paragraphs and detecting a complex formed between the DbpA antigen and the antibody.
- the disclosure relates to a method of treating a Lyme disease caused by Borrelia species, e.g., Borrelia burgdorferi , especially Borrelia burgdorferi sensu lato (s.l.) in a subject in need thereof, comprising contacting the subject's biological sample with an effective amount of a composition comprising an antibody or an antigen binding fragment thereof of the foregoing or following paragraphs and a carrier.
- Borrelia species e.g., Borrelia burgdorferi , especially Borrelia burgdorferi sensu lato (s.l.) in a subject in need thereof, comprising contacting the subject's biological sample with an effective amount of a composition comprising an antibody or an antigen binding fragment thereof of the foregoing or following paragraphs and a carrier.
- the disclosure relates to a method of treating a Lyme disease caused by Borrelia species, e.g., Borrelia burgdorferi , especially Borrelia burgdorferi sensu lato (s.l.), in a subject in need thereof, comprising administering into the subject, an effective amount of pharmaceutical composition comprising an antibody or an antigen binding fragment thereof of the foregoing or following paragraphs and a pharmaceutically acceptable carrier.
- a Lyme disease caused by Borrelia species e.g., Borrelia burgdorferi , especially Borrelia burgdorferi sensu lato (s.l.
- the disclosure relates to an antibody or an antigen-binding fragment thereof or a pharmaceutical composition thereof comprising the antibody and a carrier, as provided above, for use in diagnosing a Lyme disease in a subject.
- the disclosure relates to an antibody or an antigen-binding fragment thereof or a pharmaceutical composition thereof comprising the antibody or the antigen-binding fragment and a pharmaceutically acceptable carrier for use in treating a Lyme disease in a subject.
- the disclosure relates to a method of making the antibody or an antigen-binding fragment thereof of the foregoing or following paragraphs, comprising immunizing an animal with a polypeptide comprising at least 80%, at least 90%, at least 95% or at least 99% sequence identity to a polypeptide comprising, consisting essentially of, or consisting of the amino acid sequence set forth in SEQ ID NO: 77, or an immunogenic fragment thereof; and obtaining the antibody from the blood or sera of the animal; and optionally digesting the antibody with pepsin to obtain an F(ab′)2 fragment and/or with papain to obtain two Fab fragments.
- the disclosure relates to a method of making the antibody or an antigen-binding fragment thereof of the foregoing or following paragraphs, comprising culturing a hybridoma which comprises a nucleic acid encoding the antibody or the antigen-binding fragment thereof under conditions sufficient for the synthesis of the antibody; and obtaining the antibody from the culture.
- the disclosure relates to a method of making the antibody or an antigen-binding fragment thereof of the foregoing or following paragraphs, comprising culturing a hybridoma comprising plasmacytoma cells with antibody-producing B cells harvested from immunized mice.
- the disclosure relates to a method of making the antibody or an antigen-binding fragment thereof of the foregoing or following paragraphs, comprising chemical synthesis of the polypeptide sequences which make up the antibody or the antigen-binding fragment.
- the disclosure relates to use of an antibody or an antigen-binding fragment thereof or a pharmaceutical composition thereof of the foregoing or following paragraphs, for the manufacture of a medicament for diagnosing a Lyme disease in a subject.
- the disclosure relates to use of an antibody or an antigen-binding fragment thereof or a pharmaceutical composition thereof of the foregoing or following paragraphs, for the manufacture of a medicament for treating a Lyme disease caused by Borrelia species, e.g., Borrelia burgdorferi , especially Borrelia burgdorferi sensu lato (s.l.).
- Borrelia species e.g., Borrelia burgdorferi , especially Borrelia burgdorferi sensu lato (s.l.).
- the disclosure relates to a polypeptide comprising at least 80%, at least 90%, at least 95% or at least 99% sequence identity to a polypeptide comprising, consisting essentially of, or consisting of the amino acid sequence set forth in SEQ ID NO: 77, or an immunogenic fragment thereof.
- the disclosure relates to a fusion protein comprising a polypeptide comprising at least 80%, at least 90%, at least 95% or at least 99% sequence identity to a polypeptide comprising, consisting essentially of, or consisting of the amino acid sequence set forth in SEQ ID NO: 77 and a heterologous protein.
- the heterologous protein comprises keyhole limpet hemocyanin (KLH).
- the disclosure relates to a composition
- a composition comprising a polypeptide comprising at least 80%, at least 90%, at least 95% or at least 99% sequence identity to a polypeptide comprising, consisting essentially of, or consisting of the amino acid sequence set forth in SEQ ID NO: 77 and a carrier.
- the disclosure relates to a kit comprising, in one or separate packages, a polypeptide comprising at least 80%, at least 90%, at least 95% or at least 99% sequence identity to a polypeptide comprising, consisting essentially of, or consisting of the amino acid sequence set forth in SEQ ID NO: 77 and a carrier, optionally together with instructions for using the kit.
- the disclosure relates to a support comprising a polypeptide comprising at least 80%, at least 90%, at least 95% or at least 99% sequence identity to a polypeptide comprising, consisting essentially of, or consisting of the amino acid sequence set forth in SEQ ID NO: 77 and moiety for anchoring the polypeptide to the support.
- the anchoring moiety comprises biotin-streptavidin or biotin-avidin complex.
- the disclosure relates to a method of generating antibodies which bind specifically to Borrelia burgdorferi DbpA, comprising immunizing a host with a polypeptide comprising at least 80%, at least 90%, at least 95% or at least 99% sequence identity to a polypeptide comprising, consisting essentially of, or consisting of the amino acid sequence set forth in SEQ ID NO: 77; obtaining the antibodies generated by the host; and optionally modifying the host-generated antibodies.
- the modification comprises pepsin digestion or papain digestion or digestion with both pepsin and papain; and optionally comprising tagging a label (e.g., detectable label) to the antibody or the antigen-binding fragment.
- the disclosure relates to a nucleic acid encoding an antibody or an antigen-binding fragment thereof of the foregoing or following paragraphs. In some embodiments, the disclosure relates to a vector comprising the nucleic acid.
- the disclosure relates to a composition or a vaccine comprising a nucleic acid encoding an antibody or an antigen-binding fragment thereof of the foregoing or following paragraphs and a carrier.
- the disclosure relates to a host cell comprising a nucleic acid or a vector comprising the nucleic acid encoding an antibody or an antigen-binding fragment thereof of the foregoing or following paragraphs.
- the host cell is a mammalian host cell or an insect host cell.
- the disclosure relates to a method of generating the antibody, comprising culturing the host cell comprising the nucleic acid or the vector encoding an antibody or an antigen-binding fragment thereof of the foregoing or following paragraphs under conditions sufficient for the expression of the polypeptide and obtaining the antibody from the culture.
- the disclosure relates to a nucleic acid encoding an antigenic peptide of the foregoing or following paragraphs (e.g., SEQ ID NO: 77) or an immunogenic fragment thereof.
- the disclosure relates to a composition or a vaccine comprising a nucleic acid encoding an antigenic peptide of the foregoing or following paragraphs (e.g., SEQ ID NO: 77) or an immunogenic fragment thereof and a carrier.
- a nucleic acid encoding an antigenic peptide of the foregoing or following paragraphs (e.g., SEQ ID NO: 77) or an immunogenic fragment thereof and a carrier.
- the disclosure relates to a composition or a vaccine comprising a vector comprising the nucleic acid encoding an antigenic peptide of the foregoing or following paragraphs (e.g., SEQ ID NO: 77) or an immunogenic fragment thereof.
- the disclosure relates to a host cell comprising a nucleic acid or a vector comprising a nucleic acid encoding an antigenic peptide of the foregoing or following paragraphs (e.g., SEQ ID NO: 77) or an immunogenic fragment thereof.
- the host cell is a mammalian host cell or an insect host cell.
- the disclosure relates to a method of generating the antigen of the foregoing or following paragraphs (e.g., SEQ ID NO: 77) or an immunogenic fragment thereof, comprising culturing the host cell comprising a vector or a nucleic acid encoding the antigenic polypeptide (e.g., SEQ ID NO: 77) or a immunogenic fragment thereof under conditions sufficient for the expression of the polypeptide; and obtaining the antigen from the culture.
- a method of generating the antigen of the foregoing or following paragraphs e.g., SEQ ID NO: 77
- an immunogenic fragment thereof comprising culturing the host cell comprising a vector or a nucleic acid encoding the antigenic polypeptide (e.g., SEQ ID NO: 77) or a immunogenic fragment thereof under conditions sufficient for the expression of the polypeptide; and obtaining the antigen from the culture.
- FIGS. 1 A- 1 D show SDS-PAGE analysis of purification of various proteins by CAPTURESELECT IgM/HITRAP IgM column.
- FIGS. 1 A- 1 B show electrophoretic resolution of 6G8 under reducing ( FIG. 1 A ) and non-reducing ( FIG. 1 B ) conditions;
- FIGS. 1 C- 1 D show electrophoretic resolution of 8C10 under reducing ( FIG. 1 C ) and non-reducing ( FIG. 1 D ) conditions.
- FIG. 2 A and FIG. 2 B show chromatographic profiles of purified chimeric proteins.
- FIG. 2 A shows HPLC SEC profile of 6G8.
- FIG. 2 B shows HPLC SEC profile of 8C10.
- FIG. 3 shows the results of BIACORE testing of binding between 6G8 and CM5 chip-immobilized DbpA antigen.
- the binding assay was performed at 4 different concentrations of 6G8: 60 ⁇ g/ml, 30 ⁇ g/ml, 15 ⁇ g/ml, and 7.5 ⁇ g/ml.
- FIG. 4 shows the results of BIACORE testing of binding between 8C10 and CM5 chip-immobilized DbpA antigen. Assay was performed at 8 different concentrations of 8C10: 250 g/ml, 125 ⁇ g/ml, 62 ⁇ g/ml, 31 ⁇ g/ml, 16 ⁇ g/ml, 8 ⁇ g/ml, 4 ⁇ g/ml, and 2 ⁇ g/ml.
- FIG. 5 A and FIG. 5 B show the results of immunoassay testing for IgM.
- FIG. 5 A shows test results with 6G8.
- FIG. 5 B shows test results with 8C10.
- FIG. 6 show the results of testing of additional batches of DbpA_8C10 (lots 4, 5, and 6).
- Standard techniques are used, for example, for nucleic acid purification and preparation, chemical analysis, recombinant nucleic acid, and oligonucleotide synthesis.
- Enzymatic reactions and purification techniques are performed according to manufacturer's specifications or as commonly accomplished in the art or as described herein.
- the techniques and procedures described herein are generally performed according to conventional methods well known in the art and as described in various general and more specific references that are cited and discussed throughout the instant specification. See, e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual (4 th ed., CSH Press, Cold Spring Harbor, N.Y.
- the word “about” means a range of plus or minus 10% of that value, e.g., “about 5” means 4.5 to 5.5, “about 100” means 90 to 100, etc., unless the context of the disclosure indicates otherwise, or is inconsistent with such an interpretation.
- “about 49, about 50, about 55” means a range extending to less than half the interval(s) between the preceding and subsequent values, e.g., more than 49.5 to less than 52.5.
- the phrases “less than about” a value or “greater than about” a value should be understood in view of the definition of the term “about” provided herein.
- substantially means sufficient to work for the intended purpose.
- the term “substantially” thus allows for minor, insignificant variations from an absolute or perfect state, dimension, measurement, result, or the like such as would be expected by a person of ordinary skill in the field but that do not appreciably affect overall performance.
- “substantially” means within 10%, or within 5% or less, e.g., with 2%.
- substantially purified refers to nucleic acids, amino acids or antibodies that are removed from their natural environment and are isolated or separated, and are at least about 60% free, preferably about 75% free, most preferably about 90%, especially about 95% free and particularly about 99% free from other components with which they are naturally associated.
- set means one or more, e.g., at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, or more than 6.
- the term “plurality” can be 2, 3, 4, 5, 6, 7, 8, 9, 10, or more.
- the term “synthetic” refers to a molecule, e.g., a polypeptide or a polynucleotide, which has been manufactured by artificial chemical synthesis or biosynthesis (e.g., genetic engineering-based production).
- the term relates to non-naturally-occurring molecules constructed by one of the methods mentioned above or by other suitable methods known in the art.
- isolated means a nucleic acid sequence or a polypeptide sequence that is separated from the wild or native sequence in which it naturally occurs or is in an environment different from that in which the sequence naturally occurs.
- peptide includes synthetic or natural peptides comprising a linear chain or branched chain of amino acids, peptidomimetics, as well as pharmaceutically acceptable salts thereof.
- a peptide comprises a plurality of amino acid residues, e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 or more, e.g., 200 amino acid residues (particularly about 2-60 amino acid residues; especially about 2-30 amino acid residues) which are bonded to each other via covalent bonds, e.g., a peptide bond.
- protein is often used in reference to relatively large polypeptides, and “peptide” is often used in reference to small polypeptides, usage of these terms in the art overlaps and varies.
- polypeptide will be used herein, although in some cases, the art may refer to the same polymer as a “protein.” Unless otherwise indicated, the sequence for a polypeptide is given in the order from the amino terminus to the carboxyl terminus. Typically a peptide contains an amino (NH 2 ) terminus (free or modified) and a carboxy (COOH) terminus (free or modified); the directionality of the polypeptide chain flowing from the amino (NH 2 ) group to the carboxyl (COOH) group.
- amino acid includes the 22 amino acids that are proteinogenic amino acids and non-proteinogenic amino acids.
- proteinogenic amino acid is used in the field of biochemistry to refer to the 22 amino acids that are incorporated into eukaryotic and/or prokaryotic proteins during translation, such as: (a) histidine (His; H); (b) isoleucine (Ile; I); (c) leucine (Leu; L); (d) Lysine (Lys; K); (e) methionine (Met; M); (f) phenylalanine (Phe; F); (g) threonine (Thr; T); (h) tryptophan (Trp; W); (i) valine (Val; V); (j) arginine (Arg; R); (k) cysteine (Cys; C); (1) glutamine (Gln; Q); (m) glycine (Gly; G); (n) proline (Pro; P); (o)
- non-proteinogenic amino acid is used in the field of biochemistry to refer to naturally occurring and non-naturally occurring amino acids that are not proteinogenic amino acids, such as (1) citrulline (Cit); (2) cystine; (3) gama-amino butyric acid (GABA); (4) ornithine (Orn); (5) theanine; (6) homocysteine (Hey); (7) thyroxine (Thx); and amino acid derivatives such as betaine; carnitine; carnosine creatine; hydroxytryptophan; hydroxyproline (Hyp); N-acetyl cysteine; S-Adenosyl methionine (SAM-e); taurine; tyramine, D-amino acids such as D-alanine (D-Ala); Norleucine (Nle); 4-hydroxyproline (HYP); 3,4-dehydro-L-proline (DHP); aminoheptanoic acid (AHP); (2R,5S)-5-phenyl-pyr
- amino acid residue means the individual amino acid units incorporated into a polypeptide. Amino acid residues are generally preferred to be in the “L” isomeric form. However, residues in the “D” isomeric form can be substituted for any L-amino acid residue, as long as the desired functional property (e.g., antibody binding) is retained by the polypeptide. It should be noted that all amino-acid residue sequences are represented herein by formulae whose left and right orientation is in the conventional direction of amino-terminus to carboxy-terminus. Furthermore, it should be noted that a dash at the beginning or end of an amino acid residue sequence indicates a peptide bond to a further sequence of one or more amino-acid residues.
- a “domain” as used herein, is a portion of a protein that has a tertiary structure.
- the domain may be connected to other domains in the complete protein by short flexible regions of polypeptide.
- the domain may represent a functional portion.
- an immunoglobulin molecule contains heavy and light chains, each chain containing a series of similar, although not identical, amino acid sequences. Each of these repeats corresponds to a discrete, compactly folded region of protein structure known as a protein domain.
- the light chain is made up of two such immunoglobulin domains, whereas the heavy chain of the IgG antibody contains four.
- the amino-terminal sequences of both the heavy and light chains vary greatly between different antibodies and the remaining domains are constant between immunoglobulin chains of the same isotype.
- the amino-terminal variable domains (V) of the heavy and light chains confer on it the ability to bind specific antigen, while the constant domains (C domains) of the heavy and light chains (CH and CL, respectively) make up the C region.
- the multiple heavy-chain C domains are numbered from the amino-terminal end to the carboxy terminus, for example CH1, CH2, CH3, and so on.
- a “conservative” amino acid substitution generally refer to substitution of one amino acid residue with another amino acid residue from within a recognized group which typically changes the structure of the peptide by biological activity of the peptide is substantially retained.
- Conservatively substituted amino acids can be identified using a variety of well know methods, such as a blocks substitution matrix (BLOSUM), e.g., BLOSUM62 matrix.
- BLOSUM is a substitution matrix used for sequence alignment of proteins, wherein an alignment score is used to map out relationship between evolutionarily divergent protein sequences. They are based on local alignments.
- a BLOSUM62 substitution matrix can be found in the world-wide-web URL NCBI(dot)NLM(dot)NIH(dot)GOV/class/fieldguide/BLOSUM62.txt, which is incorporated by reference.
- substantially identical in reference to an amino sequence or nucleotide sequence means that a candidate sequence is at least 80% sequence identical to the reference sequence over a given comparison window (e.g., 250 amino acids).
- substantially similar sequences include those having, for example, at least 85% sequence identity, at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%, or greater, e.g., 99.5%, sequence identity.
- Two sequences that are identical to each other are also substantially similar.
- the comparison window or the length of comparison sequence will generally be at least the length of antibody binding fragment of the candidate. Sequence identity is calculated based on the reference sequence, and algorithms for sequence analysis are known in the art.
- the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in the sequence of one polypeptide for optimal alignment with the other polypeptide).
- the amino acid residues at corresponding amino acid positions are then compared. When a position in one sequence is occupied by the same amino acid residue as the corresponding position in the other sequence, then the molecules are identical at that position.
- Percent sequence identity between two polypeptide sequences can be determined using the Vector NTI software package (Invitrogen Corp., Carlsbad, Calif.). A gap opening penalty of 10 and a gap extension penalty of 0.1 are used for determining the percent identity of two polypeptides. All other parameters are set at the default.
- the term “derivative” includes salts, amides, esters, enol ethers, enol esters, acetals, ketals, acids, bases, solvates, hydrates, polymorphs or prodrugs of the individual amino acids, antigenic peptides or antibodies (or their antigen-binding fragments).
- Derivatives may be readily prepared by those of skill in this art using known methods for such derivatization.
- the derivatives suitable for use in the methods described herein may be administered to animals or humans without substantial toxic effects and either are biologically active or are prodrugs.
- Derivatives include solvent addition forms, e.g., a solvate or alcoholate.
- Derivatives further include amides or esters of the amino acids and/or isomers (e.g., tautomers or stereoisomers).
- salt includes salts derived from any suitable of organic and inorganic counter ions well known in the art and include, by way of example, hydrochloric acid salt or a hydrobromic acid salt or an alkaline or an acidic salt of the amino acids or peptides.
- solvate refers to compounds containing either stoichiometric or non-stoichiometric amounts of a solvent, and may be formed during the process of crystallization with acceptable solvents such as water, ethanol, and the like. “Hydrates” are formed when the solvent is water; alcoholates are formed when the solvent is alcohol. Solvates of compounds described herein can be conveniently prepared or formed using routine techniques. “Polymorphs” refer to alternate crystal forms of the compounds described herein.
- Polymorphic purity of drug samples can be checked using techniques such as powder X-ray diffraction, IR/Raman spectroscopy, and utilizing the differences in their optical properties in some cases (Thomas et al., Chemical Communications, 48: 10559-10561 (2012)).
- amino acid analogs are compounds that are structurally or chemically similar to an amino acid.
- Many suitable amino acid analogs are known in the art, and representative examples include, e.g., p-Acetylphenylalanine, m-Acetylphenylalanine, 0-allyltyrosine, Phenylselenocysteine, p-Propargyloxyphenylalanine, p-Azidophenylalanine, p-Boronophenylalanine, O-methyltyrosine, p-Aminophenylalanine, p-Cyanophenylalanine, m-Cyanophenylalanine, p-Fluorophenylalanine, p-Iodophenylalanine, p-Bromophenylalanine, p-Nitrophenylalanine, L-DOPA, 3-Aminotyrosine, 3-Iodoty
- the term includes modified or unusual amino acids e.g., D-amino acids, hydroxylysine, 4-hydroxyproline, N-Cbz-protected amino acids, 2,4-diaminobutyric acid, homoarginine, norleucine, N-methylaminobutyric acid, naphthylalanine, phenylglycine, -phenylproline, tert-leucine, 4-aminocyclohexylalanine, N-methyl-norleucine, 3,4-dehydroproline, N,N-dimethylaminoglycine, N-methylaminoglycine, 4-aminopiperidine-4-carboxylic acid, 6-aminocaproic acid, trans-4-(aminomethyl)-cyclohexanecarboxylic acid, 2-, 3-, and 4-(aminomethyl)-benzoic acid, 1-aminocyclopentanecarboxylic acid, 1-aminocyclopropanecarbox
- polypeptide refers to a polypeptide containing one or more N-substituted glycine residues.
- An N-substituted amino acid residue has a standard amino acid side-chain pendant from the N, rather than from the a-carbon.
- Representative examples of peptoids are provided in, e.g., U.S. Pat. Nos. 6,075,121 and 6,887,845.
- variant in the context of a polypeptide refers an amino acid sequence in which one or more amino acids are added and/or substituted and/or deleted and/or inserted in the sequences of the DbpA antigen or the antibody that binds thereto.
- a “consensus” amino acid is an amino acid chosen to occupy a given position in the consensus polypeptide obtained by this method.
- a system which is organized to select consensus amino acids as described above may be a computer program, or a combination of one or more computer programs with “by hand” analysis and calculation.
- a set of amino acid sequences existing within the group of amino acid sequences from which the consensus sequence is prepared means a set of such sequences which are more similar to each other than to other members of the group, based on the evolutionary similarity analysis performed above.
- An example of such a group is a species where a set with in the group would be members of a particular polypeptide, e.g., antigenic regions.
- fusion protein refers to a peptide or a functional fragment thereof, that is bonded through a bond, e.g., a peptide bond (or amide bond), to an amino acid sequence that is not bonded naturally in the parent peptide.
- fusion polypeptides include fusions of an antigenic peptide of the disclosure (or a functional fragment thereof) to a heterologous protein or polypeptide, e.g., a polypeptide comprising all or a portion of a protein which is not B. burgdorferi DbpA.
- polynucleotide and “nucleic acid molecule” are used herein to include a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides. This term refers only to the primary structure of the molecule. Thus, the term includes triple-, double- and single-stranded DNA, as well as triple-, double- and single-stranded RNA. It also includes modifications, such as by methylation and/or by capping, and unmodified forms of the polynucleotide.
- polynucleotide and “nucleic acid molecule” include polydeoxyribonucleotides (containing 2-deoxy-D-ribose), polyribonucleotides (containing D-ribose), any other type of polynucleotide which is an N- or C-glycoside of a purine or pyrimidine base, and other nonnucleotidic backbones, for example, polyamide (e.g., peptide nucleic acids (PNAs)) and polymorpholino polymers (commercially available from the Anti-Virals, Inc., Corvallis, Oreg., USA, as NEUGENE), and other synthetic sequence-specific nucleic acid polymers provided that the polymers contain nucleobases in a configuration which allows for base pairing and base stacking, such as is found in DNA and RNA. There is no intended distinction in length between the terms “polynucleotide” and “nucleic acid molecule.”
- nucleotide refers to molecules that, when joined, make up the individual structural units of the nucleic acids RNA and DNA.
- a nucleotide is composed of a nucleobase (nitrogenous base), a five-carbon sugar (either ribose or 2-deoxyribose), and one phosphate group.
- Nucleic acids as used herein are polymeric macromolecules made from nucleotide monomers.
- the purine bases are adenine (A) and guanine (G), while the pyrimidines are thymine (T) and cytosine (C).
- RNA uses uracil (U) in place of thymine (T).
- nucleic acid can be a polymeric form of nucleotides of any length, can be DNA or RNA, and can be single- or double-stranded.
- Nucleic acids can include promoters or other regulatory sequences. Oligonucleotides can be prepared by synthetic means. Nucleic acids include segments of DNA, or their complements spanning or flanking any one of the polymorphic sites.
- the segments can be between 5 and 1000 contiguous bases and can range from a lower limit of 5, 20, 50, 100, 200, 300, 500, 700 or 1000 nucleotides to an upper limit of 500, 1000, 2000, 5000, or 10000 nucleotides (where the upper limit is greater than the lower limit).
- Nucleic acids between 5-20, 50-100, 50-200, 100-200, 120-300, 150-300, 100-500, 200-500, or 200-1000 bases are common.
- a reference to the sequence of one strand of a double-stranded nucleic acid defines the complementary sequence and except where otherwise clear from context, a reference to one strand of a nucleic acid also refers to its complement.
- complementarity means the ratio of complementary base pairs between sequences to be compared. All the numeric values of “complementarity” shown in the present specification need only to be numeric values calculated as homology between the complementary strands of one nucleotide sequence and another nucleotide sequence using a homology search program generally known by those skilled in the art.
- numeric values of complementarity can be calculated easily using default (initial setting) parameters in, for example, FASTA or BLAST.
- Methods for generating polynucleotides that are complementary to a template nucleic acid sequence are known in the art. See, e.g., using the “Reverse Complement” program available via The Sequence Manipulation Suite at Bioinformatics(dot)Org.
- RNA equivalent of nucleic acids include variants of a template DNA sequence containing at least one, if not all, bases and/or sugars commonly found in RNA molecules.
- Methods for generating RNA equivalents of template DNA sequences are known in the art, e.g., sequence editor tools available via the Health Sciences Library System at the University of Pittsburgh.
- sequence refers to the actual nucleotide sequence obtained from sequencing; for example, DNA having the sequence AGTCC.
- sequence refers to a process whereby the nucleotide sequence of a polynucleotide, e.g., DNA, or order of nucleotides, is determined, such as a nucleotide order AGTCC, etc.
- variation refers to a change or deviation.
- a variation refers to a difference(s) or a change(s) between DNA nucleotide sequences, including differences in bases.
- This actual difference in nucleotides between DNA sequences may be a single nucleotide polymorphism (SNP), and/or a change in a DNA sequence, e.g., fusion, deletion, addition, repeats, etc., observed when a sequence is compared to a reference, such as, e.g., a B. burgdorferi DbpA sequence of SEQ ID NO: 78 or an immunogenic fragment thereof.
- SNP single nucleotide polymorphism
- hybridization refers to any process by which a strand of nucleic acid bonds with a complementary strand through base pairing.
- hybridization under high stringency conditions could occur in about 50% formamide at about 37° C. to 42° C.
- Hybridization could occur under reduced stringency conditions in about 35% to 25% formamide at about 30° C. to 35° C.
- hybridization could occur under high stringency conditions at 42° C. in 50% formamide, 5 ⁇ SSPE, 0.3% SDS, and 200 ⁇ g/ml sheared and denatured salmon sperm DNA.
- Hybridization could occur under reduced stringency conditions as described above, but in 35% formamide at a reduced temperature of 35° C.
- the temperature range corresponding to a particular level of stringency can be further narrowed by calculating the purine to pyrimidine ratio of the nucleic acid of interest and adjusting the temperature. Variations on the above ranges and conditions are well known in the art.
- hybridization complex refers to a complex formed between two nucleic acid sequences by virtue of the formation of hydrogen bonds between complementary bases.
- a hybridization complex may be formed in solution or formed between one nucleic acid sequence present in solution and another nucleic acid sequence immobilized on a solid support (e.g., paper, plastic, membranes, filters, chips, or any other appropriate substrate).
- nucleic acid derivatives include, e.g., methylphosphonates, phosphotriesters, phosphorothioates, phosphoramidates and the like.
- Nucleic acid derivatives may contain modification of the sugar, base, or phosphate portion of a nucleotide.
- oligonucleotides may be derivatized at the bases, the sugars, the ends of the chains, or at the phosphate groups of the backbone to promote in vivo stability.
- CpG sequences may be derivatized to minimize degradation; derivatization may be alkylation, and is preferably methylation.
- phosphate linkages are sensitive to nuclease activity.
- Preferred derivatives are the methylphosphonates, phosphotriesters, phosphorothioates, and phosphoramidates. Derivatives may also contain alternating phosphorothioate and unmodified linkages, or alternating methylphosphonate and unmodified linkages, or alternating phosphorothioate and methylphosphonate linkages.
- the phosphate linkages may be completely substituted with non-phosphate linkages such as amide linkages. Appendages to the ends of the oligonucleotide chains also provide exonuclease resistance.
- the 5′ or 3′ end may be derivatized or “capped” with a phosphoramidate linkage, an inverted nucleotide conjugated to the oligonucleotide via a 3′-3′ linkage, an aminoacridine residue, or poly-L-lysine.
- nucleic acid “analog” includes oligonucleotides having residues or linkers synthetically introduced therein, such as a ribonucleic acid residue within a DNA sequence, a branching linking agent such as a glycerol derivative, or an aminoalkyl linker, for example.
- Nucelic acid “adduct” includes, for example, O6-alkyl-dG and O6-Me-dG.
- nucleic acid “conjugate” refers to a molecule covalently or non-covalently bound to one or more polynucleotides, e.g., a linear, branched, or dendritic polynucleotide covalently or non-covalently bound to a fluorescent dye molecule.
- oligonucleotide refers to a nucleic acid sequence of at least about 6 nucleotides to 60 nucleotides, preferably about 15 to 30 nucleotides, and most preferably about 20 to 25 nucleotides, which can be used in PCR amplification or in a hybridization assay.
- operably linked refer to functionally related nucleic acid sequences.
- a promoter is operably linked with a coding sequence if the promoter controls the transcription of the encoded polypeptide. While operably linked nucleic acid sequences can be contiguous and in reading frame, certain elements, e.g., repressor genes, may not be contiguously linked but still bind to operator sequences that control expression of the polypeptide product.
- vector refers to a molecule that is capable of transferring nucleic acid sequences to target cells (e.g., viral vectors, non-viral vectors, particulate carriers, and liposomes).
- target cells e.g., viral vectors, non-viral vectors, particulate carriers, and liposomes.
- vector construct means any nucleic acid construct capable of directing the expression of a nucleic acid of interest and which can transfer nucleic acid sequences to target cells.
- the term includes cloning, expression, and viral vectors.
- reporter refers to molecule, e.g., a DNA, RNA, and/or polypeptide sequence, that is detectable in any detection system, including, but not limited to enzyme (e.g., ELISA, as well as other histochemical assays), fluorescent, and luminescent systems.
- enzyme e.g., ELISA, as well as other histochemical assays
- fluorescent e.g., IL-12
- luminescent systems e.g., ⁇ -glucuronidase, green fluorescent protein (GFP), E.
- coli ⁇ -galactosidase (LacZ), Halobacterium ⁇ -galactosidase, Neuropsora tyrosinase, human placental alkaline phosphatase, and chloramphenicol acetyl transferase (CAT), Aequorin (jellyfish bioluminescence), Firefly luciferase (EC 1.13.12.7) form Photinus pyralis, Renilla luciferase (EC 1.13.12.5) from the sea pansy Renilla reniformis , and Bacterial luciferase (EC 1.14.14.3) from Photobacterium fischeri .
- LacZ Halobacterium ⁇ -galactosidase
- Neuropsora tyrosinase Neuropsora tyrosinase
- human placental alkaline phosphatase and chloramphenicol acetyl transferase (CAT
- the reporter comprises a luciferin-luciferase system.
- luciferin-luciferase system refers to any process or method that allows the contact of luciferin and luciferase in the presence of a substrate (i.e., for example, cAMP) under conditions such that the resulting luminescence may be detected.
- a substrate i.e., for example, cAMP
- Such a system may be comprised within a transfected host cell or provided in separate kit containers whereby the contents may be mixed together.
- an “antibody” includes whole antibodies and any antigen binding fragment or a single chain thereof.
- the antibody includes any protein or peptide containing molecule that comprises at least a portion of an immunoglobulin molecule, such as but not limited to at least one complementarity determining region (CDR) of a heavy or light chain or a ligand binding portion thereof, a heavy chain or light chain variable region, a heavy chain or light chain constant region, a framework (FR) region, or any portion thereof, or at least one portion of a binding protein, which can be incorporated into an antibody of the present disclosure.
