RU2815197C2 - Triamterene or nolatrexed for use in treating phenylketonuria - Google Patents
Triamterene or nolatrexed for use in treating phenylketonuria Download PDFInfo
- Publication number
- RU2815197C2 RU2815197C2 RU2021123366A RU2021123366A RU2815197C2 RU 2815197 C2 RU2815197 C2 RU 2815197C2 RU 2021123366 A RU2021123366 A RU 2021123366A RU 2021123366 A RU2021123366 A RU 2021123366A RU 2815197 C2 RU2815197 C2 RU 2815197C2
- Authority
- RU
- Russia
- Prior art keywords
- phenylketonuria
- compound
- pharmaceutically acceptable
- triamterene
- acceptable salt
- Prior art date
Links
- 201000011252 Phenylketonuria Diseases 0.000 title claims abstract description 81
- FNYLWPVRPXGIIP-UHFFFAOYSA-N Triamterene Chemical compound NC1=NC2=NC(N)=NC(N)=C2N=C1C1=CC=CC=C1 FNYLWPVRPXGIIP-UHFFFAOYSA-N 0.000 title claims abstract description 67
- 229960001288 triamterene Drugs 0.000 title claims abstract description 66
- XHWRWCSCBDLOLM-UHFFFAOYSA-N nolatrexed Chemical compound CC1=CC=C2NC(N)=NC(=O)C2=C1SC1=CC=NC=C1 XHWRWCSCBDLOLM-UHFFFAOYSA-N 0.000 title claims abstract description 56
- 229950000891 nolatrexed Drugs 0.000 title claims abstract description 55
- 150000001875 compounds Chemical class 0.000 claims abstract description 159
- 150000003839 salts Chemical class 0.000 claims abstract description 91
- 238000011282 treatment Methods 0.000 claims abstract description 39
- YOJQZPVUNUQTDF-UHFFFAOYSA-N hydrastinine Chemical compound C1=C2C(O)N(C)CCC2=CC2=C1OCO2 YOJQZPVUNUQTDF-UHFFFAOYSA-N 0.000 claims abstract description 32
- -1 oxytriptan Chemical compound 0.000 claims abstract description 29
- FNKQXYHWGSIFBK-RPDRRWSUSA-N sapropterin Chemical compound N1=C(N)NC(=O)C2=C1NC[C@H]([C@@H](O)[C@@H](O)C)N2 FNKQXYHWGSIFBK-RPDRRWSUSA-N 0.000 claims abstract description 28
- VXTGHWHFYNYFFV-UHFFFAOYSA-N albendazole S-oxide Chemical compound CCCS(=O)C1=CC=C2NC(NC(=O)OC)=NC2=C1 VXTGHWHFYNYFFV-UHFFFAOYSA-N 0.000 claims abstract description 25
- VDCRFBBZFHHYGT-IOSLPCCCSA-N 2-amino-9-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-7-prop-2-enyl-3h-purine-6,8-dione Chemical compound O=C1N(CC=C)C=2C(=O)NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O VDCRFBBZFHHYGT-IOSLPCCCSA-N 0.000 claims abstract description 23
- ZFMITUMMTDLWHR-UHFFFAOYSA-N Minoxidil Chemical compound NC1=[N+]([O-])C(N)=CC(N2CCCCC2)=N1 ZFMITUMMTDLWHR-UHFFFAOYSA-N 0.000 claims abstract description 23
- HXHWSAZORRCQMX-UHFFFAOYSA-N albendazole Chemical compound CCCSC1=CC=C2NC(NC(=O)OC)=NC2=C1 HXHWSAZORRCQMX-UHFFFAOYSA-N 0.000 claims abstract description 23
- WPVFJKSGQUFQAP-GKAPJAKFSA-N Valcyte Chemical compound N1C(N)=NC(=O)C2=C1N(COC(CO)COC(=O)[C@@H](N)C(C)C)C=N2 WPVFJKSGQUFQAP-GKAPJAKFSA-N 0.000 claims abstract description 22
- 229950005634 loxoribine Drugs 0.000 claims abstract description 22
- 229960003632 minoxidil Drugs 0.000 claims abstract description 22
- HDOVUKNUBWVHOX-QMMMGPOBSA-N Valacyclovir Chemical compound N1C(N)=NC(=O)C2=C1N(COCCOC(=O)[C@@H](N)C(C)C)C=N2 HDOVUKNUBWVHOX-QMMMGPOBSA-N 0.000 claims abstract description 21
- 229960002669 albendazole Drugs 0.000 claims abstract description 21
- VPVOXUSPXFPWBN-VKHMYHEASA-N sepiapterin Chemical compound N1C(N)=NC(=O)C2=C1NCC(C(=O)[C@@H](O)C)=N2 VPVOXUSPXFPWBN-VKHMYHEASA-N 0.000 claims abstract description 21
- 229960002149 valganciclovir Drugs 0.000 claims abstract description 21
