SE437997B - NON-WATERLY BOTTOM BLACK COMPOSITION WITH HIGH TORQUE CONTENT - Google Patents
NON-WATERLY BOTTOM BLACK COMPOSITION WITH HIGH TORQUE CONTENTInfo
- Publication number
- SE437997B SE437997B SE7803316A SE7803316A SE437997B SE 437997 B SE437997 B SE 437997B SE 7803316 A SE7803316 A SE 7803316A SE 7803316 A SE7803316 A SE 7803316A SE 437997 B SE437997 B SE 437997B
- Authority
- SE
- Sweden
- Prior art keywords
- ink
- resins
- rosin
- composition according
- acid
- Prior art date
Links
- 239000000203 mixture Substances 0.000 title claims description 28
- 229920005989 resin Polymers 0.000 claims description 49
- 239000011347 resin Substances 0.000 claims description 49
- 239000002904 solvent Substances 0.000 claims description 31
- RSWGJHLUYNHPMX-UHFFFAOYSA-N Abietic-Saeure Natural products C12CCC(C(C)C)=CC2=CCC2C1(C)CCCC2(C)C(O)=O RSWGJHLUYNHPMX-UHFFFAOYSA-N 0.000 claims description 15
- KHPCPRHQVVSZAH-HUOMCSJISA-N Rosin Natural products O(C/C=C/c1ccccc1)[C@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 KHPCPRHQVVSZAH-HUOMCSJISA-N 0.000 claims description 15
- KHPCPRHQVVSZAH-UHFFFAOYSA-N trans-cinnamyl beta-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OCC=CC1=CC=CC=C1 KHPCPRHQVVSZAH-UHFFFAOYSA-N 0.000 claims description 15
- 239000003792 electrolyte Substances 0.000 claims description 12
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical group CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 claims description 12
- 229920000297 Rayon Polymers 0.000 claims description 9
- 239000002964 rayon Substances 0.000 claims description 9
- 239000002253 acid Substances 0.000 claims description 6
- -1 glycol ethers Chemical class 0.000 claims description 6
- 229920000728 polyester Polymers 0.000 claims description 6
- NIXOWILDQLNWCW-UHFFFAOYSA-N acrylic acid group Chemical group C(C=C)(=O)O NIXOWILDQLNWCW-UHFFFAOYSA-N 0.000 claims description 5
- 239000003795 chemical substances by application Substances 0.000 claims description 4
- LYCAIKOWRPUZTN-UHFFFAOYSA-N ethylene glycol Natural products OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 claims description 4
- 150000002576 ketones Chemical class 0.000 claims description 4
- 150000003839 salts Chemical class 0.000 claims description 4
- OFOBLEOULBTSOW-UHFFFAOYSA-N Propanedioic acid Natural products OC(=O)CC(O)=O OFOBLEOULBTSOW-UHFFFAOYSA-N 0.000 claims description 3
- 239000002585 base Substances 0.000 claims description 3
- 150000002148 esters Chemical class 0.000 claims description 3
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 claims description 3
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 claims description 3
- 239000011976 maleic acid Substances 0.000 claims description 3
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 claims description 3
- NIXOWILDQLNWCW-UHFFFAOYSA-M Acrylate Chemical compound [O-]C(=O)C=C NIXOWILDQLNWCW-UHFFFAOYSA-M 0.000 claims description 2
- 150000001298 alcohols Chemical class 0.000 claims description 2
- CDQSJQSWAWPGKG-UHFFFAOYSA-N butane-1,1-diol Chemical group CCCC(O)O CDQSJQSWAWPGKG-UHFFFAOYSA-N 0.000 claims description 2
- 150000002170 ethers Chemical class 0.000 claims description 2
- 239000000463 material Substances 0.000 claims description 2
- 229920001568 phenolic resin Polymers 0.000 claims description 2
- 239000005011 phenolic resin Substances 0.000 claims description 2
- 159000000000 sodium salts Chemical class 0.000 claims description 2
- 150000005846 sugar alcohols Polymers 0.000 claims description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 claims 2
- GSEJCLTVZPLZKY-UHFFFAOYSA-N Triethanolamine Chemical compound OCCN(CCO)CCO GSEJCLTVZPLZKY-UHFFFAOYSA-N 0.000 claims 1
- 150000001242 acetic acid derivatives Chemical class 0.000 claims 1
- 150000007513 acids Chemical group 0.000 claims 1
- 239000003513 alkali Substances 0.000 claims 1
- VZTDIZULWFCMLS-UHFFFAOYSA-N ammonium formate Chemical compound [NH4+].[O-]C=O VZTDIZULWFCMLS-UHFFFAOYSA-N 0.000 claims 1
- 238000004040 coloring Methods 0.000 claims 1
- 150000002334 glycols Chemical class 0.000 claims 1
- 229910001629 magnesium chloride Inorganic materials 0.000 claims 1
- 239000000976 ink Substances 0.000 description 76
- 239000000758 substrate Substances 0.000 description 16
- ZWEHNKRNPOVVGH-UHFFFAOYSA-N 2-Butanone Chemical compound CCC(C)=O ZWEHNKRNPOVVGH-UHFFFAOYSA-N 0.000 description 12
- 229920000180 alkyd Polymers 0.000 description 11
- 239000000975 dye Substances 0.000 description 11
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 9
- 229910052751 metal Inorganic materials 0.000 description 8
- 239000002184 metal Substances 0.000 description 8
- 238000001704 evaporation Methods 0.000 description 7
- KFZMGEQAYNKOFK-UHFFFAOYSA-N isopropyl alcohol Natural products CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 7
- UVZGOOXAARJPHD-UHFFFAOYSA-N butan-2-one;methanol Chemical compound OC.CCC(C)=O UVZGOOXAARJPHD-UHFFFAOYSA-N 0.000 description 6
- 239000003981 vehicle Substances 0.000 description 6
- 230000008020 evaporation Effects 0.000 description 5
- 229920000642 polymer Polymers 0.000 description 5
- 239000000126 substance Substances 0.000 description 5
- 238000001035 drying Methods 0.000 description 4
- 238000000034 method Methods 0.000 description 4
- 239000003973 paint Substances 0.000 description 4
- 238000007639 printing Methods 0.000 description 4
- 229910000831 Steel Inorganic materials 0.000 description 3
- 229920002678 cellulose Polymers 0.000 description 3
- 230000000694 effects Effects 0.000 description 3
- 238000002844 melting Methods 0.000 description 3
- 230000008018 melting Effects 0.000 description 3
- 238000002156 mixing Methods 0.000 description 3
- CKIGNOCMDJFFES-UHFFFAOYSA-N n-naphthalen-2-yl-1-phenylmethanimine Chemical compound C=1C=C2C=CC=CC2=CC=1N=CC1=CC=CC=C1 CKIGNOCMDJFFES-UHFFFAOYSA-N 0.000 description 3
- 239000000049 pigment Substances 0.000 description 3
- 239000010959 steel Substances 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- 239000004698 Polyethylene Substances 0.000 description 2
- PPBRXRYQALVLMV-UHFFFAOYSA-N Styrene Chemical compound C=CC1=CC=CC=C1 PPBRXRYQALVLMV-UHFFFAOYSA-N 0.000 description 2
- 238000005299 abrasion Methods 0.000 description 2
- WNLRTRBMVRJNCN-UHFFFAOYSA-N adipic acid Chemical compound OC(=O)CCCCC(O)=O WNLRTRBMVRJNCN-UHFFFAOYSA-N 0.000 description 2
- 229910052782 aluminium Inorganic materials 0.000 description 2
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 239000004359 castor oil Substances 0.000 description 2
- 235000019438 castor oil Nutrition 0.000 description 2
- 239000001913 cellulose Substances 0.000 description 2
- 229920001971 elastomer Polymers 0.000 description 2
- 239000010685 fatty oil Substances 0.000 description 2
- ZEMPKEQAKRGZGQ-XOQCFJPHSA-N glycerol triricinoleate Natural products CCCCCC[C@@H](O)CC=CCCCCCCCC(=O)OC[C@@H](COC(=O)CCCCCCCC=CC[C@@H](O)CCCCCC)OC(=O)CCCCCCCC=CC[C@H](O)CCCCCC ZEMPKEQAKRGZGQ-XOQCFJPHSA-N 0.000 description 2
- 150000007522 mineralic acids Chemical class 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 235000019198 oils Nutrition 0.000 description 2
- 150000007524 organic acids Chemical class 0.000 description 2
- 235000005985 organic acids Nutrition 0.000 description 2
- 150000007530 organic bases Chemical class 0.000 description 2
- 230000035515 penetration Effects 0.000 description 2