- CDR complementarity determining region
- antibody is further intended to encompass antibodies, digestion fragments, specified portions and variants thereof, including antibody mimetics or comprising portions of antibodies that mimic the structure and/or function of an antibody or specified fragment or portion thereof, including single chain antibodies and fragments thereof.
- Functional fragments include antigen-binding fragments to a preselected target.
- binding fragments encompassed within the term “antigen binding portion” of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH, domains; (ii) a F(ab′)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH, domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR).
- a Fab fragment a monovalent fragment consisting of the VL, VH, CL and CH, domains
- a F(ab′)2 fragment a bivalent fragment comprising two Fab fragments linked by a dis
- the two domains of the Fv fragment, VL and VH are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et al., Science 242:423-426, 1988; Huston et al., PNAS USA, 85:5879-5883, 1988), including diabodies.
- single chain Fv single chain Fv
- Such single chain antibodies and diabodies are also intended to be encompassed within the term “antigen-binding portion” of an antibody.
- diabody refers a noncovalent dimer of single-chain Fv (scFv) fragment that consists of the heavy chain variable (VH) and light chain variable (VL) regions connected by a small peptide linker.
- scFv single-chain Fv
- Another form of diabody is single-chain (Fv)2 in which two scFv fragments are covalently linked to each other.
- single domain antibody refers to a type of single chain antibody comprising a variable region (VH) of a heavy chain of a human antibody.
- SdAbs are antibody fragments consisting of a single monomeric variable antibody domain. They are derived, for example, from heavy chain antibodies derived from humans, which consist only of two antibody heavy chains, with no light chain. With a molecular weight of only 12-15 kDa, sdAbs are much smaller than monoclonal antibodies (mAbs), e.g., IgG antibodies (150-160 kDa), which have two heavy protein chains and two light chains.
- mAbs monoclonal antibodies
- SdAbs may be derived from any species including, but not limited to mouse, human, camel, llama, goat, rabbit, bovine.
- the sdAb can be modified versions of a naturally occurring immunoglobulin known as heavy chain antibody devoid of light chains.
- immunoglobulins are disclosed in U.S. Pat. Nos. 8,293,233 and 9,371,371; and U.S. Pub. No. 2011-0052565.
- the variable domain derived from a heavy chain antibody naturally devoid of light chain is known herein as a VHor sdAb to distinguish it from the conventional VHof four chain immunoglobulins.
- epitope means a protein determinant capable of specific binding to an antibody.
- Epitopes usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three-dimensional structural characteristics, as well as specific charge characteristics. Conformational and nonconformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents.
- native conformational epitope or “native protein epitope” are used interchangeably herein, and include protein epitopes resulting from conformational folding of the DbpA molecule which arise when amino acids from differing portions of the linear sequence of the DbpA molecule come together in close proximity in 3-dimensional space. Such conformational epitopes are distributed on the extracellular side of the plasma membrane.
- paratope or “an antigen-binding site” refers to the part of an antibody which recognizes and binds to an antigen. Generally, paratopes comprise 5 to 10 amino acids of the antibody's Fv region, part of the fragment antigen-binding region (Fab), and contains parts of the antibody's heavy and light chains.
- Fab fragment antigen-binding region
- the term “bispecific molecule” is intended to include any agent, e.g., a protein, peptide, or protein or peptide complex, which has two different binding specificities.
- the molecule may bind to, or interact with, (a) a cell surface antigen and (b) an Fc receptor on the surface of an effector cell.
- multispecific molecule or “heterospecific molecule” is intended to include any agent, e.g., a protein, peptide, or protein or peptide complex, which has more than two different binding specificities.
- the molecule may bind to, or interact with, (a) a cell surface antigen, (b) an Fc receptor on the surface of an effector cell, and (c) at least one other component.
- the disclosure includes bispecific, trispecific, tetraspecific, and other multispecific molecules which are directed to cell surface antigens, such as DbpA, and to other targets, such as Fc receptors on effector cells.
- bivalent antibody refers to antibodies in which the VH and VL domains are expressed on a single polypeptide chain, but using a linker that is too short to allow for pairing between the two domains on the same chain, thereby forcing the domains to pair with complementary domains of another chain and creating two antigen binding sites (see e.g., Holliger et al., PNAS USA, 90, 6444-8, 1993; Poljak et al., Structure, 2, 1121-23, 1994).
- Multivalent antibodies include two or more binding domains which may all be of the same specificity or may have multiple specificities.
- chimeric antibodies are those antibodies that retain distinct domains, usually the variable domain, from one species and the remainder from another species; e.g., mouse-human chimeras.
- the term “human antibody”, as used herein, is intended to include antibodies having variable and constant regions derived from or closely matching human germline immunoglobulin sequences.
- the human antibodies of the disclosure may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo such as during the recombination of V, D, and J segments of the human heavy chain).
- human antibody refers to an antibody in which substantially every part of the protein (e.g., CDR, framework, C L , C H domains (e.g., C H 1, C H 2, C H 3), hinge, (V L , V H )) is substantially similar to those encoded by human germline antibody genes.
- Human antibodies have been classified into groupings based on their amino acid sequence similarities (Nikoloudis et al., Peer J., 2, e456, 2014; Adolf-Bryfogle et al., Nucleic Acids Res., 43, D432-8, 2015).
- an antibody with similar linear sequence can be chosen as a template to select or create human or humanized antibodies.
- humanization also called reshaping or CDR-grafting
- mAbs monoclonal antibodies
- ADCC complement activation, C1q binding
- the engineered mAb can be produced using the techniques of molecular biology, using phage displayed randomized sequences, or synthesized de novo.
- the design might include variations such as conservative amino acid substitutions in residues of the CDRs, and back substitution of residues from the nonhuman mAb into the human framework regions (back-mutations).
- the positions can be discerned or identified by sequence comparison methods, consensus sequence analysis, or structural analysis of the variable regions' 3D structure.
- Computer programs are available which illustrate and display probable three-dimensional conformational structures of selected candidate immunoglobulin sequences. Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate immunoglobulin sequence, i.e., the analysis of residues that influence the ability of the candidate immunoglobulin to bind its antigen.
- FR (framework) residues can be selected and combined from the consensus and import sequences so that the desired antibody characteristic, such as increased affinity for the target antigen(s), is achieved.
- Another approach to humanization is to modify only surface residues of the rodent sequence with the most common residues found in human mAbs and has been termed “resurfacing” or “veneering.”
- Known human Ig sequences are disclosed in, e.g., IGBLAST (NCBI); Kabat et al., Sequences of Proteins of Immunological Interest, DIANE Publishing, 1992.
- Humanization or engineering of antibodies of the present disclosure can be performed using any known method, such as but not limited to those described in, Jones et al., Nature 321:522 (1986); Riechmann et al., Nature 332:323 (1988); Verhoeyen et al., Science 239:1534 (1988)), Sims et al., J.
- CDR refers to the complementarity determining region or hypervariable region amino acid residues of an antibody which are responsible for antigen-binding.
- the hypervariable region or CDRs of the human IgG subtype of antibody typically comprise amino acid residues from residues 24-34 (L1), 50-56 (L2) and 89-97 (L3) in the light chain variable domain and 31-35 (H1), 50-65 (H2) and 95-102 (H3) in the heavy chain variable domain as described by Kabat et al. (supra) and/or those residues from a hypervariable loop in the heavy chain variable domain as described by Chothia et al. ( J. Mol. Biol. 196: 901-17, 1987).
- Framework or FR residues are those variable domain residues other than and bracketing the hypervariable regions.
- the term “monoclonal antibody” refers to a preparation of antibody molecules of single molecular composition.
- a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
- the term “human monoclonal antibody” refers to antibodies displaying a single binding specificity which have variable and constant regions derived from human germline immunoglobulin sequences.
- recombinant antibody refers to antibodies that are prepared, expressed, created or isolated by recombinant means, such as (a) antibodies isolated from an animal or a hybridoma prepared therefrom (described further in Section I, below), (b) antibodies isolated from a host cell transformed to express the antibody, e.g., from a transfectoma, (c) antibodies isolated from a recombinant, combinatorial human or other species antibody library, and (d) antibodies prepared, expressed, created or isolated by any other means that involve splicing of immunoglobulin gene sequences to other DNA sequences.
- recombinant means such as (a) antibodies isolated from an animal or a hybridoma prepared therefrom (described further in Section I, below), (b) antibodies isolated from a host cell transformed to express the antibody, e.g., from a transfectoma, (c) antibodies isolated from a recombinant, combinatorial human or other species antibody library, and (d) antibodies prepared, expressed, created or isolated by
- isolated antibody refers to an antibody which is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds to DbpA is substantially free of antibodies that specifically bind antigens other than DbpA).
- An isolated antibody that specifically binds to an epitope, isoform or variant of DbpA may, however, have cross-reactivity to other related antigens, e.g., from other species (e.g., DbpA species homologs).
- an isolated antibody may be substantially free of other cellular material and/or chemicals.
- isolated monoclonal antibodies having different specificities are combined in a well-defined manner to formulate the composition.
- high affinity for an antibody refers to an antibody having a K D of 10 ⁇ 8 M or less, more preferably 10 ⁇ 9 M or less and even more preferably 10 ⁇ 10 M or less, e.g., 10 ⁇ 11 M or even 10 ⁇ 12 M.
- “high affinity” binding can vary for other antibody isotypes.
- “high affinity” binding in the context of an IgM isotype may to an antibody having a K D of 10 ⁇ 7 M or less, more preferably 10 ⁇ 8 M or less, e.g., 10 ⁇ 9 M.
- K dis dissociation constant
- K D dissociation rate of a particular antibody-antigen interaction
- K 2 rate of dissociation
- K D k2/k1 or k off /k on and is expressed as a molar concentration (M). It follows that the smaller Kd, the stronger the binding. So 10 ⁇ 6 M (or 1 ⁇ M) indicates weak binding compared to 10 ⁇ 9 M (or 1 nM).
- telomere binding when made in reference to the binding of two molecules, e.g., antibody and an antigen, refer to an interaction which is dependent upon the presence of a particular structure on the molecule(s). For example, if an antibody is specific for epitope “A” on the molecule, then the presence of a protein containing epitope A (or free, unlabeled A) in a reaction containing labeled “A” and the antibody will reduce the amount of labeled A bound to the antibody.
- the level of binding of an antibody to a molecule is determined using the “IC 50 ” i.e., “half maximal inhibitory concentration” that refers to the concentration of a substance (e.g., inhibitor, antagonist, etc.) that produces a 50% inhibition of a given biological process, or a component of a process (e.g., binding between antigen-antibody and/or the resulting biological effect, e.g., symptoms of Lyme diseases). It is commonly used as a measure of an antagonist substance's potency.
- IC 50 i.e., “half maximal inhibitory concentration” that refers to the concentration of a substance (e.g., inhibitor, antagonist, etc.) that produces a 50% inhibition of a given biological process, or a component of a process (e.g., binding between antigen-antibody and/or the resulting biological effect, e.g., symptoms of Lyme diseases). It is commonly used as a measure of an antagonist substance's potency.
- specific binding in the context of an antibody-antigen interaction refers to binding with a dissociation constant (K D ) of about 10 ⁇ 7 M or less to the antigen (e.g., DbpA), preferably 10 ⁇ 8 M or less and even more preferably 10 ⁇ 9 M or less, e.g., 10 ⁇ 10 M or even 10 ⁇ 11 M.
- the antibody may bind to the antigen with a K D that is at least about 3-fold, 4-fold, or 5-fold less than its K D for binding to a non-specific antigen (e.g., BSA, casein, or a random polypeptide having a sequence that is not present in the particular antigen (e.g., DbpA)).
- highly specific binding means that the relative K D of the antibody for the specific target epitope is at least 10-fold, at least 20-fold, e.g., about 50-fold less than the K D for binding that antibody to other ligands (e.g., BSA, casein, or a random polypeptide).
- other ligands e.g., BSA, casein, or a random polypeptide
- isotype refers to the antibody class (e.g., IgM or IgG) that is encoded by heavy chain constant region genes.
- Some antibody classes further encompass subclasses which are also encoded by the heavy chain constant regions and further decorated by oligosaccharides at specific residues within the constant region domains (e.g. IgG1, IgG2, IgG3 and IgG4) which further impart biological functions to the antibody.
- the term “capture antibody” refers to an antibody that is used to bind an antigen and thereby permit the recognition of the antigen by a subsequently applied antibody.
- the capture antibody may be bound to a microtiter well and serve to bind an antigen of interest present in a sample added to the well.
- Another antibody (termed the “primary antibody”) is then used to bind to the antigen-antibody complex, in effect to form a “sandwich” comprised of antibody-antigen-antibody complex. Detection of this complex can be performed by several methods.
- the primary antibody may be prepared with a label such as biotin, an enzyme, a fluorescent marker, or radioactivity, and may be detected directly using this label.
- a labelled “secondary antibody” or “reporter antibody” which recognizes the primary antibody may be added, forming a complex comprised of an antibody-antigen-antibody-antibody complex. Again, appropriate reporter reagents are then added to detect the labelled antibody. Any number of additional antibodies may be added as desired. These antibodies may also be labelled with a marker, including, e.g., an enzyme, fluorescent marker, or radioactivity.
- chimeric refers to any nucleic and/or amino acid sequence containing portions from two or more different species.
- a protein may be chimeric if the primary amino acid sequence contains portions from two or more different species (i.e., for example, an B. burgdorferi DbpA fused to Renilla luciferase).
- a protein may also be chimeric if the primary amino acids sequence contains portions from two or more different proteins, whether from the same species or different species.
- a nucleic acid may be chimeric if the primary nucleotide sequence contains portions from two or more different species.
- a nucleic acid may also be chimeric if the primary nucleotide sequence contains portions from two or more different proteins, whether from the same species or different species.
- An antibody may be chimeric if regions/domains of the antibody molecule are derived from two different species, e.g., fusing the antigen binding region (variable domains of the heavy and light chains, VH and VL) from one species like a mouse, with the constant domain (effector region) from another species such as a rabbit.
- Humanized antibodies which are antibodies from non-human species whose protein sequences have been modified to increase their similarity to antibody variants produced naturally in humans, may be chimeric antibodies.
- hybridomas refers to cells produced by fusing two cell types together. Commonly used hybridomas include those created by the fusion of antibody-secreting B cells from an immunized animal, with a malignant myeloma cell line capable of indefinite growth in vitro. These cells are cloned and used to prepare monoclonal antibodies.
- the term “pharmaceutically acceptable” means a molecule or a material that is not biologically or otherwise undesirable, i.e., the molecule or the material can be administered to a subject without causing any undesirable biological effects such as toxicity.
- the term “carrier” denotes buffers, adjuvants, dispersing agents, diluents, and the like.
- the peptides or compounds of the disclosure can be formulated for administration in a pharmaceutical carrier in accordance with known techniques. See, e.g., Remington, The Science & Practice of Pharmacy (9 th Ed., 1995).
- the peptide or the compound is typically admixed with, inter alia, an acceptable carrier.
- the carrier can be a solid or a liquid, or both, and is preferably formulated with the peptide or the compound as a unit-dose formulation, for example, a tablet, which can contain from about 0.01 or 0.5% to about 95% or 99%, particularly from about 1% to about 50%, and especially from about 2% to about 20% by weight of the peptide or the compound.
- a tablet which can contain from about 0.01 or 0.5% to about 95% or 99%, particularly from about 1% to about 50%, and especially from about 2% to about 20% by weight of the peptide or the compound.
- One or more peptides or compounds can be incorporated in the formulations of the disclosure, which can be prepared by any of the well-known techniques of pharmacy.
- culture refers to any sample or specimen which is suspected of containing one or more microorganisms or cells.
- Pure cultures are cultures in which the cells or organisms are only of a particular species or genus. This is in contrast to “mixed cultures,” wherein more than one genus or species of microorganism or cell are present.
- the terms “treat,” “treating,” or “treatment of,” refers to reduction of severity of a condition or at least partially improvement or modification thereof, e.g., via complete or partial alleviation, mitigation or decrease in at least one clinical symptom of the condition, e.g., Lyme disease.
- administering is used in the broadest sense as giving or providing to a subject in need of the treatment, a composition such as the compound or peptide of the disclosure, or a pharmaceutical composition containing the peptide or the compound.
- administering means applying as a remedy, such as by the placement of a peptide or an antibody in a manner in which such molecule would be received, e.g., intravenous, oral, topical, buccal (e.g., sub-lingual), vaginal, parenteral (e.g., subcutaneous; intramuscular including skeletal muscle, cardiac muscle, diaphragm muscle and smooth muscle; intradermal; intravenous; or intraperitoneal), topical (i.e., both skin and mucosal surfaces), intranasal, transdermal, intraarticular, intrathecal, inhalation, intraportal delivery, organ injection (e.g., eye or blood, etc.), or ex vivo (e.g., via immunoapheresis).
- a remedy such as by the placement of a peptide or an antibody in a manner in which such molecule would be received, e.g., intravenous, oral, topical, buccal (e.g., sub-lingual), vagina
- contacting means that the composition comprising the active ingredient is introduced into a sample containing a target, e.g., cell target, in a test tube, flask, tissue culture, chip, array, plate, microplate, capillary, or the like, and incubated at a temperature and time sufficient to permit binding of the peptide or the compound to the target (e.g., antibodies) or vice versa (e.g., antibodies binding to B. burgdorferi DbpA).
- a target e.g., cell target
- contacting means that the therapeutic or diagnostic molecule is introduced into a patient or a subject for the treatment of a Lyme disease, and the molecule is allowed to come in contact with the patient's target tissue, e.g., blood tissue, in vivo or ex vivo.
- target tissue e.g., blood tissue
- terapéuticaally effective amount refers to an amount that provides some improvement or benefit to the subject.
- a “therapeutically effective” amount is an amount that will provide some alleviation, mitigation, or decrease in at least one clinical symptom in the subject.
- the term “inhibit” refers to reduction in the amount, levels, density, turnover, association, dissociation, activity, signaling, or any other feature associated with an etiological agent of a disorder, e.g., B. burgdorferi or a complex containing B. burgdorferi.
- a subject means an individual.
- a subject is a mammal such as a human.
- a subject can be a non-human primate.
- Non-human primates include marmosets, monkeys, chimpanzees, gorillas, orangutans, and gibbons, to name a few.
- subject also includes domesticated animals, such as cats, dogs, etc., livestock (e.g., llama, horses, cows), wild animals (e.g., deer, elk, moose, etc.,), laboratory animals (e.g., mouse, rabbit, rat, gerbil, guinea pig, etc.) and avian species (e.g., chickens, turkeys, ducks, etc.).
- livestock e.g., llama, horses, cows
- wild animals e.g., deer, elk, moose, etc.
- laboratory animals e.g., mouse, rabbit, rat, gerbil, guinea pig, etc.
- avian species e.g., chickens, turkeys, ducks, etc.
- Subjects can also include, but are not limited to fish, amphibians and reptiles. Subjects may further include invertebrates such as ticks, lice, and fleas. Preferably, the subject is a human subject. Especially, the subject is a human patient.
- Lyme disease refers to a medical condition that is transmitted by B. burgdorferi or related species, e.g., B. afzelli , or B. garinii, B. lusitaniae and B. valaisianae.
- the term “detecting,” refers to the process of determining a value or set of values associated with a sample by measurement of one or more parameters in a sample, and may further comprise comparing a test sample against reference sample.
- the detection of Lyme disease in a subject may include identification, assaying, measuring and/or quantifying one or more DbpA antigens in the subject's biological sample, e.g., sputum, serum or blood.
- a “detectable label” is a moiety, the presence of which can be ascertained directly or indirectly. Generally, detection of the label involves the creation of a detectable signal such as for example an emission of energy.
- the label may be of a chemical, peptide or nucleic acid nature although it is not so limited. The nature of label used will depend on a variety of factors, including the nature of the analysis being conducted, the type of the energy source and detector used and the type of polymer, analyte, probe and primary and secondary analyte-specific binding partners.
- the label should be sterically and chemically compatible with the constituents to which it is bound.
- the label can be detected directly for example by its ability to emit and/or absorb electromagnetic radiation of a particular wavelength.
- a label can be detected indirectly for example by its ability to bind, recruit and, in some cases, cleave another moiety which itself may emit or absorb light of a particular wavelength (e.g., an epitope tag such as the FLAG epitope, an enzyme tag such as horseradish peroxidase, etc.).
- a particular wavelength e.g., an epitope tag such as the FLAG epitope, an enzyme tag such as horseradish peroxidase, etc.
- the detectable label can be selected from the group consisting of directly detectable labels such as a fluorescent molecule (e.g., fluorescein, rhodamine, tetramethylrhodamine, R-phycoerythrin, Cy-3, Cy-5, Cy-7, Texas Red, Phar-Red, allophycocyanin (APC), fluorescein amine, eosin, dansyl, umbelliferone, 5-carboxyfluorescein (FAM), 2′7′-dimethoxy-4′5′-dichloro-6-carboxyfluorescein (JOE), 6 carboxyrhodamine (R6G), N,N,N′,N′-tetramethyl-6-carboxyrhodamine (TAMRA), 6-carboxy-X-rhodamine (ROX), 4-(4′-dimethylaminophenylazo) benzoic acid (DABCYL), 5-(2′-aminoethyl)
- the detectable label can also be selected from the group consisting of indirectly detectable labels such as an enzyme (e.g., alkaline phosphatase, horseradish peroxidase, p-galactosidase, glucoamylase, lysozyme, luciferases such as firefly luciferase and bacterial luciferase (U.S. Pat. No.
- an enzyme e.g., alkaline phosphatase, horseradish peroxidase, p-galactosidase, glucoamylase, lysozyme
- luciferases such as firefly luciferase and bacterial luciferase
- saccharide oxidases such as glucose oxidase, galactose oxidase, and glucose-6-phosphate dehydrogenase
- heterocyclic oxidases such as uricase and xanthine oxidase coupled to an enzyme that uses hydrogen peroxide to oxidize a dye precursor such as HRP, lactoperoxidase, or microperoxidase
- an enzyme substrate an affinity molecule, a ligand, a receptor, a biotin molecule, an avidin molecule, a streptavidin molecule, an antigen (e.g., epitope tags such as the FLAG or HA epitope), a hapten (e.g., biotin, pyridoxal, digoxigenin fluorescein and dinitrophenol), an antibody, an antibody fragment, a microbead, etc.
- Antibody fragments include Fab, F(ab)2, Fd and antibody fragments which include a CDR.
- specific detection refers to level of detection of a particular target (“signal”) over other non-targets (“noise”). Specific detection is achieved when the signal-to-noise for the detection is at least 0.6-fold, 0.7-fold, 0.8-fold, 0.9-fold, 1-fold, 1.5-fold, 2-fold (e.g., 100% increase), 3-fold, 5-fold, 10-fold, 20-fold, 50-fold, 70-fold, 100-fold, or more.
- diagnosis refers to methods by which a determination can be made as to whether a subject is likely to be suffering from a given disease or condition, including but not limited diseases or conditions characterized by autoantibodies.
- the skilled artisan often makes a diagnosis on the basis of one or more diagnostic indicators, e.g., autoantibodies, the presence, absence, amount, or change in amount of which is indicative of the presence, severity, or absence of the disease or condition.
- diagnostic indicators can include patient history; physical symptoms (e.g., itch, rash, fever, chills, headache, fatigue, muscle and joint aches, and swollen lymph nodes); memory problems (e.g., short-term memory loss); late signs or symptoms such as arthritis with severe joint pain and swelling (particularly the knees and other large joints); facial palsy; intermittent pain in tendons, muscles, joints, and bones; heart palpitations or an irregular heart beat (Lyme carditis); episodes of dizziness or shortness of breath; inflammation of the brain and spinal cord; nerve pain; shooting pains, numbness, or tingling in the hands or feet. Diagnosis may include analysis of genetic or environmental or heredity factors.
- diagnostic refers to an increased probability that certain course or outcome will occur; that is, that a course or outcome is more likely to occur in a patient exhibiting a given characteristic, e.g., the presence or level of a diagnostic indicator, when compared to individuals not exhibiting the characteristic. Diagnostic methods of the disclosure can be used independently, or in combination with other diagnosing methods, to determine whether a course or outcome is more likely to occur in a patient exhibiting a given characteristic.
- signal is used in reference to an indicator that a reaction has occurred, for example, binding of antibody to antigen. It is contemplated that signals in the form of radioactivity, fluorescence reactions, luminescent and enzymatic reactions will be used with the present disclosure. The signal may be assessed quantitatively as well as qualitatively. As used herein the term “signal intensity” refers to magnitude of the signal strength wherein the intensity correlates with the amount of reaction substrate.
- biological cells include eukaryotic cells, plant cells, animal cells, such as mammalian cells, insect cells, avian cells, fish cells, or the like, prokaryotic cells, bacterial cells, fungal cells, protozoan cells, or the like, cells dissociated from a tissue, such as muscle, cartilage, fat, skin, liver, lung, neural tissue, and the like, immune cells, such as T cells, B cells, natural killer cells, macrophages, and the like, embryos (e.g., zygotes), oocytes, ova, sperm cells, hybridomas, cultured cells, cells from a cell line, cancer cells, infected cells, transfected and/or transformed cells, reporter cells, and the like.
- a mammalian cell can be, e.g., from a human, a mouse, a rat, a horse, a goat, a sheep, a cow,
- sample refers to a composition that is obtained or derived from a subject of interest that contains a cellular and/or other molecular entity that is to be characterized and/or identified, for example based on physical, biochemical, chemical and/or physiological characteristics.
- tissue sample is a substance obtained from the subject's body.
- the particular “biological sample” selected will vary based on the disorder the patient is suspected of having and, accordingly, which biological sample is most likely to contain the analyte.
- the source of the tissue sample may be blood or any blood constituents; bodily fluids; solid tissue as from a fresh, frozen and/or preserved organ or tissue sample or biopsy or aspirate; and cells from any time in gestation or development of the subject or plasma.
- Samples include, but not limited to, primary or cultured cells or cell lines, cell supernatants, cell lysates, platelets, serum, plasma, vitreous fluid, ocular fluid, lymph fluid, synovial fluid, follicular fluid, seminal fluid, amniotic fluid, milk, whole blood, urine, cerebrospinal fluid (CSF), saliva, sputum, tears, perspiration, mucus, tumor lysates, and tissue culture medium, as well as tissue extracts such as homogenized tissue, tumor tissue, and cellular extracts.
- CSF cerebrospinal fluid
- Samples further include biological samples that have been manipulated in any way after their procurement, such as by treatment with reagents, solubilized, or enriched for certain components, such as proteins or nucleic acids, or embedded in a semi-solid or solid matrix for sectioning purposes, e.g., a thin slice of tissue or cells in a histological sample.
- the sample is obtained from blood or blood components, including, e.g., whole blood, plasma, serum, lymph, and the like.
- control refers to a reference for a test sample, such as a sample obtained from a subject who is undiagnosed or unsuspected of having a disease (e.g., Lyme disease).
- a “reference sample,” as used herein, refers to a sample of tissue or cells that may or may not have Lyme diseases that are used for comparisons. Thus a “reference” sample thereby provides a basis to which another sample, for example plasma sample containing markers, e.g., DbpA antigen, can be compared.
- a “test sample” refers to a sample compared to a reference sample or control sample.
- the reference sample or control may comprise molecules that have a pre-defined activity, e.g., ability or inability to bind specifically to an anti-DbpA antibody such as monoclonal antibody 6G8 and/or 8C10.
- Presence means the level of analyte (e.g., DbpA antigen) which is greater by a statistically significant amount than the level of analyte present in a particular biological sample of a subject that is not suffering from a disease.
- an elevated level of the analyte may mean an increase of about 20%, 50%, 75%, 100%, 150%, 200%, 300%, 400%, or more, e.g., 500%, of DbpA antigen, compared to that of subject who is not suffering from Lyme disease. This differentiation enables the diagnostic aspects of the present disclosure.
- the present disclosure relates to isolated, recombinant and/or synthetic antibodies that bind to decorin-binding protein A (DbpA) of B. burgdorferi and microorganisms related thereto.
- Decorin binding protein (DbpA) is a lipoprotein that contributes to the adhesion and colonization of B. burgdorferi within mammalian hosts.
- DbpA-encoding genes reside in an operon (dbpBA) inside linear plasmid 54 (lp54), which are present in the genomes of many B. burgdorferi sensu lato isolates.
- dbpBA operon inside linear plasmid 54
- lp54 linear plasmid 54
- DbpA is not expressed in vector ticks, its expression is upregulated in the mammalian host after ticks deposit spirochetes into the skin of mammals.
- the protein binds to decorin, a connective-tissue proteoglycan which binds to type I collagen fibrils and plays a role in matrix assembly.
- decorin a connective-tissue proteoglycan which binds to type I collagen fibrils and plays a role in matrix assembly.
- DbpA a connective-tissue proteoglycan which binds to type I collagen fibrils and plays a role in matrix assembly.
- Monoclonal antibodies which bind with specificity to an antigenic epitope in B. burgdorferi DbpA were obtained by immunizing animals (e.g., mice) with the antigen and antibody isolates were prepared and further screened using hybridoma screening technology.
- the hybridoma clones were sequenced by RT-PCR technology to obtain unique antibody sequences, based on which, humanized chimeric antibodies were designed to include the mouse variable region domains and human Fc region from an IgM framework.
- Biochemical characterization of the purified antibodies using immunoblotting revealed that the antibodies comprise a heavy chain of about 80 kDa and a light chain of about 25 kDa under reducing sodium dodecylsulfate polyacrilimide gel electrophoretic (SDS-PAGE) resolution and higher molecular bands (e.g., bands larger than 500 kDa) were observed using non-reducing conditions.
- the purified antibodies showed as one major dominant peak on HPLC-SEC (retention time of about 3.8 mins, corresponding to human IgM molecular weight).
- the antibody compositions of the disclosure are particularly useful in serological testing of patient samples for diseases that are mediated by B. burgdorferi , e.g., Lyme disease.
- DbpA relates to a B. burgdorferi DbpA polypeptide (UNIPROT Accession No. O50917; version 92, last revised: Mar. 28, 2018), including variants and mutants thereof or an immunogenic fragment thereof.
- DbpA relates to a B. burgdorferi DbpA having polypeptide sequence set forth in SEQ ID NO: 78, including, variants or mutants thereof, as recited in Table 1 or a fragment of SEQ ID NO: 78 or its variant or mutant.
- amino acid sequence of wild-type B. burgdorferi DbpA is recited in SEQ ID NO: 78, below. Amino acids making up the signal sequence (aa 1-29) are underlined.
- Natural variants and/or mutants of wild-type DbpA (SEQ ID NO: 78) Feature Position(s) key in SEQ#Y Description Actions Natural 34 R ⁇ K in strain: variant 297, LP7 and Sh-2-82. Natural 37 R ⁇ S in strain: variant 297, LP7 and Sh-2-82. Natural 41-43 DIT ⁇ AIV in strain: variant 297, LP7 and Sh-2-82. Natural 52 D ⁇ K in strain: variant 297, LP7 and Sh-2-82. Natural 55-56 LK ⁇ SM in strain: variant 297, LP7 and Sh-2-82. Natural 128 K ⁇ E in strain: variant 297, LP7 and Sh-2-82.
- DbpA relates to homologs of wild-type B. burgdorferi DbpA (SEQ ID NO: 78), which are structurally and/or functionally similar to B. burgdorferi DbpA.
- Representative homologs include members having at least 70%, 80% or 90% identity, at the genomic, trancriptomic, or proteomic level to wild-type B. burgdorferi DbpA (SEQ ID NO: 78), e.g., proteins in the cluster UNIREF90_O50917 (published: Aug. 30, 2017), e.g., DbpA from B. japonica, B. finierinsis or B. garinii.
- DbpA relates to a fragment of B. burgdorferi DbpA.
- the DbpA fragment comprises an N-terminal antigenic domain of DbpA, comprising, e.g., from about aa 24 to about aa 191 of SEQ ID NO: 78, including, a fragment comprising, consisting essentially of, or consisting of, aa 21-194, aa 22-194, aa 23-194, aa 24-194, aa 25-194, aa 26-194, aa 27-194, aa 21-193, aa 22-193, aa 23-193, aa 24-193, aa 25-193, aa 26-193, aa 27-193, aa 21-192, aa 22-192, aa 23-192, a 24-192, aa 24-192, aa 24-192, aa 26-192, aa 27-192, aa 21-191, aa 22-191, aa 23-191, aa 24
- DbpA polypeptide of the disclosure relates to polypeptide which comprises, consists essentially of, or consists of the sequence set forth in SEQ ID NO: 77 or in SEQ ID NO: 78 (e.g., a polypeptide comprising, consisting essentially of, or consisting of aa 24-191 of SEQ ID NO: 78 or SEQ ID NO: 77) or an immunogenic fragment thereof.