- SSEBTPPFLLCUMN-CYBMUJFWSA-N (1r)-2-(tert-butylamino)-1-(7-ethyl-1-benzofuran-2-yl)ethanol Chemical compound CCC1=CC=CC2=C1OC([C@H](O)CNC(C)(C)C)=C2 SSEBTPPFLLCUMN-CYBMUJFWSA-N 0.000 claims abstract description 20
- VPVOXUSPXFPWBN-UHFFFAOYSA-N L-sepiapterin Natural products N1=C(N)NC(=O)C2=C1NCC(C(=O)C(O)C)=N2 VPVOXUSPXFPWBN-UHFFFAOYSA-N 0.000 claims abstract description 20
- 229950006886 bufuralol Drugs 0.000 claims abstract description 20
- 229940126478 sepiapterin Drugs 0.000 claims abstract description 20
- 229940093257 valacyclovir Drugs 0.000 claims abstract description 20
- 230000002265 prevention Effects 0.000 claims abstract description 17
- 108010024815 pegvaliase Proteins 0.000 claims abstract description 16
- NPOCDVAOUKODSQ-ZDUSSCGKSA-N (2s)-2-amino-6-[6-(2-methoxyethoxy)hexanoylamino]hexanoic acid Chemical compound COCCOCCCCCC(=O)NCCCC[C@H](N)C(O)=O NPOCDVAOUKODSQ-ZDUSSCGKSA-N 0.000 claims abstract description 15
- WKSAUQYGYAYLPV-UHFFFAOYSA-N pyrimethamine Chemical compound CCC1=NC(N)=NC(N)=C1C1=CC=C(Cl)C=C1 WKSAUQYGYAYLPV-UHFFFAOYSA-N 0.000 claims abstract description 15
- 229950009453 pegvaliase Drugs 0.000 claims abstract description 14
- 229960000611 pyrimethamine Drugs 0.000 claims abstract description 14
- 229960004617 sapropterin Drugs 0.000 claims abstract description 13
- 239000003814 drug Substances 0.000 claims abstract description 12
- 238000002360 preparation method Methods 0.000 claims abstract description 12
- 208000014252 Mild phenylketonuria Diseases 0.000 claims description 18
- 208000014249 Classic phenylketonuria Diseases 0.000 claims description 8
- BKTRENAPTCBBFA-UHFFFAOYSA-N 4-[2-(4-hydroxy-3-phenylphenyl)propan-2-yl]-2-phenylphenol Chemical compound C=1C=C(O)C(C=2C=CC=CC=2)=CC=1C(C)(C)C(C=1)=CC=C(O)C=1C1=CC=CC=C1 BKTRENAPTCBBFA-UHFFFAOYSA-N 0.000 claims description 5
- 230000000694 effects Effects 0.000 abstract description 28
- 239000000126 substance Substances 0.000 abstract description 18
- 239000004480 active ingredient Substances 0.000 abstract description 6
- 229940079593 drug Drugs 0.000 abstract description 4
- 102100038223 Phenylalanine-4-hydroxylase Human genes 0.000 description 43
- 101710125939 Phenylalanine-4-hydroxylase Proteins 0.000 description 36
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 30
- 229960005190 phenylalanine Drugs 0.000 description 27
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 26
- 210000004027 cell Anatomy 0.000 description 24
- 108090000623 proteins and genes Proteins 0.000 description 21
- 102200031316 rs5030849 Human genes 0.000 description 21
- 239000012458 free base Substances 0.000 description 20
- 102000004169 proteins and genes Human genes 0.000 description 20
- 102000004190 Enzymes Human genes 0.000 description 19
- 108090000790 Enzymes Proteins 0.000 description 19
- 239000000203 mixture Substances 0.000 description 17
- 235000018102 proteins Nutrition 0.000 description 17
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 13
- 238000000034 method Methods 0.000 description 12
- 239000008280 blood Substances 0.000 description 11
- 210000004369 blood Anatomy 0.000 description 11
- 229940024606 amino acid Drugs 0.000 description 10
- 235000001014 amino acid Nutrition 0.000 description 10
- 150000001413 amino acids Chemical class 0.000 description 10
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 10
- 229960004441 tyrosine Drugs 0.000 description 10
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 9
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 9