- XNGIFLGASWRNHJ-UHFFFAOYSA-N phthalic acid Chemical compound OC(=O)C1=CC=CC=C1C(O)=O XNGIFLGASWRNHJ-UHFFFAOYSA-N 0.000 description 2
- 229920000573 polyethylene Polymers 0.000 description 2
- 229920000915 polyvinyl chloride Polymers 0.000 description 2
- 238000001556 precipitation Methods 0.000 description 2
- 239000002994 raw material Substances 0.000 description 2
- 229920002554 vinyl polymer Polymers 0.000 description 2
- SQAINHDHICKHLX-UHFFFAOYSA-N 1-naphthaldehyde Chemical compound C1=CC=C2C(C=O)=CC=CC2=C1 SQAINHDHICKHLX-UHFFFAOYSA-N 0.000 description 1
- SMZOUWXMTYCWNB-UHFFFAOYSA-N 2-(2-methoxy-5-methylphenyl)ethanamine Chemical compound COC1=CC=C(C)C=C1CCN SMZOUWXMTYCWNB-UHFFFAOYSA-N 0.000 description 1
- 239000004925 Acrylic resin Substances 0.000 description 1
- 229920000178 Acrylic resin Polymers 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 101100346656 Drosophila melanogaster strat gene Proteins 0.000 description 1
- 239000001856 Ethyl cellulose Substances 0.000 description 1
- ZZSNKZQZMQGXPY-UHFFFAOYSA-N Ethyl cellulose Chemical compound CCOCC1OC(OC)C(OCC)C(OCC)C1OC1C(O)C(O)C(OC)C(CO)O1 ZZSNKZQZMQGXPY-UHFFFAOYSA-N 0.000 description 1
- JOYRKODLDBILNP-UHFFFAOYSA-N Ethyl urethane Chemical compound CCOC(N)=O JOYRKODLDBILNP-UHFFFAOYSA-N 0.000 description 1
- 229920000663 Hydroxyethyl cellulose Polymers 0.000 description 1
- 239000004354 Hydroxyethyl cellulose Substances 0.000 description 1
- 229920002153 Hydroxypropyl cellulose Polymers 0.000 description 1
- 241001676573 Minium Species 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- SJEYSFABYSGQBG-UHFFFAOYSA-M Patent blue Chemical compound [Na+].C1=CC(N(CC)CC)=CC=C1C(C=1C(=CC(=CC=1)S([O-])(=O)=O)S([O-])(=O)=O)=C1C=CC(=[N+](CC)CC)C=C1 SJEYSFABYSGQBG-UHFFFAOYSA-M 0.000 description 1
- 239000004952 Polyamide Substances 0.000 description 1
- 229920002367 Polyisobutene Polymers 0.000 description 1
- 239000004743 Polypropylene Substances 0.000 description 1
- 239000004793 Polystyrene Substances 0.000 description 1
- 239000004372 Polyvinyl alcohol Substances 0.000 description 1
- 229920001328 Polyvinylidene chloride Polymers 0.000 description 1
- 235000004443 Ricinus communis Nutrition 0.000 description 1
- ATJFFYVFTNAWJD-UHFFFAOYSA-N Tin Chemical compound [Sn] ATJFFYVFTNAWJD-UHFFFAOYSA-N 0.000 description 1
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 1
- 150000001241 acetals Chemical class 0.000 description 1
- 239000000980 acid dye Substances 0.000 description 1
- 235000011037 adipic acid Nutrition 0.000 description 1
- 239000001361 adipic acid Substances 0.000 description 1
- 150000001299 aldehydes Chemical class 0.000 description 1
- 239000000981 basic dye Substances 0.000 description 1
- 238000004061 bleaching Methods 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- 229920002301 cellulose acetate Polymers 0.000 description 1
- 229920003086 cellulose ether Polymers 0.000 description 1
- 238000004140 cleaning Methods 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 239000003240 coconut oil Substances 0.000 description 1
- 235000019864 coconut oil Nutrition 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 238000002508 contact lithography Methods 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- XHFGWHUWQXTGAT-UHFFFAOYSA-N dimethylamine hydrochloride Natural products CNC(C)C XHFGWHUWQXTGAT-UHFFFAOYSA-N 0.000 description 1
- IQDGSYLLQPDQDV-UHFFFAOYSA-N dimethylazanium;chloride Chemical compound Cl.CNC IQDGSYLLQPDQDV-UHFFFAOYSA-N 0.000 description 1
- 238000007598 dipping method Methods 0.000 description 1
- 239000000986 disperse dye Substances 0.000 description 1
- 238000004043 dyeing Methods 0.000 description 1
- 239000003822 epoxy resin Substances 0.000 description 1
- 229920001249 ethyl cellulose Polymers 0.000 description 1
- 235000019325 ethyl cellulose Nutrition 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 235000021323 fish oil Nutrition 0.000 description 1
- HDNHWROHHSBKJG-UHFFFAOYSA-N formaldehyde;furan-2-ylmethanol Chemical compound O=C.OCC1=CC=CO1 HDNHWROHHSBKJG-UHFFFAOYSA-N 0.000 description 1
- 239000007849 furan resin Substances 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 229920000578 graft copolymer Polymers 0.000 description 1
- 238000000227 grinding Methods 0.000 description 1
- LNEPOXFFQSENCJ-UHFFFAOYSA-N haloperidol Chemical compound C1CC(O)(C=2C=CC(Cl)=CC=2)CCN1CCCC(=O)C1=CC=C(F)C=C1 LNEPOXFFQSENCJ-UHFFFAOYSA-N 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- CATSNJVOTSVZJV-UHFFFAOYSA-N heptan-2-one Chemical compound CCCCCC(C)=O CATSNJVOTSVZJV-UHFFFAOYSA-N 0.000 description 1
- 229930195733 hydrocarbon Natural products 0.000 description 1
- 150000002430 hydrocarbons Chemical class 0.000 description 1
- 235000019447 hydroxyethyl cellulose Nutrition 0.000 description 1
- 239000001863 hydroxypropyl cellulose Substances 0.000 description 1
- 235000010977 hydroxypropyl cellulose Nutrition 0.000 description 1
- 238000007641 inkjet printing Methods 0.000 description 1
- 150000007529 inorganic bases Chemical class 0.000 description 1
- 239000000944 linseed oil Substances 0.000 description 1
- 235000021388 linseed oil Nutrition 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 230000001050 lubricating effect Effects 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 239000000025 natural resin Substances 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 238000009928 pasteurization Methods 0.000 description 1
- VLTOSDJJTWPWLS-UHFFFAOYSA-N pent-2-ynal Chemical compound CCC#CC=O VLTOSDJJTWPWLS-UHFFFAOYSA-N 0.000 description 1
- WXZMFSXDPGVJKK-UHFFFAOYSA-N pentaerythritol Chemical compound OCC(CO)(CO)CO WXZMFSXDPGVJKK-UHFFFAOYSA-N 0.000 description 1
- XNGIFLGASWRNHJ-UHFFFAOYSA-L phthalate(2-) Chemical compound [O-]C(=O)C1=CC=CC=C1C([O-])=O XNGIFLGASWRNHJ-UHFFFAOYSA-L 0.000 description 1
- 239000010665 pine oil Substances 0.000 description 1
- 238000006068 polycondensation reaction Methods 0.000 description 1
- 229920000647 polyepoxide Polymers 0.000 description 1
- 229920001225 polyester resin Polymers 0.000 description 1
- 239000004645 polyester resin Substances 0.000 description 1
- 239000004848 polyfunctional curative Substances 0.000 description 1
- 238000006116 polymerization reaction Methods 0.000 description 1
- 229920000098 polyolefin Polymers 0.000 description 1
- 229920001155 polypropylene Polymers 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 229920002223 polystyrene Polymers 0.000 description 1
- 229920002635 polyurethane Polymers 0.000 description 1
- 239000004814 polyurethane Substances 0.000 description 1
- 229920002689 polyvinyl acetate Polymers 0.000 description 1
- 239000011118 polyvinyl acetate Substances 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 239000004800 polyvinyl chloride Substances 0.000 description 1
- 229920001289 polyvinyl ether Polymers 0.000 description 1
- 239000005033 polyvinylidene chloride Substances 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- HJWLCRVIBGQPNF-UHFFFAOYSA-N prop-2-enylbenzene Chemical compound C=CCC1=CC=CC=C1 HJWLCRVIBGQPNF-UHFFFAOYSA-N 0.000 description 1
- FVSKHRXBFJPNKK-UHFFFAOYSA-N propionitrile Chemical compound CCC#N FVSKHRXBFJPNKK-UHFFFAOYSA-N 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- 229920002050 silicone resin Polymers 0.000 description 1