- the disclosure further relates to antibodies that bind to immunogenic fragment of SEQ ID NO: 77, which comprises at least one epitope to which the antibodies of the disclosure, e.g., MAb 6G8 and/or MAb 8C10, specifically bind to.
- the at least one epitope can comprise at least one antibody binding region that comprises at least one portion of DbpA protein, which epitope comprises 1, 2, 3, 4, 5, 6 or more amino acids of a DbpA fragment of SEQ ID NO: 77.
- the disclosure relates to epitopes on the DbpA protein defined by the epitope of MAb 6G8 or MAb 8C10, and/or which compete for binding to DbpA with antibody MAb 6G8 or MAb 8C10, or which have other functional binding characteristics exhibited by or MAb 6G8 or MAb 8C10.
- the immunogenic fragments may comprise about 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, or 165 contiguous amino acids of SEQ ID NO: 77.
- the disclosure relates to a DbpA antibody which functionally affects DbpA ligand or a function thereof.
- the antibodies of the disclosure bind to and/or sequester DbpA.
- the antibody modulates, decreases, increases, antagonizes, agonizes, mitigates, alleviates, blocks, inhibits, abrogates and/or interferes with at least one biological activity of DbpA in vitro, in situ, ex vivo, and/or in vivo.
- the disclosure relates to anti-DbpA monoclonal antibody or an antigen-binding fragment thereof.
- the antibodies are anti-DbpA chimeric antibodies, particularly, anti-DbpA chimeric monoclonal antibodies or an antigen-binding fragment thereof.
- the antibodies are humanized anti-DbpA antibodies, especially, anti-DbpA humanized monoclonal antibodies or an antigen-binding fragment thereof.
- the disclosure relates to antibodies having the amino acid sequence of monoclonal antibodies 6G8 and/or 8C10, chains thereof, e.g., heavy chain (VH) and light chain (VL) variable regions, and fragments thereof, e.g., antigen-binding fragments comprising CDRs of monoclonal antibodies (MAb) 6G8 and/or 8C10.
- chains thereof e.g., heavy chain (VH) and light chain (VL) variable regions
- fragments thereof e.g., antigen-binding fragments comprising CDRs of monoclonal antibodies (MAb) 6G8 and/or 8C10.
- the disclosure relates to antibodies having the CDRs of MAb 6G8, e.g., heavy chain CDRs (CDR H ) and/or light chain CDRs (CDR L ).
- the antibody or antigen-binding fragment thereof comprises a CDR H comprising one or more CDRs comprising (1) CDR H1 comprising, consisting essentially of, or consisting of the sequence RYWMYW (SEQ ID NO: 1) or a variant thereof comprising, consisting essentially of, or consisting of at least 80%, 90%, or 95% sequence identity thereto; (2) CDR H2 comprising, consisting essentially of, or consisting of the sequence RLDPNSGVTKYNEKFKS (SEQ ID NO: 2) or a variant thereof comprising, consisting essentially of, or consisting of at least 80%, 90%, or 95% sequence identity thereto; and/or (3) CDR H3 comprising, consisting essentially of, or consisting of the sequence DDSWYFDV (SEQ ID NO:
- the antibody or antigen-binding fragment thereof may comprise a CDR L comprising one or more CDRs comprising (4) CDR L1 comprising, consisting essentially of, or consisting of the sequence QATQDIVKNLN (SEQ ID NO: 4) or a variant thereof comprising, consisting essentially of, or consisting of at least 80%, 90%, or 95% sequence identity thereto; (5) CDR L2 comprising, consisting essentially of, or consisting of the sequence YATELAE (SEQ ID NO: 5) or a variant thereof comprising, consisting essentially of, or consisting of at least 80%, 90%, or 95% sequence identity thereto; and/or (6) CDR L3 comprising, consisting essentially of, or consisting of the sequence LQFYAFPLT (SEQ ID NO: 6) or a variant thereof comprising, consisting essentially of, or consisting of at least 80%, 90%, or 95% sequence identity thereto.
- the disclosure relates to antibodies having the CDRs of MAb 8C10, e.g., heavy chain CDRs (CDR H ) and/or light chain CDRs (CDR L ).
- the antibody or antigen-binding fragment thereof comprises a CDR H comprising one or more CDRs comprising (1) CDR H1 comprising, consisting essentially of, or consisting of the sequence DYWIE (SEQ ID NO: 7) or a variant thereof comprising, consisting essentially of, or consisting of at least 80%, 90%, or 95% sequence identity thereto; (2) CDR H2 comprising, consisting essentially of, or consisting of the sequence EILPGSGSTKDNERFKG (SEQ ID NO: 8) or a variant thereof comprising, consisting essentially of, or consisting of at least 80%, 90%, or 95% sequence identity thereto; and (3) CDR H3 comprising, consisting essentially of, or consisting of the sequence REWGYYFDY (SEQ ID NO:
- the CDR L may comprise one or more CDRs comprising (4) CDR L1 comprising, consisting essentially of, or consisting of the sequence KASQDVSTAVA (SEQ ID NO: 10) or a variant thereof comprising, consisting essentially of, or consisting of at least 80%, 90%, or 95% sequence identity thereto; (5) CDR L2 comprising, consisting essentially of, or consisting of the sequence IYWASTRHT (SEQ ID NO: 11) or a variant thereof comprising, consisting essentially of, or consisting of at least 80%, 90%, or 95% sequence identity thereto; and/or (6) CDR L3 comprising, consisting essentially of, or consisting of the sequence QQHYSTPYT (SEQ ID NO: 12) or a variant thereof comprising, consisting essentially of, or consisting of at least 80%, 90%, or 95% sequence identity thereto.
- CDR L1 comprising, consisting essentially of, or consisting of the sequence KASQDVSTAVA (SEQ ID
- the disclosure relates to antibodies containing variant paratopes. While antibody paratopes are often defined by CDRs, not all the residues within the CDRs are involved in antigen-binding. In fact, an early analysis of the 3-D structures of antibodies suggested that only 20-33% of the residues within the CDRs participate in antigen-binding (Padlan et al., Mol Immunol., 31(3):169-217, 1994). Amino acid residues within CDRs that contact with the antigen are now recognized to serve as better proxies for paratope (Sela-Culang et al., Front Immunol., 4, 302, 2013).
- CDR L3 and CDR H3 are unchanged between various numbering schemes, while in other CDRs (e.g., L2, H1, and H2) there are substantial differences between the schemes.
- computational analyses of next-generation sequencing (NGS) data of antibody-encoding genes have enabled classification of discrete classes of CDRs (termed canonical classes).
- NGS next-generation sequencing
- the results show that CDR L2 is the least diverse in terms of length, with around 99% of known structures belonging to the same class, while CDR H3 is the most diverse (Nowak et al., MAbs, 8(4): 751-760, 2016).
- minimal antibodies or antigen-binding fragments thereof comprising less than the full complement of six CDRs which specifically bind to DbpA fragment of SEQ ID NO: 77 or an immunogenic fragment thereof.
- such minimal antibodies or antigen-binding fragments thereof may comprise at least three heavy chain CDRs (e.g., CDR H1 , CDR H2 , and CDR H3 ) optionally together with one or more light chain CDRs (e.g., CDR L1 and/or CDR L2 and/or CDR L3 ) and still bind with specificity to DbpA fragment of SEQ ID NO: 77 or an immunogenic fragment thereof.
- Non-limiting examples of such minimal antibodies include, e.g., (a) an MAb 6G8-derived minimal antibody comprising CDR H1-3 comprising, consisting essentially of, or consisting of, the sequences set forth in SEQ ID Nos: 1-3 (or variants thereof), optionally together one or more CDR L1-3 comprising, consisting essentially of, or consisting of, the sequences set forth in SEQ ID Nos: 4-6 (or variants thereof); or (b) an MAb 8C10-derived minimal antibody comprising CDR H1-3 comprising, consisting essentially of, or consisting of, the sequences set forth in SEQ ID Nos: 7-9 (or variants thereof), optionally together one or more CDR L1-3 comprising, consisting essentially of, or consisting of, the sequences set forth in SEQ ID Nos: 10-12 (or variants thereof), wherein the minimal antibody of (a) or (b) specifically binds to DbpA fragment SEQ ID NO: 77 or an immunogenic fragment thereof.
- the recombinant antibodies of the disclosure comprise the heavy and light chain CDR3s of MAb 6G8 or MAb 8C10.
- the antibodies can further comprise the CDR2s of MAb 6G8 or MAb 8C10.
- the antibodies can further comprise the CDR1s of MAb 6G8 or MAb 8C10.
- anti-DbpA antibodies comprising: (1) human heavy chain framework regions, a human heavy chain CDR1 region, a human heavy chain CDR2 region, and a human heavy chain CDR3 region, wherein the human heavy chain CDR3 region is selected from the CDR3s of MAb 6G8 as shown in SEQ ID NO: 3; and (2) human light chain framework regions, a human light chain CDR1 region, a human light chain CDR2 region, and a human light chain CDR3 region, wherein the human light chain CDR3 region is selected from the CDR3s of MAb 6G8 as shown in SEQ ID NO: 6, wherein the antibody binds DbpA.
- the antibody may further comprise the heavy chain CDR2 and/or the light chain CDR2 of MAb 6G8.
- the antibody may further comprise the heavy chain CDR1 and/or the light chain CDR1 of MAb 6G8.
- the disclosure also provides anti-DbpA antibodies comprising: (1) human heavy chain framework regions, a human heavy chain CDR1 region, a human heavy chain CDR2 region, and a human heavy chain CDR3 region, wherein the human heavy chain CDR3 region is selected from the CDR3s of MAb 8C10 as shown in SEQ ID NO: 9; and (2) human light chain framework regions, a human light chain CDR1 region, a human light chain CDR2 region, and a human light chain CDR3 region, wherein the human light chain CDR3 region is selected from the CDR3s of MAb 6G8 as shown in SEQ ID NO: 12, wherein the antibody binds DbpA.
- the antibody may further comprise the heavy chain CDR2 and/or the light chain CDR2 of MAb 8
- the antibody or antigen-binding portion or variant can comprise at least one of the heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 3, and/or a light chain CDR3 having the amino acid sequence of SEQ ID NO:6.
- the antibody or antigen-binding fragment can have an antigen-binding region that comprises at least a portion of at least one heavy chain CDR (i.e., CDR1, CDR2 and/or CDR3) having the amino acid sequence of the corresponding CDRs 1, 2 and/or 3 (e.g., SEQ ID NOS: 1, 2, and/or 3).
- the antibody or antigen-binding portion or variant can have an antigen-binding region that comprises at least a portion of at least one light chain CDR (i.e., CDR1, CDR2 and/or CDR3) having the amino acid sequence of the corresponding CDRs 1, 2 and/or 3 (e.g., SEQ ID NOS: 4, 5, and/or 6).
- the three heavy chain CDRs and the three light chain CDRs of the antibody or antigen-binding fragment have the amino acid sequence of the corresponding CDR of at least one of MAb 6G8 or MAb 8C10, as described herein.
- Such antibodies can be prepared by chemically joining together the various portions (e.g., CDRs, framework) of the antibody using conventional techniques, by preparing and expressing a (i.e., one or more) nucleic acid molecule that encodes the antibody using conventional techniques of recombinant DNA technology or using any suitable methods.
- the CDR1, 2, and/or 3 of the engineered antibodies described above comprise the exact amino acid sequence(s) as those of MAb 6G8 or MAb 8C10 disclosed herein.
- the engineered antibody may be composed of one or more CDRs that are, for example, at least 80%, 90%, 95%, or more, e.g., 97% identical to one or more CDRs of MAb 6G8 or MAb 8C10.
- engineered antibodies such as those described above may be selected for their retention of other functional properties of antibodies of the disclosure.
- the disclosure relates to antibodies comprising framework regions (FR) of MAb 6G8 comprising heavy chain framework regions 1-3 and/or light chain framework regions 1-3, wherein heavy chain FR1 comprises, consists essentially of, or consists of the polypeptide sequence set forth in QVQLQQPGAELVKPGASVKLSCKASGYTF (SEQ ID NO: 13) or a polypeptide having at least 80%, 90%, 95%, or more, e.g., 97% sequence identity thereto; heavy chain FR2 comprises, consists essentially of, or consists of the polypeptide sequence set forth in WVKQRPGRGLEWIG (SEQ ID NO: 14) or a polypeptide having at least 80%, 90%, 95%, or more, e.g., 97% sequence identity thereto; and heavy chain FR3 comprises, consists essentially of, or consists of the polypeptide sequence set forth in KATLTVDKSSSTAYMQLSSLTSEDSAVYYCVRDDS (SEQ ID NO:
- the disclosure relates to antibodies comprising framework regions (FR) of MAb 8C10 comprising heavy chain framework regions 1-3 and/or light chain framework regions 1-3, wherein heavy chain FR1 comprises, consists essentially of, or consists of the polypeptide sequence set forth in QVQLQQSGAELMKPGASVKLSCKAAGYTFT (SEQ ID NO: 19) or a polypeptide having at least 80%, 90%, 95%, or more, e.g., 97% sequence identity thereto; heavy chain FR2 comprises, consists essentially of, or consists of the polypeptide sequence set forth in WVKQRPGHGLEWIG (SEQ ID NO: 20) or a polypeptide having at least 80%, 90%, 95%, or more, e.g., 97% sequence identity thereto; and heavy chain FR3 comprises, consists essentially of, or consists of the polypeptide sequence set forth in KATFTADTSSNTAYMQLSSLTTEDSAIYYCAR (SEQ ID NO: 19
- the disclosure further relates to variants of the antibodies of the disclosure or antigen-binding fragments thereof.
- the variants may comprise one or more variations (e.g., mutations such as deletion or substitution) of one or more amino acid residues in the antigen-binding domains and/or framework regions in the parent antibody, wherein the variant antibody specifically binds to DbpA.
- the variant comprises variation in the non-antigen-binding regions in the antibody, e.g., variations in the Fc portion, the hinge portion, or the framework regions of the antibody.
- the variant antibodies comprise variations in the amino acids in the CDRs.
- the variants comprise, at most 3, 2, or 1 mutation comprising addition of an amino acid, deletion of an amino acid or substitution of an amino acid with another proteinogenic amino acid or non-proteinogenic amino acid.
- such engineered antibodies may comprise one or more CDRs comprising at most 3, 2, or 1 semi-conservative or conservative substitution (especially conservative substitutions) in one or more CDRs of MAb 6G8 or MAb 8C10.
- such variant antibodies may be selected for their retention of other functional properties of antibodies of the disclosure.
- variant antibodies of the disclosure comprising variant CDRs do not contain mutations (e.g., deletions or non-conservative substitutions) of amino acid residues that are common to CDRs in the aforementioned MAbs 6G8 and 8C10.
- Methods for identifying such common amino acids are known, for example, by aligning sequences of CDRs using, e.g., simple sequence alignment (SIM), CLUSTAL alignment, Chothia alignment, alignment using dynamic time warping (DTW) algorithm, IMGT alignment, PDB multiple structure alignment (MSTA) or a combination thereof.
- variant antibodies of the disclosure comprising variant CDRs do not contain mutations in the following amino acid residues:
- the mutation preferably comprises a conservative substitution
- Conservative amino acid substitutions of proteinogenic amino acids with other proteinogenic amino acids are generally from within the groups in Table 2.
- amino acid substitutions may be based on any characteristic known in the art, including the relative similarity or differences of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like.
- the hydropathic index of amino acids may be considered. The importance of the hydropathic amino acid index in conferring interactive biologic function on a protein is generally understood in the art (see, Kyte et al., J Mol. Biol. 757:105 (1982).
- hydropathic index values based on their hydrophobicity and charge characteristics, e.g., isoleucine (+4.5); valine (+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine/cystine (+2.5); methionine (+1.9); alanine (+1.8); glycine ( ⁇ 0.4); threonine ( ⁇ 0.7); serine ( ⁇ 0.8); tryptophan ( ⁇ 0.9); tyrosine ( ⁇ 1.3); proline ( ⁇ 1.6); histidine ( ⁇ 3.2); glutamate ( ⁇ 3.5); glutamine ( ⁇ 3.5); aspartate ( ⁇ 3.5); asparagine ( ⁇ 3.5); lysine ( ⁇ 3.9); and arginine ( ⁇ 4.5).
- amino acid substitutions can be made to preserve the general hydropathic character of the original amino acid, for example by replacing isoleucine with valine. Similarly, amino acid substitutions can be made on the basis of hydrophilicity. See U.S. Pat. No.
- 4,554,101 at Table 2 which assigns the following hydrophilicity values to the amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0 ⁇ 1); glutamate (+3.0 ⁇ 1); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine ( ⁇ 0.4); proline ( ⁇ 0.5 ⁇ 1); alanine ( ⁇ 0.5); histidine ( ⁇ 0.5); cysteine ( ⁇ 1.0); methionine ( ⁇ 1.3); valine ( ⁇ 1.5); leucine ( ⁇ 1.8); isoleucine ( ⁇ 1.8); tyrosine ( ⁇ 2.3); phenylalanine ( ⁇ 2.5); tryptophan ( ⁇ 3.4). Accordingly, the hydrophilicity of the amino acid (or amino acid sequence) may be considered when identifying additional peptides beyond those specifically disclosed herein.
- the antibodies of the disclosure or antigen-binding fragments thereof comprise all six CDRs of the monoclonal antibodies which specifically bind to the polypeptide of SEQ ID NO: 77.
- the disclosure relates to antibodies or antigen-binding fragments thereof comprising (a) all six CDRs of MAb 6G8 comprising CDR H1 -3 comprising, consisting essentially of, or consisting of, the sequences set forth in SEQ ID Nos: 1-3 and CDR L1 -3 comprising, consisting essentially of, or consisting of, the sequences set forth in SEQ ID Nos: 4-6; or (b) all six CDRs of MAb 8C10 comprising CDR H1 -3 comprising, consisting essentially of, or consisting of, the sequences set forth in SEQ ID Nos: 7-9 and CDR L1 -3 comprising, consisting essentially of, or consisting of, the sequences set forth in SEQ ID Nos: 10-12.
- the disclosure further relates to antibodies or fragments thereof that specifically bind to DbpA fragment of SEQ ID NO: 77 or an immunogenic fragment thereof and also specifically bind to full-length DbpA comprising SEQ ID NO: 78 or a variant thereof.
- the full-length DbpA is present on the surface of B. burgdorferi .
- the full-length DbpA is secreted by the B. burgdorferi .
- the full-length DbpA is in complex with an ECM component, e.g., decorin.
- the structural features of the antigen-binding domains in MAb 6G8 or MAb 8C10 are used to create structurally related anti-DbpA antibodies that retain at least one functional property of the antibodies of the disclosure, such as binding to DbpA. More specifically, one or more CDR regions of MAb 6G8 or MAb 8C10 can be combined recombinantly with known human framework regions and CDRs to create additional, recombinantly-engineered, anti-DbpA antibodies of the disclosure.
- Engineered antibodies of the disclosure can be tested for binding to DbpA using routine assays, for example, sandwich immunoassay complex formation, enzyme-linked immunoassay, radioimmunoassay, immunoprecipitation assay, fluorescence immunoassay, chemiluminescent assay, immunoblot assay, lateral flow assay, flow cytometry assay, mass spectrometry assay, direct binding assay, antibody or antigen displacement assay, latex agglutination, indirect hemagglutination assay (IHA), complement fixation assay, inhibition assay, avidity assay, a dipstick test, particulate-based assay, surface plasmon resonance (SPR) assay (e.g., BIACORE).
- antigenic peptide-antibody complexes described herein are detected using enzyme-linked immunoassay (ELISA), lateral flow assay, direct binding assay or SPR.
- each antibody can be biotinylated using commercially available reagents (Pierce, Rockford, Ill., USA). Competition studies using unlabeled (“cold”) antibodies and biotinylated (“hot”) antibodies can be performed using DbpA coated-ELISA plates. Biotinylated mAb binding can be detected with a strep-avidin-alkaline phosphatase probe. If the cold antibody competes with (and/or displaces) the hot antibody for binding to the antigen, then it can be inferred that the two antibodies share a common epitope or that the epitope of the cold antibody is in close proximity with the epitope of the hot antibody. Kinetic studies can be further conducted to assess whether the cold antibody is allosterically inhibiting the binding between the hot antibody and the antigen.
- isotype ELISAs can be performed. In order to demonstrate binding of monoclonal antibodies to live cells expressing the DbpA, flow cytometry can be used. Anti-DbpA immunoglobulins can be further tested for reactivity with DbpA antigen by Western blotting.
- the structural features e.g., amino sequences or three-dimensional structures or both
- the structural features may be used to create structurally related anti-DbpA antibodies that retain at least one functional property of the antibodies of the disclosure, such as binding to DbpA.
- one or more CDR regions of MAb 6G8 or MAb 8C10 can be combined recombinantly with known human framework regions and CDRs to create additional, recombinantly-engineered, anti-DbpA antibodies of the disclosure.
- the FR H1 sequences of the two antibodies could be swapped such that 8C10 FR H1 sequence of SEQ ID NO: 19 is used as framework for 6G8 CDR H1 sequence of SEQ ID NO: 1 or 6G8 FR H1 sequence of SEQ ID NO: 13 is used is used as framework for 8C10 CDR H1 sequence of SEQ ID NO: 7.
- framework regions could also be swapped to create new variants, e.g., swapping of FR H2 sequences of MAb 6G8 (SEQ ID NO: 14) and 8C10 (SEQ ID NO: 20) (about 93% sequence identity); swapping of FR H3 sequences of MAb 6G8 (SEQ ID NO: 15) and 8C10 (SEQ ID NO: 21) (about 78% sequence identity); swapping of light framework 1 (FR L1 ) sequences of MAb 6G8 (SEQ ID NO: 16) and 8C10 (SEQ ID NO: 22) (about 65% sequence identity); swapping of FR L2 sequences of MAb 6G8 (SEQ ID NO: 17) and 8C10 (SEQ ID NO: 23) (about 73% sequence identity); and/or swapping of FR L3 sequences of MAb 6G8 (SEQ ID NO: 18) and 8C10 (SEQ ID NO: 24) (about 57% sequence identity).
- the disclosure relates to molecules comprising antigen-binding sequences comprising a variable heavy chain (VH) and/or a variable light chain (VL) domain, wherein the VH comprises FR H1 -CDR H1 -FR H2 -CDR H2 -FR H3 -CDR H3 and/or VL comprises FR L1 -CDR L1 -FR L2 -CDR L2 -FR L3 -CDR L3 , wherein FR 1-3 , in each VH or VL chain, represent antibody framework regions; and wherein CDR 1-3 , in each VH or VL chain, represent antibody complementary determining regions.
- VH variable heavy chain
- VL variable light chain
- Non-limiting examples of such molecules include, e.g., polypeptides comprising, consisting essentially of, or consisting of, the following amino acid sequences for VH and/or VL chains (“ ⁇ ” indicates a bond, preferably a peptide bond):
- VH SEQ ID NO: 13-SEQ ID NO: 1-SEQ ID NO: 14-SEQ ID NO: 2-SEQ ID NO: 15-SEQ ID NO: 3;
- VL SEQ ID NO: 16-SEQ ID NO: 4-SEQ ID NO: 17-SEQ ID NO: 5-SEQ ID NO: 18-SEQ ID NO: 6;
- the VH and VL sequences are set forth in the sequences QVQLQQPGAELVKPGASVKLSCKASGYTFTRYWMYWVKQRPGRGLEWIGRLDPNSGVTKYNEKF KSKATLTVDKSSSTAYMQLSSLTSEDSAVYYCVRDDSWYFDV (SEQ ID NO: 25) and EIQMTQSPSSMSASLGDRITITCQATQDIVKNLNWYQQKPGKPPSFLIYYATELAEGVPSRFSG SGSGSDYSLTINNLESQDFADYFCLQFYAFPLT (SEQ ID NO: 26), respectively.
- VH SEQ ID NO: 19-SEQ ID NO: 7-SEQ ID NO: 20-SEQ ID NO: 8-SEQ ID NO: 21-SEQ ID NO: 9;
- VL SEQ ID NO: 22-SEQ ID NO: 10-SEQ ID NO: 23-SEQ ID NO: 11-SEQ ID NO: 24-SEQ ID NO: 12;
- the VH and VL sequences are set forth in the sequences QVQLQQSGAELMKPGASVKLSCKAAGYTFTDYWIEWVKQRPGHGLEWIGEILPGSGSTKDNERF KGKATFTADTSSNTAYMQLSSLTTEDSAIYYCARREWGYYFDY (SEQ ID NO: 27) and DIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLIYWASTRHTGVPDRFTG SGSGTDYTLTISSVQAEDLALYYCQQHYSTPYT (SEQ ID NO: 28), respectively.
- the engineered molecules of the disclosure may contain a peptide sequence, for example, an N-terminal signal sequence that guides the trafficking of the antibody or a fragment thereof to the extracellular milieu, plasma membrane (outer membrane, transmembrane, or inner membrane), or a specialized compartment in the cell, e.g., endosome, lysosome, ER, Golgi's apparatus, vacuoles, inclusion bodies, nucleolus, mitochondria, chloroplast, periplasm, etc.
- a peptide sequence for example, an N-terminal signal sequence that guides the trafficking of the antibody or a fragment thereof to the extracellular milieu, plasma membrane (outer membrane, transmembrane, or inner membrane), or a specialized compartment in the cell, e.g., endosome, lysosome, ER, Golgi's apparatus, vacuoles, inclusion bodies, nucleolus, mitochondria, chloroplast, periplasm, etc.
- the signal sequence comprises, consists essentially of, or consists of 6G8 signal sequence set forth in MGWSCIMLFLAATATGVHS (SEQ ID NO: 29) or MDMRAPAQFLGILLLWFPGARC (SEQ ID NO: 30) or 8C10 signal sequence set forth in MEWTWVFLFLLSVTAGVHS (SEQ ID NO: 31) or MESQIQAFVFVFLWLSGVDG (SEQ ID NO: 32).
- Other signal peptides such as those disclosed in U.S. Pat. No. 7,807,409, may also be used.
- the disclosure therefore relates to molecules comprising signal peptides (e.g., SEQ ID NOs: 29-32), that are conjugated to the N-termini of antigen-binding sequences comprising a variable heavy chain (VH) and/or a variable light chain (VL) domain, wherein the VH comprises FR H1 -CDR H1 -FR H2 -CDR H2 -FR H3 -CDR H3 and/or VL comprises FR L1 -CDR L1 -FR L2 -CDR L2 -FR L3 -CDR L3 , wherein FR 1-3 , in each VH or VL chain, represent antibody framework regions and CDR 1-3 , in each VH or VL chain, represent antibody complementary determining regions, wherein the meanings of each FR and each CDR have been provided above.
- signal peptides e.g., SEQ ID NOs: 29-32
- the disclosure further relates to antibodies comprising secondary antibody regions and domains.
- Such may include, e.g., constant domains, hinge regions, including antibody portions comprising a plurality of such domains (e.g., constant portion comprising two or more constant domains).
- the variable domains of each pair of light and heavy chains are the specific ligand binding domains of the antibody, other molecules, known as effector molecules or cells, bind to other sites in the remainder of the antibody molecule, i.e., other than the antigen binding sites.
- these domains are generally referred as “secondary regions” of an antibody, such regions being located particularly in the Fc region constituted by the portions of the heavy chains extending beyond the ends of the light chains.
- DbpA binding antibodies with reconfigured, redesigned, or otherwise altered constant domains are encompassed by the anti-DbpA antibody compositions of the disclosure.
- effector functions mediated by the antibody Fc region can be divided into two categories: (1) effector functions that operate after the binding of antibody to an antigen (these functions involve the participation of the complement cascade or Fc receptor (FcR)-bearing cells); and (2) effector functions that operate independently of antigen binding (these functions confer persistence in the circulation and the ability to be transferred across cellular barriers by transcytosis (Ward et al., Therapeutic Immunology, 2:77-94, 1995).
- FcR complement cascade or Fc receptor
- cellular responses include neutralization of target, opsonization and sensitization (if antigen is displayed on the surface of a cell, such as in the case of DbpA), sensitization of mast cells, and activation of complement.
- opsonization and sensitization if antigen is displayed on the surface of a cell, such as in the case of DbpA
- sensitization of mast cells if activation of complement.
- cellular targets e.g., cell antigens
- the effector functions include antibody directed cellular cytotoxicity (ADCC) or complement-mediated cytotoxicity (CDC).
- the disclosure relates to antibodies comprising an entire heavy and/or an entire light chain of MAb 6G8, the sequences of which comprise, consist essentially of, or consist of the polypeptide sequences of SEQ ID NO: 33 (6G8 ⁇ chain) and/or SEQ ID NO: 34 (6G8 ⁇ chain) or a variant comprises at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to SEQ ID NO: 33 and/or SEQ ID NO: 34, wherein the amino acids at positions 1-19 of SEQ ID NO: 33 and at positions 1-22 of SEQ ID NO: 34 make up the signal peptide, which are optionally cleaved (in a mature protein):
- the disclosure relates to antibodies comprising an entire heavy and/or an entire light chain of MAb 8C10, the sequences of which comprise, consist essentially of, or consist of the polypeptide sequences of SEQ ID NO: 35 (8C10 ⁇ chain) and/or SEQ ID NO: 36 (8C10 ⁇ chain) or a variant comprises at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to SEQ ID NO: 35 and/or SEQ ID NO: 36 (note: the amino acids at positions 1-19 of SEQ ID NO: 35 and at positions 1-20 of SEQ ID NO: 36 make up the signal peptide, which may be cleaved in the mature protein):
- immunoglobulin G includes other types of immunoglobulin isotypes, e.g., any of the five major classes or isotypes selected from IgA, IgD, IgE, IgG and IgM, including subclasses (subtypes) thereof, e.g. IgG1, IgG2, IgG3, and IgG4; IgA1, IgA2, and IgAsec.
- immunoglobulin isotypes e.g., any of the five major classes or isotypes selected from IgA, IgD, IgE, IgG and IgM, including subclasses (subtypes) thereof, e.g. IgG1, IgG2, IgG3, and IgG4; IgA1, IgA2, and IgAsec.
- the light chains of the antibodies usually are of two classes (K and X) and the heavy chain constant regions correspond to the different classes of immunoglobulins, vis-á-vis ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ for IgA, IgD, IgE, IgG and IgM, respectively.
- K and X the heavy chain constant regions
- immunoglobulins vis-á-vis ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ for IgA, IgD, IgE, IgG and IgM, respectively.
- human immunoglobulin classes only human IgG, IgG2, IgG3 and IgM are known to activate complement; and human IgG and IgG3 mediate ADCC more effectively than IgG2 and IgG4.
- the antibodies of the disclosure may include chimeric or humanized forms of the MAb 6G8 or MAb 8C10 in a variety of human antibody isotypes and subtypes, such as, IgG K, IgG2, IgG4, IgM, and IgA1.
- the antibody is an IgM antibody.
- the IgM class of antibodies recognizes a large variety of pathogenic antigens and is highly active in cytotoxic and cytolytic reactions due to its superior activation of the complement system.
- IgM antibody is useful in antibody drug discovery.
- IgM antibody demonstrates strong avidity as well as complement fixation property against bacterial antigens.
- an IgM antibody is particularly useful.
- the IgM antibody comprises, consists essentially of, or consists of, the Ig t chain C region SEQ ID NO: 37 (see PIR: S37768; GI: 7439150; last revised: Mar. 10, 2005) or a fragment thereof or a variant thereof:
- Fragments of Ig Ct chain C region preferably comprise deletion of the first constant Ig domain of the heavy chain, e.g., a deletion of aa1-102 of SEQ ID NO: 37.
- Variants of the Ig Ct chain C region include, polypeptides comprising at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to SEQ ID NO: 37.