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 9
- 108010069013 Phenylalanine Hydroxylase Proteins 0.000 description 9
- 201000010099 disease Diseases 0.000 description 9
- 230000035772 mutation Effects 0.000 description 8
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 8
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 7
- 239000013641 positive control Substances 0.000 description 7
- 102200027736 rs5030841 Human genes 0.000 description 7
- 102200027925 rs5030843 Human genes 0.000 description 7
- 102200031487 rs5030853 Human genes 0.000 description 7
- 102200031113 rs5030856 Human genes 0.000 description 7
- 102200031135 rs5030858 Human genes 0.000 description 7
- 102200031139 rs5030860 Human genes 0.000 description 7
- 102200031443 rs62508730 Human genes 0.000 description 7
- 102200031097 rs62516092 Human genes 0.000 description 7
- 102200031124 rs62516101 Human genes 0.000 description 7
- 102200031493 rs62642934 Human genes 0.000 description 7
- 102200031486 rs62642939 Human genes 0.000 description 7
- 102200031138 rs62644499 Human genes 0.000 description 7
- 102200027763 rs75193786 Human genes 0.000 description 7
- 239000004475 Arginine Substances 0.000 description 6
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 6
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 6
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 6
- 239000002253 acid Substances 0.000 description 6
- 238000004458 analytical method Methods 0.000 description 6
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 6
- DLNQCQJCIITVHC-UHFFFAOYSA-N hydron;6-methyl-7,8-dihydro-5h-[1,3]dioxolo[4,5-g]isoquinolin-5-ol;chloride Chemical compound Cl.C1=C2C(O)N(C)CCC2=CC2=C1OCO2 DLNQCQJCIITVHC-UHFFFAOYSA-N 0.000 description 6
- 229920000136 polysorbate Polymers 0.000 description 6
- 239000004474 valine Substances 0.000 description 6
- 230000008859 change Effects 0.000 description 5
- 235000005911 diet Nutrition 0.000 description 5
- 238000004128 high performance liquid chromatography Methods 0.000 description 5
- 238000002347 injection Methods 0.000 description 5
- 239000007924 injection Substances 0.000 description 5
- 238000000111 isothermal titration calorimetry Methods 0.000 description 5
- 239000008194 pharmaceutical composition Substances 0.000 description 5
- 239000000546 pharmaceutical excipient Substances 0.000 description 5
- 230000001105 regulatory effect Effects 0.000 description 5
- 102200031275 rs76212747 Human genes 0.000 description 5
- 239000000243 solution Substances 0.000 description 5
- 230000007704 transition Effects 0.000 description 5
- QCQCHGYLTSGIGX-GHXANHINSA-N 4-[[(3ar,5ar,5br,7ar,9s,11ar,11br,13as)-5a,5b,8,8,11a-pentamethyl-3a-[(5-methylpyridine-3-carbonyl)amino]-2-oxo-1-propan-2-yl-4,5,6,7,7a,9,10,11,11b,12,13,13a-dodecahydro-3h-cyclopenta[a]chrysen-9-yl]oxy]-2,2-dimethyl-4-oxobutanoic acid Chemical class N([C@@]12CC[C@@]3(C)[C@]4(C)CC[C@H]5C(C)(C)[C@@H](OC(=O)CC(C)(C)C(O)=O)CC[C@]5(C)[C@H]4CC[C@@H]3C1=C(C(C2)=O)C(C)C)C(=O)C1=CN=CC(C)=C1 QCQCHGYLTSGIGX-GHXANHINSA-N 0.000 description 4
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 4
- 101100221606 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) COS7 gene Proteins 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- 235000004279 alanine Nutrition 0.000 description 4
- 238000003556 assay Methods 0.000 description 4
- 239000002585 base Substances 0.000 description 4
- 238000004925 denaturation Methods 0.000 description 4