- 229920002379 silicone rubber Polymers 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000003549 soybean oil Substances 0.000 description 1
- 235000012424 soybean oil Nutrition 0.000 description 1
- 239000007858 starting material Substances 0.000 description 1
- 229940124530 sulfonamide Drugs 0.000 description 1
- 150000003456 sulfonamides Chemical class 0.000 description 1
- 239000000057 synthetic resin Substances 0.000 description 1
- 239000003760 tallow Substances 0.000 description 1
- 150000003505 terpenes Chemical class 0.000 description 1
- 235000007586 terpenes Nutrition 0.000 description 1
- 239000005029 tin-free steel Substances 0.000 description 1
- IMTKRLUCQZWPRY-UHFFFAOYSA-N triazine-4-carbaldehyde Chemical compound O=CC1=CC=NN=N1 IMTKRLUCQZWPRY-UHFFFAOYSA-N 0.000 description 1
- 229920006337 unsaturated polyester resin Polymers 0.000 description 1
- 239000002966 varnish Substances 0.000 description 1
- 125000000391 vinyl group Chemical group [H]C([*])=C([H])[H] 0.000 description 1
- 150000003751 zinc Chemical class 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C09—DYES; PAINTS; POLISHES; NATURAL RESINS; ADHESIVES; COMPOSITIONS NOT OTHERWISE PROVIDED FOR; APPLICATIONS OF MATERIALS NOT OTHERWISE PROVIDED FOR
- C09D—COATING COMPOSITIONS, e.g. PAINTS, VARNISHES OR LACQUERS; FILLING PASTES; CHEMICAL PAINT OR INK REMOVERS; INKS; CORRECTING FLUIDS; WOODSTAINS; PASTES OR SOLIDS FOR COLOURING OR PRINTING; USE OF MATERIALS THEREFOR
- C09D11/00—Inks
- C09D11/30—Inkjet printing inks
- C09D11/36—Inkjet printing inks based on non-aqueous solvents
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Materials Engineering (AREA)
- Wood Science & Technology (AREA)
- Organic Chemistry (AREA)
- Inks, Pencil-Leads, Or Crayons (AREA)
- Developing Agents For Electrophotography (AREA)
- Inspection Of Paper Currency And Valuable Securities (AREA)
Description
10 15 20 25 30 35 UU 780331641 lats, som arbetar tillfredsställande på ett begränsat antal sub- strat. Huvudskälet för denna begränsning är bristen på tillräck- lig mängd bindemedel i ett bläck för att ge lämplig skrift, adhe- sion och andra slutanvändningsegenskaper. 10 15 20 25 30 35 UU 780331641 operating satisfactorily on a limited number of sub- strat. The main reason for this limitation is the lack of amount of binder in an ink to provide suitable writing, and other end-use properties.
För att arbeta tillfredsställande i ett bläeketralekrift- system måste ett bläck utveckla en konsekvent droppsönderbryt- ningslängd, dropphastighet och droppladdning under givna maskin- driftförhållanden. För att uppnå dessa mål måste bläcket möta stränga krav avseende viskositet, resistivitet, löslighet och komponenternas blandbarhet, stabilitet och antiskinnegenskaper och bläcket måste kunna âterupplösas i ett lämpligt lösningsme- del för snabb rengöring av maskinkomponenterna med ett minimum av ansträngning.In order to work satisfactorily in a bleaching medium system, an ink must develop a consistent droplet break dropping speed, dropping speed and dropping charge during given machines operating conditions. To achieve these goals, the ink must meet strict requirements regarding viscosity, resistivity, solubility and the miscibility, stability and anti-splash properties of the components and the ink must be able to be redissolved in a suitable solvent part for quick cleaning of the machine components with a minimum of effort.
Det har bestämts att på bläckstrålskrivare, som beskrivas i amerikanska patentskrifterna 3 465 350 och 3 465 351, bläck med vlskesiteten 0,02 Ne/mz kommer att uppträda tillfredsställande beroende på typ av använt munstycke. Emellertid uppträder bläck med lägre viskositeter mycket bättre. Bläckets resistivitet kan sträcka sig så högt som 100 ohm-meter för tillfredsställande ver- kan.It has been decided that on inkjet printers, as described in U.S. Pat. Nos. 3,465,350 and 3,465,351, ink The liquidity 0.02 Ne / mz will perform satisfactorily depending on the type of nozzle used. However, ink does appear with lower viscosities much better. Ink resistivity can extend as high as 100 ohm-meters for satisfactory ver- can.
Det är även viktigt att i ett bläckstrålskriftsystem, där bläcket cirkuleras, innan bläcket återanvändas, det måste bringas till sin ursprungliga form genom tillsats av exakta mängder lös- ningsmedel och beståndsdelar, som förlorats under cirkuleringen.It is also important that in an inkjet writing system, there the ink is circulated, before the ink is reused, it must be brought to its original form by adding precise amounts of solution agents and constituents lost during circulation.
Tryckbläck måste även äga den tillfredsställande tryckbarheten för pavsett utnyttjande, för att möta kraven, som kan variera för var- je specifik typ av substrat och skrivapparatur. Speciellt under- kastas tryckbläck för icke kontakt-tryckning ett antal begräns- ningar ådragna genom tryckningsmaskínen.Printing inks must also have the satisfactory printability for paved use, to meet the requirements, which may vary for each je specific type of substrate and writing apparatus. Especially under- non-contact printing ink is discarded a number of drawn by the printing press.
Det är en avsikt med föreliggande uppfinning att tillhanda- hålla ett bläck med hög viktprocent filmbildande harts/polymer för användning inom bläckstrålskrift på en stor mängd substrat, vilket kombinerar egenskaper nödvändiga för tillfredsställande verkan av bläcket i skrivapparaten med egenskaper nödvändiga för att erhålla och bevara en tillfredsställande tryckt bild på det speciella substratet ifråga.It is an object of the present invention to provide hold an ink with a high weight percentage of film-forming resin / polymer for use in inkjet printing on a wide variety of substrates, which combines properties necessary for satisfactory effect of the ink in the typewriter with properties necessary for to obtain and preserve a satisfactorily printed image on it special substrate in question.
En ytterligare avsikt med föreliggande uppfinning är att tillhandahålla ett strålskriftbläck, vilket ger mycket mera flexibilitet vid drivandet av bläckstrålskriftapparaten. Tidigare bläck har mycket snävt parameterområde, under vilket god skrift 10 15 20 25 30 35 40 . .,_.._,-_:_.._..7_._. _ . 7803316-4 kommer att erhållas, under det att skrivbläck enligt föreliggande uppfinning har mycket vidsträckta parametrar, under vilka lämplig áqfift kommer att erhållas.A further object of the present invention is that provide a rayon ink, which provides much more flexibility in operating the inkjet typewriter. Earlier Ink has a very narrow parameter range, under which good writing 10 15 20 25 30 35 40 . ., _.._, -_: _.._ .. 7 _._. _. 7803316-4 will be obtained, while writing ink according to the present invention has very extensive parameters, under which suitable áq fi ft will be obtained.
En annan avsikt med föreliggande uppfinning är att tillhan- dahålla ett icke kontakt-bläck, som har mycket god vattenresistänä när det vätes, så att det kan användas på ställen där det kommer i kontakt med fuktighet omedelbart efter tryckningen.Another object of the present invention is to provide maintain a non-contact ink, which has very good water resistance when it is wetted, so that it can be used in places where it comes in contact with moisture immediately after printing.