- Non-limiting examples of such variants include, polypeptides having the following accession numbers: UNIPROT #P01871 (last revised: Mar. 28, 2018), GENBANK #CAB37838 (last revised: Jul. 25, 2016) and GENBANK #CAC20458 (last revised: Jul. 14, 2016), all of which comprise >95% sequence identity to SEQ ID NO: 37, including fragments thereof (e.g., comprising, deletion of the first constant Ig domain of the heavy chain).
- the disclosure further relates to chimeric proteins wherein the constant portion of an immunoglobulin (e.g., IgG) is replaced by a constant portion of a different immunoglobulin isotype (e.g., IgA, IgD, IgE, or IgM; preferably IgM).
- an immunoglobulin e.g., IgG
- a different immunoglobulin isotype e.g., IgA, IgD, IgE, or IgM; preferably IgM.
- the disclosure provides for a chimeric antibody comprising a variable (Fv) region of a first antibody (e.g., IgG) fused to constant regions (C1, optionally together with C2 and/or C3) of a second antibody (e.g., IgA, IgD, IgE, or IgM; preferably IgM) or a chimeric antibody comprising a fragment antigen-binding (Fab) region of a first antibody (e.g., IgG) fused to constant regions (C2 and/or C3) of a second antibody (e.g., IgA, IgD, IgE, or IgM; preferably IgM).
- a chimeric antibody comprising a variable (Fv) region of a first antibody (e.g., IgG) fused to constant regions (C1, optionally together with C2 and/or C3) of a second antibody (e.g., IgA, IgD, IgE, or IgM; preferably I
- the constant regions comprise all or a substantial portion of the crystallizable region (Fc) of the second antibody.
- the disclosure includes a 6G8 chimeric IgM (SEQ ID NO: 38) and 8C10 chimeric IgM (SEQ ID NO: 39), wherein for SEQ ID NO: 38, the IgG sequences correspond to amino acid residues 1-214 and the remainder are IgM sequences.
- the disclosure further provides a method for preparing an anti-DbpA antibody comprising: preparing an antibody comprising (1) human heavy chain framework regions and human heavy chain CDRs, wherein at least one of the human heavy chain CDRs comprises an amino acid sequence selected from the amino acid sequences of CDRs shown in SEQ ID NOs: 1-3; and (2) human light chain framework regions and human light chain CDRs, wherein at least one of the human heavy chain CDRs comprises an amino acid-sequence selected from the amino acid sequences of CDRs shown in SEQ ID NOs: 4-6; wherein the antibody retains the ability to bind to DbpA.
- the ability of the antibody to bind DbpA can be determined using standard binding assays, such as those set forth in the Examples (e.g., using BIACORE or an ELISA).
- the disclosure further provides a method for preparing an anti-DbpA antibody comprising: preparing an antibody comprising (1) human heavy chain framework regions and human heavy chain CDRs, wherein at least one of the human heavy chain CDRs comprises an amino acid sequence selected from the amino acid sequences of CDRs shown in SEQ ID NOs: 7-9; and (2) human light chain framework regions and human light chain CDRs, wherein at least one of the human heavy chain CDRs comprises an amino acid-sequence selected from the amino acid sequences of CDRs shown in SEQ ID NOs: 10-12; wherein the antibody retains the ability to bind to DbpA.
- the ability of the antibody to bind DbpA can be determined using standard binding assays, such as those set forth in the Examples (e.g., using BIACORE or an ELISA).
- the antibodies of the disclosure can bind DbpA fragment of SEQ ID NO: 77 with a wide range of affinities (K D ).
- at least one mAb of the present disclosure can optionally bind DbpA subunit with high affinity.
- a human mAb can bind DbpA with a K D equal to or less than about 10 ⁇ 7 M, such as but not limited to, 0.1-9.9 (or any range or value therein) ⁇ 10 ⁇ 7 , 10 ⁇ 8 , 10 ⁇ 9 , 10 ⁇ 10 , 10 ⁇ 11 , 10 ⁇ 12 , 10 ⁇ 13 M or any range or value therein.
- the affinity or avidity of an antibody of the disclosure for an antigen such as DbpA fragment of SEQ ID NO: 77 can be determined experimentally using any suitable method. Representative methods are described in, Berzofsky et al. In: Fundamental Immunology , Paul et al., Ed., Raven Press: New York, N.Y. (1984); Kuby et al., In: Immunology , W. H. Freeman and Company, New York, N.Y. (1992); and methods described herein).
- the measured affinity of a particular antibody-antigen interaction can vary if measured under different conditions (e.g., salt concentration, pH).
- affinity and other antigen-binding parameters e.g., K D , IC 50
- K D , IC 50 are preferably made with standardized solutions of antibody and antigen, and a standardized buffer, such as the buffer described herein.
- the antibody or antigen-binding fragment of the disclosure binds DbpA and, thereby partially or substantially sequesters the protein.
- the antibodies of the disclosure inhibit at least one biological activity of DbpA.
- the disclosure also relates to antibodies, antigen-binding fragments, immunoglobulin chains and CDRs comprising amino acids in a sequence that is substantially the same as an amino acid sequence described herein.
- such antibodies bind DbpA with high affinity (e.g., K D less than or equal to about 10 ⁇ 9 M).
- Amino acid sequences that are substantially the same as the sequences described herein include sequences comprising conservative amino acid substitutions, as well as amino acid deletions and/or insertions.
- the anti-DbpA antibody of the present disclosure can include one or more amino acid substitutions, deletions or additions, either from natural mutations or human manipulation, as specified herein.
- Amino acids in an anti-DbpA antibody of the present disclosure that are important for function, e.g., DbpA binding, can be identified by methods known in the art, such as site-directed mutagenesis or alanine-scanning mutagenesis (e.g., Ausubel, Current Protocols (2002), Chapters 8, 15, supra; Cunningham et al., Science 244:1081-1085, 1989). Cunningham's procedure introduces single alanine mutations at every residue in the molecule. The resulting mutant molecules are then tested for biological activity, such as, but not limited to at least one DbpA binding activity.
- Sites that are important for antibody binding can also be identified by structural analysis such as crystallization, nuclear magnetic resonance or photo affinity labeling (Smith et al., J. Mol. Biol., 224:899-904, 1992 and de Vos et al., Science 255:306-312, 1992).
- the present disclosure includes at least one biologically active antibody of the present disclosure.
- Biologically active antibodies have a specific activity at least 20%, 30%, or 40%, and preferably at least 50%, 60%, or 70%, and most preferably at least 80%, 90%, or 95%-100% of that of the parent antibody, MAb 6G8 or MAb 8C10. Methods of assaying and quantifying measures of activity and antigen specificity are well known to immunologists.
- the disclosure especially relates to antigen-binding fragments of the antibodies, e.g., Fab, F(ab′)2, Fv and scFv.
- the Fab fragment of an antibody which is about one-third the size of a complete antibody contains the heavy and light chain variable regions, the complete light chain constant region and a portion of the heavy chain constant region.
- Fab molecules are stable and associate well due to the contribution of the constant region sequences. They can be generated via papain digestion of a complete antibody or recombinantly.
- F(ab′)2 comprise two antigen binding sites and are generated from complete antibodies using pepsin or Streptococcus pyogenes immunoglobulin degrading enzyme (IDES),
- functional Fab or F(ab′)2 expressed in bacterial systems is lower than that of the smaller Fv fragment which contains only the variable regions of the heavy and light chains.
- the Fv fragment is the smallest portion of an antibody that still retains a functional antigen binding site.
- the Fv fragment has the same binding properties as the Fab, however without the stability conferred by the constant regions, the two chains of the Fv can dissociate relatively easily in dilute conditions.
- VH and VL regions of Fv can be fused via a polypeptide linker (Huston et al., PNAS USA, 85 (16) 5879-5883, 1988) to stabilize the antigen binding site.
- This single polypeptide Fv fragment is known as a single chain antibody (scFv). See WO; U.S. Pat. Nos. 5,534,254; 5,571,894; and 5,587,458.
- Fv and sFv comprising intact combining sites, that is VH and VL domains that are devoid of constant regions, can also be generated.
- the VH and VL in Fv, sFv and scFv can be arranged with either domain first.
- the linker joins the carboxy terminus of the first chain to the amino terminus of the second chain.
- the disclosure further relates to antibodies comprising single domain antibodies (sdAb).
- sdAb single domain antibodies
- Versatile methods for generating rabbit variable domain of heavy chain (rVH) derived sdAbs with high affinities (K D ⁇ 1 nM) and enhanced thermal stabilities are known in the art. See, Shinozaki et al., Sci. Rep., 7(1):5794, 2017; Hussack et al., PLoS One, 6(11), e28218, 2011.
- a variety of sdAbs, including those with high affinities, can be efficiently acquired using an rVH-displaying phage library.
- antibody fragments may be made and used in accordance with the disclosure.
- heavy or light chains in antibody fragments can be mutagenized using site directed mutagenesis. The two chains can be combined to form a functional antibody fragment.
- Random non-specific light or heavy chain sequences may be added using a combinatorial system to generate a library of diverse members, which are tested for functionality, e.g., DbpA binding (more specifically binding to DbpA fragment of SEQ ID NO: 77) using routine methods, e.g., a high throughput method based on BIACORE screening.
- Anti-DbpA antibodies of the present disclosure can be optionally produced by a variety of techniques, including the standard somatic cell hybridization technique (hybridoma method) of Kohler et al., Nature 256:495, 1975.
- hybridoma method a mouse or other appropriate host animal, such as a hamster or macaque monkey, is immunized as described herein to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the protein used for immunization.
- lymphocytes may be immunized in vitro.
- Lymphocytes then are fused with myeloma cells using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (Goding et al., Monoclonal Antibodies: Principles and Practice., pp. 59-103 (Academic Press, 1986)).
- a suitable fusing agent such as polyethylene glycol
- the anti-DbpA antibody can also be optionally generated by immunization of a transgenic animal (e.g., mouse, rat, hamster, non-human primate, and the like) capable of producing a repertoire of human antibodies, as described herein and/or as known in the art.
- a transgenic animal e.g., mouse, rat, hamster, non-human primate, and the like
- Cells that produce a human anti-DbpA antibody can be isolated from such animals and immortalized using suitable methods, such as the methods described herein.
- transgenic mice carrying human immunoglobulin (Ig) loci in their germline configuration provide for the isolation of high affinity fully human monoclonal antibodies directed against a variety of targets including human self antigens for which the normal human immune system is tolerant (See, Lonberg et al., Nature, 368, 856-9, 1994; Green et al., Nature Genet., 7, 13-21, 1994; Green et al., Exp. Med., 188:483-95, 1988; Lonberg et al., Int. Rev. Immunol., 13:65-93, 1995; Bruggemann et al., Eur. J. Immunol., 21, 1323-1326, 1991; Fishwild et al., Nat.
- Ig immunoglobulin
- immunogenic antigens and monoclonal antibody production can be performed using any suitable technique such as recombinant protein production.
- the immunogenic antigens can be administered to an animal in the form of purified protein, or protein mixtures including whole cells or cell or tissue extracts, or the antigen can be formed de novo in the animal's body from nucleic acids encoding said antigen or a portion thereof.
- Immunization with antigen can be optionally accompanied by addition of an adjuvant, such as complete Freund's adjuvant.
- the immune response can be monitored over the course of the immunization protocol with plasma samples being obtained by retroorbital bleeds.
- the plasma can be screened by ELISA (as described below), and mice with sufficient titers of anti-DbpA immunoglobulin can be used for fusions.
- Mice can be boosted intravenously with antigen 3 days before sacrifice and removal of the spleen.
- plurality e.g., 2, 3, 4 or more
- Several mice may be immunized for each antigen.
- splenocytes and lymph node cells from immunized mice can be isolated and fused to an appropriate immortalized cell line, such as a mouse myeloma cell line.
- an appropriate immortalized cell line such as a mouse myeloma cell line.
- the resulting hybridomas can be screened for the production of antigen-specific antibodies.
- a suitable immortal cell line incapable of producing immunoglobulin chains is selected as a fusion partner, e.g., a myeloma cell line such as, but not limited to, Sp2/0 and derivative cell lines, NS1 and derivatives, especially NSO engineered NSO lines such as GS-NSO, AE-1, L.5, P3X63Ag8.653, U937, MLA 144, ACT IV, MOLT4, DA-1, JURKAT, WEHI, K-562, COS, RAJI, NIH 3T3, HL-60, MLA 144, NAMAIWA, NEURO 2A, CHO, PerC.6, YB2/O or the like, or hetero-myelomas, fusion products thereof, or any cell or fusion cell derived therefrom, or any other suitable cell line as known in the art (Birch et al., Biologics 22:127-133, 1994).
- NSO engineered NSO lines such as GS-NSO, AE-1
- the fused cells (hybridomas) or recombinant cells can be isolated using selective culture conditions or other suitable known methods, and cloned by limiting dilution or cell sorting, or other known methods. Cells which produce antibodies with the desired specificity can be detected by a suitable assay (e.g., ELISA) and selected for manipulation.
- a suitable assay e.g., ELISA
- Suitable methods of generating or isolating antibodies of the requisite specificity can be used, including, but not limited to, methods that select recombinant antibody from a peptide or protein library (e.g., but not limited to, a bacteriophage, ribosome, oligonucleotide, RNA, cDNA, or the like, display library; e.g., as available from Cambridge antibody Technologies, Cambridgeshire, UK; MORPHOSYS, Martinsreid, Germany; Biovation, Aberdeen, Scotland, UK; Biolnvent, Lund, Sweden; Dyax Corp., Enzon, Affymax/Biosite; Xoma, Berkeley, Calif., USA. See, e.g., U.S. Pat. Nos.
- Such techniques include, but are not limited to, ribosome display (Hanes et al., PNAS USA, 94:4937-4942, 1997); Hanes et al., PNAS USA, 95:14130-1413, 1998); single cell antibody producing technologies (e.g., selected lymphocyte antibody method (“SLAM”) (U.S. Pat. No. 5,627,052; Wen et al., J.
- SLAM selected lymphocyte antibody method
- Screening antibodies for specific binding to similar proteins or fragments can also be conveniently achieved using peptide display libraries. This method involves the screening of large collections of peptides for individual members having the desired function or structure.
- Antibody screening using peptide display libraries is well known in the art.
- the displayed peptide sequences can be from 3 to 5000 or more amino acids in length, frequently from 5-100 amino acids long, and often from about 8 to 25 amino acids long.
- Peptide display libraries, vector, and screening kits are commercially available from such suppliers as Invitrogen (Carlsbad, Calif., USA), and Cambridge Antibody Technologies (Cambridgeshire, UK). See, U.S. Pat. No. 5,885,793. See also, e.g., Enzon patents (U.S. Pat. Nos.
- Antibody fragments can be derived via proteolytic digestion of intact antibodies (see, e.g., Morimoto et al., J Biochem Biophys Methods, 24:107-117, 1992; and Brennan et al., Science, 229:81, 1985). However, these fragments can now be produced directly by recombinant host cells. F(ab′)2, Fab, Fv and ScFv antibody fragments can all be expressed in and secreted from mammalian host cells or from E. coli , thus allowing the facile production of large amounts of these fragments. Antibody fragments can be isolated from the antibody phage libraries discussed above. Alternatively, Fab′-SH fragments can be directly recovered from E. coli and chemically coupled to form F(ab′)2 fragments (Carter et al., BioTechnology 10:163-167, 1992).
- recombinant production of antibody fragments is carried out using a single-chain expression polynucleotide.
- This expression polynucleotide contains: (1) a single-chain antibody cassette consisting of a VH domain, spacer peptide, and VL domain operably linked to encode a single-chain antibody, (2) a promoter suitable for in vitro transcription (e.g., T7 promoter, SP6 promoter, and the like) operably linked to ensure in vitro transcription of the single-chain antibody cassette forming a mRNA encoding a single-chain antibody, and (3) a transcription termination sequence suitable for functioning in an in vitro transcription reaction.
- the expression polynucleotide may also comprise an origin of replication and/or a selectable marker.
- VH and VL sequences are synthesized.
- V gene family-specific primers or V gene-specific primers may be used (Nicholls et al., J. Immunol. Meth., 165: 81, 1993; WO 1993/12227) or are designed according to standard art-known methods based on available sequence information.
- mouse or human VH and VL sequences are isolated.
- VH and VL sequences are then ligated, usually with an intervening spacer sequence (e.g., encoding an in-frame flexible peptide spacer), forming a cassette encoding a single-chain antibody.
- an intervening spacer sequence e.g., encoding an in-frame flexible peptide spacer
- a library comprising a plurality of VH and VL sequences is used (sometimes also with a plurality of spacer peptide species represented), wherein the library is constructed with one or more of the VH and VL sequences mutated to increase sequence diversity particularly at CDR residues, sometimes at framework residues.
- V region sequences can be conveniently cloned as cDNAs or PCR amplification products for immunoglobulin-expressing cells.
- cells from human hybridoma, or lymphoma, or other cell line that synthesizes either cell surface or secreted immunoglobulin may be used for the isolation of polyA+RNA.
- the RNA is then used for the synthesis of oligo dT primed cDNA using the enzyme reverse transcriptase (see, Goodspeed et al., Gene, 76: 1, 1989; Dunn et al., J. Biol. Chem., 264: 13057, 1989).
- the V-region cDNA or PCR product is isolated, it is cloned into a vector to form a single-chain antibody cassette.
- the antibodies of the disclosure or antigen-binding fragments thereof may be prepared by in vitro (e.g., cell-free) synthesis, using conventional methods as known in the art.
- Various synthetic apparatuses are available, e.g., automated synthesizers by Applied Biosystems, Inc., Foster City, Calif., USA.
- synthesizers Naturally occurring amino acids may be substituted with unnatural amino acids. The particular sequence and the manner of preparation will be determined by convenience, economics, purity required, and the like.
- the disclosure further relates to nucleic acids which encode the antigens of the disclosure or antibodies or antigen-binding fragments thereof which bind to the antigens.
- the disclosure relates to nucleic acid sequences that encode the CDRs of MAb 6G8 comprising, consisting essentially of, or consisting of SEQ ID Nos: 1-6 or variants thereof comprising at least 80%, 90%, or 95% sequence identity to SEQ ID Nos: 1-6.
- the nucleic acid sequences comprise MAb 6G8 CDR H1 encoding sequence AGG TACTGGATGT AC (SEQ ID NO: 40); CDRH2 encoding sequence AGGCTT GATCCTAATA GTGGTGTTAC TAAATACAAT GAGAAGTTCA AGAGC (SEQ ID NO: 41); CDRH3 encoding sequence GATGATTCC TGGTACTTCG ATGTC (SEQ ID NO: 42); CDR L1 encoding sequence CAGGC AACTCAAGAC ATTGTTAAGA ATTTAAAC (SEQ ID NO: 43); CDRu encoding sequence TATGCAA CTGAACTGGC AGAA (SEQ ID NO: 44); and CDR L3 encoding sequence CTACAGTTTT ATGCGTTTCC GCTCACG (SEQ ID NO: 45).
- the disclosure further relates to polynucleotides that comprise at least 80%, 90%, or 95% sequence identity to SEQ ID Nos: 40-45, complements thereof, RNA equivalents thereof, or degener
- the disclosure relates to nucleic acid sequences that encode the CDRs of MAb 8C10 comprising, consisting essentially of, or consisting of SEQ ID Nos: 7-12 or variants thereof comprising at least 80%, 90%, or 95% sequence identity to SEQ ID Nos: 7-12.
- the nucleic acid sequences comprise MAb 8C10 CDR H1 encoding sequence GAC TACTGGATAG AG (SEQ ID NO: 46); CDR H2 encoding sequence GAGATT TTACCTGGAA GTGGTAGTAC TAAGGACAAT GAGAGGTTCA AGGGC (SEQ ID NO: 47); CDR H3 encoding sequence AGGGAGTGG GGCTACTACT TTGACTAC (SEQ ID NO: 48); CDR L1 encoding sequence A AGGCCAGTCA GGATGTGAGT ACTGCTGTAG CC (SEQ ID NO: 49); CDR L2 encoding sequence ATTTACTGG GCATCCACCC GGCACACT (SEQ ID NO: 50); and CDR L3 encoding sequence CAGCAA CATTATAGCA CTCCGTACAC G (SEQ ID NO: 51).
- the disclosure further relates to polynucleotides that comprise at least 80%, 90%, or 95% sequence identity to SEQ ID Nos: 46-51, complements thereof, RNA equivalent
- the disclosure relates to nucleic acid sequences that encode the FRs of MAb 6G8 comprising, consisting essentially of, or consisting of SEQ ID Nos: 13-18 or variants thereof comprising at least 80%, 90%, or 95% sequence identity to SEQ ID Nos: 13-18.
- the nucleic acid sequences comprise MAb 6G8 FR H1 encoding sequence CAG GTCCAACTGC AGCAGCCTGG GGCTGAGCTT GTGAAGCCTG GGGCTTCAGT GAAGCTGTCC TGCAAGGCTT CTGGCTACAC TTTCACT (SEQ ID NO: 52); FR H2 encoding sequence TGGGTGAA ACAGAGGCCT GGACGAGGCC TTGAGTGGAT TGGA (SEQ ID NO: 53); FR H3 encoding sequence AAGGC CACTCTGACT GTAGACAAAT CCTCCAGCAC AGCCTACATG CAGCTCAGCA GCCTGACATC TGAGGACTCT GCGGTCTATT ATTGTGTAAG GGATGATTCC (SEQ ID NO: 54); FR L1 encoding sequence GAAA TCCAGATGAC CCAGTCTCCA TCCTCTATGT CTGCATCTCT GGGAGACAGA ATAACCATCA CTTGC (SEQ ID NO: 55); FR L2 encoding
- the disclosure relates to nucleic acid sequences that encode the FRs of MAb 8C10 comprising, consisting essentially of, or consisting of SEQ ID Nos: 19-24 or variants thereof comprising at least 80%, 90%, or 95% sequence identity to SEQ ID Nos: 19-24.
- the nucleic acid sequences comprise MAb 6G8 FR H1 encoding sequence CAG GTTCAGCTGC AGCAGTCTGG AGCTGAGCTG ATGAAGCCTG GGGCCTCAGT GAAGCTTTCC TGCAAGGCTG CTGGCTACAC ATTCACT (SEQ ID NO: 58); FR H2 encoding sequence TGGGTAAA ACAGAGGCCT GGACATGGCC TTGAGTGGAT TGGA (SEQ ID NO: 59); FR H3 encoding sequence AAGGC CACATTCACT GCAGATACAT CCTCCAACAC AGCCTACATG CAACTCAGCA GCCTGACAAC TGAGGACTCT GCCATCTATT ACTGTGCAAG G (SEQ ID NO: 60); FR L1 encoding sequence GACATTGTGA TGACCCAGTC TCACAAATTC ATGTCCACAT CAGTAGGAGA CAGGGTCAGT ATCACCTGC (SEQ ID NO: 61); FR L2 encoding sequence TGGTATCA
- the variant nucleic acids which encode CDRs of MAb 6G8 or MAb 8C10 do not contain mutations that would result in deletion, non-conservative substitutions, and/or change in positioning of the following amino acids: (1) CDR H1 : 2 Y and/or 3 W (relative to SEQ ID NO: 1); (2) CDR H2 : 4 P, 6 S, 7 G, 9 T, 10 K, 12 N, 13 E, 16 F and/or 17 K (relative to SEQ ID NO: 2); (3) CDR H3 : 6 F (relative to SEQ ID NO: 3); (4) CDR L1 : 2 A, 4 Q, and/or 5 D (relative to SEQ ID NO: 4); (5) CDR L2 : 1 Y (relative to SEQ ID NO: 5); and/or CDR L3 : 2 Q, 4 Y, 7 P and/or 9 T (relative to SEQ ID NO: 6).
- the disclosure relates to nucleic acids encoding molecules comprising antigen-binding sequences comprising a variable heavy chain (VH) and/or a variable light chain (VL) domain, wherein the VH comprises FR H1 -CDR H1 -FR H2 -CDR H2 -FR H3 -CDR H3 and/or VL comprises FR L1 -CDR L1 -FR L2 -CDR L2 -FR L3 -CDR L3 , wherein FR 1-3 , in each VH or VL chain, represent antibody framework regions; and wherein CDR 1-3 , in each VH or VL chain, represent antibody complementary determining regions (“ ⁇ ” indicates a bond, preferably a peptide bond).
- VH variable heavy chain
- VL variable light chain
- Non-limiting examples of such molecules include, e.g., polypeptides comprising, consisting essentially of, or consisting of, the following amino acid sequences for VH and/or VL chains: (a) SEQ ID NOs: 25 and 26 or variants thereof comprising at least 80%, 90%, or 95% sequence identity to nucleic acids encoding SEQ ID Nos: 25 and/or 26; or (b) SEQ ID NOs: 27 and 28 or variants thereof comprising at least 80%, 90%, or 95% sequence identity to nucleic acids encoding SEQ ID Nos: 27 and/or 28.
- the disclosure further includes nucleic acids encoding signal sequences comprising SEQ ID Nos: 29-32 or variants thereof. Such nucleic acids may be included or excluded from the 5′ end of nucleic acids which encode CDRs and/or FRs.
- the disclosure relates to nucleic acids encoding an entire heavy and/or an entire light chain of MAb 6G8, which comprise, consist essentially of, or consist of the polynucleotide sequences of SEQ ID NO: 64 (6G8 ⁇ chain) and/or SEQ ID NO: 65 (6G8 ⁇ chain) or a variant comprises at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity to SEQ ID NO: 64 and/or SEQ ID NO: 65 (note: bases 1-57 from SEQ ID NO: 64 or bases 1-66 from SEQ ID NO: 65 may be deleted as they encode signal peptides).
- the disclosure relates to nucleic acids encoding an entire heavy and/or an entire light chain of MAb 8C10, the sequences of which comprise, consist essentially of, or consist of the polynucleotide sequences of SEQ ID NO: 66 (8C10 ⁇ chain) and/or SEQ ID NO: 67 (8C10 ⁇ chain) or a variant comprises at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% sequence identity to SEQ ID NO: 66 and/or SEQ ID NO: 67 (note: bases 1-57 from SEQ ID NO: 66 or bases 1-60 from SEQ ID NO: 67 may be deleted as they encode signal peptides).
- the disclosure further relates to antibody constructs comprising nucleic acids which encode an Ig ⁇ chain C region.
- the nucleic acid encodes a protein having the sequence SEQ ID NO: 37 or a fragment thereof or variant thereof, the protein accessioned in GENBANK under accession number PIR: S37768 or GI: 7439150.
- Nucleic acid fragments encoding fragments of Ig t chain C region preferably encode proteins which have partial or complete truncation of the first constant Ig domain of the heavy chain, e.g., a deletion of a part or whole of aa1-102 of SEQ ID NO: 37 (S37768).
- Variants of the Ig t chain C region include, polypeptides comprising at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% sequence identity to SEQ ID NO: 37.
- Non-limiting examples of such variants include, polypeptides having the following accession numbers: GENBANK #X57086 (last revised: Jul. 25, 2016) and GENBANK #AJ294734 (last revised: Jul. 14, 2016), including fragments thereof (e.g., comprising, deletion of the first constant Ig domain of the heavy chain).
- the disclosure especially relates to nucleic acids which encode chimeric antibodies whose sequences are set forth in SEQ ID NO: 38 (6G8 chimeric IgM) or SEQ ID NO: 39 (8C10 chimeric IgM), including polynucleotides that comprise at least 80%, 90%, or 95% sequence identity to the chimeric antibody-encoding polynucleotides, complements thereof, RNA equivalents thereof, or degenerates thereof.
- the nucleic acids of the present disclosure can be made using (a) recombinant methods, (b) synthetic techniques, (c) purification techniques, or combinations thereof, as well-known in the art.
- DNA encoding the monoclonal antibodies is readily isolated and sequenced using methods known in the art (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies). Where a hybridoma is produced, such cells can serve as a source of such DNA.
- display techniques such as phage or ribosomal display libraries, the selection of the binder and the nucleic acid is simplified.
- the antibody coding regions from the phage can be isolated and used to generate whole antibodies, including human antibodies, or any other desired antigen binding fragment, and expressed in any desired host, including mammalian cells, insect cells, plant cells, yeast, and bacteria, e.g., as described below.
- Techniques to recombinantly produce Fab, Fab′ and F(ab′)2 fragments can also be employed using methods known in the art such as those disclosed in Mullinax et al., BioTechniques, 12(6), 864-869, 1992; and Better et al., Science, 240, 1041-1043, 1988.
- the DNA may be placed into expression vectors, which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese Hamster Ovary (CHO) cells, or myeloma cells that do not otherwise produce antibody protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells.
- host cells such as E. coli cells, simian COS cells, Chinese Hamster Ovary (CHO) cells, or myeloma cells that do not otherwise produce antibody protein.
- RNA amplification includes, but are not limited to, polymerase chain reaction (PCR) and related amplification processes.
- PCR and other in vitro amplification methods can also be useful, for example, to clone nucleic acid sequences that code for proteins to be expressed, to make nucleic acids to use as probes for detecting the presence of the desired mRNA in samples, for nucleic acid sequencing, or for other purposes. Examples of techniques sufficient to direct persons of skill through in vitro amplification methods are found in U.S. Pat. No. 4,683,202.
- kits for genomic PCR amplification are known in the art. See, e.g., Advantage-GC Genomic PCR Kit (Clontech). Additionally, e.g., the T4 gene 32 protein (Boehringer Mannheim) can be used to improve yield of long PCR products.
- RNA, cDNA, genomic DNA, or any combination thereof can be obtained from biological sources using any number of cloning methodologies known to those of skill in the art.
- oligonucleotide probes that selectively hybridize, under stringent conditions, to the polynucleotides of the present disclosure are used to identify the desired sequence in a cDNA or genomic DNA library.
- the isolation of RNA, and construction of cDNA and genomic libraries, is well known to those of ordinary skill in the art.
- the nucleic acid molecules of the disclosure are nucleic acids encoding antibodies or antibody portions (e.g., VH, VL, CDR3) that bind to DbpA.
- the nucleic acid molecules comprise constant portions of human IgG or IgM that are fused to mouse anti-DbpA VH and/or VL sequences.
- mutations can be introduced randomly along all or part of an anti-DbpA antibody coding sequence, such as by saturation mutagenesis or by recombination, and the resulting modified anti-DbpA antibodies can be screened for binding activity.
- antibodies encoded by variants of the heavy and light CDR nucleotide sequences disclosed herein include antibodies that are substantially similar sequences to that of the parent antibodies 6G8 and/or 8C10.
- the variant nucleic acids comprising substantial homology to the nucleic acids encoding 6G8 and/or 8C10 CDR and/or FR sequences.
- the term “substantial homology” indicates that two nucleic acids, or designated sequences thereof, when optimally aligned and compared, are identical, with appropriate nucleotide insertions or deletions, in at least about 80%, 90%, 95%, or have greater % identity, e.g., 98% to 99.5%, of the nucleotides.
- substantial homology exists when the sequences hybridize under selective hybridization conditions, to the complement of segments with the strand.
- the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm, as described in the non-limiting examples below.
- the percent identity between two nucleotide sequences can be determined using the GAP program in the GCG software package, using a NWSgapdnaCMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6.
- the percent identity between two nucleotide or amino acid sequences can also be determined using the algorithm of Meyers et al. ( Comput. AppL. Biosci., 4:11-17, 1988).
- the nucleic acid and protein sequences of the present disclosure can further be used as a “query sequence” to perform a search against public databases to, for example, identify related sequences. Such searches can be performed using the NBLAST and XBLAST programs of Altschul et al., J. Mol.
- BLAST nucleotide searches can be performed with the NBLAST program; Gapped BLAST can be utilized as described in Altschul et al., Nucleic Acids Res. 25(17):3389, 1997.
- the default parameters of the respective programs e.g., XBLAST and NBLAST are used.
- the nucleic acids encoding the aforementioned antibodies or fragments thereof are obtained using computational methods, e.g., Reverse Translate Tool provided via Sequence Manipulation Suite under Bioinformatics(dot)Org.
- the amino acid sequences encoded by the nucleic acids of the disclosure may be determined using a translate-tool program available via SBI's Expert Protein Analysis System (EXPASY).
- the nucleic acids may be designed by ligating a fragment nucleic acid encoding the antigenic peptide to a plurality of nucleic acids encoding the linker and/or the carrier using routine recombinant DNA technology.