- 230000036425 denaturation Effects 0.000 description 4
- 239000003446 ligand Substances 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 102220176138 rs886049510 Human genes 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 3
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 3
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 101000604901 Homo sapiens Phenylalanine-4-hydroxylase Proteins 0.000 description 3
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 3
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 108700023158 Phenylalanine ammonia-lyases Proteins 0.000 description 3
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 230000037213 diet Effects 0.000 description 3
- 238000002022 differential scanning fluorescence spectroscopy Methods 0.000 description 3
- 230000002255 enzymatic effect Effects 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 235000013336 milk Nutrition 0.000 description 3
- 239000008267 milk Substances 0.000 description 3
- 210000004080 milk Anatomy 0.000 description 3
- 102200031320 rs5030847 Human genes 0.000 description 3
- 102200031364 rs5030851 Human genes 0.000 description 3
- 102200031140 rs5030857 Human genes 0.000 description 3
- 102200031099 rs62508646 Human genes 0.000 description 3
- 102200031361 rs62508698 Human genes 0.000 description 3
- RKSUYBCOVNCALL-NTVURLEBSA-N sapropterin dihydrochloride Chemical compound Cl.Cl.N1=C(N)NC(=O)C2=C1NC[C@H]([C@@H](O)[C@@H](O)C)N2 RKSUYBCOVNCALL-NTVURLEBSA-N 0.000 description 3
- 208000024891 symptom Diseases 0.000 description 3
- HNSDLXPSAYFUHK-UHFFFAOYSA-N 1,4-bis(2-ethylhexyl) sulfosuccinate Chemical compound CCCCC(CC)COC(=O)CC(S(O)(=O)=O)C(=O)OCC(CC)CCCC HNSDLXPSAYFUHK-UHFFFAOYSA-N 0.000 description 2
- KJBONRGCLLBWCJ-UHFFFAOYSA-N 2-(tert-butylamino)-1-(7-ethyl-1-benzofuran-2-yl)ethanol;hydron;chloride Chemical compound Cl.CCC1=CC=CC2=C1OC(C(O)CNC(C)(C)C)=C2 KJBONRGCLLBWCJ-UHFFFAOYSA-N 0.000 description 2
- HZAXFHJVJLSVMW-UHFFFAOYSA-N 2-Aminoethan-1-ol Chemical compound NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 description 2
- PJKVJJYMWOCLIJ-UHFFFAOYSA-N 2-amino-6-methyl-5-pyridin-4-ylsulfanyl-1h-quinazolin-4-one;hydron;dichloride Chemical compound Cl.Cl.CC1=CC=C2NC(N)=NC(=O)C2=C1SC1=CC=NC=C1 PJKVJJYMWOCLIJ-UHFFFAOYSA-N 0.000 description 2
- LDCYZAJDBXYCGN-VIFPVBQESA-N 5-hydroxy-L-tryptophan Chemical compound C1=C(O)C=C2C(C[C@H](N)C(O)=O)=CNC2=C1 LDCYZAJDBXYCGN-VIFPVBQESA-N 0.000 description 2
- QGZKDVFQNNGYKY-UHFFFAOYSA-N Ammonia Chemical compound N QGZKDVFQNNGYKY-UHFFFAOYSA-N 0.000 description 2
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 239000007995 HEPES buffer Substances 0.000 description 2
- JZUTXVTYJDCMDU-MOPGFXCFSA-N Hydrastine Chemical compound CN1CCC2=CC=3OCOC=3C=C2[C@@H]1[C@@H]1C2=CC=C(OC)C(OC)=C2C(=O)O1 JZUTXVTYJDCMDU-MOPGFXCFSA-N 0.000 description 2
- CRAVBINFWZGLSC-UHFFFAOYSA-N Hydrastine Natural products COC1=C(OC)C2C(C=C1)C(OC2=O)C3N(C)CCc4cc5OCOc5cc34 CRAVBINFWZGLSC-UHFFFAOYSA-N 0.000 description 2
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 2
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 2
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 2
- 108020005067 RNA Splice Sites Proteins 0.000 description 2
- UNRHXEPDKXPRTM-UHFFFAOYSA-N Sultopride Chemical compound CCN1CCCC1CNC(=O)C1=CC(S(=O)(=O)CC)=CC=C1OC UNRHXEPDKXPRTM-UHFFFAOYSA-N 0.000 description 2
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 2