En ytterligare avsikt med föreliggande uppfinning är att tillhandahålla bläck, som, när de cirkuleras i en bläckstrålskrift- apparat, inte måste bringas till sin ursprungliga sammansättning innan återanvändning. Det är önskvärt att vidmakthålla den ur- sprungliga sammansättningen med "kompletterings"-bläck; emeller- tid är det inte nödvändigt att göra detta. Vad som är nödvändigt är att vidmakthålla arbetsviskositeten och resistivitetsområdet hela tiden.A further object of the present invention is that provide inks which, when circulated in an ink jet script, apparatus, must not be brought into its original composition before reuse. It is desirable to maintain the original composition with "complementary" inks; emeller- time, it is not necessary to do this. What is necessary is to maintain the working viscosity and resistivity range continuously.
En ytterligare avsikt med föreliggande uppfinning är att tillhandahålla ett bläck, som inte är beroende av ett lösnings- medel för att ge dess skrivegenskaper på metalliska och andra styva substrat.A further object of the present invention is that provide an ink which is not dependent on a solution means for imparting its writing properties to metallic and others rigid substrate.
En ytterligare avsikt med föreliggande uppfinning är att tillhandahålla ett strålskriftbläck, som har utmärkt adhesion till belagd eller ren, styv eller flexibel aluminium, olika tenn- fria stål, plåt belagd med tenn, elektrolytishïeller genom värme- doppning, glas, polyeten, polyester och olika andra substrat.A further object of the present invention is that provide a rayon ink which has excellent adhesion to coated or pure, rigid or flexible aluminum, various tin- free steel, sheet metal coated with tin, electrolytic steel by heating dipping, glass, polyethylene, polyester and various other substrates.
En ytterligare avsikt med föreliggande uppfinning är att tillhandahålla ett bläck, som förlorar mycket liten procent lös- ningsmedel i cirkulationen jämfört med tidigare kända bläck.A further object of the present invention is that provide an ink which loses a very small percentage of circulating agents compared to previously known inks.
Skrivbläck enligt föreliggande uppfinning består av vehikeln som är en lösning av filmbildande harts/polymer eller blandning av hartser/polymerer i mycket hög viktprocent löst i lösningsme- del eller blandning av lösningsmedel för att ge arbetsviskosite- ter och innehållande en lämplig elektrolyt, blandbar med använda hartser/polymerer. Färg erhålles genom att tillsätta färgämne till vehikeln.Writing ink according to the present invention consists of the vehicle which is a solution of film-forming resin / polymer or mixture of resins / polymers in a very high percentage by weight dissolved in the solvent part or mixture of solvents to give working viscosity and containing a suitable electrolyte, miscible with used resins / polymers. Color is obtained by adding dye to the vehicle.
I nuvarande tillgängliga kommersiella bläck för bläckstrål- skrift bestämmes vanligen skrivbarhetsegenskaperna genom lösnings- medelssammansättningen. Emellertid bestämmes i allmänhet skriv- egenskaperna hos vilken typ av skrivbläck som helst genom dess vehikelsammansättning. I bläck enligt föreliggande uppfinning bestämmes skrivegenskaperna och slutanvändningsegenskaperna genom 10 15 20 25 30 35 40 7803316-4 vehikelkomponenterna och lösningsmedlen, som kan spela en under- stödjande roll vid inträngning av bläcken i substraten.In currently available commercial inks for inkjet writing, the writability properties are usually determined by the the composition of funds. However, in general, writing the properties of any type of writing ink through it vehicle composition. In ink according to the present invention the writing properties and end-use properties are determined by 10 15 20 25 30 35 40 7803316-4 the vehicle components and solvents, which may play a supporting role in the penetration of the ink into the substrates.
Genom att utvälja något av hartserna upptagna i kraven, är det möjligt att tillverka ett bläck, som kommer att tillfreds- ställa bläckstrålskriftapparatens krav och slutanvändningskraven.By selecting one of the resins included in the requirements, is it is possible to produce an ink which will satisfy set the requirements of the inkjet printer and the end-use requirements.
Fastän strålskriftbläck innehåller ett färgämne, ett lös- ningsmedel och ett bindemedel i likhet med vanliga bläck, erford- ras vissa funktioner hos dessa komponenter i strålskriftbläck förutom de som erfordras i vanliga bläck och särskilt ålägger bläckstrålskrift på belagda eller rena metallsubstrat, såsom alu- minium, stål och förtenta stålburkar speciella funktionella krav på dessa komponenter. Uppnåendet av en tillfredsställande balans av de funktionella kraven på bläcket genom lämplig sammansättning är i grund och botten innehållet i föreliggande uppfinning och det är av detta skäl som de speciella funktionerna, som krävs av de olika bläckkomponenterna i strålskriftbläck för metall, disku- teras häri till någon detalj.Although rayon ink contains a dye, a solvent and a binder similar to ordinary inks, required certain functions of these components are printed in rayon ink in addition to those required in ordinary inks and especially imposes inkjet writing on coated or pure metal substrates, such as aluminum minium, steel and tinned steel cans special functional requirements on these components. Achieving a satisfactory balance of the functional requirements of the ink by appropriate composition is basically the content of the present invention and it is for this reason that the special features, which are required of the various ink components in lithographic ink for metal, discussed to this in some detail.
Hartsernas egenskaper och kännetecknen som är förlänade åt bläcket genom hartset, är av yttersta vikt i föreliggande uppfin- ning. Det har tidigare påpekats, att den totala bläckkompositio- nen måste vara av mycket låg viskositet. Tillfredsställande re- sultat är lätt erhâllbara med bläck med en viskositet så hög som cirka 0,02 Ns/m2 vid 25°C och det är möjligt att arbeta med bläck med en viskositet som närmar sig 0,025 Ns/m2, fastän strålskrift- förfarandet blir mer och mer svårt att kontrollera, då bläckvis- kositeten ökar. En viskositet på 0,002-0,005 Ns/m2 betraktas opti- mal. Emedan hartskomponenten tenderar att öka viskositeten hos lösningsmediet, är det därför nödvändigt att ha harts, som vid hög viktprocent i lösningsmedel har mycket låg viskositet, för att förhindra en icke önskvärd viskositetsuppbyggnad såsom ett resul- tat av sammanblandningen.The properties of the resins and the characteristics which are endowed with ink through the resin, is of utmost importance in the present invention ning. It has previously been pointed out that the total ink composition must be of very low viscosity. Satisfactory results The results are readily available with inks having a viscosity as high as about 0.02 Ns / m2 at 25 ° C and it is possible to work with ink with a viscosity approaching 0.025 Ns / m2, although the procedure becomes more and more difficult to control, as the ink the quality increases. A viscosity of 0.002-0.005 Ns / m2 is considered opti- moth. Because the resin component tends to increase the viscosity of solution medium, it is therefore necessary to have resin, as at high weight percent in solvent has very low viscosity, to prevent an undesirable viscosity build-up as a result of of the mixture.
Hartskomponenten hos ett strålskriftbläck, som är lämpligt för skrift på belagd eller ren metall, måste också möta en mängd krav. Av primär betydelse är förmågan hos hartset att vidhäfta den belagda eller rena metallytan, på vilket bläcket skrives, och att vidmakthålla denna starka adhesion under vitt varierande . förhållanden beträffande fuktighet och temperatur. När bläcket påföres på metallytan, måste det "våta" eller vidhäfta en belagd eller ren metallyta även i närvaro av någon fuktighet och det måste uppvisa en hög grad av fukthärdighet inte endast för att 10 15 20 30 35 UU 78033164 vidmakthålla adhesion till metallen utan också för att skydda färgämnet, som kan vara vattenkänsligt, från verkningarna av fuktighet, vilka kan göra att färgämnet blöder in i omgivande områden.The resin component of a rayon ink, which is suitable for writing on coated or pure metal, must also meet a variety requirement. Of primary importance is the ability of the resin to adhere the coated or clean metal surface on which the ink is written, and to maintain this strong adhesion during widely varying. conditions of humidity and temperature. When the ink applied to the metal surface, it must "wet" or adhere a coated or pure metal surface even in the presence of any moisture and that must exhibit a high degree of moisture resistance not only to 10 15 20 30 35 UU 78033164 maintain adhesion to the metal but also to protect the dye, which may be water sensitive, from the effects of moisture, which can cause the dye to bleed into the surrounding areas.
