TH71484A - Recombinant, antibody, and known N glycolicyl, GM3, ganglioside and their use in tumor diagnosis and therapy. - Google Patents

Abstract

DC60 (19/07/47) This invention is mainly related to the known monoclonal antibodies, N-glycyl-colyl GM3 antigens, and not other gangliosides of the genus. N-glycolyl or N-acetyl or sulfate-bound glycolipids More specifically This invention is related to the peptide sequence that Identify recombinant monoclonal antibodies derived from 14F7, known N-Glycolyl GM3 antibodies, garglioside, or their derivatives, and available aliment mixtures. Recombinant such antibodies or their parts and their use in diagnosis or treatment. Breast cancer and melanoma The invention is mainly related to known monoclonal antibodies, antigens containing N-glycyl, GM3, ganglioside and not other gangliozides of the genus. N-glycolyl or N-acetyl or sulfate-bound glycolipids More specifically This invention relates to the peptide sequence that Identify recombinant monoclonal antibodies derived from 14F7, known N-Glycolyl GM3 antibodies, garglioside, or their derivatives, and available aliment mixtures. Recombinant such antibodies or their parts and their use in diagnosis or treatment. Breast cancer and melanoma drug patents

Claims (6)

Disclaimer (all) which will not appear on the advertisement page: Edit 17/01/2020 No disclaimer. ------------------------- Edit 10/09/2019 Page 1 of Number 6 Claims 1. Recombinant Antibody A derivative of 14F7 monoclonal antibodies of mice produced. The hybrid comes with the ECACC deposit number 98101901 characterized by the order of Hyper variable regions (CDRs) along with the sequence of frame regions (FRs) of heavy and light chains are Shown below; Heavy chain CDR1: SYWIH CDR2: YIDPATAYTESNQKFKD CDR3: ESPRLRRGIYYYAMDY FR1: QVQLQQSGNELAKPGASMKMSCRASGYSFT FR2: WLKQRPDQGLEWIG FR3: KAILTADRSSNTAFMYLNSLTSEDSAVYYCAR FR4: WGQGTTVTVSS chain light CDR1: RASQSISNNLH CDR2: YASQSIS CDR3: QQSNRWPLT FR1: DLVLTQSPATLSVTPGDSVSFSC FR2: WYQQRTHESPRLLIK FR3: GIPSRFSGSGSGTDFTLSIISVETEDFGMYFC FR4: FGAGTKLELKRA and in which areas. The work frame of heavy and light chains includes one of the following mutations: Heavy chain, Position 5: Q by V, Position 9: N by A, Position 11: L by V, Position 12: A by V, Position 18: M by V position 19: K by R position 20: M by V ----------------------------------- -------------------------------------------------- --------------- Revised 25/09/2018 Disclaimer 1. Recombinant Antibody Derivative from 14F7 Monoclonal Antibody of Rats Produced. The hybrid comes with the ECACC deposit number 98101901 characterized by the order of Hyper variable regions (CDRs) along with the sequence of frame regions (FRs) of heavy and light chains are Shown below; Heavy chain CDR1: SYWIH CDR2: YIDPATAYTESNQKFKD CDR3: ESPRLRRGIYYYAMDY FR1: QVQLQQSGNELAKPGASMKMSCRASGYSFT FR2: WLKQRPDQGLEWIG FR3: KAILTADRSSNTAFMYLNSLTSEDSAVYYCAR FR4: WGQGTTVTVSS chain light CDR1: RASQSISNNLH CDR2: YASQSIS CDR3: QQSNRWPLT FR1: DLVLTQSPATLSVTPGDSVSFSC FR2: WYQQRTHESPRLLIK FR3: GIPSRFSGSGSGTDFTLSIISVETEDFGMYFC FR4: FGAGTKLELKRA and in which areas. The heavy and light chain framework consists of one of the following mutations: Heavy chain Position 5: Q by V Position 9: N by A Position 11: L by V Position 12: A by V position 18: M by V position 19: K by R position 20: M by V ---------- 1. Recombinant antibody derivative from 14F7 monoclonal antibody. Of rats produced by hybrid-doma with cumulative number ECACC 98101901 that are characterized by the following sequence of The hyper variable area (CDRs) of the heavy and