- ZCDDBUOENGJMLV-QRPNPIFTSA-N Valacyclovir hydrochloride Chemical compound Cl.N1C(N)=NC(=O)C2=C1N(COCCOC(=O)[C@@H](N)C(C)C)C=N2 ZCDDBUOENGJMLV-QRPNPIFTSA-N 0.000 description 2
- 229910052783 alkali metal Inorganic materials 0.000 description 2
- 230000000507 anthelmentic effect Effects 0.000 description 2
- 230000001430 anti-depressive effect Effects 0.000 description 2
- 239000000935 antidepressant agent Substances 0.000 description 2
- 229940005513 antidepressants Drugs 0.000 description 2
- 239000003443 antiviral agent Substances 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- 230000006931 brain damage Effects 0.000 description 2
- 231100000874 brain damage Toxicity 0.000 description 2
- 208000029028 brain injury Diseases 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- JZUTXVTYJDCMDU-UHFFFAOYSA-N d-alpha-hydrastine Natural products CN1CCC2=CC=3OCOC=3C=C2C1C1C2=CC=C(OC)C(OC)=C2C(=O)O1 JZUTXVTYJDCMDU-UHFFFAOYSA-N 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 230000000378 dietary effect Effects 0.000 description 2
- 239000000975 dye Substances 0.000 description 2
- 229930195712 glutamate Natural products 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 229930005369 hydrastine Natural products 0.000 description 2
- 238000005805 hydroxylation reaction Methods 0.000 description 2
- 238000003384 imaging method Methods 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 239000006166 lysate Substances 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 229910052751 metal Chemical class 0.000 description 2
- 239000002184 metal Chemical class 0.000 description 2
- 208000026770 mild hyperphenylalaninemia Diseases 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 230000007935 neutral effect Effects 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 235000019198 oils Nutrition 0.000 description 2
- 101150036331 pah gene Proteins 0.000 description 2
- 239000002831 pharmacologic agent Substances 0.000 description 2
- 238000001050 pharmacotherapy Methods 0.000 description 2
- 229910052700 potassium Inorganic materials 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 230000006432 protein unfolding Effects 0.000 description 2
- 238000003753 real-time PCR Methods 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 239000012146 running buffer Substances 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 230000006641 stabilisation Effects 0.000 description 2
- 238000011105 stabilization Methods 0.000 description 2
- 230000000087 stabilizing effect Effects 0.000 description 2
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 2
- URBFHJWLYXILMP-VOMIJIAVSA-N (3s)-6,7-dimethoxy-3-[(5r)-6-methyl-7,8-dihydro-5h-[1,3]dioxolo[4,5-g]isoquinolin-5-yl]-3h-2-benzofuran-1-one;hydron;chloride Chemical compound Cl.CN1CCC2=CC=3OCOC=3C=C2[C@@H]1[C@@H]1C2=CC=C(OC)C(OC)=C2C(=O)O1 URBFHJWLYXILMP-VOMIJIAVSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- WBYWAXJHAXSJNI-VOTSOKGWSA-M .beta-Phenylacrylic acid Natural products [O-]C(=O)\C=C\C1=CC=CC=C1 WBYWAXJHAXSJNI-VOTSOKGWSA-M 0.000 description 1
- FNKQXYHWGSIFBK-RSJRKSSKSA-N 2-amino-6-[(1s,2r)-1,2-dihydroxypropyl]-5,6,7,8-tetrahydro-1h-pteridin-4-one Chemical compound N1C(N)=NC(=O)C2=C1NCC([C@H](O)[C@H](O)C)N2 FNKQXYHWGSIFBK-RSJRKSSKSA-N 0.000 description 1
- 208000030507 AIDS Diseases 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 206010067484 Adverse reaction Diseases 0.000 description 1