Hartskomponenten måste också vara mycket lättlöslig i lös- ningsmedelsmediet för att bilda en stabil lösning med låg visko- sitet, så att verksamma mängder kan lösas i lösningsmedlet utan att orimligt öka kompositionens viskositet. På liknande sätt måste den elektrolytiska komponenten, som användes i de lämpliga utfö- ríngsformerna enligt föreliggande uppfinning, också vara verksam vid koncentrationer väl under dess löslighetsgräns för att uppnå de önskade droppavvikningsegenskaperna utan fara för utfällning och igenpluggning av systemet.The resin component must also be very readily soluble in medium to form a stable, low viscosity solution. site, so that effective amounts can be dissolved in the solvent without to unreasonably increase the viscosity of the composition. Similarly must the electrolytic component used in the appropriate embodiments the molds of the present invention may also be effective at concentrations well below its solubility limit to achieve the desired droplet deviation properties without risk of precipitation and plugging of the system.
Ett ytterligare krav på hartset är att det skall ha tillräck- lig frigivning av lösningsmedel, så att en önskad torkningshas- tighet erhålles på ett givet substrat. För att vara verksamt i en beredning av ett strålskriftbläck för ett givet substrat, mås- te lösningsmedelsmediet lätt lösa tillräckliga mängder av harts- komponenten, färgämnet och vilka önskvärda eventuella komponenter som helst, såsom en elektrolyt, för attuppnå önskad grad av vid- häftning, konduktivitet och synligt intryck av bläckkompositionen.An additional requirement for the resin is that it should have sufficient release of solvent, so that a desired drying rate obtained on a given substrate. To be active in a preparation of a rayon ink for a given substrate, solvent medium easily dissolve sufficient amounts of resin the component, the dye and any desired components at any time, such as an electrolyte, to achieve the desired degree of adhesion, conductivity and visible impression of the ink composition.
Vidare, emedan någon grad av avdunstning av lösningsmedel kommer att uppträda i bläckförrådet och bläckcirkulationssystemet och därvid öka koncentrationen av fasta ämnen i bläcket, skall lös- ningsmedlet ha tillräcklig styrka för>$t förhindra utfällning i denna situation.Furthermore, because some degree of evaporation of solvent is coming to appear in the ink supply and ink circulation system and thereby increasing the concentration of solids in the ink, the have sufficient strength to prevent precipitation in this situation.
Fastän avdunstning av lösningsmedlet från bläckförrâdet och cirkulationssystemen vanligen icke är önskvärd, är det viktigt att lösningsmedlet avdunstar med önskad hastighet från den skriv- na bildytan för att lämna den skrivna bilden smörjsäker och fukt- härdig inom erforderlig tid efter det att skrivningsoperationen utförts. Lösningsmedlet måste uppnå en tillfredsställande balans i avdunstningsegenskaper mellan dessa motsatta mål.Although evaporation of the solvent from the ink supply and circulatory systems are usually not desirable, it is important that the solvent evaporates at the desired rate from the image area to leave the printed image lubricating and moisturized hardy within the required time after the writing operation performed. The solvent must achieve a satisfactory balance in evaporation properties between these opposite targets.
Beroende på typ av substrat, på vilket bläcket skall tryckas, är det fördelaktigt att använda ett lösningsmedel som kommer att genomtränga vaxet eller annan beläggning på substraten för att öka bläckets vidhäftning och gnidningshärdighet.Depending on the type of substrate on which the ink is to be printed, it is advantageous to use a solvent that will penetrate the wax or other coating onto the substrates to increase ink adhesion and abrasion resistance.
Föreliggande uppfinning avser strålskriftbläck, som har ut- märkt vidhäftning på olika substrat. I all synnerhet avser före- liggande uppfinning skrivbläck, som framställes genom att till- 10 15 20 25 30 35 H0 7803316-4 sätta en lämplig elektrolyt till en bläckvehikel, som omfattar såsom den väsentliga komponenten, mycket hög viktprocent harts eller blandning av harts löst i lösningsmedel eller blandning av lösningsmedel för att ge en viskositet inom området 0,0015 Ns/m2 till 0,012 Ns/m2, och som är blandbar med feta oljor; olika cl- jor, hartser, hartsaktiga lacker, lösningsmedel, etc., som vanli- gen användes såsom skrivbläcksmaterial och vidare, om så är nöd- vändigt, genom att mala och dispergera pigment, fyllmedel och/el- ler hjälpmedel i de erhållna komponenterna.The present invention relates to rayon inks which have labeled adhesion to various substrates. In particular, The present invention provides writing inks which are prepared by 10 15 20 25 30 35 H0 7803316-4 add a suitable electrolyte to an ink vehicle, which includes as the essential component, very high weight percent resin or mixing resin dissolved in solvent or mixing solvent to give a viscosity in the range 0.0015 Ns / m2 to 0.012 Ns / m2, and which is miscible with fatty oils; different cl- ions, resins, resinous varnishes, solvents, etc., which are usually were used as writing ink materials and further, if necessary. by grinding and dispersing pigments, fillers and / or aids in the components obtained.
Vidare förutsätter framställningen av strålskriftbläcket en- ligt föreliggande uppfinning inte någon kritisk begränsning vad beträffar utgängsmaterialen och blandningsmetod, annat än att vehikelkomponenten skall innehålla en lämplig elektrolyt. Konven- tionella råmaterial, som användes i vätskeformiga tryckbläck, så- som feta oljor, harts, hartsaktiga mfltser,lösningsmedel, etc., kan fritt införlivas i optimala kvantiteter beroende på avsedd slutanvändning av bläcket.Furthermore, the production of the rayon ink requires According to the present invention there is no critical limitation on what concerning the starting materials and mixing method, other than that the vehicle component must contain a suitable electrolyte. Conventional raw materials used in liquid printing inks, such as such as fatty oils, resins, resinous mats, solvents, etc., can be freely incorporated in optimal quantities depending on the intended end use of the ink.
Pärgkomponenter. Det finns inte några begränsningar i an- vändningen av något färgämne, enda begränsningen är att färgämne eller pigment måste vara blandbara med harts och eleknnlyt och använda lösningsmedel. Några av färgämnena som är lämpliga för färgning är basiska färgämnen, sura färgämnen, färgämnesbaser, dispersa färgämnen, pigment. Det finns inte någon gräns och nå- gon mängd av färgämne som kan användas; den enda gränsen är lös- ligheten av färgämnet i lösningsmedlen, som användes i bläcken.Pärgkomponenter. There are no restrictions on the reversal of any dye, the only limitation is that dye or pigments must be miscible with resin and electrolyte and use solvents. Some of the dyes that are suitable for dyeing are basic dyes, acid dyes, dye bases, disperse dyes, pigments. There is no limit and no any amount of dye that can be used; the only limit is the dye in the solvents used in the ink.
Lösningsmedelskomponent. Det finns inte någon begränsning av typen av lösningsmedel, som kan användas i bläcket, den enda begränsningen är verkan på maskinkomponenterna. Några lösnings- medel, som är lämpliga för dessa bläck, är alkoholer, ketoner, etrar, estrar, kolväten, glykol, glykoletrar. Naturligtvis kom- mer lösningsmedelsvalet att bero på typ av harts eller blandning av hartser, som utvalts, och erforderlig avdunstningshastighet och typ av substrat, som skall tryckas, och om inträngning i sub- stratet önskas eller inte.Solvent component. There is no limit of the type of solvent, which can be used in the ink, the only one the limitation is the effect on the machine components. Some solutions Agents suitable for these inks are alcohols, ketones, ethers, esters, hydrocarbons, glycol, glycol ethers. Of course, more solvent choice depending on the type of resin or mixture of resins, selected, and required evaporation rate and type of substrate to be printed, and if penetration into the desired or not.
Variabler, som bestämmer hastigheten vid vilken ett icke kontakt-bläck enligt föreliggande uppfinning kommer att torka, beror på avdunstningshastigheten av närvarande lösningsmedel och lösningsmedelsfrigivningsegenskaperna hos hartserna närvarande i ett bläck. Sålunda är det möjligt att bereda bläck med mycket snabb torkning genom att använda mycket snabbt avdunstande lös- 10 15 20 25 30 35 H0 780331644 ningsmedel till fullständigt icke torkande bläck genom att använ- da icke avdunstande lösningsmedel eller komponenter, som är icke torkande.Variables that determine the rate at which one does not contact inks of the present invention will dry, depends on the evaporation rate of the solvent present and the solvent release properties of the resins present in an ink. Thus, it is possible to prepare inks with a lot rapid drying by using very rapidly evaporating solution 10 15 20 25 30 35 H0 780331644 completely non-drying ink by using non-evaporating solvents or components which are not drying.