- Codon optimization for expression in a host cell e.g., bacteria such as E. coli or insect Hi5 cells or mammalian cells such as CHO cells, may be routinely performed using Codon Optimization Tool (CODONOPT), available from Integrated DNA Technologies, Inc., Coralville, Iowa
- CODONOPT Codon Optimization Tool
- the nucleic acids may be present in whole cells, in a cell lysate, or in a partially purified or substantially pure form.
- a nucleic acid is “isolated” or “rendered substantially pure” when purified away from other cellular components or other contaminants, e.g., other cellular nucleic acids or proteins, by standard techniques, including alkaline/SDS treatment, CsCl banding, column chromatography, agarose gel electrophoresis and others well known in the art.
- the nucleic acid compositions of the present disclosure while often in a native sequence (except for modified restriction sites and the like), from either cDNA, genomic or mixtures thereof, may be mutated in accordance with standard techniques to provide gene sequences. For coding sequences, these mutations, may affect amino acid sequence as desired.
- DNA sequences substantially homologous to or derived from native V, D, J, constant, switches and other such sequences described herein are contemplated.
- the disclosure further relates to nucleic acids that are in operable linkage to another nucleic acid sequence (e.g., the two nucleic acids are in a functional relationship with one another).
- a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence.
- operably linked means that the DNA sequences being linked are contiguous and, where necessary to join two protein coding regions, contiguous and in reading frame.
- operably linked indicates that the sequences are capable of effecting switch recombination.
- nucleotide sequences encoding at least 70-100% of the contiguous amino acids of at least one of SEQ ID NOs: 1-12 CDR sequences
- nucleotide sequences encoding 70-100% of the contiguous amino acids of at least one of SEQ ID NOs: 13-18 FR sequences
- Nucleic acid molecules of the present disclosure can be in the form of RNA, such as mRNA, hnRNA, tRNA or any other form, or in the form of DNA, including, but not limited to, cDNA and genomic DNA obtained by cloning or produced synthetically, or any combinations thereof.
- the DNA can be triple-stranded, double-stranded or single-stranded, or any combination thereof. Any portion of at least one strand of the DNA or RNA can be the coding strand, also known as the sense strand, or it can be the non-coding strand, also referred to as the anti-sense strand.
- nucleic acid molecules of the present disclosure which comprise a nucleic acid encoding an anti-DbpA antibody can include, but are not limited to, those encoding the amino acid sequence of an antibody fragment, by itself; the coding sequence for the entire antibody or a portion thereof; the coding sequence for an antibody, fragment or portion, as well as additional sequences, such as the coding sequence of at least one signal leader or fusion peptide, with or without the aforementioned additional coding sequences, such as at least one intron, together with additional, non-coding sequences, including but not limited to, non-coding 5′ and 3′ sequences, such as the transcribed, non-translated sequences that play a role in transcription, mRNA processing, including splicing and polyadenylation signals (for example-ribosome binding and stability of mRNA); an additional coding sequence that codes for additional amino acids, such as those that provide additional functionalities.
- the sequence encoding an antibody can be fused to a marker sequence, such as a sequence en
- vectors preferably, expression vectors, containing a nucleic acid encoding the anti-DbpA antibody, or may be used to obtain plasmids containing various antibody HC or LC genes or portions thereof.
- vector refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
- plasmid refers to a circular double stranded DNA loop into which additional DNA segments can be ligated.
- viral vector wherein additional DNA segments can be ligated into the viral genome.
- the present disclosure also relates to vectors that include isolated nucleic acid molecules of the present disclosure, host cells that are genetically engineered with the recombinant vectors, and the production of at least one anti-DbpA antibody by recombinant techniques, as is well known in the art.
- DNAs encoding partial or full-length light and heavy chains can be inserted into expression cassettes or vectors such that the genes are operatively linked to transcriptional and translational control sequences.
- a cassette which encodes an antibody can be assembled as a construct.
- a construct can be prepared using methods known in the art. The construct can be prepared as part of a larger plasmid. Such preparation allows the cloning and selection of the correct constructions in an efficient manner. The construct can be located between convenient restriction sites on the plasmid or other vector so that they can be easily isolated from the remaining plasmid sequences.
- the light and heavy chain variable regions of the antibodies described herein can be used to create full-length antibody genes of any antibody isotype by inserting them into expression vectors already encoding heavy chain constant and light chain constant regions of the desired isotype such that the VH segment is operatively linked to the CH segment(s) within the vector and the VI, segment is operatively linked to the CL segment within the vector.
- the recombinant expression vector can encode a signal peptide that facilitates secretion of the antibody chain from a host cell.
- the antibody chain gene can be cloned into the vector such that the signal peptide is linked in-frame to the amino terminus of the antibody chain gene.
- the signal peptide can be an immunoglobulin signal peptide or a heterologous signal peptide (e.g., a signal peptide from a non-immunoglobulin protein).
- a mammalian expression vector contains (1) regulatory elements, usually in the form of viral promoter or enhancer sequences and characterized by a broad host and tissue range; (2) a “polylinker” sequence, facilitating the insertion of a DNA fragment which comprises the antibody coding sequence within the plasmid vector; and (3) the sequences responsible for intron splicing and polyadenylation of mRNA transcripts.
- This contiguous region of the promoter-polylinker-polyadenylation site is commonly referred to as the transcription unit.
- the vector will likely also contain (4) a selectable marker gene(s) (e.g., the beta-lactamase gene), often conferring resistance to an antibiotic (such as ampicillin), allowing selection of initial positive transformants in E.
- a plasmid origin of replication are included for propagation of the expression construct in E. coli and for transient expression in Cos cells, the SV40 origin of replication is included in the expression plasmid.
- a promoter may be selected from a SV40 promoter, (e.g., late or early SV40 promoters, the CMV promoter (U.S. Pat. Nos. 5,168,062; 5,385,839), an HSV tk promoter, a pgk (phosphoglycerate kinase) promoter, an EF-1 alpha promoter (U.S. Pat. No.
- Expression vectors will preferably but optionally include at least one selectable marker.
- markers include, e.g., but not limited to, methotrexate (MTX), dihydrofolate reductase (DHFR, U.S. Pat. Nos. 4,399,216; 4,634,665; 4,656,134; 4,956,288; 5,149,636; 5,179,017, ampicillin, neomycin (G418), mycophenolic acid, or glutamine synthetase (GS, U.S. Pat. Nos.
- splicing sequence is the VP1 intron from SV40 (Sprague et al., J. Virol. 45:773-781, 1983).
- gene sequences to control replication in the host cell can be incorporated into the vector, as known in the art.
- additional elements include enhancers, Kozak sequences and intervening sequences flanked by donor and acceptor sites for RNA splicing.
- LTRS long terminal repeats
- CMV cytomegalovirus
- cellular elements can also be used (e.g., the human actin promoter).
- Suitable expression vectors for use in practicing the present disclosure include, for example, vectors such as pIRES lneo, pRetro-Off, pRetro-On, PLXSN, or pLNCX (Clonetech Labs, Palo Alto, Calif.), pcDNA3.1 (+/ ⁇ ), pcDNA/Zeo (+/ ⁇ ) or pcDNA3.1/Hygro (+/ ⁇ ) (Invitrogen), PSVL and PMSG (Pharmacia, Uppsala, Sweden), pRSVcat (ATCC 37152), pSV2dhfr (ATCC 37146) and pBC12MI (ATCC 67109).
- vectors such as pIRES lneo, pRetro-Off, pRetro-On, PLXSN, or pLNCX (Clonetech Labs, Palo Alto, Calif.), pcDNA3.1 (+/ ⁇ ), pcDNA/Zeo (+/ ⁇ ) or pcDNA
- the nucleic acids encoding the antibody sequence can be expressed in stable cell lines that contain the gene integrated into a chromosome.
- a selectable marker such as DHFR, GPT, neomycin, or hygromycin allows the identification and isolation of the transfected cells which express large amounts of the encoded antibody.
- the DHFR (dihydrofolate reductase) marker is useful to develop cell lines that carry several hundred or even several thousand copies of the gene of interest.
- Another useful selection marker is the enzyme glutamine synthase (GS) (Murphy et al., Biochem. J. 227:277-279, 1991).
- the DNA constructs used in the production of the antibodies of the disclosure can optionally include at least one insulator sequence.
- An insulator element is a control element which insulates the transcription of genes placed within its range of action but which does not perturb gene expression, either negatively or positively.
- an insulator sequence is inserted on either side of the DNA sequence to be transcribed.
- the insulator can be positioned about 200 bp to about 1 kb, 5′ from the promoter, and at least about 1 kb to 5 kb from the promoter, at the 3′ end of the gene of interest.
- Examples of suitable inducible non-fusion E. coli expression vectors include pTrc and pET 11d.
- vectors for expression in yeast S. cerevisiae include pYepSec1, pMFa, pJRY88, pYES2, and pPicZ (Invitrogen Corp, San Diego, Calif., USA).
- Examples of baculovirus vectors available for expression of proteins in cultured insect cells include the pOET, pTriEx, pIEx, pBAC, pBacPAK, and the BD pVL and pAc families of vectors (Expression Systems LLC, Davis, Calif., USA).
- a nucleic acid of the disclosure is expressed in mammalian cells using a mammalian expression vector.
- mammalian expression vectors include pCDM8 (Seed et al., Nature, 329:840, 1987) and pMT2PC (Kaufman et al., EMBO J., 6:187-195, 1987).
- the recombinant mammalian expression vector is capable of directing expression of the nucleic acid, preferentially in a particular cell type, such as lymphoma cells (e.g., mouse myeloma cells).
- tissue-specific regulatory elements are used to express the nucleic acid. Tissue-specific regulatory elements are known in the art.
- tissue-specific promoters include the albumin promoter (liver-specific; Pinkert et al., Genes Dev., 1:268-277, 1987), lymphoid-specific promoters (Calame et al., Adv.
- T cell receptors Winoto et al., EMBO J., 8:729-733, 1989
- immunoglobulins Bonerji et al., Cell, 33:729-740, 1983; Queen et al., Cell, 33:741-748, 1983
- neuron-specific promoters e.g., Byrne et al., PNAS USA, 86:5473-5477, 1989
- pancreas-specific promoters Edlund et al., Science, 230:912-916, 1985
- mammary gland-specific promoters e.g., U.S. Pat. No.
- Developmentally-regulated promoters are also encompassed, for example, by the murine hox promoters (Kessel et al., Science, 249:374-379, 1990) and the ⁇ -fetoprotein promoter (Campes et al., Genes Dev., 3:537-546, 1989).
- the disclosure further provides a recombinant expression vector comprising a DNA molecule cloned into the expression vector in an antisense orientation. That is, the DNA molecule is operably linked to a regulatory sequence in a manner that allows for expression (by transcription of the DNA molecule) of an RNA molecule that is antisense to the mRNA encoding a polypeptide.
- the antisense expression vector can be in the form of a recombinant plasmid, phagemid, or attenuated virus in which antisense nucleic acids are produced under the control of a high efficiency regulatory region, the activity of which can be determined by the cell type into which the vector is introduced. See Weintraub et al., Reviews - Trends in Genetics, 1, 1986).
- the nucleic acids encoding the antibodies of the disclosure are transfected in mouse myeloma cells (Looney et al. Hum Antibodies Hybridomas, 3(4):191-200, 1992), which attains production levels of >500 mg/L.
- mouse myeloma cells Looney et al. Hum Antibodies Hybridomas, 3(4):191-200, 1992
- plasmid pC4 containing the mouse DHFR gene under control of the SV40 early promoter, may be used.
- Cells lacking dihydrofolate activity that are transfected with these plasmids can be selected by growing the cells in a selective medium (e.g., ⁇ -MEM, Life Technologies, Gaithersburg, Md., USA) supplemented with the chemotherapeutic agent methotrexate.
- a selective medium e.g., ⁇ -MEM, Life Technologies, Gaithersburg, Md., USA
- MTX methotrexate
- Mammalian cells such as CHO cells, myeloma cells, HEK293 cells, BHK cells (BHK21, ATCC CRL-10), mouse Ltk-cells, and NIH3T3 cells have been frequently used for stable expression of heterologous genes.
- cell lines such as Cos (COS-1 ATCC CRL 1650; COS-7, ATCC CRL-1651) and HEK293 are routinely used for transient expression of recombinant proteins.
- Preferred mammalian host cells for expressing the recombinant antibodies of the disclosure include myeloma cells such as Sp2/0, YB2/0 (ATC CRL-1662), NSO, and P3 ⁇ 63.Ag8.653 (e.g.
- the antibodies are produced by culturing the host cells for a period of time sufficient to allow for expression of the antibody in the host cells or, more preferably, secretion of the antibody into the culture medium in which the host cells are grown.
- Antibodies can be recovered from the culture medium using standard protein purification methods.
- Illustrative of cell cultures useful for the production of the antibodies, specified portions or variants thereof, are mammalian cells. Mammalian cell systems often will be in the form of monolayers of cells although mammalian cell suspensions or bioreactors can also be used.
- a non-human animal in which is one or more, and preferably essentially all, of the cells of the animal contain a heterologous nucleic acid introduced by way of human intervention, a transgene, coding for the antibody.
- the transgene can be introduced into the cell, directly or indirectly, by introduction into a precursor of the cell, by way of deliberate genetic manipulation, such as by microinjection or by infection with a recombinant virus.
- Methods for generating non-human transgenic mammals are known in the art. See, e.g., but not limited to, U.S. Pat. Nos.
- Such methods can involve introducing DNA constructs into the germ line of a mammal to make a transgenic mammal. For example, one or several copies of the construct may be incorporated into the genome of a mammalian embryo by standard transgenic techniques.
- non-human transgenic mammals can be produced using a somatic cell as a donor cell. The genome of the somatic cell can then be inserted into an oocyte and the oocyte can be fused and activated to form a reconstructed embryo.
- methods of producing transgenic animals using a somatic cell are described in U.S. Pat. No.
- the antibodies may be produced in mammary glands of animals using promoters that are preferentially activated in mammary epithelial cells, including promoters that control the genes encoding milk proteins such as caseins, beta lactoglobulin. See, Clark et al., Bio Technology, 7: 487-492, 1989; Gordon et al. Bio Technology, 5: 1183-1187, 1987), and Soulier et al., FEBS Letts., 297: 13, 1992).
- Antibodies of the present disclosure can additionally be produced using at least one anti-DbpA antibody encoding nucleic acid to provide transgenic plants and cultured plant cells (e.g., tobacco, maize, and duckweed). See, Cramer et al., Curr. Top.
- Transgenic plants may also be used. See, Fischer et al., Biotechnol. Appl. Biochem., 30:99-108, 1999; Ma et al., Trends Biotechnol., 13:522-7, 1995; Ma et al., Plant Physiol., 109:341-6, 1995; Whitelam et al., Biochem. Soc. Trans., 22:940-944, 1994.
- nucleic acids of the present disclosure can also be prepared by direct chemical synthesis by known methods, e.g., U.S. Pat. Nos. 5,942,609; 6,521,427; 6,586,211; & 6,670,127.
- the anti-DbpA antibody can be recovered and purified from recombinant cell cultures by well-known methods including, but not limited to, protein A purification, ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography such as with a Protein A column, hydroxylapatite chromatography, lectin chromatography, HPLC, and the like.
- Antibodies of the present disclosure include naturally purified products, products of chemical synthetic procedures, and products produced by recombinant techniques from a eukaryotic host, including, for example, yeast, higher plant, insect and mammalian cells. Depending upon the host employed in a recombinant production procedure, the antibody of the present disclosure can be glycosylated or can be non-glycosylated, with glycosylated preferred.
- the present disclosure also provides at least one anti-DbpA antibody composition comprising at least 1, 2, 3, 4, or more, e.g., 7, 10 or even 20 anti-DbpA antibodies thereof, as described herein and/or as known in the art that are provided in a non-naturally occurring composition, mixture or form.
- Such compositions comprise non-naturally occurring compositions comprising at least one or two full length, C- and/or N-terminally deleted variants, domains, fragments, or specified variants, of the antiDbpA antibody amino acid sequences.
- the composition comprises a plurality of the same anti-DbpA antibody or antigen-binding fragments thereof (e.g., MAb 6G8 or MAb 8C10).
- the composition may comprise at least one unit each of MAb 6G8 and MAb 8C10 or antigen-binding fragments thereof.
- the disclosure further relates to modified antibodies, e.g., fusion proteins, comprising, e.g., secretion signals and optionally heterologous functional regions.
- modified antibodies e.g., fusion proteins, comprising, e.g., secretion signals and optionally heterologous functional regions.
- a region of additional amino acids, particularly charged amino acids can be added to the N-terminus of an antibody to improve stability and persistence in the host cell, during purification, or during subsequent handling and storage.
- peptide moieties can be added to an antibody of the present disclosure to facilitate purification. Such regions can be removed prior to final preparation of an antibody or at least one fragment thereof.
- various tag polypeptides and their respective antibodies are well known in the art.
- Examples include poly-histidine (poly-his) or poly-histidine-glycine (poly-his-gly) tags; the flu HA tag polypeptide and its antibody 12CA5 (Field et al., Mol. Cell. Biol., 8:2159-2165, 1988); c-myc tags 8F9, 3C7, 6E10, G4, B7 and 9E10 antibodies thereto (Evan et al., MCB, 5:3610-3616, 1985); HSV glycoprotein D (gD) tag and its antibody (Paborsky et al., Protein Enoineering, 3(6):547-553, 1990); Flag-peptide (Hopp et al., Bio Technology, 6:1204-1210, 1988); KT3 peptide (Martin et al., Science, 255:192-194, 1992); an ⁇ -tubulin epitope (Skinner et al., J.
- the disclosure further relates to antibodies and antigen-binding fragments that are modified by the covalent attachment of an organic moiety. Such modification can produce an antibody or antigen-binding fragment with improved pharmacokinetic properties (e.g., increased in vivo serum half-life).
- the organic moiety can be a linear or branched hydrophilic polymeric group, fatty acid group, or fatty acid ester group.
- the hydrophilic polymeric group can have a molecular weight of about 800 to about 120,000 Daltons and can be a polyalkane glycol (e.g., PEG, PPG), carbohydrate polymer, amino acid polymer or polyvinyl pyrolidone, and the fatty acid or fatty acid ester group having about 8-40 carbon units.
- the modified antibodies and antigen-binding fragments can be prepared using suitable methods, such as by reaction with one or more modifying agents, e.g., amine-reactive activating groups including electrophilic groups such as tosylate, mesylate, halo (chloro, bromo, fluoro, iodo), N-hydroxysuccinimidyl esters (NHS); activating groups that can react with thiols including, e.g., maleimide, iodoacetyl, acrylolyl, pyridyl disulfides, 5-thiol-2-nitrobenzoic acid thiol (TNB-thiol); amine- or hydrazide-containing molecules; or an azide group.
- modifying agents e.g., amine-reactive activating groups including electrophilic groups such as tosylate, mesylate, halo (chloro, bromo, fluoro, iodo), N-hydroxys
- the present disclosure also relates to an anti-idiotypic (anti-Id) antibody that is specific for the antibodies of the disclosure, e.g., MAb 6G8 or MAb 8C10 or antigen-binding fragments thereof.
- An anti-Id antibody is an antibody that recognizes unique determinants generally associated with the antigen-binding region of another antibody.
- the anti-Id can be prepared by immunizing an animal of the same species and genetic type (e.g. mouse strain) as the source of the Id antibody with the antibody or a CDR containing region thereof. The immunized animal will recognize and respond to the idiotypic determinants of the immunizing antibody and produce an anti-Id antibody.
- the anti-Id antibody may also be used as an “immunogen” to induce an immune response in yet another animal, producing a so-called anti-anti-Id antibody.
- compositions comprising at least one anti-DbpA antibody and a carrier.
- the composition is a pharmaceutical composition comprising at least one anti-DbpA antibody and a pharmaceutically acceptable carrier.
- the compositions can further comprise at least one of any suitable auxiliary, such as, but not limited to, diluent, binder, stabilizer, buffers, salts, lipophilic solvents, preservative, adjuvant or the like.
- Pharmaceutically acceptable auxiliaries are preferred.
- Non-limiting examples of, and methods of preparing such sterile solutions are well known in the art, such as, but limited to, Remington's Pharmaceutical Sciences, Gennaro et al., Ed., 18 th Edition, Mack Publishing Co., Easton, Pa., USA (1990).
- Pharmaceutically acceptable carriers can be routinely selected that are suitable for the mode of administration, solubility and/or stability of the anti-DbpA antibody, fragment or variant composition as well known in the art or as described herein.
- Anti-DbpA antibody compositions may include a buffer or a pH adjusting agent; typically, the buffer is a salt prepared from an organic acid or base.
- Representative buffers include organic acid salts such as salts of citric acid, ascorbic acid, gluconic acid, carbonic acid, tartaric acid, succinic acid, acetic acid, or phthalic acid; TRIS, tromethamine hydrochloride, or phosphate buffers.
- Preferred buffers for use in the present compositions are amino acids or organic acid salts such as citrate.
- Representative amino acid/antibody components which can also function in a buffering capacity, include alanine, glycine, arginine, betaine, histidine, glutamic acid, aspartic acid, cysteine, lysine, leucine, isoleucine, valine, methionine, phenylalanine, aspartame, and the like.
- One preferred amino acid is glycine.
- the formulations can cover a wide range of pHs, such as from about pH 4 to about pH 10, and preferred ranges from about pH 5 to about pH 9, and a most preferred range of about 6.0 to about 8.0.
- the formulations of the present disclosure have pH between about 6.8 and about 7.8.
- additives such as a pharmaceutically acceptable solubilizers such as surfactants: Tween 20 (polyoxyethylene (20) sorbitan monolaurate), Tween 40 (polyoxyethylene (20) sorbitan monopalmitate), Tween 80 (polyoxyethylene (20) sorbitan monooleate); Pluronic F68 (polyoxyethylene polyoxypropylene block copolymers), and PEG (polyethylene glycol) or non-ionic surfactants such as polysorbate 20 or 80 or poloxamer 184 or 188, Pluronic® polyls, other block co-polymers, and chelators such as EDTA and EGTA can optionally be added to the formulations or compositions to reduce aggregation.
- solubilizers such as surfactants: Tween 20 (polyoxyethylene (20) sorbitan monolaurate), Tween 40 (polyoxyethylene (20) sorbitan monopalmitate), Tween 80 (polyoxyethylene (20) sorbitan
- Amounts will generally range between 0.001 and 14% by weight of the formulation.
- Especially preferred surfactants for purposes of this disclosure are polyoxyethylene sorbitan monooleate, polysorbate 80, polysorbate 20, or the like. Additional agents known in the art for formulation of a protein such as DbpA antibodies, or specified portions or variants, can also be included in the formulation.
- compositions include but are not limited to proteins, peptides, amino acids, lipids, and carbohydrates (e.g., sugars, including monosaccharides, di-, tri-, tetra-, and oligosaccharides; and polysaccharides or sugar polymers), which can be present singly or in combination, comprising alone or in combination 1-99.99% by weight or volume.
- Exemplary protein excipients include serum albumin such as human serum albumin (HSA), recombinant human albumin (rHA), gelatin, casein, protamine and the like.
- Carbohydrate excipients suitable for use in the disclosure include, for example, monosaccharides such as fructose, maltose, galactose, glucose, D-mannose, sorbose, and the like; disaccharides, such as lactose, sucrose, trehalose, cellobiose, and the like; polysaccharides, such as raffinose, melezitose, maltodextrins, dextrans, starches, and the like; and alditols, such as mannitol, xylitol, maltitol, lactitol, xylitol sorbitol (glucitol), myoinositol, aldonic acids, such as gluconate, esterified sugars, and the like.
- monosaccharides such as fructose, maltose, galactose, glucose, D-mannose, sorbose, and the like
- Preferred carbohydrate excipients for use in the present disclosure are mannitol, trehalose, and raffinose.
- anti-DbpA antibody compositions of the disclosure can include polymeric excipients/additives such as polyvinylpyrrolidones, ficolls (a polymeric sugar), dextrates (e.g., cyclodextrins, such as 2-hydroxypropyl-alpha-cyclodextrin), polyethylene glycols, flavoring agents, antimicrobial agents, sweeteners, antioxidants, antistatic agents, lipids (e.g., phospholipids, fatty acids), steroids (e.g., cholesterol), and chelating agents (e.g., EDTA).
- polymeric excipients/additives such as polyvinylpyrrolidones, ficolls (a polymeric sugar), dextrates (e.g., cyclodextrins, such as 2-hydroxypropyl-alpha-
- the formulations can be prepared by a process which comprises mixing at least one anti-DbpA antibody and an aqueous diluent.
- the diluent will preferable contain buffering components and, optionally, stabilizers or preservatives. Mixing the at least one anti-DbpA antibody in an aqueous diluent is carried out using conventional dissolution procedures.
- compositions or formulations of the disclosure can be administered to a patient in accordance with the present disclosure via a variety of delivery methods including SC or IM injection; transdermal, pulmonary, transmucosal, implant, osmotic pump, cartridge, micro pump, or other means appreciated by the skilled artisan, as well-known in the art.
- the formulation is sterilized by known or suitable techniques.
- the disclosure further relates to an article of manufacture comprising packaging material and at least one vial comprising a solution of at least one anti-DbpA antibody with the prescribed buffers and/or preservatives, optionally in an aqueous diluent, wherein said packaging material comprises a label that indicates that such solution can be held over a period of time, e.g., 96 hours or more.
- kits comprising a first vial comprising lyophilized anti-DbpA antibody, and a second vial comprising an aqueous diluent of prescribed buffer or preservative, optionally together with instructions for using the antibody as a research reagent, a diagnostic product or a therapeutic product.
- the aqueous diluent typically comprises a pharmaceutically acceptable buffer such as sodium citrate, L-histidine and L-histidine hydrochloride monohydrate, sodium phosphate in sterile water for injection and adjusted to a suitable pH.
- a pharmaceutically acceptable buffer such as sodium citrate, L-histidine and L-histidine hydrochloride monohydrate, sodium phosphate in sterile water for injection and adjusted to a suitable pH.
- the aqueous diluent optionally further comprises a pharmaceutically acceptable polypeptide stabilizer.
- Polypeptide stabilizers include sucrose, sodium chloride, L-arginine, and polysorbate 20, polysorbate 80, and (alpha)-trehalose dehydrate.
- the aqueous diluent optionally further comprises a pharmaceutically acceptable preservative.
- Preferred preservatives include those selected from the group consisting of benzyl alcohol, benzalkonium chloride, benzethonium chloride, sodium dehydroacetate, or mixtures thereof.
- concentrations are dependent on the diluent buffer, if any, the stabilizer and the preservative selected and are readily determined by the skilled artisan.
- the range of at least one anti-DbpA antibody in the product of the present disclosure includes amounts yielding upon reconstitution, if in a wet/dry system, concentrations from about 10 ng/ml to about 1000 mg/ml (preferably about 1 mg/ml to about 100 mg/ml), although lower and higher concentrations are operable and are dependent on the intended delivery vehicle, e.g., solutions will differ from transdermal patch, pulmonary, transmucosal, or osmotic pumps.
- Formulations of the disclosure can optionally be safely stored at temperatures of from about 2 to about 40° C. and retain the biologically activity of the protein for extended periods of time, thus, allowing a package label indicating that the solution can be held and/or used over a period of 6, 12, 18, 24, 36, 48, 72, or 96 hours or greater. If preserved diluent is used, such label can include use up to 1-12 months, one-half, one and a half, and/or two years.
- compositions or formulations e.g., syringes, depots, pens, droppers, etc.
- syringes e.g., syringes, depots, pens, droppers, etc.
- Embodiments of the disclosure further provide for surfaces comprising the aforementioned antibody or antigen compositions, wherein the antibody or antigen is oriented to permit binding to a partner.
- the surface is a surface of a solid support.
- solid supports include, without limitation, nitrocellulose, the walls of wells of a reaction tray, multi-well plates, test tubes, polystyrene beads, magnetic beads, membranes, and microparticles (such as latex particles). Nitrocellulose, nylon and other microporous structures are useful, as are materials with gel structure in the hydrated state.
- useful solid supports include natural polymeric carbohydrates and their synthetically modified, cross-linked or substituted derivatives, such as agar, agarose, cross-linked alginic acid, substituted and cross-linked guar gums, cellulose esters, especially with nitric acid and carboxylic acids, mixed cellulose esters, and cellulose ethers; natural polymers containing nitrogen, such as proteins and derivatives, including cross-linked or modified gelatins; natural hydrocarbon polymers, such as latex and rubber; synthetic polymers which may be prepared with suitably porous structures, such as vinyl polymers, including polyethylene, polypropylene, polystyrene, polyvinylchloride, polyvinylacetate and its partially hydrolyzed derivatives, polyacrylamides, polymethacrylates, copolymers and terpolymers of the above polycondensates, such as polyesters, polyamides, and other polymers, such as polyurethanes or polyepoxides; porous inorganic materials such as sulf
- the support is a well of an array plate, e.g., a microarray such as a protein array or an antibody array. Methods for constructing such arrays are known in the art.
- solid supports which can be used for the method and the kit of the present disclosure.
- Well known materials which may be employed include glass, polystyrene, polypropylenes dextran, nylon, agarose, dextran, acrylamide, nitrocellulose, PVDF and other materials, in the form of tubes, beads, membranes and microtiter plates formed from or coated with such materials, and the like.
- the isolated and purified recombinant polypeptides and/or the antibodies of the present disclosure can be either covalently or physically bound to the solid support, by techniques such as covalent bonding via an amide, ester or disulfide linkage, or by adsorption.
- This binding or immobilization can be accomplished by using e.g., covalent bonding via an amide, ester or disulfide linkage between the solid support and the antibodies (e.g., via the Fc domain) or the epitopes of the antigen.
- the fusion polypeptide is preferably immobilized in such a way that it is aligned on the solid support via a disulfide linkage between the solid support presenting glutathione on its surface and the GST portion of the polypeptide.
- micro titer plates made of polystyrole which can be obtained from various commercial suppliers such as NUNC, Costar, Greiner, Falcon or Coring Inc.
- the solid support is coated with the isolated and purified recombinant antibodies or antigen-binding fragments thereof. Coating may be performed by using a coating buffer known to the person skilled in the art such as PBS buffer or carbonate buffer. Such coating buffers as well as solid supports already coated might be included as reagents to the kit of the present disclosure. In a preferred mode for performing the above described method of the disclosure it is important to use certain “blockers” which might be included as a reagent in the kit of the disclosure as well.
- the “blockers” are added to assure that non-specific proteins, protease, or antibodies other than those that bind specifically to the antigenic peptides do not cross-link or destroy the antigens or antibodies on the solid support, or the radiolabeled indicator antigen or antibody, to yield false positive or false negative results.
- a usual blocker which can be used is bovine serum albumin (BSA), which is preferred.
- BSA bovine serum albumin
- the blocker can be added in buffer solution like PBS buffer. In case a solid support is used the blocker is usually added after coating the solid support.
- non-natural antigens of the disclosure comprise at least one modification in a natural DbpA protein, wherein the modification may alter a primary structure (e.g., amino acid sequence), secondary structure (e.g., sheet, loop, and/or helical configuration), or tertiary structure (e.g., 3D structure and/or epitope configuration), or quarternary structure (e.g., multi-subunit structure of DbpA interacting with decorin) of the protein.
- a primary structure e.g., amino acid sequence
- secondary structure e.g., sheet, loop, and/or helical configuration
- tertiary structure e.g., 3D structure and/or epitope configuration
- quarternary structure e.g., multi-subunit structure of DbpA interacting with decorin
- modifications include, e.g., mutations, deletions or truncations, additions or fusions, alterations in post-translational processing, e.g., altered ubiquitination, prenylation, phosphorylation, glycosylation, methylation, AMPylation, and de-AMPylation, phosphocholination, and de-phosphocholination, which may or may not change the biological activity of the protein (e.g., antigencity).
- modifications include, e.g., mutations, deletions or truncations, additions or fusions, alterations in post-translational processing, e.g., altered ubiquitination, prenylation, phosphorylation, glycosylation, methylation, AMPylation, and de-AMPylation, phosphocholination, and de-phosphocholination, which may or may not change the biological activity of the protein (e.g., antigencity).
- modifications include, dimerization, multimerization, bispecificity, multispecifity, chimeras, humanization, fusions, truncations (e.g., of CH1 domain), deletions (e.g., of Fc portion), domain swapping (e.g., replace IgG constant domains with IgM constant domains), tagging (e.g., attaching a label such as a dye),
- modifications may include polymorphisms, mutations, indels, codon optimization, truncations, fusions (chimeras), alteration of non-coding regions (e.g., change in promoter, regulator, repressor, or other elements; deletion of intronic sequences), and synthetic cDNA sequences that differ from naturally-occurring DNA counterparts.