- 201000004384 Alopecia Diseases 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- SSEBTPPFLLCUMN-UHFFFAOYSA-N Bufuralol Chemical compound CCC1=CC=CC2=C1OC(C(O)CNC(C)(C)C)=C2 SSEBTPPFLLCUMN-UHFFFAOYSA-N 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 102000016938 Catalase Human genes 0.000 description 1
- 108010053835 Catalase Proteins 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 206010010904 Convulsion Diseases 0.000 description 1
- 206010011831 Cytomegalovirus infection Diseases 0.000 description 1
- 206010012559 Developmental delay Diseases 0.000 description 1
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 1
- PIICEJLVQHRZGT-UHFFFAOYSA-N Ethylenediamine Chemical compound NCCN PIICEJLVQHRZGT-UHFFFAOYSA-N 0.000 description 1
- 206010055690 Foetal death Diseases 0.000 description 1
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 1
- 206010064571 Gene mutation Diseases 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- TWTPDFFBLQEBOE-IUCAKERBSA-N Gly-Leu-Gln Chemical compound [H]NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O TWTPDFFBLQEBOE-IUCAKERBSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 206010019973 Herpes virus infection Diseases 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-N Hydrogen bromide Chemical compound Br CPELXLSAUQHCOX-UHFFFAOYSA-N 0.000 description 1
- 206010020772 Hypertension Diseases 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 201000006347 Intellectual Disability Diseases 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- 238000012897 Levenberg–Marquardt algorithm Methods 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 206010027374 Mental impairment Diseases 0.000 description 1
- 208000036626 Mental retardation Diseases 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 1
- 102000008300 Mutant Proteins Human genes 0.000 description 1
- 108010021466 Mutant Proteins Proteins 0.000 description 1
- 229910002651 NO3 Inorganic materials 0.000 description 1
- 208000012902 Nervous system disease Diseases 0.000 description 1
- NHNBFGGVMKEFGY-UHFFFAOYSA-N Nitrate Chemical compound [O-][N+]([O-])=O NHNBFGGVMKEFGY-UHFFFAOYSA-N 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- MUBZPKHOEPUJKR-UHFFFAOYSA-N Oxalic acid Chemical compound OC(=O)C(O)=O MUBZPKHOEPUJKR-UHFFFAOYSA-N 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- 206010069116 Tetrahydrobiopterin deficiency Diseases 0.000 description 1
- 208000037063 Thinness Diseases 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 201000005485 Toxoplasmosis Diseases 0.000 description 1
- GSEJCLTVZPLZKY-UHFFFAOYSA-N Triethanolamine Chemical compound OCCN(CCO)CCO GSEJCLTVZPLZKY-UHFFFAOYSA-N 0.000 description 1
- ZORWARFPXPVJLW-MTFPJWTKSA-N [2-[(2-amino-6-oxo-3h-purin-9-yl)methoxy]-3-hydroxypropyl] (2s)-2-amino-3-methylbutanoate;hydron;chloride Chemical compound Cl.N1C(N)=NC(=O)C2=C1N(COC(CO)COC(=O)[C@@H](N)C(C)C)C=N2 ZORWARFPXPVJLW-MTFPJWTKSA-N 0.000 description 1
- 206010000059 abdominal discomfort Diseases 0.000 description 1
- 230000001594 aberrant effect Effects 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 239000000674 adrenergic antagonist Substances 0.000 description 1
- 230000006838 adverse reaction Effects 0.000 description 1
- 150000001340 alkali metals Chemical class 0.000 description 1
- 230000000172 allergic effect Effects 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- 229910021529 ammonia Inorganic materials 0.000 description 1