För att de små bläckdropparna, som insprutas från skrivaren, skall erhålla och hålla den rätta elektriska 1addningen,måste bläcket vara konduktivt. Bläckets konduktivitet kontrolleras av dess låga resistans till elektrisk ström; bläck med resistivitet på upp till 100 ohm-meter är lämpliga. _ Det har visat sig, att några av bläckkomponenterna enligt föreliggande uppfinning kommer att ha en resistivitet inom drift- dugligt område utan nödvändigheten av att tillsätta en elektrolyt.Because the small drops of ink, which are injected from the printer, must obtain and maintain the correct electrical charge, must the ink be conductive. The conductivity of the ink is checked by its low resistance to electric current; ink with resistivity of up to 100 ohm-meters are suitable. _ It has been found that some of the ink components according to the present invention will have a resistivity in operation. capable area without the need to add an electrolyte.
I allmänhet har det emellertid visat sig, att optimala resultat erhålles om en elektrolyt sättes till bläcket. Lämpliga elektro- lyter för bläck enligt föreliggande uppfinning är organiska syror, organiska baser, salter av organiska syror och oorganiska baser, salter av organiska baser och oorganiska syror; t.ex. oorganiska syror, salter, baser, som är lösliga i lösningsmedel. Några exem- pel på elektrolyterna är paratoluensulfonsyra, natriumsalt av paratoluensulfonsyra, Na-propionat, dimetylaminhydroklorid.In general, however, it has been found that optimal results obtained if an electrolyte is added to the ink. Suitable electrical Inks for the present invention are organic acids, organic bases, salts of organic acids and inorganic bases, salts of organic bases and inorganic acids; for example inorganic acids, salts, bases, which are soluble in solvents. Some examples on the electrolytes is paratoluenesulfonic acid, sodium salt of paratoluenesulfonic acid, Na-propionate, dimethylamine hydrochloride.
Hartskomponent. Hartskomponenten är av yttersta vikt i bläck enligt föreliggande uppfinning beroende på typ av substrat och erforderliga slutanvändningsegenskaper hos tryckt substrat. Ett lämpligt harts eller kombination av hartser utväljes från följan- de typ av hartser: Syntetiska, halvsyntetiska och naturliga hartser, vilket vill säga både polymerisations- såväl som polykondensations- och poly- additionsprodukter, är lämpliga. I princip användes alla hartser vanliga inom skrivbläcks- och färgindustrien, sådana som exempel- vis är beskrivna i lackråmaterialtabellerna enligt Karstne (äre upplagan, Hanover 1967) och i Wagner och Sarx's arbete på lack- hartser (üze upplagan, München 1959).Heart component. The resin component is of utmost importance in ink according to the present invention depending on the type of substrate and required end-use properties of printed substrate. One suitable resin or combination of resins is selected from the following the type of resins: Synthetic, semi-synthetic and natural resins, whatever say both polymerization as well as polycondensation and poly- addition products, are suitable. In principle, all resins were used common in the inkjet and paint industry, such as are described in the paint raw material tables according to Karstne (äre edition, Hanover 1967) and in Wagner and Sarx's work on paint resins (üze edition, Munich 1959).
De följande är exempelvis lämpliga hartser: kolofonium och derivat därav, hydrerad kolofonium, di- eller polymeriserad kolo- fonium, såsom kalcium- eller zinksalt, kolofonium, förestrad med en- eller flervärda alkoholer; med hartsbildare såsom akrylsyra och butandiol eller maleinsyra och pentaerytritol modifierat ko- lofoniumharts; de lösliga fenolhartserna modifierade med kolofo- nium och hartser baserade på akrylföreningar, maleinathartser, oljefria alkydhartser, styrenbehandlade alkydhartser, vinyltoluen- modifierade alkydhartser, alkydhartser med syntetiska fettsyror, 10 15 20 25 30 78033164: linfröolje-alkydhartser, ricinen-alkydhartser, ricinolje-alkyd- hartser, sojaolje-alkydhartser, kokosnötolja-alkydhartser, tall- olje- och fiskolje-alkydhartser, akrylerade alkydhartser, även oljor och oljelacker. Lämpliga är också terpenhartser, polyvinyl- hartser, såsom polyvinylacetat, polyvinylklorid, polyvinyliden- kloríd, polyvinylacetaler, polyvinylalkohol, polyvinyleter, sam- polymerisat och ymppolymerisat med olika vinylmonomerer, poly- akrylhartser, akrylathartser, polystyrener, polyisobutylener, polyestrar baserade på ftalsyra, maleinsyra, adipinsyra, talgsy~ ra, etc; naftalenformaldehydhartser, furanhartser, ketonhartser, aldehydhartser, polyuretaner (speciellt uretan-primära-produkter, som härdar endast vid förhöjd temperatur), epoxidhartser (speci- ellt blandningar av hartshärdare, som härdar endast vid förhöjd temperatur) och förkondensat därav. Även lämpliga är primära pro- dukter av omättade polyesterhartser, dialkylftalat-förpolymerer, polyolefiner, såsom polyetylenvax eller polypropylenvax, inden- och kumaronindenhartser, karbamid- och sulfonamidhartser, poly- amid- och polyesterhartser, silikonhartser, gummi och derivat därav, t.ex. cyklokautschuk och klorkautschuk, framför allt emel- lertid cellulosaderivat, såsom cellulosaestrar (nitrocellulosa, cellulosaacetat och liknande), och speciellt cellulosaetrar, t.ex. metylcellulosa, hydroxietylcellulosa, hydroxipropylcellu- losa, propionitrilcellulosa, etylcellulosa och bensylcellulosa.The following are suitable resins, for example: rosin and derivatives thereof, hydrogenated rosin, di- or polymerized rosin phonium, such as calcium or zinc salt, rosin, esterified with mono- or polyhydric alcohols; with resin formers such as acrylic acid and butanediol or maleic acid and pentaerythritol modified co- lofonium resin; the soluble phenolic resins modified with rosin nium and resins based on acrylic compounds, maleinate resins, oil-free alkyd resins, styrene-treated alkyd resins, vinyl toluene modified alkyd resins, alkyd resins with synthetic fatty acids, 10 15 20 25 30 78033164: flaxseed oil alkyd resins, castor alkyd resins, castor oil alkyd resins resins, soybean oil alkyd resins, coconut oil alkyd resins, pine oil and fish oil alkyd resins, acrylated alkyd resins, whether or not oils and oil paints. Also suitable are terpene resins, polyvinyl resins such as polyvinyl acetate, polyvinyl chloride, polyvinylidene chloride, polyvinyl acetals, polyvinyl alcohol, polyvinyl ether, polymers and graft polymers with different vinyl monomers, acrylic resins, acrylate resins, polystyrenes, polyisobutylenes, polyesters based on phthalic acid, maleic acid, adipic acid, tallow acid ra, etc; naphthalene formaldehyde resins, furan resins, ketone resins, aldehyde resins, polyurethanes (especially urethane primary products, curing only at elevated temperature), epoxy resins (specific or mixtures of resin hardeners, which cure only at elevated temperature) and precondensed thereof. Also suitable are primary pro- products of unsaturated polyester resins, dialkyl phthalate prepolymers, polyolefins, such as polyethylene wax or polypropylene wax, and coumaronindene resins, urea and sulfonamide resins, poly- amide and polyester resins, silicone resins, rubber and derivatives thereof, e.g. cyclo-rubber and chlor-rubber, in particular cellulose derivatives, such as cellulose esters (nitrocellulose, cellulose acetate and the like), and in particular cellulose ethers, for example methylcellulose, hydroxyethylcellulose, hydroxypropylcellulose losa, propionitrile cellulose, ethylcellulose and benzylcellulose.
De motsvarande derivaten av andra polysackarider kan även använ- das.The corresponding derivatives of other polysaccharides can also be used. das.