light chain m is shown below the heavy chain CDR1: SYWIH CDR2: YIDPATAYTESNQKFKD CDR3: ESPRLRRGIYYYAMDY, light chain CDR1: RASQSISNNLH CDR2: YASQSIS CDR3: QQSNRWPLT. Specifically, it is a chimeric variant of 14F7 antibody with CDRs and framing regions (FRs) of the 14F7 heavy and light chain such antibodies and the fixed region of human lgG1 heavy chain and the fixed region of the Ck light chain. of the following sequences of the framework (FRs) of the heavy chain and light chain heavy FR1: QVQLQQSGNELAKPGASMKMSCRASGYSFT FR2: WLKQRPDQGLEWIG FR3: KAILTADRSSNTAFMYLNSLTSEDSAVYYCAR FR4: WGQGTTVTVSS chain light FR1: DLVLTQSPATLSVTPGDSVSFSC FR2: WYQQRTHESPRLLIK FR3: GIPSRFSGSGSGTDFTLSIISVETEDFGMYFC FR4: FGAGTKLELKRA 3. antibodies. According to Clause 1 and 2, any one that defines a particular character, where it is a variable The humaneization of 14F7 monoclonal antibodies with point shift in the framing regions (FRs) of the heavy and light chains to reduce their immunization. 4. Antibodies according to claim 3 characteristic. It is a humaneized variant of 14F7 Monoclonal Antibody, whose heavy and light chain frameworks are mutated. One of the following heavy chains, Position 5: Q with V, position 9: N with A, position 11: L with V, position 12: A with V, position 18: M with V, position 19: K with R. Position 20: M with V, position 38: K with R, position 40: R with A, position 42: D with G, light chain, position 39: R with K, position 40: T with P, position 41: H too. G position 42: E with Q. 5. Fv single-chain derivative of 14F7 hybridoma monoclonal antibody with cumulative number ECACC 98101901 characterized by region sequencing. It was able to vary the heavy chain of 14F7 monoclonal antibodies of mice and the regions that could be altered. Diversion of the antibody light chain of mice 6. Part Fv. Single-chain according to claim 5, which characterizes due to the mutable region. The conjugation of the light chain is 14F7, the antibody itself. 7. Part Fv, the single chain according to claim 6, specifies the characteristics due to the order of the regions. The higher variability (CDRs) of the heavy and light chain is one of the ones shown below. Article 7 rights are characterized by the presence of CDRs and framing regions (FRs) of the 14F7 heavy and light chains. The sequences of the framework (FRs) of the heavy chain and light is the heavy chain FR1: QVQLQQSGNELAKPGASMKMSCRASGYSFT FR2: WLKQRPDQGLEWIG FR3: KAILTADRSSNTAFMYLNSLTSEDSAVYYCAR FR4: WGQGTTVTVSS chain light FR1: DLVLTQSPATLSVTPGDSVSFSC FR2: WYQQRTHESPRLLIK FR3: GIPSRFSGSGSGTDFTLSIISVETEDFGMYFC FR4: FGAGTKLELKRA 9. The Fv. The single chain according to claim 8, which contains the heavy and light chain framed area mutation points (FRs) to reduce its immunity, 1 0. Single-chain Fv according to claim 9, where the framework area. Of its heavy and light chains. Any of the following mutants, heavy chain, Position 5: Q with V, position 9: N with A, position 11: L with V, position 12: A with V, position 18: M with V, position 19: K too. R position 20: M with V position 38: K with R position 40: R with A position 42: D with G light chain 39th position: R with K position 40: T with P position 41: H With G position 42: E with Q. 1 1. Part Fv, single-chain derivative of 14F7 monoclonal antibody produced by hybridoma with cumulative ECACC number 98101901 according to claim 5 characteristic. Only by sequence Of the heavy chain variation region of the rat 14F7 monoclonal antibody and the region It is possible to vary the light-chain, whose sequence is as follows: Fr1 DIVMFQSPASLAVSLGRATIS C CDR1 