- the disclosure relates to antigenic peptides that comprise, consist essentially of, or consist of fragments of decorin-binding Protein A from Borrelia Burgdorferi .
- the antigen (PEP) preferably comprises aa24-191 of B. Burgdorferi DbpA (full length sequence shown in SEQ ID NO: 78; fragment sequence provided in SEQ ID NO: 77).
- the antigenic peptides may comprise acid mutations. Such mutations are typically selected to so as to substantially preserve the antibody binding activity of the peptide.
- Guidance for substitutions, insertion, or deletion may be based on alignments of amino acid sequences of different variant proteins or proteins from different species. For example, at certain residue positions that are fully conserved, substitution, deletion or insertion is generally disfavored, while at other positions where one or more residues are not conserved, an amino acid change can be tolerated. Residues that are semi-conserved may tolerate changes that preserve charge, polarity, and/or size. For example, a compound or peptide comprising amino acids 24-191 of B.
- Burgdorferi DbpA may have 1, 2, 3 or 4 amino acid mutations comprising substitutions, deletions, or insertions.
- PEP can include additional amino acids at the amino and/or carboxyl terminal.
- the N-terminus or the C-terminus or both the N- and the C-termini of the peptide does not contain a corresponding amino acid from a naturally occurring protein, such as B. Burgdorferi DbpA (UNIPROT #O50917). However, this exclusion does not encompass chimeras, e.g., wherein the core DbpA fragment sequence is from species A (e.g., B.
- Burgdorferi and the additional amino acids at the N- or C terminus are made up of corresponding sequences from species B (e.g., B. afzelii, B. finlandernsis, B. mayonii, B. garinii, E. coli ).
- species B e.g., B. afzelii, B. finlandernsis, B. mayonii, B. garinii, E. coli .
- the PEP component of the compounds of Formula I comprises, consists essentially of, or consists of amino acids (aa) 1-168 of SEQ ID NO: 77 or a fragment thereof comprising, consisting essentially of, or consisting of aa 2-168, aa 3-168, aa 4-168, aa 5-168, aa 6-168, aa 7-168, aa 8-168, aa 9-168, aa 10-198, aa 11-198, aa 12-198, aa 13-168, aa 14-168, aa 15-168, aa 16-168, aa 17-168, aa 18-168, aa 19-168, aa 20-168, aa 21-168, aa 22-168, aa 23-168, aa 24-168, aa 25-168, aa 26-168, aa 27-168, aa 28-168, aa 29-168 of SEQ ID NO:
- this disclosure excludes naturally occurring proteins comprising SEQ ID NO: 77, e.g., the full-length B. Burgdorferi DbpA (UNIPROT #O50917).
- the disclosure further relates to derivatives such as salts (e.g., hydrochloride salt, hydrobromide salt, sulfate salt, citrate salt, tosylate salt), amides, esters, enol ethers, enol esters, acetals, ketals, acids, bases, solvates, hydrates, polymorphs or prodrugs of the individual amino acids or the aforementioned peptide compounds (PEP).
- salts e.g., hydrochloride salt, hydrobromide salt, sulfate salt, citrate salt, tosylate salt
- amides esters
- enol ethers e.g., enol esters
- acetals e.g., acetals, ketals
- acids e.g., solvates, hydrates, polymorphs or prodrugs of the individual amino acids or the aforementioned peptide compounds (PEP).
- PEP polymorphs or prodrugs
- the peptide may include one to about four, preferably one or two, non-proteinogenic amino acids, such as a D-amino acid (e.g., D-alanine), Norleucine (Nle); 4-hydroxyproline (HYP); 3,4-dehydro-L-proline (DHP); aminoheptanoic acid (AHP); (2R,5S)-5-phenyl-pyrrolidine-2-carboxylic acid (2PP); L-a-methylserine (MS); N-methylvaline (MV); 6-aminohexanoic acid (6-AHP); 7-aminoheptanoic acid (7-AHP), and the like.
- D-amino acid e.g., D-alanine
- Nle Norleucine
- DHP 4-hydroxyproline
- DHP 3,4-dehydro-L-proline
- AHP aminoheptanoic acid
- MS
- the disclosure further relates to modified peptides (PEP).
- the peptide (PEP) can be cyclized.
- the peptide (PEP) can have one or more amino acid modifications.
- Modifications of interest that do not alter primary sequence include chemical derivatization of the peptides, e.g., acetylation, or carboxylation.
- modifications of glycosylation e.g., those made by modifying the glycosylation patterns of a polypeptide during its synthesis and processing or in further processing steps, e.g., by exposing the polypeptide to enzymes which affect glycosylation, such as mammalian glycosylating or deglycosylating enzymes.
- peptides that have phosphorylated amino acid residues e.g., phosphotyrosine, phosphoserine, or phosphothreonine.
- peptides that have been modified using ordinary molecular biological techniques and synthetic chemistry so as to improve their resistance to proteolytic degradation or to optimize solubility properties or to render them more suitable as an immunogen.
- the disclosure further relates to peptides containing other types of modifications including, e.g., (1) end-capping of the terminal of the peptides, such as amidation of the C-terminus and/or acetylation or deamination of the N-terminus; (2) introducing peptidomimetic elements in the structure; and (3) cyclization, in which the cyclization of the peptide can occur through natural amino acids or non-naturally-occurring building blocks.
- the disclosure also relates to antigenic peptides that have been modified with polymers.
- inclusion of a non-naturally occurring amino acid can provide for linkage to a polymer, a second polypeptide, a scaffold, etc.
- a subject antigenic peptide linked to a water-soluble polymer can be made by reacting a water-soluble polymer (e.g., poly(ethylene glycol) (PEG)) that comprises a carbonyl group to an the subject antigenic peptide that comprises a non-naturally encoded amino acid that comprises an aminooxy, hydrazine, hydrazide or semicarbazide group.
- PEG poly(ethylene glycol)
- Suitable polymers can have an average molecular weight in a range of from 500 Da to 50 kDa, e.g., from 5 kDa to 40 kDa, from 25 kDa to 40 kDa, or from 40 kDa to 60 kDa.
- the disclosure relates to peptidomimetics that have the same sidechains as one or more peptides described herein.
- the disclosure further relates to peptoids derived from one or more above-described peptides.
- the term “peptoid” refers to a polypeptide containing one or more N-substituted glycine residues. Representative examples of peptoids are provided in, e.g., U.S. Pat. Nos. 6,075,121 and 6,887,845.
- the disclosure further relates to variant peptides having at least 1 amino acid variation (e.g., substitution, deletion, addition) compared to the parent polypeptide, e.g., from about 1 to 10 ten amino acid variations, 1 to about 5 amino acid variations compared to the parent, or 1, 2, 3, 4 or 5 amino acid variations, e.g., differing in amino acid sequence by one, two, three, four, or five amino acids, compared to the amino acid sequence set forth in one of SEQ ID NO: 77 or a functional fragment thereof.
- 1 amino acid variation e.g., substitution, deletion, addition
- variants of longer polypeptide sequence of SEQ ID NO: 77 or a functional fragment thereof may be able to tolerate a greater number of variations (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more, e.g., 20) in the polypeptide sequence.
- Variant polypeptides of the disclosure comprising substitutions generally comprise conservative substitutions.
- the variant peptide may comprise a sequence which is at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99%, identical to, for example, a polypeptide having an amino acid sequence set forth in one of SEQ ID NO: 77 or a functional fragment thereof. Methods/programs for determining % identity between two sequences have been described previously.
- the disclosure further relates to recombinant antigenic peptides (rPEP).
- the rPEP may be glycosylated or unglycosylated. Glycosylated rPEP produced by, e.g., mammalian or insect cells, are preferred.
- the disclosure further relates to fusion molecules comprising a peptide (PEP) of the instant disclosure (a peptide of SEQ ID NO: 77 or a functional fragment thereof) and a fusion partner.
- the fusion molecule is a fusion protein.
- a “fusion protein” of this disclosure comprises a peptide of SEQ ID NO: 77, or a functional fragment thereof, that is bonded through a peptide bond to an amino acid sequence that is not bonded to SEQ ID NO: 77 in a naturally occurring protein.
- Illustrative fusion polypeptides include fusions of a peptide of the disclosure (or a fragment thereof) to a heterologous protein or polypeptide, e.g., a tag.
- the antigenicity of the peptide (PEP) of the disclosure may be improved using a carrier.
- a carrier proteins from the group of bovine serum globulin (BSG), keyhole limpet hemocyanin (KLH), ovalbumin (OVA), and bovine serum albumin (BSA), are effective carriers of antigens and their inclusion greatly boosts the immune response in a host.
- BSG bovine serum globulin
- KLH keyhole limpet hemocyanin
- OVA ovalbumin
- BSA bovine serum albumin
- the disclosure relates to antigenic peptides which are fused to a carrier protein on the N-terminus or the C-terminus, preferably the C-terminus.
- the antigen carrier is selected from bovine serum globulin (BSG), keyhole limpet hemocyanin (KLH), ovalbumin (OVA), and bovine serum albumin (BSA).
- BSG bovine serum globulin
- KLH keyhole limpet hemocyanin
- OVA ovalbumin
- BSA bovine serum albumin
- the C-terminal end of the antigenic peptide is fused to the N-terminal end of KLH (PEP-KLH) via an m-maleimidobenzoyl-N-hydroxysuccinimide ester linker.
- the heterologous protein in fusion peptides of the disclosure can include a linker which joins or links a carrier moiety or peptide to an antigenic peptide.
- the linker may be a peptide having any of a variety of amino acid sequences.
- a linker which is a spacer peptide can be of a flexible nature, although other chemical linkages are not excluded.
- a linker peptide can have a length of about 1, 2, 3, 4, 5 amino acids or from about 1 to 2, 1 to 3, 2 to 4, 2 to 5, 1 to 5, 5 to 10, 10 to 20, 20 to 30, or 30 to 40 amino acids in length. Peptide linkers with a degree of flexibility can be used.
- the linking peptides may have virtually any amino acid sequence, where in some embodiments the linker peptide will have a sequence that results in a generally flexible peptide.
- the use of small amino acids, such as glycine and alanine, are of use in creating a flexible peptide. The creation of such sequences is routine to those of skill in the art.
- Various linkers are commercially available and are considered suitable for use.
- Exemplary flexible linkers which can be used to join or link a carrier moiety to a antigenic peptide, for example, via peptide bonds, include glycine polymers (e.g., (G)n, where n is an integer from 1 to about 20; preferably 1, 2 or 3); glycine-serine polymers (including, for example, (GS)n, GSGGSn (SEQ ID NO: 84) (“GSGGS” disclosed as SEQ ID NO: 72) and GGGSn (SEQ ID NO: 85) (“GGGS” disclosed as (SEQ ID NO: 73), where n is an integer of between 1 and 10, e.g., 1, 2, 3, 4, 5, 6, 7, or more; preferably 1, 2 or 3), glycine-alanine polymers, alanine-serine polymers, lysine polymers (e.g., (K)n, where n is an integer from 1 to about 20; preferably 1, 2 or 3) and other flexible linkers known in the art.
- Glycine and glycine-serine polymers are of interest since both of these amino acids are relatively unstructured, and therefore may serve as a neutral tether between components. Glycine polymers are used in some embodiments. See Scheraga et al., in Reviews in Computational Chemistry , K. B. Lipkowitz and D. B. Boyd, Eds ., VCH Publishers, New York (1992). Lysine polymers are of interest because they have amine (NH 2 ) side chain (R) groups that can be coupled to moieties of interest. For instance, lysines easily react with N-hydroxysuccinimide (NHS) esters incorporated into compounds such as dyes to form stable amides that can be decoupled using a protic buffer.
- NHS N-hydroxysuccinimide
- Exemplary flexible linkers include, e.g., GG, GGG, GGS, GGSG (SEQ ID NO: 68), GGSGG (SEQ ID NO: 69), GSGSG (SEQ ID NO: 70), GSGGG (SEQ ID NO: 71), GSGGS (SEQ ID NO: 72), GGGS (SEQ ID NO: 73), GSSSG (SEQ ID NO: 74), KK, KKK, KKKK (SEQ ID NO: 75).
- the linker is non-peptide linker.
- Non-peptide linker moieties can also be used to join or link a carrier moiety to an antigenic peptide.
- the linker molecules are generally about 6-50 atoms long.
- the linker molecules include, e.g., aryl acetylene, ethylene glycol oligomers containing 2-10 monomer units, diamines, diacids, or combinations thereof.
- the peptide may be linked to the carrier peptide by a disulfide bond.
- the disulfide bond is formed between two cysteines, two cysteine analogs or a cysteine and a cysteine analog.
- the peptide may contain an additional amino acid comprising a reactive side chain, e.g., SH group of cysteine that is coupled to other moieties such as linkers via click chemistry. See Liang et al., J. Angew. Chem ., Int. Ed., 48, 965 (2009).
- the antigenic peptides are labeled, e.g., with a detectable label.
- the detectable label may be located on or within any part of the peptide molecule, e.g., N-terminus, C-terminus, R-group, or even the a-carbon (e.g., via use of radiolabeled carbon).
- the detectable label may be located on or within any component.
- the detectable label is located in the antigenic peptide component of the compound.
- label refers to any substance attached to an epitope binding agent, or other substrate material, in which the substance is detectable by a detection method.
- suitable labels include luminescent molecules, chemiluminescent molecules, fluorochromes, fluorescent quenching agents, colored molecules, radioisotopes, scintillants, biotin, avidin, streptavidin, protein A, protein G, antibodies or fragments thereof, polyhistidine, Ni 2+ , Flag tags, myc tags, heavy metals, and enzymes (including alkaline phosphatase, peroxidase, and luciferase). Such methods are well-known in the art.
- the peptides are labeled with label which is detectable.
- the peptides are conjugated with donor and acceptor fluorophores, respectively, which form a FRET pair.
- FRET can be used, for example, in an array format in order to determine if a particular secondary antibody is bound regardless of the identity of the analyte to which it binds.
- the label is a lipid.
- the lipid is a synthetic phospholipid derivative.
- the synthetic phospholipid derivative is DDPC, DLPC, DMPC, DPPC, DSPC, DOPC, POPC, DEPC or a derivative thereof selected from DLPC, DMPC, or DPPC; preferably DLPC, DMPC or DPPC.
- the peptides of the disclosure may be labeled using any routine method.
- the peptides (PEP) are labeled by the introduction of active amino or thiol groups in the core peptide structure. Reaction conditions such as pH, amine fluorophore concentration, and incubation time and temperature affect the yield of products formed. At high concentrations of the amine fluorophore (3M), transamination can approach 100%.
- Probes e.g., antibodies which bind to the antigenic peptides of the disclosure
- probe-specific binding partner e.g., secondary antibodies that bind to the antibody probes
- probes may also be labeled, for example, using one or more of the aforementioned detectable labels. It is to be understood that probes may comprise antigenic peptides of the disclosure that are labeled which may bind to antibodies that are specific thereto and thereby be employed in a manner analogous to how labeled antibodies are employed.
- labeled antigens may be used as probes to identify amount and/or specificity of binding between DbpA antigens in a sample (e.g., a patient's blood) and the antibodies of the disclosure.
- the detectable label may be conjugated to the antigenic peptide (PEP) of the disclosure either directly or via a linker, e.g., glycine or glycine serine linker such as, for example, GGGS (SEQ ID NO: 73).
- PEP antigenic peptide
- the antigenic peptides may be prepared using recombinant methods or chemical synthetic methods described previously.
- the disclosure further relates to compositions or kits comprising the antigenic peptides of the disclosure (PEP).
- the composition can comprise, in addition to the antigenic peptide, one or more of: a salt, e.g., NaCl, MgCl, KCl, MgSO 4 , etc.; a buffering agent, e.g., a Tris buffer, N-(2-Hydroxyethyl)piperazine-N′-(2-ethanesulfonic acid) (HEPES), 2-(N-Morpholino)ethanesulfonic acid (MES), 2-(N-Morpholino)ethanesulfonic acid sodium salt (MES), 3-(N-Morpholino)propanesulfonic acid (MOPS), N-tris[Hydroxymethyl]methyl-3-aminopropane sulfonic acid (TAPS), etc.; a solubilizing agent; a detergent, e.g.
- compositions comprising the antigenic peptide may include a buffer, which is selected according to the desired use of the peptide, and may also include other substances appropriate to the intended use. Those skilled in the art can readily select an appropriate buffer, a wide variety of which are known in the art, suitable for an intended use.
- a composition comprising the antigenic peptide is a diagnostic composition.
- Diagnostic compositions according to the disclosure can, for example, be employed in usual immunoassays in which the at least one peptide of the composition is reacted with antibodies of the disclosure (as controls). As stated above the disclosure does not only cover diagnostic compositions but also especially immunoassay methods in which the compositions are used as antigenic substance.
- One further embodiment of the disclosure intended for heterogeneous assays provides a composition wherein at least one peptide or fusion peptide is linked to solid support.
- the composition includes a tracer complex composed of at least one peptide or fusion peptide linked to a marker, e.g., a fluorescent or a luminescent molecule, either directly or via a linker.
- a marker e.g., a fluorescent or a luminescent molecule
- kits or other articles of manufacture which contains one or more of antigenic peptide or a composition comprising the same, together with instructions for formulating and/or using the composition, e.g., generating antibodies.
- Kits or other articles of manufacture may include a container, a syringe, vial, a surface, or any other article, device or equipment useful in conducting the diagnostic test (e.g., in vitro or ex vivo). Diagnostic tests may also be conducted in vivo.
- Suitable containers include, for example, bottles, vials, syringes (e.g., pre-filled syringes), ampules, cartridges, reservoirs, pumps, or lyo-jects.
- the container may be formed from a variety of materials such as glass or plastic.
- compositions and/or kits for manufacture of the polypeptide may include nucleic acids, e.g., cDNA, encoding the polypeptide having the sequence set forth in SEQ ID NO: 77 or a variant thereof or a functional fragment thereof and a carrier, e.g., buffer.
- nucleic acids e.g., cDNA
- a carrier e.g., buffer
- Expression kits may include vectors, e.g., phages (e.g., T7), phagemids, cosmids, plasmid vectors (e.g., bacterial or yeast), viral vectors (e.g., retroviral, lentiviral, adenoviral, adeno-associated viral, hybrid, baculoviral), which when incorporated into a suitable host system (e.g., cell such as a mammalian cell), encode the polypeptide of SEQ ID NO: 77 or a variant thereof or an immunogenic fragment thereof.
- phages e.g., T7
- phagemids e.g., cosmids
- plasmid vectors e.g., bacterial or yeast
- viral vectors e.g., retroviral, lentiviral, adenoviral, adeno-associated viral, hybrid, baculoviral
- suitable host system e.g., cell such as a mamm
- nucleic acids where a subject synthetic nucleic acid comprises a nucleotide sequence encoding one or more antigenic peptides of the present disclosure.
- Nucleic acids include oligonucleotides, nucleotides, polynucleotides, or any fragment thereof, to DNA or RNA of genomic or synthetic origin which may be single-stranded or double-stranded and may represent the sense or the antisense strand, to peptide nucleic acid (PNA), or to any DNA-like or RNA-like material.
- PNA peptide nucleic acid
- fragments refers to those nucleic acid sequences which are greater than about 10 nucleotides in length, and most preferably are at least about 20 nucleotides, at least about 50 nucleotides, or more.
- nucleic acids encoding the antigenic peptides of the disclosure or an immunogenic fragment thereof, nucleic acids that are complementary to the encoding nucleic acids, or the RNA equivalent thereof, or a complementary RNA thereof.
- the disclosure relates to polynucleotides which encode an antigenic peptide (PEP) comprising, consisting essentially of, or consisting of the sequence set forth in SEQ ID NO: 77.
- the polynucleotide is a DNA, e.g., cDNA, or a complementary strand thereto, or the RNA equivalent thereof, or a complementary RNA thereof.
- the proximal (5′) end of the nucleic acid may comprise a plurality of elements, e.g., initiation site (AUG), 5′ untranslated region (UTR), and optionally a cap (e.g., m 7 CAAP).
- initiation site e.g., initiation site (AUG)
- UTR 5′ untranslated region
- cap e.g., m 7 CAAP
- the 5′ UTR may contain a ribosome binding site (RBS), also known as the Shine Dalgarno sequence (AGGAGGU), which is usually 3-10 base pairs upstream from the initiation codon (AUG).
- RBS ribosome binding site
- AGGAGGU Shine Dalgarno sequence
- the 5′ UTR may contain the Kozak consensus sequence (ACCAUGG), which contains the initiation codon (AUG), cis-acting regulatory elements called upstream open reading frames (uORFs) and upstream AUGs and termination codons (uAUGs), which have a great impact on the regulation of translation. Also, unlike prokaryotes, 5′ UTRs in eukaryotes can harbor introns.
- ACCAUGG Kozak consensus sequence
- UAG initiation codon
- uORFs upstream open reading frames
- uAUGs upstream AUGs and termination codons
- nucleic acids encoding tagged antigenic peptides of the disclosure e.g., histidine-tagged, Flag-tagged, or Myc-tagged antigenic peptides, or the complementary strand(s) of the nucleic acids encoding the tagged antigenic peptides, or the RNA equivalent of the encoding strand or the complementary strand, or a complementary RNA equivalent thereof.
- Embodiments disclosed herein further relate to variants of the aforementioned polynucleotides.
- variants of aforementioned nucleic acids which comprise, or alternatively consist of, a nucleotide sequence which is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99%, or greater % identity, e.g., 99.5% to nucleic acids encoding the antigenic peptides, e.g., a nucleic acid encoding SEQ ID NO: 77.
- variant polynucleotides which hybridize to one or more nucleic acid molecules under stringent hybridization conditions or lower stringency conditions.
- oligonucleotides e.g., PCR primers, which hybridize to one or more nucleic acids, which can be used in PCR amplification or in a hybridization assay or microarray.
- PNA peptide nucleic acid
- the disclosure relates to surfaces comprising nucleic acids which encode the antigenic peptides of the disclosure.
- Such surfaces can be used to detect DbpA mRNA via hybridization-based detection schemes. For instance, probes that are complementary to nucleic acids encoding SEQ ID NO: 77 may be used in the detection.
- the surface is an array plate and the DbpA antigens in a sample are detected using routine techniques of DNA microarray.
- vectors which contain one or more of the aforementioned nucleic acids.
- the vector comprises at least one protein encoding nucleic acid, e.g., nucleic acids encoding at least one of the foregoing peptides (e.g., SEQ ID NO: 77), in operable linkage with one or more additional sequences.
- the additional sequences may be synthetic in nature.
- a nucleotide sequence encoding an antigenic peptide can be operably linked to one or more regulatory elements, such as a promoter and enhancer, that allow expression of the nucleotide sequence in the intended target cells (e.g., a cell that is genetically modified to synthesize the encoded antigenic peptide).
- a subject nucleic acid is a recombinant expression vector.
- a nucleotide sequence encoding an antigenic peptide (PEP) can be present in an expression vector and/or a cloning vector.
- the vector is a mammalian vector which allows for transient, stable, or lentiviral expression of proteins.
- the following mammalian vectors are especially preferred: pD2610, including variants thereof (transient); pD2500, including variants thereof (stable); or pD2100, including variants thereof (lentiviral). These vectors can be purchased from ATUM, Inc. (Newark, Calif., USA).
- the present disclosure provides isolated host cells that are genetically modified (e.g., transformed cells or cell-lines) with a nucleic acid comprising a nucleic acid sequence which encodes an antigenic peptide.
- the isolated genetically modified host cell can produce an antigenic peptide.
- Suitable host cells include eukaryotic host cells, such as a mammalian cell, an insect host cell, a yeast cell; and prokaryotic cells, such as a bacterial cell.
- Introduction of a subject nucleic acid into the host cell can be effected, for example by calcium phosphate precipitation, DEAE dextran mediated transfection, liposome-mediated transfection, electroporation, or other known method.
- the disclosure further relates to cell cultures comprising the aforementioned transformed host cells which inducibly, transiently, or stably express the recombinant antigenic polypeptides or antibodies of the disclosure.
- Such cultures may comprise, e.g., monolayer cultures, liquid (e.g., floating) cultures, 2D cultures, 3D cultures (both scaffold-free and scaffold or matrix-dependent).
- the host cells may be cultured in scaffold systems such as hydrogel matrices and solid scaffolds, and scaffold-free systems such as low-adhesion plates, nanoparticle facilitated magnetic levitation, and hanging drop plates.
- the disclosure further relates to organs, organ systems, and/or transgenic animals which comprise the aforementioned host cells which comprise the polynucleotides that encode the antigenic peptides of the disclosure.
- Embodiments of the instant disclosure further provide for systems, e.g., diagnostic systems or immunoapheresis systems, comprising the aforementioned compositions and/or kits.
- systems e.g., diagnostic systems or immunoapheresis systems, comprising the aforementioned compositions and/or kits.
- the disclosure is directed inter alia to the detection of antigens that are diagnostic of Lyme disease.
- the disclosure provides specific and sensitive assays for diagnosing such diseases, thereby providing clarity to clinical assessment of the patient.
- One aspect of the disclosure is a method for detecting Lyme disease in a subject suspected of having antibody against a causative agent of Lyme disease.
- the diagnostic method is useful for diagnosing subjects exhibiting the clinical symptoms of, or suspected of having, Lyme disease.
- Another aspect of the disclosure there is provided a method for detecting Lyme disease in the subject having or suspected of having B. burgdorferi infection, comprising detecting DbpA antigen using one or more antibodies of the disclosure.
- the method comprises detecting the DbpA antigen using MAb 6G8 or MAb 8C10 or antigen-binding fragments thereof.
- the subject is a human or a domestic animal (e.g., dogs, cats, sheep, cows) or a wild animal (e.g., deer, elk, moose).
- a domestic animal e.g., dogs, cats, sheep, cows
- a wild animal e.g., deer, elk, moose
- One aspect of the disclosure is a method for diagnosing Lyme disease in a subject (e.g., for diagnosing exposure to and/or infection by a pathogenic Borrelia ), comprising measuring a bodily fluid (which would be expected to contain antibodies) of the subject for the presence of an antibody against a causative agent of Lyme disease (e.g. an antibody capable of binding to such an agent), wherein an elevated level of antibody in the subject compared to a corresponding level of antibody in a control (such as a known unaffected subject) indicates an infection by the causative agent and/or that the subject has Lyme disease.
- a causative agent of Lyme disease includes a pathogenic species of B. burgdorferi, B.
- B. garinii B. garinii
- Other species of Borrelia which have been implicated in Lyme disease, such as, e.g., B. lusitaniae and B. valaisianae are also included, provided they induce antibodies which can react specifically with the antigenic peptide of the disclosure.
- the disclosure provides a method for diagnosing Lyme disease in a subject (e.g., for diagnosing exposure to and/or infection by a pathogenic Borrelia ), comprising measuring a bodily fluid (which would be expected to contain antibodies) of the subject for the presence of a DbpA antigen from a causative agent of Lyme disease (e.g., an antigen which shares significant homology or identity with SEQ ID NO: 77 or an immunogenic fragment thereof), wherein an elevated level of the antigen in the subject compared to a corresponding level of antibody in a control (such as a known unaffected subject) indicates an infection by the causative agent and/or that the subject has Lyme disease.
- a causative agent of Lyme disease e.g., an antigen which shares significant homology or identity with SEQ ID NO: 77 or an immunogenic fragment thereof
- One embodiment of this method comprises contacting (incubating, reacting) a sample of a biological fluid (e.g., serum or CSF) from a subject to be diagnosed (a subject suspected of having Lyme disease) with the diagnostic reagent comprising the antibody of the disclosure or the antigenic peptide of the disclosure.
- a biological fluid e.g., serum or CSF
- the diagnostic reagent comprising the antibody of the disclosure or the antigenic peptide of the disclosure.
- an antigen-antibody complex is formed.
- the reaction mixture is analyzed to determine the presence or absence of this antigen-antibody complex.
- a variety of conventional assay formats can be employed for the detection, such, e.g., as ELISA, microarray analysis, Luminex bead based assays or lateral flow methods.
- a positive response is defined as a value of 1.5, 2, 3, 4 or more, e.g., 5 standard deviations greater than the mean value of a group of healthy controls.
- a positive response is defined as a statistically significant difference in the mean binding of diagnostic reagent (e.g., anti-DbpA antibody or the DbpA antigen) and the analyte (e.g., DbpA antigen or the subject's antibody in biological sample) compared to controls (e.g., a healthy subject).
- diagnostic reagent e.g., anti-DbpA antibody or the DbpA antigen
- the analyte e.g., DbpA antigen or the subject's antibody in biological sample
- controls e.g., a healthy subject.
- Statistical significance may be determined using a Kruskal-Wallis test followed by a Dunn's comparison test.
- a second tier assay is performed to provide an unequivocal sero-diag
- One embodiment of the disclosure is a diagnostic immunoassay method, which comprises (1) taking a sample of body fluid or tissue likely to contain antibodies; (2) contacting the sample with an antibody of the disclosure or a peptide of the disclosure, under conditions effective for the formation of a specific antibody-antigen complex, e.g., reacting or incubating the sample and the anti-DbpA antibody of the disclosure (or reacting or incubating the sample and the DbpA peptide of SEQ ID NO: 77); and (3) assaying the contacted (reacted) sample for the presence of an antibody-antigen complex (e.g., determining the amount of an antibody-peptide complex).
- a diagnostic immunoassay method which comprises (1) taking a sample of body fluid or tissue likely to contain antibodies; (2) contacting the sample with an antibody of the disclosure or a peptide of the disclosure, under conditions effective for the formation of a specific antibody-antigen complex, e.g., reacting or incubating the sample and the anti-DbpA antibody of the disclosure
- the sample is preferably easy to obtain and may be serum or plasma derived from a venous blood sample or even from a finger prick.
- Tissue from other body parts or other bodily fluids such as cerebro-spinal fluid (CSF), saliva, gastric secretions, mucus, etc. are known to contain antibodies and may be used as a source of the sample.
- CSF cerebro-spinal fluid
- an assay is performed to determine the presence or absence of an antibody-peptide reaction.
- suitable assays which will be evident to a skilled worker, are ELISA, immunoprecipitation and agglutination assays.
- the assay may comprise (1) immobilizing the analyte in the sample, adding the binding partner (e.g., peptide of SEQ ID NO: 77 or MAb 6G8 or MAb 8C10 or antigen-binding fragments thereof), and then detecting the degree of complex between the analyte and the probe.
- the binding partner e.g., peptide of SEQ ID NO: 77 or MAb 6G8 or MAb 8C10 or antigen-binding fragments thereof
- Detection may be facilitated using a labeled probe (e.g., labeled SEQ ID NO: 77 or labeled MAb 6G8 or MAb 8C10 or antigen-binding fragments thereof) or by adding a labeled substance (conjugate, binding partner), such as a labeled antibody, which specifically recognizes the probe; (2) immobilizing the probe of the disclosure, adding the sample containing an analyte, and then detecting the amount of the complex between the analyte and the probe, e.g., by adding a labeled substance (conjugate, binding partner), such as a labeled antibody, which specifically recognizes the probe in complex with the analyte; or (3) reacting the probe and the analyte without any of the reactants being immobilized, and then detecting the amount of the probe-analyte complex.
- a labeled probe e.g., labeled SEQ ID NO: 77 or labeled MAb 6G8 or MA
- Immobilization of a peptide of the disclosure can be either covalent or non-covalent, and the non-covalent immobilization can be non-specific (e.g. non-specific binding to a polystyrene surface in e.g. a microtiter well).
- Specific or semi-specific binding to a solid or semi-solid carrier, support or surface can be achieved by the peptide having, associated with it, a moiety which enables its covalent or non-covalent binding to the solid or semi-solid carrier, support or surface.
- the moiety can have affinity to a component attached to the carrier, support or surface.
- the moiety may be, e.g., a biotin or biotinyl group or an analogue thereof bound to an amino acid group of the peptide, such as 6-aminohexanoic acid, and the component is then avidin, streptavidin or an analogue thereof.
- an alternative is a situation in which the moiety has the amino acid sequence HHHHHH (SEQ ID NO: 76) and the carrier comprises a nitrilotriacetic acid derivative (NTA) charged with Ni 2+ ions.