Under det att nedan beskrives ett begränsat antal av utfö- ringsformer av föreliggande uppfinning, som presenterats häri, är det möjligt att likväl framställa andra utföringsformer utan att avvika från den häri beskrivna uppfinningens idé. Olika andra modifikationer kommer att vara lätt uppenbara för fackmannen.While a limited number of embodiments are described below. embodiments of the present invention, as presented herein, it is still possible to produce other embodiments without to depart from the spirit of the invention described herein. Various others modifications will be readily apparent to those skilled in the art.
Följande nya kompositioner uttryckes i viktdelar och fram- ställes genom sedvanligt förfarande: Exempel 1 Syntetiskt ketonbasharts, som uppvisar en viskositet av V pa Gardner-goldt-skalan och en mjukningspunkt pa 117°C, sald sasom "Krumbhaar Resin K-1717 HMP" av Lawter Chemicals Inc., Chicago, Illinois 50,00 Metyletylketon 50,00 Metanol q0,gg Paratoluensulfonsyra 2,00 Metylviolettbas 2,00 1H4,Û0 Exempel .The following new compositions are expressed in parts by weight and by the usual procedure: Example 1 Synthetic ketone base resin, which has a viscosity of V on the Gardner-goldt scale and a softening point at 117 ° C, sald as "Krumbhaar Resin K-1717 HMP" av Lawter Chemicals Inc., Chicago, Illinois 50.00 Methyl ethyl ketone 50.00 Methanol q0, gg Paratoluenesulfonic acid 2.00 Methyl violet base 2.00 1H4, Û0 Example.
Icke oxiderande polyester uppvisande en viskositet av S-X på Gardner-Holdt-skalan och en smältpunkt på 7803316-4 75-85°C, såld såsom "Arochem 650" av Ashland Chemical Company, Columbus, Ohio Metanol Metyletylketon Paratoluensulfonsyra Auraminbas Exempel 3.Non-oxidizing polyester having a viscosity of S-X on the Gardner-Holdt scale and a melting point on 7803316-4 75-85 ° C, sold as "Arochem 650" by Ashland Chemical Company, Columbus, Ohio Methanol Methyl ethyl ketone Paratoluenesulfonic acid Auraminbas Example 3.
Icke oxiderande polyester uppvisande en viskositet av S-X på Gardner-Holdt-skalan och en smältpunkt på 75-85°C, såld såsom "Arochem 650" av Ashland Chemical Company, Columbus, Ohio Metanol Metyletylketon Paratoluensulfonsyra Auraminbas Exempel U.Non-oxidizing polyester having a viscosity of S-X on the Gardner-Holdt scale and a melting point at 75-85 ° C, sold as "Arochem 650" by Ashland Chemical Company, Columbus, Ohio Methanol Methyl ethyl ketone Paratoluenesulfonic acid Auraminbas Example U.
Icke oxiderande polyester uppvisande en viskositet av S-X på Gardner Holdt-skalan och en smältpunkt på 75-85°C, såld såsom "Arochem 650" av Ashland Chemical Company, Columbus, Ohio Metanol Metyletylketon Paratoluensulfonsyra Auraminbas Rå ricinolja Exempel Q.Non-oxidizing polyester having a viscosity of S-X on the Gardner Holdt scale and a melting point at 75-85 ° C, sold as "Arochem 650" by Ashland Chemical Company, Columbus, Ohio Methanol Methyl ethyl ketone Paratoluenesulfonic acid Auraminbas Crude castor oil Example Q.
"Krumbar 1717 HMP" Paratoluensulfonsyra Metyletylketon Metanol Isopropylalkohol Exempel 6."Krumbar 1717 HMP" Paratoluenesulfonic acid Methyl ethyl ketone Methanol Isopropyl alcohol Example 6.
"Krumbar 1717 HMP" Paratoluensulfonsyra Metyletylketon Metanol Isopropylalkohol Exempel 7."Krumbar 1717 HMP" Paratoluenesulfonic acid Methyl ethyl ketone Methanol Isopropyl alcohol Example 7.
"Krumbar 1717 HMP" Metyletylketon Metanol Paratoluensulfonsyra Metylviolettbas 01,00 41,40 16,00 1,00 0,20 100,00 20,00 24,00 40,00 5,00 7,00 100,00 30,50 30,50 v..-__...-._. _ 780331 6-1: 10 Exempel 8."Krumbar 1717 HMP" Methyl ethyl ketone Methanol Paratoluenesulfonic acid Methyl violet base 01.00 41.40 16.00 1.00 0.20 100.00 20.00 24.00 40.00 5.00 7.00 100.00 30.50 30.50 v ..-__...-._. _ 780331 6-1: 10 Example 8.
"Pentalyn 856" 35,00 Metyletylketon 35,00 Metanol 70,00 m-bensen-disulfonsyra 0,50 Metylviolettbas 1,00 141,50 Exempel 9."Pentalyn 856" 35.00 Methyl ethyl ketone 35.00 Methanol 70.00 m-benzenesisulfonic acid 0.50 Methyl violet base 1.00 141.50 Example 9.
"Krumbar 1717 HMP" 15,00 Isopropylalkohol 36,00 Metanol 25,70 Metyletylketon 14,00 Mgclz 2,00 Rodaminbas FB 0,80 Petrexsyra SS 70 A 2,50 96,00 Exempel 10."Krumbar 1717 HMP" 15.00 Isopropyl alcohol 36.00 Methanol 25.70 Methyl ethyl ketone 14.00 Mgclz 2.00 Rhodamine base FB 0.80 Petrexic acid SS 70 A 2.50 96.00 Example 10.
Triazin-formaldehydharts såld såsom "Uformite-336" av Rohm & Haas Chemical Corp., Philadelphia, Pennsylvania 41,00 Metyletylketon 85,00 Heptanon 13,00 Paratoluensulfonsyra 2,00 Viktoriablåttbas 1,00 143,00 De föregående strâlbläcken tillhandahåller utmärkt adhesion till praktiskt taget varje substrat, som visas i mer än 500 tim- mars livslängdsförsök, utmärkt gnidningshärdighet, utmärkta termo- tropa egenskaper under ångbehandlingsförloppet och pastörisering, och utmärkt resistans mot vatten.Triazine-formaldehyde resin sold as "Uformite-336" by Rohm & Haas Chemical Corp., Philadelphia, Pennsylvania 41.00 Methyl ethyl ketone 85.00 Heptanone 13.00 Paratoluenesulfonic acid 2.00 Victoria Blue Base 1.00 143.00 The foregoing ray inks provide excellent adhesion to virtually any substrate, which is displayed for more than 500 hours. March service life, excellent abrasion resistance, excellent thermal tropical properties during the steam treatment process and pasteurization, and excellent resistance to water.