ARSQSVSSSSYSYMH Fr2 WYQQKPGQPPKLLIK CDR2 YASNLES Fr3 GVPARFSGSGSGTDFTLNIHP VEEEDAATYYC CDR3 QHSRLE VEEEDAATYYC CDR3 QHSRLE 1. Ridoma with the cumulative number ECACC 98101901 according to claim 5 that is characterized by sequence. Of the heavy chain variation region of the rat 14F7 monoclonal antibody and the region It is possible to vary the light chain, whose order is as follows: Fr1 DIQMTQTPSSLSASLGDRVTI SC CDR1 RASQDISNYLN Fr2 WYQQKPGAGQPPKLLIV CDR2 YTSRLHS Fr3 GVPSRFSGSGSGSGTDYSLTISN LEQEDIATYFC CDR3 QQGNTLPPT CDR3 F7 QQGNTLPPT CDR3 QQGNTLPPT 14. Ridoma with cumulative ECACC number 98101901 that is characterized by region sequencing. It was able to vary the heavy chain of 14F7 monoclonal antibodies of mice and their regions. Align the human antibody light chain 1 4. Part Fv. Single chain according to claim 13, characterized by the presence of the region of the human antibody. It was able to vary the heavy chain of 14F7 monoclonal antibodies of mice and their regions. Variable chain light, which sequence is the following: Fr1 D I Q M T Q T P S S L S A S L G D R V T I S C CDR1 R A S Q S I S S F L N Fr2 W Y Q Q K P G K A P K L L I Y CDR2 A A S N L Q S Fr3 G V P S R F S G R G S G T D F T L T I S S L Q P E D F A A Y Y C Fr4 G Q G T K L E L K 1 5. The Fv single chain according to claim 13, characterized only by a number of grounds. It was able to vary the heavy chain of 14F7 monoclonal antibodies of mice and their regions. Light-chain variant, whose sequence is as follows: Fr1 QSVVTQPPSASGGPGQSLTIS C CDR1 TGTSSDVGGYNGVS Fr2 WYQQHPGKAPKLMIY CDR2 DVSKRPS Fr3 GVPHRFSGSKSGNTASLTVSG LQAEDEAVYN, section 13, FTVSG, FTVSG, FTVSG, Fr2, WYQQHPGKAPKLMIY CDR2. Area It was able to vary the heavy chain of 14F7 monoclonal antibodies of mice and their regions. Variation of the light chain, in which its sequence is as follows: Fr1 SSELTQDPAVSVALGQTVRIT C CDR1 QGDSLRSYYAS Fr2 WYQQKPGQAPVLVIY CDR2 GKNNRPS Fr3 GIPDRFSGSSSGNTASLTITG AQAEDEADYVGC CDR4 GIPDRFSGSSSGNTASLTITG AQAEDEADYVG, CDR4 NSRDSGGNHGNNTGTVG, CDR3 NSRDSGNH. Clause 1 to 4 of any of Clause 1 to 4 1. 8. Cell line characterized by expression Fv. Single chain of Clause 5 to 16 of Clause 1 9. Mixing mix for therapy. Tumor has a force that defines a particular characteristic by Contains recombinant antibody of any one of Claims 1 to 4 2 0. Mixing agent for the treatment of tumors with a specific force. Contains the section Fv. Any single chain of claims 5 through 16. And supplementary drugs from Suitable exterior 2 1. Use of the drug mixture of claim 19 for the treatment of malignant breast tumors. And melanoma and its diffusion and recurrence 2 2. Use of the drug mixtures of claim 20 for the treatment of malignant breast tumors. And melanoma and its diffusion and recurrence 2 3. Positioning Substances "Inside the body" and the identification of malignant tumors that are defined. Characteristic by containing recombinant antibody of any claim 1 to 4 and appropriate marker 2. 4. Substances according to claim 23 defining characteristics for which are used for determining positions. "Inside the body" and identification of malignant breast tumors and melanoma and metastasis and Its recurrence 2 5. Substances for positioning "Inside the body" and the identification of malignant tumors that are defined. Characterized by a single-chain Fv part of any Clause 5 to 16. And a suitable marker 2 6. Substances according to claim 25 specifying the characteristics for which are used for determination of position. "Inside the body" and identification of malignant breast tumors and melanoma and metastasis and Its recurrence