- supports or surface are, e.g., magnetic beads or latex of co-polymers such as styrene-divinyl benzene, hydroxylated styrene-divinyl benzene, polystyrene, carboxylated polystyrene, beads of carbon black, non-activated or polystyrene or polyvinyl chloride activated glass, epoxy-activated porous magnetic glass, gelatin or polysaccharide particles or other protein particles, red blood cells, mono- or polyclonal antibodies or Fab fragments of such antibodies.
- co-polymers such as styrene-divinyl benzene, hydroxylated styrene-divinyl benzene, polystyrene, carboxylated polystyrene, beads of carbon black, non-activated or polystyrene or polyvinyl chloride activated glass, epoxy-activated porous magnetic glass, gelatin or polysacc
- an antibody of the disclosure is immobilized to the solid or semi-solid surface or carrier by means of covalent or non-covalent binding, either prior to or after the addition of the sample comprising or believed to contain an antigen (e.g., DbpA or a variant thereof).
- an antigen e.g., DbpA or a variant thereof.
- Solid phase assays in general, are easier to perform than heterogeneous assay methods which require a separation step, such as precipitation, centrifugation, filtration, chromatography, or magnetism, because separation of reagents is faster and simpler.
- Solid-phase assay devices include microtiter plates, flow-through assay devices, dipsticks and immunocapillary or immunochromatographic immunoassay devices.
- the solid or semi-solid surface or carrier is the floor or wall in a microtiter well; a filter surface or membrane (e.g. a nitrocellulose membrane or a PVDF (polyvinylidene fluoride) membrane, such as an Immobilon membrane); a hollow fiber; a beaded chromatographic medium (e.g.
- an agarose or polyacrylamide gel a magnetic bead
- a fibrous cellulose matrix a fibrous cellulose matrix
- an HPLC matrix a FPLC matrix
- probes e.g., immunogenic fragments of SEQ ID NO: 77 or fragments of MAb 6G8 or MAb 8C10
- microspheres tiny polystyrene beads
- each peptide is immobilized onto a bead with a unique spectral signature
- the probe is provided with a suitable label which enables detection.
- Conventional labels may be used which are capable, alone or in concert with other compositions or compounds, of providing a detectable signal.
- Suitable detection methods include, e.g., detection of an agent which is tagged, directly or indirectly, with a fluorescent label by immunofluorescence microscopy, including confocal microscopy, or by flow cytometry (FACscan); detection of a radioactively labeled agent by autoradiography; electron microscopy; immunostaining; subcellular fractionation, or the like.
- a radioactive element e.g. a radioactive amino acid
- a fluorescent label is associated with a peptide via biotin/avidin interaction, association with a fluorescein conjugated antibody, or the like.
- a detectable specific binding partner for the antibody is added to the mixture.
- the binding partner can be a detectable secondary antibody which binds to the first antibody.
- This secondary antibody can be labeled, e.g., with a radioactive, enzymatic, fluorescent, luminescent, or other detectable label, such as an avidin/biotin system.
- the detection procedure comprises visibly inspecting the antibody-peptide complex for a color change, or inspecting the antibody-peptide complex for a physical-chemical change.
- Physical-chemical changes may occur with oxidation reactions or other chemical reactions. They may be detected by eye, using a spectrophotometer, or the like.
- the probe is electro- or dot-blotted onto nitrocellulose paper.
- the biological fluid e.g., serum or plasma
- analyte in the biological fluid is allowed to bind to the probe(s).
- the bound complex can then be detected, e.g. by standard immunoenzymatic methods.
- latex or polystyrene beads are conjugated to the probes and the biological fluid is incubated with the bead/probe conjugate, thereby forming a reaction mixture. The reaction mixture is then analyzed to determine the presence of the analyte.
- ELISA One assay for the screening of blood products or other physiological or biological fluids is ELISA.
- the probe of the disclosure is adsorbed to the surface of a microtiter well directly or through a capture matrix. Residual, non-specific protein-binding sites on the surface are then blocked with an appropriate agent, such as BSA, heat-inactivated normal goat serum (NGS), or BLOTTO (a buffered solution of nonfat dry milk).
- BSA heat-inactivated normal goat serum
- BLOTTO a buffered solution of nonfat dry milk.
- the well is then incubated with a biological sample suspected of containing pathogenic Borrelia (e.g. B. burgdoferi ) analyte (e.g., DbpA antigen or antibody thereto).
- BSA heat-inactivated normal goat serum
- BLOTTO a buffered solution of nonfat dry milk
- the sample can be applied neatly, or more often it can be diluted, usually in a buffered solution which contains a small amount (0.1-5.0% by weight) of protein, such as BSA, NGS, or BLOTTO.
- a buffered solution which contains a small amount (0.1-5.0% by weight) of protein, such as BSA, NGS, or BLOTTO.
- an appropriate anti-immunoglobulin antibody e.g., for human subjects, an anti-human immunoglobulin (ctHulg) from another animal, such as dog, mouse, cow, etc.
- an enzyme or other label by standard procedures and is dissolved in blocking buffer.
- the label can be chosen from a variety of enzymes, including horseradish peroxidase (HRP), ⁇ -galactosidase, alkaline phosphatase, glucose oxidase, etc. Sufficient time is allowed for specific binding to occur again, then the well is washed again to remove unbound conjugate, and a suitable substrate for the enzyme is added. Color is allowed to develop and the optical density of the contents of the well is determined visually or instrumentally (measured at an appropriate wave length).
- HRP horseradish peroxidase
- ⁇ -galactosidase alkaline phosphatase
- glucose oxidase etc.
- Color is allowed to develop and the optical density of the contents of the well is determined visually or instrumentally (measured at an appropriate wave length).
- Another useful assay format is a lateral flow format.
- Antibody to human or animal antibody or staph A or G protein antibodies is labeled with a signal generator or reporter (i.e., colloidal gold) that is dried and placed on a glass fiber pad (sample application pad).
- the diagnostic probe is immobilized on membrane, such as a PVDF (polyvinylidene fluoride) membrane (e.g., an IMMOBILON membrane (Millipore)) or a nitrocellulose membrane.
- PVDF polyvinylidene fluoride
- IMMOBILON membrane IMMOBILON membrane
- This mixture is transported into the next membrane (PVDF or nitrocellulose containing the diagnostic probe) by capillary action. If the analyte is present in the sample, they bind to the probe striped on the membrane generating a signal.
- An additional antibody specific to the colloidal gold labeled antibody such as goat anti-mouse IgG may be used to produce a control signal.
- any number of conventional protein assay formats may be designed to utilize the isolated peptides of this disclosure for the detection of pathogenic Borelia (e.g., B. burgdorferi ) infection a subject.
- This disclosure is thus not limited by the selection of the particular assay format, and is believed to encompass assay formats that are known to those of skill in the art.
- the disclosure relates to methods of generating an immune response in a subject, including a human.
- the methods generally involve administering to an animal or human a pharmaceutical composition comprising an immunologically effective amount of a DbpA fragment (e.g., SEQ ID NO: 77), nucleic acid or antibody composition as disclosed herein.
- Animals to be immunized include mammals, particularly humans, but also murine, bovine, equine, porcine, canine, feline and non-human primate species.
- the term “immunologically effective amount” is meant an amount of a DbpA fragment, polypeptide, peptide, nucleic acid or antibody composition that is capable of generating an immune response in the recipient animal or human.
- B cell response an antibody response
- T cell response a cytotoxic immune response
- these methods may be used for the prevention or treatment of infections caused by pathogens such as B. burgdorferi, B. afzelii, B. garinii , and related Borrelial species.
- the disclosure relates to methods of producing bioreagents, e.g., cytotoxic T lymphocytes (CTLs) and, more particularly, reactive antibodies using the DbpA fragments of the disclosure.
- bioreagents e.g., cytotoxic T lymphocytes (CTLs) and, more particularly, reactive antibodies using the DbpA fragments of the disclosure.
- CTLs cytotoxic T lymphocytes
- Bioreagents such as CTLs and antibodies have numerous practical uses outside prophylaxis and therapy, such as in vitro diagnostics.
- a plurality of vaccinations may be used.
- the course of the immunization may be followed by assays for antibodies for the supernatant antigens.
- the assays may be performed by labeling with conventional labels, such as radionuclides, enzymes, fluorescers, and the like.
- the pharmaceutical, vaccine or other compositions for administration to generate an immune response will typically include combinations of partially or significantly purified Borrelial proteins, polypeptides and/or peptides, obtained from natural or recombinant sources, which proteins, polypeptides and/or peptides may be obtainable naturally or either chemically synthesized, or alternatively produced in vitro from recombinant host cells expressing DNA segments encoding such proteins, polypeptides and/or peptides. Smaller peptides that include reactive epitopes, such as those between about 10 amino acids and about 50 amino acids, between about 15 amino acids and about 25 amino acids in length, or even between about 50 amino acids and about 100 amino acids in length will often be preferred.
- the antigenic proteins, polypeptides and/or peptides may also be combined with other agents.
- Antibodies may be of several types including those raised in heterologous donor animals or human volunteers immunized with Borrelial proteins, monoclonal antibodies (mAbs) resulting from hybridomas derived from fusions of B cells from immunized animals or humans with compatible myeloma cell lines, so-called “humanized” mAbs resulting therefrom, or antibody-containing fractions of plasma from human donors residing in Lyme disease-endemic areas. It is contemplated that any of the techniques described herein might be used for the passive immunization of subjects for protection against, or treatment of, Borrelial infections, such as Lyme disease.
- the immunogenicity of a particular immunogen composition can be enhanced by the use of non-specific stimulators of the immune response, known as adjuvants.
- Suitable adjuvants include all acceptable immunostimulatory compounds, such as cytokines, toxins or synthetic compositions.
- Adjuvants that may be used include IL-1, IL-2, IL-4, IL-7, IL-12, g-interferon, GMCSP, BCG, aluminum hydroxide, MDP compounds, such as thur-MDP and nor-MDP, CGP (MTP-PE), lipid A, and monophosphoryl lipid A (MPL).
- RIBI which contains three components extracted from bacteria, MPL, trehalose dimycolate (TDM) and cell wall skeleton (CWS) in a 2% squalene/Tween 80 emulsion.
- MHC antigens may even be used.
- exemplary, often preferred adjuvants include complete Freund's adjuvant (a non-specific stimulator of the immune response containing killed Mycobacterium tuberculosis ), incomplete Freund's adjuvants and aluminum adjuvants.
- BRM biologic response modifiers
- BRM biologic response modifiers
- BRMs include, but are not limited to, Cimetidine (CIM; 1200 mg/d) (Smith/Kline, PA); or low-dose Cyclophosphamide (CYP; 300 mg/m2) (Johnson/Mead, NJ) and Cytokines such as y-interferon, IL-2, or IL-12 or genes encoding proteins involved in immune helper functions, such as B-7.
- Cimetidine Cimetidine
- CYP low-dose Cyclophosphamide
- Cytokines such as y-interferon, IL-2, or IL-12 or genes encoding proteins involved in immune helper functions, such as B-7.
- live antigen delivery systems will be useful in the practice of certain embodiments of the present disclosure. Examples of these include, but are not limited to, vaccinia virus, poliovirus, Salmonella sp., Vibrio sp. and Mycobacteria sp.
- the disclosure further relates to use of compositions comprising the antibodies of the disclosure to eliminate DbpA toxins (or even pathogens such as B. burgdorferi, B. afzelii, B. garinii , and related Borrelial species) from a subject (e.g. human patient suffering from Lyme disease) ex vivo, e.g., via immunoapheresis.
- DbpA toxins or even pathogens such as B. burgdorferi, B. afzelii, B. garinii , and related Borrelial species
- IgM chimeric human antibodies
- DbpA Lyme antigen DbpA
- a mammalian system was used to develop the cloning and expression of the synthesized genes of antibody.
- the purified chimeric DbpA IgM protein is used for the development of Lyme standards and controls in the lateral flow-based assays.
- Monoclonal antibodies against Lyme antigens provide consistency that is desirable of diagnostic reagents. Also, such antibodies can be generated, as desired, so that they can be readily deployed, as needed, over a longer duration, e.g., during outbreaks.
- murine monoclonal antibody is obtained by immunizing mice with an antigenic peptide.
- hybridoma cell lines are developed and antibody variable regions sequences are obtained using RT-PCR technology.
- expression vectors containing nucleic acids encoding such variable regions of the antibody are generated using recombinant techniques, e.g., cloning and sub-cloning. This is followed by generation of chimeric antibody constructs, wherein mouse CDRs are grafted into human IgG/M framework Fc region.
- Such constructs are utilized for antibody production, e.g., either batch production or production in commercial scale.
- hybridomas For fusion and cloning, about 500 hybridomas were generated for screening. Excess fused hybridomas were frozen and retained to generate additional candidates, as needed. Depending on the health of the animals, mice whose B-cells were not fused to generate hybridomas were retained until the end of the project.
- Immunoglobulin gene transcripts expressed by mouse hybridomas 6G8 and 8C10 were amplified with sets of SYNBUILD primers from cDNA generated from the hybridoma cells using standard RT-PCR protocol. The transcripts were sequenced using a standard dye-terminator capillary sequencing method. Annotated sequences of the identified immunoglobulin gene transcripts, the corresponding sequencing trace files and a sequencing report was compiled. DNA fragments of the identified regions, which are embedded in agarose, may be used for further amplification and/or downstream manipulation.
- the protein is to be expressed in mammalian HEK cells and for easy chromatography purification of the recombinant protein.
- Chimera antibodies were designed and produced in order to maintain the two critical features: antigen-specific binding (from Fv/Fab region), and human IgM Fc region for the binding to anti-hu IgM Fc5u antibody (i.e. goat anti-human IgM Fc5u fragment-specific, JIR #109-005-129, in this case).
- the antigen-specific binding domain comes from the mouse hybridoma cell line, which secretes the monoclonal antibody.
- the human IgM Fc region comes from the plasmid expression vector.
- the construct design is as follows: Heavy Chain: Mouse VH-CH1 and human IgM u chain (CH2-4); Light Chain: Mouse VL-CL
- LC full length and HC variable VH with CH1 were sub-cloned into full human IgM expression vectors.
- Full-length chimeric IgM was expressed in 293 cells by transient transfection and purified by one-step affinity purification. Purified antibodies were characterized by SDS-PAGE and SEC-HPLC.
- HEK 293 cells Mammalian culture was carried out in HEK 293 cells. Protein expression vectors were transfected in HEK293 using standard transfection methods. Cells were grown for 7 days and harvested. The pH of the supernatant was adjusted with IM HEPES pH 7.4. CAPTURESELECT IgM resin was used to capture proteins. The resin was washed was PBS and proteins were eluted with citrate buffer (50 mM Citrate pH 3.5, 100 mM NaCl). Proteins were desalted by PD-10 columns into PBS and protein concentration and amount were quantified by OD280 using calculated extinction coefficient.
- citrate buffer 50 mM Citrate pH 3.5, 100 mM NaCl
- Reduced/non-reduced SDS-PAGE gels (BIORAD criterion Tris/Glycine/SDS, 4-20%) were used to determine purity and approximate size.
- Phase II Fusion & Cloning-Tail bleed data were reviewed and based on titers, positive confirmation of fusion was made. Roughly 500 hybridomas were generated for screening.
- Phase III Hybridoma Screening—From the 500 clones, ninety one positives were identified using solid-phase robotic ELISA screening, which were then used for confirmatory testing and screening (2 nd screening). Forty clones were selected based on ELISA results. Mouse IgG quantitation data were requested. Of these, 28 clones were selected for Octet affinity scouting. Results are shown in Table 3 and 4.
- Phase IV Culture supernatant preparation and Octet mIgG quantification (with anti-mIgG Fc)-Octet scouting analysis was used to determine on/off rate and K D ranking for up to 28 samples to the full length protein The following 28 clones were selected Octet Affinity Scouting with DbpA as the analyte. The mAbs were determined with affinity ranging KD of nM to pM.
- Phase IV Culture supernatant preparation and Octet mIgG quantification (with anti-mIgG Fc)-Octet scouting analysis was used to determine on/off rate and K D ranking for up to 28 samples to the full length protein The following 28 clones were selected Octet Affinity Scouting with DbpA as the analyte. The mAbs were determined with affinity ranging KD of nM to pM.
- the 40 expanded clone culture sups were forwarded for BIACORE testing.
- BIACORE ranking was performed using DbpA chips for all the clones.
- Dissociation constant (K D ) of the tested antibodies were generally in picomolar (pM) range. This was consistent for Octet ranking.
- Phase V Final selection-Based on the Octet affinity and Biacore affinity ranking, the final 5 clones were chosen. Vials containing the clones (2 vials/clone) were cryo-conserved in liquid nitrogen.
- Recombinant Lyme DbpA antigen was produced and used for mouse immunization and hybridoma cell line development.
- 5 high affinity mouse monoclonal antibodies were discovered and obtained as hybridoma clones.
- Two of them, 6G8 and 8C10, were sequenced of the full-length immunoglobulin gene transcripts. Novel sequences of the CDR regions of VH/VL chains were identified.
- Humanized chimeric antibodies were then designed to include the DbpA-specific CDR domains from mouse IgG and human IgM Fc region for the binding of a secondary anti-human IgM Fc antibody in the immunoassay for detection of IgM.
- the two clones namely 6G8 and 8C10, were sequenced of the full-length immunoglobulin gene transcripts expressed by mouse hybridomas RNA.
- the mouse IgG VH/VL region genes were synthesized and cloned into a mammalian expression vector.
- Two chimeric IgM antibodies were expressed and produced from the secreted media.
- Small scale cell culture and purification experiments in HEK 293 cells were carried out for antibody functional analysis. 0.18 mg of 6G8 and 1.6 mg of 8C10 antibodies were purified from 30 mL cell culture, indicating that antibody titer at 5.4 mg/L and 52 mg/L, respectively, could be achieved when scaling up.
- results demonstrated that the antibodies were purified as 80 kDa (heavy chain) and 25 kDa (light chain) on a reducing SDS-PAGE gel, and higher molecular bands were observed on a non-reduced gel (>500 kDa and other minor bands).
- the purified antibodies showed as one major dominant peak on HPLC-SEC (Retention Time 3.8, corresponding to human IgM molecular weight).
- Biacore testing with the DbpA antigen immobilized on CM5 chip demonstrated that it bound well with the purified antibody, confirming that they were correctly folded and expressed. Immunoassay test devices were used to confirm that they served as sensitive DbpA-specific standards and calibrators for an IgM assay.
- DbpA mAb clones have been discovered and identified, in which two of them were disclosed of their epitope-binding sequences on VH/VL and CDR regions.
- the newly discovered DbpA-specific monoclonal antibodies provided as useful agents in diagnosing Lyme disease and in the detection of Lyme antigen for immunoassay development including POC, EIA and Western blot methods.
- the recombinant approach for chimeric constructs made it possible to generate an easy platform as serological controls and standards.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Immunology (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Engineering & Computer Science (AREA)
- Gastroenterology & Hepatology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- Microbiology (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Toxicology (AREA)
- Cell Biology (AREA)
- Pathology (AREA)
- General Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Virology (AREA)
- Physics & Mathematics (AREA)
- Zoology (AREA)
- Biotechnology (AREA)
- Food Science & Technology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
Abstract
Description
| (SEQ ID NO: 78) | |
| 10 20 30 40 | |
| MIKCNNKTFN |
|
| 50 60 70 80 | |
| DITDEIDAIK KDAALKGVNF DAFKDKKTGS GVSENPFILE | |
| 90 100 110 120 | |
| AKVRATTVAE KFVIAIEEEA TKLKETGSSG EFSAMYDLMF | |
| 130 140 150 160 | |
| EVSKPLQKLG IQEMTKTVSD AAEENPPTTA QGVLEIAKKM | |
| 170 180 190 | |
| REKLQRVHTK NYCTLKKKEN STFTDEKCKN N |
| TABLE 1 |
| Natural variants and/or mutants of |
| wild-type DbpA (SEQ ID NO: 78) |
| Feature | Position(s) | |
| key | in SEQ#Y | Description Actions |
| Natural | 34 | R → K in strain: |
| variant | 297, LP7 and Sh-2-82. | |
| Natural | 37 | R → S in strain: |
| variant | 297, LP7 and Sh-2-82. | |
| Natural | 41-43 | DIT → AIV in strain: |
| variant | 297, LP7 and Sh-2-82. | |
| Natural | 52 | D → K in strain: |
| variant | 297, LP7 and Sh-2-82. | |
| Natural | 55-56 | LK → SM in strain: |
| variant | 297, LP7 and Sh-2-82. | |
| Natural | 128 | K → E in strain: |
| variant | 297, LP7 and Sh-2-82. | |
| Natural | 140 | D → M in strain: |
| variant | 297, LP7 and Sh-2-82. | |
| Natural | 169 | T → K in strain: |
| variant | 297, LP7 and Sh-2-82. | |
| Natural | 172-173 | YC → QD in strain: |
| variant | 297, LP7 and Sh-2-82. | |
| Natural | 179-191 | ENSTF (SEQ ID NO: 81) . . . |
| variant | KCKNN (SEQ ID NO: 82) → | |
| NTEDSTAKS (SEQ ID NO: 83) | ||
| in strain: 297, LP7 and | ||
| Sh-2-82. | ||
| TABLE 2 |
| Exemplary amino acid substitutions |
| Amino | Exemplary Conservative | ||
| Acid | Substitutions | ||
| Ala | Ser, Gly, Cys | ||
| Arg | Lys, Gln, Met, Ile | ||
| Asn | Gln, His, Glu, Asp | ||
| Asp | Glu, Asn, Gln | ||
| Cys | Ser, Met, Thr | ||
| Gln | Asn, Lys, Glu, Asp | ||
| Glu | Asp, Asn, Gln | ||
| Gly | Pro, Ala | ||
| His | Asn, Gln | ||
| Ile | Leu, Val, Met | ||
| Leu | Ile, Val, Met | ||
| Lys | Arg, Gln, Met, Ile | ||
| Met | Leu, Ile, Val | ||
| Phe | Met, Leu, Tyr, Trp, His | ||
| Ser | Thr, Met, Cys | ||
| Thr | Ser, Met, Val | ||
| Trp | Tyr, Phe | ||
| Tyr | Trp, Phe, His | ||
| Val | Ile, Leu, Met | ||
| (SEQ ID NO: 33) |
| MGWSCIMLFLAATATGVHSQVQLQQPGAELVKPGASVKLSCKASGYTFT |
| RYWMYWVKQRPGRGLEWIGRLDPNSGVTKYNEKFKSKATLTVDKSSSTA |
| YMQLSSLTSEDSAVYYCVRDDSWYFDVWGTGTTVTVSSAKTTPPSVYPL |
| APGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSD |
| LYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPRDCGCKPCIC |
| TVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDD |
| VEVHTAQTKPREEQINSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPA |
| PIEKTISKTKGRPKAPQVYTIVYSKLNVQKSNWEAGNTFTCSVLHEGLH |
| NHHTEKSLSLSPGK |
| (SEQ ID NO: 34) |
| MDMRAPAQFLGILLLWFPGARCEIQMTQSPSSMSASLGDRITITCQATQ |
| DIVKNLNWYQQKPGKPPSFLIYYATELAEGVPSRFSGSGSGSDYSLTIN |
| NLESQDFADYFCLQFYAFPLTFGAGTKLELRRADAAPTVSIFPPSSEQL |
| TSGGASVVCFLNNFYPRDINVKWKIDGSERQNGVLNSWTDQDSKDSTYS |
| MSSTLT LTKDEYERHNSYTCEATHKTSTSPIVKSFNRGEC |
| (SEQ ID NO: 35) |
| MEWTWVFLFLLSVTAGVHSQVQLQQSGAELMKPGASVKLSCKAAGYTFT |
| DYWIEWVKQRPGHGLEWIGEILPGSGSTKDNERFKGKATFTADTSSNTA |
| YMQLSSLTTEDSAIYYCARREWGYYFDYWGQGTTLTVSSAKTTPPSVYP |
| LAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQS |
| DLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPRDCGCKPCI |
| CTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVD |
| DVEVHTAQTKPREEQINSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFP |
| APIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITNFFPEDIT |
| VEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSV |
| LHEGLHNHHTEKSLSLSPGK |
| (SEQ ID NO: 36) |
| MESQIQAFVFVFLWLSGVDGDIVMTQSHKFMSTSVGDRVSITCKASQDV |
| STAVAWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDYTLTISSV |
| QAEDLALYYCQQHYSTPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTS |
| GGASVVCFLNNFYPRDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMS |
| STLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRGEC |
| (SEQ ID NO: 37) |
| GSASAPTLFPLVSCENSPSDTSSVAVGCLAQDFLPDSITFSWKYKNNSD |
| ISSTRGFPSVLRGGKYAATSQVLLPSKDVMQGTDEHVVCKVQHPNGNKE |
| KNVPLPVIAELPPKVSVFVPPRDGFFGNPRKSKLICQATGFSPRQIQVS |
| WLREGKQVGSGVTTDQVQAEAKESGPTTYKVTSTLTIKESDWLSQSMFT |
| CRVDHRGLTFQQNASSMCVPDQDTAIRVFAIPPSFASIFLTKSTKLTCL |
| VTDLTTYDSVTISWTRQNGEAVKTHTNISESHPNATFSAVGEASICEDD |
| WNSGERFTCTVTHTDLPSPLKQTISRPKGVALHRPDVYLLPPAREQLNL |
| RESATITCLVTGFSPADVFVQWMQRGQPLSPEKYVTSAPMPEPQAPGRY |
| FAHSILTVSEEEWNTGETYTCVVAHEALPNRVTERTVDKSTGKPTLYNV |
| SLVMSDTAGTCY |
| (SEQ ID NO: 38) |
| QVQLQQPGAELVKPGASVKLSCKASGYTFTRYWMYWVKQRPGRGLEWIG |
| RLDPNSGVTKYNEKFKSKATLTVDKSSSTAYMQLSSLTSEDSAVYYCVR |
| DDSWYFDVWGTGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVK |
| GYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQT |
| VTCNVAHPASSTKVDKKILPVIAELPPKVSVFVPPRDGFFGNPRKSKLI |
| CQATGFSPRQIQVSWLREGKQVGSGVTTDQVQAEAKESGPTTYKVTSTL |
| TIKESDWLSQSMFTCRVDHRGLTFQQNASSMCVPDQDTAIRVFAIPPSF |
| ASIFLTKSTKLTCLVTDLTTYDSVTISWTRQNGEAVKTHTNISESHPNA |
| TFSAVGEASICEDDWNSGERFTCTVTHTDLPSPLKQTISRPKGVALHRP |
| DVYLLPPAREQLNLRESATITCLVTGFSPADVFVQWMQRGQPLSPEKYV |
| TSAPMPEPQAPGRYFAHSILTVSEEEWNTGETYTCVVAHEALPNRVTER |
| TVDKSTGKPTLYNVSLVMSDTAGTCY |
| (SEQ ID NO: 39) |
| QVQLQQSGAELMKPGASVKLSCKAAGYTFTDYWIEWVKQRPGHGLEWIG |
| EILPGSGSTKDNERFKGKATFTADTSSNTAYMQLSSLTTEDSAIYYCAR |
| REWGYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLV |
| KGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQ |
| TVTCNVAHPASSTKVDKKILPVIAELPPKVSVFVPPRDGFFGNPRKSKL |
| ICQATGFSPRQIQVSWLREGKQVGSGVTTDQVQAEAKESGPTTYKVTST |
| LTIKESDWLSQSMFTCRVDHRGLTFQQNASSMCVPDQDTAIRVFAIPPS |
| FASIFLTKSTKLTCLVTDLTTYDSVTISWTRQNGEAVKTHTNISESHPN |
| ATFSAVGEASICEDDWNSGERFTCTVTHTDLPSPLKQTISRPKGVALHR |
| PDVYLLPPAREQLNLRESATITCLVTGFSPADVFVQWMQRGQPLSPEKY |
| VTSAPMPEPQAPGRYFAHSILTVSEEEWNTGETYTCVVAHEALPNRVTE |
| RTVDKSTGKPTLYNVSLVMSDTAGTCY. |
| >6G8_gamma1 |
| (SEQ ID NO: 86) |
| /translation = |
| MGWSCIMLFLAATATGVHSQVQLQQPGAELVKPGASVKLSCKASGYTFT |
| RYWMYWVKQRPGRGLEWIGRLDPNSGVTKYNEKFKSKATLTVDKSSSTA |