Det är önskvärt att endast sådan begränsning pålägges de bifogade kraven, som är uppgiven däri. Såvida inte annat angives är alla delar viktdelar. uIt is desirable that only such a restriction be imposed on them attached requirements, which are set out therein. Unless otherwise stated are all parts by weight. u
Claims (8)
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US78157577A | 1977-03-28 | 1977-03-28 |
Publications (2)
Publication Number | Publication Date |
---|---|
SE7803316L SE7803316L (en) | 1978-09-29 |
SE437997B true SE437997B (en) | 1985-03-25 |
Family
ID=25123208
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
SE7803316A SE437997B (en) | 1977-03-28 | 1978-03-22 | NON-WATERLY BOTTOM BLACK COMPOSITION WITH HIGH TORQUE CONTENT |
Country Status (15)
Country | Link |
---|---|
JP (1) | JPS53123210A (en) |
AU (1) | AU515542B2 (en) |
BE (1) | BE865206A (en) |
CH (1) | CH639413A5 (en) |
DE (1) | DE2812364A1 (en) |
DK (1) | DK133078A (en) |
ES (1) | ES468239A1 (en) |
FR (1) | FR2385782A1 (en) |
GB (1) | GB1603062A (en) |
IT (1) | IT1103082B (en) |
NL (1) | NL7803273A (en) |
NO (1) | NO781044L (en) |
NZ (1) | NZ186690A (en) |
PL (1) | PL205552A1 (en) |
SE (1) | SE437997B (en) |
Families Citing this family (24)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JPS53123208A (en) * | 1977-04-02 | 1978-10-27 | Dainippon Toryo Kk | Aqueous marking ink |
JPS5550073A (en) * | 1978-10-05 | 1980-04-11 | Dainippon Toryo Co Ltd | Jet printing ink |
US4260531A (en) * | 1979-07-02 | 1981-04-07 | A. B. Dick Company | Ink composition for printing on polyolefin |
DE2966788D1 (en) * | 1979-08-15 | 1984-04-19 | American Can Co | Contactless jet printing method, printing ink composition therefor, and articles including containers bearing indicia, printed using said composition |
US4290072A (en) * | 1980-01-28 | 1981-09-15 | American Can Company | Opaque jet ink printing method and composition |
DE3239864A1 (en) * | 1982-10-27 | 1984-05-03 | Siemens AG, 1000 Berlin und 8000 München | Coating for a recording device for recording non-absorbing recording media |
DE3306786A1 (en) * | 1983-02-26 | 1984-08-30 | Fa. J.S. Staedtler, 8500 Nürnberg | WRITING FLUID |
US4465800A (en) * | 1983-03-10 | 1984-08-14 | A. B. Dick Company | Ink composition for ink jet printing |
JPS6076574A (en) * | 1983-10-03 | 1985-05-01 | Tokyo Ohka Kogyo Co Ltd | Ink composition for ink-jet recording |
JPS60118767A (en) * | 1983-11-30 | 1985-06-26 | Tokyo Ohka Kogyo Co Ltd | White ink composition for jet printing |
DE3545625A1 (en) * | 1985-12-21 | 1987-06-25 | Dataprint Datendrucksysteme R | Water-free, liquid recording material |
DE4013456A1 (en) * | 1990-04-27 | 1991-10-31 | Beck & Co Ag Dr | TEMPERATURE AND SOLVENT RESISTANT INK FOR THE JET PRINTING PROCESS |
GB9100614D0 (en) * | 1991-01-11 | 1991-02-27 | Xaar Ltd | Ink composition |
US5478383A (en) * | 1993-10-14 | 1995-12-26 | Canon Kabushiki Kaisha | Ink, and ink-jet recording method and instrument using the same |
CA2188428A1 (en) * | 1994-04-25 | 1995-11-02 | Videojet Systems International, Inc. | An ink composition for use with textiles |
US5510415A (en) * | 1994-04-25 | 1996-04-23 | Videojet Systems, Inc. | Ink jet composition for printing on textiles |
US6010564A (en) * | 1997-10-16 | 2000-01-04 | Videojet Systems International, Inc. | Jet ink composition |
US6444019B1 (en) * | 1998-11-06 | 2002-09-03 | Videojet Technologies Inc. | Ink jet ink composition |
US6726756B1 (en) | 2000-05-26 | 2004-04-27 | Videojet Technologies Inc. | Continuous ink jet printing ink composition |
DE10103851A1 (en) * | 2001-01-30 | 2002-08-14 | Staedtler Fa J S | Ink for ink jet printing and its use |
JP4984800B2 (en) * | 2005-09-30 | 2012-07-25 | Dic株式会社 | Ink for jet printer |
US20090246484A1 (en) * | 2005-09-30 | 2009-10-01 | Dainippon Ink And Chemicals, Inc. | Ink for jet printer |
JP5463130B2 (en) * | 2009-12-10 | 2014-04-09 | 株式会社ミマキエンジニアリング | ink |
CN104946012B (en) * | 2014-03-27 | 2018-05-01 | 佛山市高明绿色德化工有限公司 | Color crystal glass ink and its production method |
Family Cites Families (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US3903034A (en) * | 1970-12-07 | 1975-09-02 | Dick Co Ab | Offset jet printing ink |
US4021252A (en) * | 1973-10-31 | 1977-05-03 | American Can Company | Jet printing ink composition |
JPS5214644B2 (en) * | 1974-09-03 | 1977-04-23 | ||
US4045397A (en) * | 1975-04-24 | 1977-08-30 | Dean Burton Parkinson | Printing ink compositions for jet printing on glazed ceramic surfaces |
US4024096A (en) * | 1975-07-07 | 1977-05-17 | A. B. Dick Company | Jet printing ink composition for glass |
JPS5315905A (en) * | 1976-07-28 | 1978-02-14 | Tokyo Ouka Kougiyou Kk | Method of making offset plate material |
-
1978
- 1978-03-14 NZ NZ186690A patent/NZ186690A/en unknown
- 1978-03-20 CH CH301778A patent/CH639413A5/en not_active IP Right Cessation
- 1978-03-21 FR FR7808134A patent/FR2385782A1/en active Granted
- 1978-03-21 DE DE19782812364 patent/DE2812364A1/en active Granted
- 1978-03-22 SE SE7803316A patent/SE437997B/en not_active IP Right Cessation
- 1978-03-22 NO NO781044A patent/NO781044L/en unknown
- 1978-03-22 DK DK133078A patent/DK133078A/en not_active Application Discontinuation
- 1978-03-22 BE BE186197A patent/BE865206A/en not_active IP Right Cessation
- 1978-03-23 GB GB11803/78A patent/GB1603062A/en not_active Expired
- 1978-03-23 AU AU34468/78A patent/AU515542B2/en not_active Expired
- 1978-03-24 PL PL20555278A patent/PL205552A1/en unknown
- 1978-03-24 IT IT09390/78A patent/IT1103082B/en active
- 1978-03-27 ES ES468239A patent/ES468239A1/en not_active Expired
- 1978-03-28 JP JP3491878A patent/JPS53123210A/en active Granted
- 1978-03-28 NL NL7803273A patent/NL7803273A/en not_active Application Discontinuation
Also Published As
Publication number | Publication date |
---|---|
IT1103082B (en) | 1985-10-14 |
FR2385782B1 (en) | 1984-10-19 |
FR2385782A1 (en) | 1978-10-27 |
DK133078A (en) | 1978-09-29 |
DE2812364C2 (en) | 1988-12-01 |
NL7803273A (en) | 1978-10-02 |
CH639413A5 (en) | 1983-11-15 |
NO781044L (en) | 1978-09-29 |
AU515542B2 (en) | 1981-04-09 |
PL205552A1 (en) | 1978-12-04 |
IT7809390A0 (en) | 1978-03-24 |
JPS53123210A (en) | 1978-10-27 |
AU3446878A (en) | 1979-09-27 |
NZ186690A (en) | 1979-10-25 |
SE7803316L (en) | 1978-09-29 |
JPS6221032B2 (en) | 1987-05-11 |
ES468239A1 (en) | 1979-09-16 |
BE865206A (en) | 1978-07-17 |
DE2812364A1 (en) | 1978-10-05 |
GB1603062A (en) | 1981-11-18 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
SE437997B (en) | NON-WATERLY BOTTOM BLACK COMPOSITION WITH HIGH TORQUE CONTENT | |
US5889084A (en) | UV or visible light initiated cationic cured ink for ink jet printing | |
EP0408333B1 (en) | Jet printing ink and method | |
CN1058742C (en) | Mimeograph for marking hole free carrier | |
US5389130A (en) | Printing ink emulsion having reduced VOC | |
CN101541893B (en) | Solvent-based ink composition | |
JP3062553B2 (en) | Inkjet printer dispersion ink | |
US4207577A (en) | Opaque jet inks | |
US4402262A (en) | Printing process and printing compositions | |
JPH06116521A (en) | Resin binder for use in jet printing ink composition | |
CN101090951A (en) | A printing ink | |
JP2017061637A (en) | Inkjet Ink | |
DE1268631B (en) | Printing ink | |
US2220621A (en) | Printing ink | |
US3666502A (en) | Lithographic inks and solutions for treating lithographic plates | |
GB2031448A (en) | Water based jet inks | |
JP2020094084A (en) | Aqueous inkjet ink and inkjet recording method | |
EP0050873B1 (en) | An ink composition for use in dry planographic printing | |
US3373131A (en) | Epoxy resin compositions and novel inks containing the same | |
JP2006298948A (en) | Waterless lithographic printing ink composition | |
JP3134277B2 (en) | Marking ink for jet printer | |
JPS60229785A (en) | Wet paper printing | |
DE1221651B (en) | Printing ink | |
JPS58209586A (en) | Marking method | |
EP0011480A2 (en) | Magnetic jet ink printing |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
NUG | Patent has lapsed |
Ref document number: 7803316-4 Effective date: 19890426 Format of ref document f/p: F |