| YMQLSSLTSEDSAVYYCVRDDSWYFDVWGTGTTVTVSSAKTTPPSVYPL |
| APGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSD |
| LYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPRDCGCKPCIC |
| TVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDD |
| VEVHTAQTKPREEQINSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPA |
| PIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITNFFPEDITV |
| EWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVL |
| HEGLHNHHTEKSLSLSPGK. |
| >6G8_kappa |
| (SEQ ID NO: 34) |
| /translation = |
| MDMRAPAQFLGILLLWFPGARCEIQMTQSPSSMSASLGDRITITCQATQ |
| DIVKNLNWYQQKPGKPPSFLIYYATELAEGVPSRFSGSGSGSDYSLTIN |
| NLESQDFADYFCLQFYAFPLTFGAGTKLELRRADAAPTVSIFPPSSEQL |
| TSGGASVVCFLNNFYPRDINVKWKIDGSERQNGVLNSWTDQDSKDSTYS |
| MSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRGEC. |
| >hIgM_HC_pFUSE(S37768 Ig mu chain C region-human) |
| (SEQ ID NO: 37) |
| GSASAPTLFPLVSCENSPSDTSSVAVGCLAQDFLPDSITFSWKYKNNSD |
| ISSTRGFPSVLRGGKYAATSQVLLPSKDVMQGTDEHVVCKVQHPNGNKE |
| KNVPLPVIAELPPKVSVFVPPRDGFFGNPRKSKLICQATGFSPRQIQVS |
| WLREGKQVGSGVTTDQVQAEAKESGPTTYKVTSTLTIKESDWLSQSMFT |
| CRVDHRGLTFQQNASSMCVPDQDTAIRVFAIPPSFASIFLTKSTKLTCL |
| VTDLTTYDSVTISWTRQNGEAVKTHTNISESHPNATFSAVGEASICEDD |
| WNSGERFTCTVTHTDLPSPLKQTISRPKGVALHRPDVYLLPPAREQLNL |
| RESATITCLVTGFSPADVFVQWMQRGQPLSPEKYVTSAPMPEPQAPGRY |
| FAHSILTVSEEEWNTGETYTCVVAHEALPNRVTERTVDKSTGKPTLYNV |
| SLVMSDTAGTCY. |
IV. Gene Expression/Purification and Antibody Characterization
| TABLE 3 |
| Confirmatory ELISA and IgG quant data (40 clones) |
| Calc Conc. | ||||
| Sample ID | OD 405 | μg/ml | ||
| 1A3 | 3.520 | 58.7 | ||
| 1B10 | 3.380 | 26.3 | ||
| 1B5 | 3.605 | >120 | ||
| 1B9 | 3.481 | 72.9 | ||
| 1C4 | 3.438 | 37.9 | ||
| 1D11 | 3.432 | 59.8 | ||
| 1D12 | 3.377 | 39.4 | ||
| 1D7 | 3.233 | 48.1 | ||
| 1E1 | 3.473 | 26.4 | ||
| 2B5 | 3.297 | 17.1 | ||
| 2C10 | 3.209 | >120 | ||
| 3C2 | 3.398 | 33.1 | ||
| 4B3 | 3.160 | >120 | ||
| 4B9 | 3.445 | 45.9 | ||
| 4C1 | 3.242 | 28.9 | ||
| 4G9 | 3.341 | 17.6 | ||
| 4H12 | 3.353 | 78.7 | ||
| 4H3 | 3.155 | 28.7 | ||
| 4H6 | 3.151 | 36.6 | ||
| 5E11 | 3.422 | 23.4 | ||
| 5E4 | 3.315 | 17.4 | ||
| 5E6 | 3.146 | 35.9 | ||
| 5E9 | 3.155 | 38.1 | ||
| 5G6 | 3.141 | 45.2 | ||
| 5H3 | 3.378 | 20.5 | ||
| 5H5 | 3.259 | 26.8 | ||
| 6F11 | 3.448 | >120 | ||
| 6G1 | 3.273 | 14.9 | ||
| 6G2 | 3.174 | 33.8 | ||
| 6G8 | 3.165 | 17.4 | ||
| 7A10 | 3.147 | 47 | ||
| 7A7 | 3.305 | 16 | ||
| 7A8 | 3.278 | 35.9 | ||
| 7B8 | 3.154 | 46 | ||
| 7G7 | 3.400 | 79.2 | ||
| 8B4 | 3.187 | 32.2 | ||
| 8B8 | 3.386 | 82.6 | ||
| 8C10 | 3.243 | 27.9 | ||
| 8C11 | 3.146 | 40.4 | ||
| 8G10 | 3.188 | 29.9 | ||
| |
0.220 | 24.8 | ||
| Positive Control | ||||
| TABLE 4 |
| Octet Affinity Scouting with anti-mIgG Fc sensor and DbpA as analyte. |
| Loading | |||||||||
| Sample | Sample | Conc. | |||||||
| ID | Cycle | ID | (nM) | Response | kdis(1/s) | kon(1/Ms) | KD (M) | Full X{circumflex over ( )}2 | Full R{circumflex over ( )}2 |
| 8C10 | 1 | DpbA | 100 | 0.1523 | <1.0E−07 | 3.56E+05 | <1.0E−12 | 0.0182 | 0.9423 |
| 5H3 | 2 | DpbA | 100 | 0.1555 | 6.06E−04 | 1.04E+06 | 5.80E−10 | 0.0065 | 0.9557 |
| 5G6 | 3 | DpbA | 100 | 0.1239 | 1.85E−03 | 1.01E+06 | 1.84E−09 | 0.0236 | 0.8861 |
| 4G9 | 1 | DpbA | 100 | 0.1682 | 8.45E−04 | 1.29E+06 | 6.54E−10 | 0.0198 | 0.8927 |
| 1D11 | 2 | DpbA | 100 | 0.1567 | 1.40E−03 | 8.02E+05 | 1.75E−09 | 0.0094 | 0.9647 |
| 1B9 | 3 | DpbA | 100 | 0.1468 | 2.92E−03 | 7.86E+05 | 3.72E−09 | 0.0175 | 0.9644 |
| 1D7 | 1 | DpbA | 100 | 0.1508 | 1.82E−03 | 9.99E+05 | 1.82E−09 | 0.0187 | 0.9406 |
| 2B5 | 2 | DpbA | 100 | 0.1341 | <1.0E−07 | 1.12E+06 | <1.0E−12 | 0.0204 | 0.8376 |
| 4B9 | 3 | DpbA | 100 | 0.1291 | 3.12E−04 | 7.80E+05 | 4.00E−10 | 0.0051 | 0.9500 |
| 1B10 | 1 | DpbA | 100 | 0.1587 | 2.82E−03 | 9.52E+05 | 2.96E−09 | 0.0176 | 0.9661 |
| 1D12 | 2 | DpbA | 100 | 0.1604 | 7.72E−04 | 7.94E+05 | 9.73E−10 | 0.0078 | 0.9601 |
| 6G8 | 3 | DpbA | 100 | 0.1606 | 9.77E−04 | 1.00E+06 | 9.76E−10 | 0.0177 | 0.9178 |
| 5H5 | 1 | DpbA | 100 | 0.1436 | 9.48E−04 | 1.33E+06 | 7.12E−10 | 0.0218 | 0.8626 |
| 5.00E+06 | 2 | DpbA | 100 | 0.1469 | 5.65E−04 | 7.44E+05 | 7.59E−10 | 0.0083 | 0.9502 |
| msIgG | 3 | DpbA | 100 | 0.0328 | NA | NA | NA | NA | NA |
| TABLE 5 |
| Biacore Affinity Scouting by DbpA sensor chip |
| RU | Sample | IgG | |||||
| Clone ID | (120 s) | ID | μg/ml | RU/IgG | Ka (1/Ms) | kd(1/s) | KD (M) |
| 1A3 | 681 | 1A3 | 58.7 | 11.6 | quick off | ||
| 1B10 | 794 | 1B10 | 26.3 | 30.2 | 6.00E+04 | 6.00E−04 | 1.00E−08 |
| 1B5 | 670 | 1B5 | >120 | N/A | quick off | ||
| 1B9 | 720 | 1B9 | 72.9 | 9.9 | quick off | ||
| 1C4 | 359 | 1C4 | 37.9 | 9.5 | |||
| 1D11 | 782 | 1D11 | 59.8 | 13.1 | |||
| 1D12 | 778 | 1D12 | 39.4 | 19.7 | 6.00E+04 | 4.00E−07 | 6.00E−12 |
| 1D7 | 815 | 1D7 | 48.1 | 16.9 | 7.20E+04 | 6.00E−07 | 8.00E−13 |
| 1E1 | 463 | 1E1 | 26.4 | 17.5 | |||
| 2B5 | 782 | 2B5 | 17.1 | 45.7 | 1.40E+05 | 2.80E−08 | 2.00E−13 |
| 2C10 | 701 | 2C10 | >120 | N/A | quick off | ||
| 3C2 | 385 | 3C2 | 33.1 | 11.6 | |||
| 4B3 | 683 | 4B3 | >120 | N/A | quick off | ||
| 4B9 | 716 | 4B9 | 45.9 | 15.6 | |||
| 4C1 | 431 | 4C1 | 28.9 | 14.9 | |||
| 4G9 | 826 | 4G9 | 17.6 | 46.9 | 1.60E+05 | 8.00E−07 | 5.00E−12 |
| 4H12 | 462 | 4H12 | 78.7 | 5.9 | |||
| 4H3 | 428 | 4H3 | 28.7 | 14.9 | |||
| 4H6 | 188 | 4H6 | 36.6 | 5.1 | |||
| 5E11 | 310 | 5E11 | 23.4 | 13.2 | |||
| 5E4 | 225 | 5E4 | 17.4 | 12.9 | |||
| 5E6 | 776 | 5E6 | 35.9 | 21.6 | |||
| 5E9 | 290 | 5E9 | 38.1 | 7.6 | |||
| 5G6 | 752 | 5G6 | 45.2 | 16.6 | quick off | ||
| 5H3 | 790 | 5H3 | 20.5 | 38.6 | 1.40E+05 | 2.00E−08 | 1.50E−13 |
| 5H5 | 791 | 5H5 | 26.8 | 29.5 | 9.00E+04 | 9.00E−06 | 1.00E−10 |
| 6F11 | 422 | 6F11 | >120 | N/A | quick off | ||
| 6G1 | 528 | 6G1 | 14.9 | 35.4 | |||
| 6G2 | 151 | 6G2 | 33.8 | 4.5 | |||
| 6G8 | 938 | 6G8 | 17.4 | 53.9 | 2.00E+05 | 5.00E−08 | 2.50E−13 |
| 7A10 | 539 | 7A10 | 47 | 11.5 | quick off | ||
| 7A7 | 391 | 7A7 | 16 | 24.4 | |||
| 7A8 | 240 | 7A8 | 35.9 | 6.7 | |||
| 7B8 | 291 | 7B8 | 46 | 6.3 | |||
| 7G7 | 246 | 7G7 | 79.2 | 3.1 | |||
| 8B4 | 484 | 8B4 | 32.2 | 15.0 | |||
| 8B8 | 631 | 8B8 | 82.6 | 7.6 | quick off | ||
| 8C10 | 903 | 8C10 | 27.9 | 32.4 | 1.00E+05 | 1.30E−07 | 1.20E−12 |
| 8C11 | 549 | 8C11 | 40.4 | 13.6 | quick off | ||
| 8G10 | 624 | 8G10 | 29.9 | 20.9 | |||
| Control | 75 | Ms IgG | 24.8 | 3.0 | |||
| Media | 25 μg/ml | ||||||
| TABLE 6 |
| Summary of Octet and Biacore Affinity Scouting |
| Clone | ||||||||||
| Sample | Biacore | Biacore | Octet | DbpA | Octet | Octet | ||||
| ID | Rank | Resp. | KD (M) | Rank | (nM) | Resp. | kdis(1/s) | kon(1/Ms) | KD (M) | |
| | # | 2 | 903 | 1.20E−12 | #2 | 100 | 0.1523 | <1.0E−07 | 3.56E+05 | <1.0E−12 |
| | # | 5 | 790 | 1.50E−13 | #3 | 100 | 0.1555 | 6.06E−04 | 1.04E+06 | 5.80E−10 |
| | # | 3 | 826 | 5.00E−12 | #4 | 100 | 0.1682 | 8.45E−04 | 1.29E+06 | 6.54E−10 |
| | # | 7 | 778 | 6.00E−12 | #5 | 100 | 0.1604 | 7.72E−04 | 7.94E+05 | 9.73E−10 |
| | # | 1 | 938 | 2.50E−13 | #6 | 100 | 0.1606 | 9.77E−04 | 1.00E+06 | 9.76E−10 |
| TABLE 7 |
| Kinetics analysis of the BIACORE testing for 6G8 chimera: |
| ka (1/Ms) | kd (1/s) | Rmax (RU) | KD (M) | ||
| 1.25E+07 | 2.45E−05 | 2557.0 | 1.96E−12 | ||
| TABLE 8 | |||
| Sample | IgM Height/Cutoff | ||
| Negative Control | 0.2 | ||
| 6G8 (26394.1.a) | 5.6 | ||
| 6G8 (26394.1.b) | 5.0 | ||
Claims (9)
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16/546,113 US11548938B2 (en) | 2018-08-21 | 2019-08-20 | DbpA antibodies and uses thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201862720883P | 2018-08-21 | 2018-08-21 | |
| US16/546,113 US11548938B2 (en) | 2018-08-21 | 2019-08-20 | DbpA antibodies and uses thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| US20200062832A1 US20200062832A1 (en) | 2020-02-27 |
| US11548938B2 true US11548938B2 (en) | 2023-01-10 |
Family
ID=67874518
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/546,113 Active 2039-11-14 US11548938B2 (en) | 2018-08-21 | 2019-08-20 | DbpA antibodies and uses thereof |
Country Status (2)
| Country | Link |
|---|---|
| US (1) | US11548938B2 (en) |
| WO (1) | WO2020041360A1 (en) |
Families Citing this family (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN112218877B (en) | 2018-08-27 | 2025-07-25 | 瑞泽恩制药公司 | Use of raman spectroscopy in downstream purification |
| US20220244251A1 (en) * | 2019-05-29 | 2022-08-04 | Board Of Regents Of The Nevada System Of Higher Education On Behalf Of The University Of Nevada Reno | Targets and Methods of Diagnosing and Monitoring Lyme Disease |
| WO2021202592A2 (en) * | 2020-03-30 | 2021-10-07 | Oregon Health & Science University | Monoclonal antibodies for intracellular delivery of payloads |
| MX2023015461A (en) * | 2021-06-17 | 2024-01-18 | Fapon Biotech Inc | CHIMERIC IMMUNOGLOBULIN. |
| JP2025506122A (en) * | 2022-02-10 | 2025-03-07 | アムジエン・インコーポレーテツド | Antibody protein product expression constructs for high-throughput sequencing |
| WO2023192829A2 (en) * | 2022-03-28 | 2023-10-05 | University Of Florida Research Foundation, Incorporated | Alpha-1 antitrypsin z- and m-specific binding proteins |
| EP4611810A1 (en) * | 2022-11-03 | 2025-09-10 | Baylor College of Medicine | Anti-zp4 antibodies and chimeric antigen receptors and methods of use thereof |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6214355B1 (en) | 1995-04-24 | 2001-04-10 | Texas A & M University System | DbpA compositions |
| US6517838B1 (en) | 2000-06-16 | 2003-02-11 | The Texas A&M University System | Decorin binding protein essential peptides and methods of use |
| US20140274925A1 (en) | 2013-03-13 | 2014-09-18 | Pharmasan Labs, Inc. | Compositions and Methods for Diagnosing, Treating and Monitoring Lyme Disease |
| WO2018017998A1 (en) | 2016-07-22 | 2018-01-25 | The Research Foundation For The State University Of New York | Recombinant borrelia proteins and methods of use thereof |
Family Cites Families (65)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| NL154600B (en) | 1971-02-10 | 1977-09-15 | Organon Nv | METHOD FOR THE DETERMINATION AND DETERMINATION OF SPECIFIC BINDING PROTEINS AND THEIR CORRESPONDING BINDABLE SUBSTANCES. |
| US3949064A (en) | 1973-10-26 | 1976-04-06 | Baxter Laboratories, Inc. | Method of detecting antigens or antibodies |
| US4174384A (en) | 1975-06-30 | 1979-11-13 | Syva Company | Fluorescence quenching with immunological pairs in immunoassays |
| US4399216A (en) | 1980-02-25 | 1983-08-16 | The Trustees Of Columbia University | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4634665A (en) | 1980-02-25 | 1987-01-06 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US5179017A (en) | 1980-02-25 | 1993-01-12 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4554101A (en) | 1981-01-09 | 1985-11-19 | New York Blood Center, Inc. | Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity |
| US4656134A (en) | 1982-01-11 | 1987-04-07 | Board Of Trustees Of Leland Stanford Jr. University | Gene amplification in eukaryotic cells |
| US5149636A (en) | 1982-03-15 | 1992-09-22 | Trustees Of Columbia University In The City Of New York | Method for introducing cloned, amplifiable genes into eucaryotic cells and for producing proteinaceous products |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US5168062A (en) | 1985-01-30 | 1992-12-01 | University Of Iowa Research Foundation | Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter-regulatory DNA sequence |
| US4683202A (en) | 1985-03-28 | 1987-07-28 | Cetus Corporation | Process for amplifying nucleic acid sequences |
| DE3588239T3 (en) | 1985-03-30 | 2007-03-08 | Kauffman, Stuart A., Santa Fe | A method for obtaining DNA, RNA, peptides, polypeptides or proteins by DMS recombinant methods |
| US4737456A (en) | 1985-05-09 | 1988-04-12 | Syntex (U.S.A.) Inc. | Reducing interference in ligand-receptor binding assays |
| US5618920A (en) | 1985-11-01 | 1997-04-08 | Xoma Corporation | Modular assembly of antibody genes, antibodies prepared thereby and use |
| US5576195A (en) | 1985-11-01 | 1996-11-19 | Xoma Corporation | Vectors with pectate lyase signal sequence |
| GB8601597D0 (en) | 1986-01-23 | 1986-02-26 | Wilson R H | Nucleotide sequences |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| US5260203A (en) | 1986-09-02 | 1993-11-09 | Enzon, Inc. | Single polypeptide chain binding molecules |
| US4704692A (en) | 1986-09-02 | 1987-11-03 | Ladner Robert C | Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides |
| US5763192A (en) | 1986-11-20 | 1998-06-09 | Ixsys, Incorporated | Process for obtaining DNA, RNA, peptides, polypeptides, or protein, by recombinant DNA technique |
| EP0832981A1 (en) | 1987-02-17 | 1998-04-01 | Pharming B.V. | DNA sequences to target proteins to the mammary gland for efficient secretion |
| US4873316A (en) | 1987-06-23 | 1989-10-10 | Biogen, Inc. | Isolation of exogenous recombinant proteins from the milk of transgenic mammals |
| US4939666A (en) | 1987-09-02 | 1990-07-03 | Genex Corporation | Incremental macromolecule construction methods |
| US4956288A (en) | 1988-04-22 | 1990-09-11 | Biogen, Inc. | Method for producing cells containing stably integrated foreign DNA at a high copy number, the cells produced by this method, and the use of these cells to produce the polypeptides coded for by the foreign DNA |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| FI903489A0 (en) | 1988-11-11 | 1990-07-10 | Medical Res Council | LIGANDER MED EN ENDA SEKTION, RECEPTORER INNEHAOLLANDE NAEMNDA LIGANDER, FOERFARANDEN FOER DERAS FRAMSTAELLNING SAMT ANVAENDNING AV LIGANDERNA OCH RECEPTORERNA. |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5266491A (en) | 1989-03-14 | 1993-11-30 | Mochida Pharmaceutical Co., Ltd. | DNA fragment and expression plasmid containing the DNA fragment |
| US6713610B1 (en) | 1990-01-12 | 2004-03-30 | Raju Kucherlapati | Human antibodies derived from immunized xenomice |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5965695A (en) | 1990-05-15 | 1999-10-12 | Chiron Corporation | Modified peptide and peptide libraries with protease resistance, derivatives thereof and methods of producing and screening such |
| GB9015198D0 (en) | 1990-07-10 | 1990-08-29 | Brien Caroline J O | Binding substance |
| WO1992002551A1 (en) | 1990-08-02 | 1992-02-20 | B.R. Centre Limited | Methods for the production of proteins with a desired function |
| ES2108048T3 (en) | 1990-08-29 | 1997-12-16 | Genpharm Int | PRODUCTION AND USE OF LOWER TRANSGENIC ANIMALS CAPABLE OF PRODUCING HETEROLOGICAL ANTIBODIES. |
| US6300129B1 (en) | 1990-08-29 | 2001-10-09 | Genpharm International | Transgenic non-human animals for producing heterologous antibodies |
| DE69129154T2 (en) | 1990-12-03 | 1998-08-20 | Genentech, Inc., South San Francisco, Calif. | METHOD FOR ENRICHING PROTEIN VARIANTS WITH CHANGED BINDING PROPERTIES |
| US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
| FI941572L (en) | 1991-10-07 | 1994-05-27 | Oncologix Inc | Combination and method of use of anti-erbB-2 monoclonal antibodies |
| ATE463573T1 (en) | 1991-12-02 | 2010-04-15 | Medimmune Ltd | PRODUCTION OF AUTOANTIBODIES ON PHAGE SURFACES BASED ON ANTIBODIES SEGMENT LIBRARIES |
| EP1291360A1 (en) | 1991-12-13 | 2003-03-12 | Xoma Corporation | Methods and materials for preparation of modified antibody variable domains and therapeutic uses thereof |
| EP0746609A4 (en) | 1991-12-17 | 1997-12-17 | Genpharm Int | Transgenic non-human animals capable of producing heterologous antibodies |
| DE69333807T2 (en) | 1992-02-06 | 2006-02-02 | Chiron Corp., Emeryville | MARKERS FOR CANCER AND BIOSYNTHETIC BINDEPROTEIN THEREFOR |
| AU5670194A (en) | 1992-11-20 | 1994-06-22 | Enzon, Inc. | Linker for linked fusion polypeptides |
| WO1994018219A1 (en) | 1993-02-02 | 1994-08-18 | The Scripps Research Institute | Methods for producing antibody libraries using universal or randomized immunoglobulin light chains |
| GB9313509D0 (en) | 1993-06-30 | 1993-08-11 | Medical Res Council | Chemisynthetic libraries |
| US5827690A (en) | 1993-12-20 | 1998-10-27 | Genzyme Transgenics Corporatiion | Transgenic production of antibodies in milk |
| US5763733A (en) | 1994-10-13 | 1998-06-09 | Enzon, Inc. | Antigen-binding fusion proteins |
| US5656730A (en) | 1995-04-07 | 1997-08-12 | Enzon, Inc. | Stabilized monomeric protein compositions |
| GB9517780D0 (en) | 1995-08-31 | 1995-11-01 | Roslin Inst Edinburgh | Biological manipulation |
| US5714352A (en) | 1996-03-20 | 1998-02-03 | Xenotech Incorporated | Directed switch-mediated DNA recombination |
| GB9712818D0 (en) | 1996-07-08 | 1997-08-20 | Cambridge Antibody Tech | Labelling and selection of specific binding molecules |
| AUPO761497A0 (en) | 1997-06-27 | 1997-07-24 | University Of Sydney, The | Narrow transmission bandpass filters utilising bragg grating assisted mode conversion |
| DK1015576T3 (en) | 1997-09-16 | 2005-08-29 | Egea Biosciences Llc | Method for complete chemical synthesis and aggregation of genes and genomes |
| US6670127B2 (en) | 1997-09-16 | 2003-12-30 | Egea Biosciences, Inc. | Method for assembly of a polynucleotide encoding a target polypeptide |
| US6207392B1 (en) | 1997-11-25 | 2001-03-27 | The Regents Of The University Of California | Semiconductor nanocrystal probes for biological applications and process for making and using such probes |
| US5942609A (en) | 1998-11-12 | 1999-08-24 | The Porkin-Elmer Corporation | Ligation assembly and detection of polynucleotides on solid-support |
| DE50015858D1 (en) | 1999-02-19 | 2010-03-18 | Febit Holding Gmbh | Process for the preparation of polymers |
| WO2001060837A2 (en) | 2000-02-16 | 2001-08-23 | Northwestern University | Polypeptoid pulmonary surfactants |
| JP3523245B1 (en) | 2000-11-30 | 2004-04-26 | メダレックス,インコーポレーテッド | Transgenic chromosome-introduced rodents for the production of human antibodies |
| US8293233B2 (en) | 2005-03-25 | 2012-10-23 | National Research Council Of Canada | Method for isolation of soluble polypeptides |
| WO2007045465A1 (en) | 2005-10-21 | 2007-04-26 | F. Hoffmann-La Roche Ag | Method for the recombinant expression of a polypeptide |
| WO2009079793A1 (en) | 2007-12-21 | 2009-07-02 | National Research Council Of Canada | Non-aggregating human vh domains |
| ES2746559T3 (en) | 2011-01-28 | 2020-03-06 | Nat Res Council Canada | Genetic modification of immunoglobulin domains |
-
2019
- 2019-08-20 WO PCT/US2019/047328 patent/WO2020041360A1/en not_active Ceased
- 2019-08-20 US US16/546,113 patent/US11548938B2/en active Active
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6214355B1 (en) | 1995-04-24 | 2001-04-10 | Texas A & M University System | DbpA compositions |
| US6517838B1 (en) | 2000-06-16 | 2003-02-11 | The Texas A&M University System | Decorin binding protein essential peptides and methods of use |
| US20140274925A1 (en) | 2013-03-13 | 2014-09-18 | Pharmasan Labs, Inc. | Compositions and Methods for Diagnosing, Treating and Monitoring Lyme Disease |
| WO2018017998A1 (en) | 2016-07-22 | 2018-01-25 | The Research Foundation For The State University Of New York | Recombinant borrelia proteins and methods of use thereof |
Non-Patent Citations (13)
| Title |
|---|
| Caldas et al. (Mol. Immunol. May 2003; 39 (15): 941-952). * |
| Casadevall et al. (PNAS, vol. 109 No. 31, p. 12272-12273). * |
| Chien et al. (Proc. Natl. Acad. Sci. USA. Jul. 1989; 86 (14): 5532-5536). * |
| Giusti et al. (Proc. Natl. Acad. Sci. USA. May 1987; 84 (9): 2926-2930). * |
| Greenspan et al. (Nature Biotechnology 7: 936-937, 1999). * |
| Hagman et al., "Decorin-binding protein A (DbpA) of Borrelia burgdorferi is not protective when immunized mice are challenged via tick infestation and correlates with the lack of DbpA expression by B. burgdorferi in ticks", Infection and Immunity, vol. 68, No. 8, pp. 4759-4764 (2000). |
| Hanson et al., "Active and passive immunity against Borrelia burgdorferi decorin binding protein A (DbpA) protects against infection", Infection and Immunity, vol. 66, No. 5, pp. 2143-2153 (1998). |
| Intenational Search Report from International Application No. PCT/US2019/047328, 8 pages, dated Jan. 16, 2020. |
| Schuijt et al., "Lyme borreliosis vaccination: the facts, the challenge, the future", Trends in Parasitology, vol. 27, No. 1, pp. 40-47 (2011). |
| Schulte-Spechtel et al., "Molecular analysis of decorin-binding protein A (DbpA) reveals five major groups among European Borrelia burgdorferi sensu lato strains with impact for the development of serological assays and indicates lateral gene transfer of the dbpA gene", Int. J. Med. Microbiol., vol. 296, Suppl. 40, pp. 250-266 (2006). |
| Sela-Culang et al. (Frontiers in Immunology, 2013 vol. 4, article 302, pp. 1-13). * |
| Skolnick et al. (Trends in Biotechnology 18: 34-39, 2000). * |
| Winkler et al (J. Imm., 265:4505-4514, 2000). * |
Also Published As
| Publication number | Publication date |
|---|---|
| US20200062832A1 (en) | 2020-02-27 |
| WO2020041360A8 (en) | 2020-09-10 |
| WO2020041360A1 (en) | 2020-02-27 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11548938B2 (en) | DbpA antibodies and uses thereof | |
| KR102706743B1 (en) | Antibodies that specifically bind to human il-15 and uses thereof | |
| JP7627255B2 (en) | ANTIBODY COMPOSITIONS FOR DISRUPTION OF BIOFILM - Patent application | |
| US9527905B2 (en) | Antibodies that specifically bind Staphylococcus aureus alpha toxin and methods of use | |
| JP2021035394A (en) | Peptides and antibodies for removing biofilms | |
| KR20220140568A (en) | Human monoclonal antibody against severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) | |
| EA028433B1 (en) | ANTIBODY CONNECTING WITH VIRUSES OF INFLUENZA B AND ITS APPLICATION | |
| JP6251730B2 (en) | Compositions and methods related to antibodies that neutralize coagulase activity during STAPHYLOCOCUSAUREUS disease | |
| US20210188971A1 (en) | Monoclonal antibody fusions | |
| JP7411264B2 (en) | Novel anti-PAD2 antibody | |
| CN119176871A (en) | Antibodies against staphylococcus aureus clotting factor a (CLFA) | |
| KR20200142010A (en) | Peptide vaccine against interleukin-31 | |
| US20120282274A1 (en) | Targeting of the c-terminal segment of c.difficile toxin b for improved clinical diagnosis, prevention, and treatment | |
| JPWO2019131769A1 (en) | New anti-PAD4 antibody | |
| KR20230092978A (en) | Antibodies to canine and feline oncostatin M receptor beta and uses thereof | |
| US20230406911A1 (en) | Compositions and methods for preventing, inhibiting, disrupting, or treating a polymicrobial biofilm | |
| RU2851685C2 (en) | Compositions of antibodies for destruction of biofilms | |
| JPWO2011115231A1 (en) | Osteopontin-specific monoclonal antibody | |
| BR122024020794A2 (en) | ANTIBODIES THAT SPECIFICALLY BIND TO HUMAN IL-15 AND THEIR USES, COMPOSITION, IN VITRO METHOD FOR DETECTING IL-15 OR A COMPLEX OF IL-15 AND IL-15 RECEPTOR-ALPHA, POLYNUCLEOTIDE, VECTOR AND METHOD FOR PRODUCTION OF SAID ANTIBODY |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| FEPP | Fee payment procedure |
Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY |
|
| AS | Assignment |
Owner name: QUIDEL CORPORATION, CALIFORNIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:SUN, JASON J.;MCCLURE, JASON;REEL/FRAME:050490/0679 Effective date: 20190911 |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
| AS | Assignment |
Owner name: BANK OF AMERICA, N.A., NORTH CAROLINA Free format text: SECURITY AGREEMENT;ASSIGNORS:QUIDEL CORPORATION;BIOHELIX CORPORATION;DIAGNOSTIC HYBRIDS, INC.;AND OTHERS;REEL/FRAME:060220/0711 Effective date: 20220527 |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE AFTER FINAL ACTION FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE AFTER FINAL ACTION FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT VERIFIED |
|
| STCF | Information on status: patent grant |
Free format text: PATENTED CASE |
|
| AS | Assignment |
Owner name: ORTHO-CLINICAL DIAGNOSTICS, INC., NEW JERSEY Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:QUIDEL CORPORATION;REEL/FRAME:068657/0827 Effective date: 20240812 |
|
| AS | Assignment |
Owner name: BANK OF AMERICA, N.A., AS ADMINISTRATIVE AGENT, NORTH CAROLINA Free format text: SECURITY AGREEMENT;ASSIGNORS:CRIMSON INTERNATIONAL ASSETS LLC;MICRO TYPING SYSTEMS, INC.;ORTHO-CLINICAL DIAGNOSTICS, INC.;AND OTHERS;REEL/FRAME:072526/0643 Effective date: 20250821 Owner name: QUIDEL CORPORATION, CALIFORNIA Free format text: FREE FORM MESSAGE RELEASE (REEL 060220 / FRAME 0711);ASSIGNOR:BANK OF AMERICA, N.A.;REEL/FRAME:072577/0536 Effective date: 20250821 Owner name: BIOHELIX CORPORATION, MASSACHUSETTS Free format text: FREE FORM MESSAGE RELEASE (REEL 060220 / FRAME 0711);ASSIGNOR:BANK OF AMERICA, N.A.;REEL/FRAME:072577/0536 Effective date: 20250821 Owner name: DIAGNOSTIC HYBRIDS, INC., OHIO Free format text: FREE FORM MESSAGE RELEASE (REEL 060220 / FRAME 0711);ASSIGNOR:BANK OF AMERICA, N.A.;REEL/FRAME:072577/0536 Effective date: 20250821 Owner name: QUIDEL CARDIOVASCULAR INC., CALIFORNIA Free format text: FREE FORM MESSAGE RELEASE (REEL 060220 / FRAME 0711);ASSIGNOR:BANK OF AMERICA, N.A.;REEL/FRAME:072577/0536 Effective date: 20250821 Owner name: ORTHO-CLINICAL DIAGNOSTICS, INC., NEW JERSEY Free format text: FREE FORM MESSAGE RELEASE (REEL 060220 / FRAME 0711);ASSIGNOR:BANK OF AMERICA, N.A.;REEL/FRAME:072577/0536 Effective date: 20250821 Owner name: CRIMSON U.S. ASSETS LLC, NEW JERSEY Free format text: FREE FORM MESSAGE RELEASE (REEL 060220 / FRAME 0711);ASSIGNOR:BANK OF AMERICA, N.A.;REEL/FRAME:072577/0536 Effective date: 20250821 Owner name: CRIMSON INTERNATIONAL ASSETS LLC, NEW JERSEY Free format text: FREE FORM MESSAGE RELEASE (REEL 060220 / FRAME 0711);ASSIGNOR:BANK OF AMERICA, N.A.;REEL/FRAME:072577/0536 Effective date: 20250821 Owner name: MICRO TYPING SYSTEMS, INC., FLORIDA Free format text: FREE FORM MESSAGE RELEASE (REEL 060220 / FRAME 0711);ASSIGNOR:BANK OF AMERICA, N.A.;REEL/FRAME:072577/0536 Effective date: 20250821 Owner name: QUIDEL CORPORATION, CALIFORNIA Free format text: RELEASE (REEL 060220 / FRAME 0711);ASSIGNOR:BANK OF AMERICA, N.A.;REEL/FRAME:072577/0536 Effective date: 20250821 Owner name: BIOHELIX CORPORATION, MASSACHUSETTS Free format text: RELEASE (REEL 060220 / FRAME 0711);ASSIGNOR:BANK OF AMERICA, N.A.;REEL/FRAME:072577/0536 Effective date: 20250821 Owner name: DIAGNOSTIC HYBRIDS, INC., OHIO Free format text: RELEASE (REEL 060220 / FRAME 0711);ASSIGNOR:BANK OF AMERICA, N.A.;REEL/FRAME:072577/0536 Effective date: 20250821 Owner name: QUIDEL CARDIOVASCULAR INC., CALIFORNIA Free format text: RELEASE (REEL 060220 / FRAME 0711);ASSIGNOR:BANK OF AMERICA, N.A.;REEL/FRAME:072577/0536 Effective date: 20250821 Owner name: ORTHO-CLINICAL DIAGNOSTICS, INC., NEW JERSEY Free format text: RELEASE (REEL 060220 / FRAME 0711);ASSIGNOR:BANK OF AMERICA, N.A.;REEL/FRAME:072577/0536 Effective date: 20250821 Owner name: CRIMSON U.S. ASSETS LLC, NEW JERSEY Free format text: RELEASE (REEL 060220 / FRAME 0711);ASSIGNOR:BANK OF AMERICA, N.A.;REEL/FRAME:072577/0536 Effective date: 20250821 Owner name: CRIMSON INTERNATIONAL ASSETS LLC, NEW JERSEY Free format text: RELEASE (REEL 060220 / FRAME 0711);ASSIGNOR:BANK OF AMERICA, N.A.;REEL/FRAME:072577/0536 Effective date: 20250821 Owner name: MICRO TYPING SYSTEMS, INC., FLORIDA Free format text: RELEASE (REEL 060220 / FRAME 0711);ASSIGNOR:BANK OF AMERICA, N.A.;REEL/FRAME:072577/0536 Effective date: 20250821 |