- 229940030225 antihemorrhagics Drugs 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 239000003096 antiparasitic agent Substances 0.000 description 1
- 239000002830 appetite depressant Substances 0.000 description 1
- 239000008122 artificial sweetener Substances 0.000 description 1
- 235000021311 artificial sweeteners Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229940009098 aspartate Drugs 0.000 description 1
- 208000010668 atopic eczema Diseases 0.000 description 1
- 231100000871 behavioral problem Toxicity 0.000 description 1
- 230000003542 behavioural effect Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 102000012740 beta Adrenergic Receptors Human genes 0.000 description 1
- 108010079452 beta Adrenergic Receptors Proteins 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 230000008499 blood brain barrier function Effects 0.000 description 1
- 210000001218 blood-brain barrier Anatomy 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 239000007853 buffer solution Substances 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 239000000496 cardiotonic agent Substances 0.000 description 1
- 230000003177 cardiotonic effect Effects 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 108020001778 catalytic domains Proteins 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 208000028831 congenital heart disease Diseases 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000010217 densitometric analysis Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 238000006073 displacement reaction Methods 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- 239000002934 diuretic Substances 0.000 description 1
- 230000001882 diuretic effect Effects 0.000 description 1
- 208000002173 dizziness Diseases 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 239000003480 eluent Substances 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 238000001952 enzyme assay Methods 0.000 description 1
- 230000005284 excitation Effects 0.000 description 1
- MQLVWQSVRZVNIP-UHFFFAOYSA-L ferrous ammonium sulfate hexahydrate Chemical compound [NH4+].[NH4+].O.O.O.O.O.O.[Fe+2].[O-]S([O-])(=O)=O.[O-]S([O-])(=O)=O MQLVWQSVRZVNIP-UHFFFAOYSA-L 0.000 description 1
- 230000008175 fetal development Effects 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 208000024963 hair loss Diseases 0.000 description 1
- 230000003676 hair loss Effects 0.000 description 1
- 230000005802 health problem Effects 0.000 description 1
- 239000002874 hemostatic agent Substances 0.000 description 1
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 1
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 1
- XMBWDFGMSWQBCA-UHFFFAOYSA-N hydrogen iodide Chemical compound I XMBWDFGMSWQBCA-UHFFFAOYSA-N 0.000 description 1
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 1
- 230000033444 hydroxylation Effects 0.000 description 1
- 230000002519 immonomodulatory effect Effects 0.000 description 1
- 230000008105 immune reaction Effects 0.000 description 1
- 238000003119 immunoblot Methods 0.000 description 1
- 230000003308 immunostimulating effect Effects 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 230000002427 irreversible effect Effects 0.000 description 1
- 238000002334 isothermal calorimetry Methods 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 229910003002 lithium salt Inorganic materials 0.000 description 1
- 159000000002 lithium salts Chemical class 0.000 description 1
- 235000020905 low-protein-diet Nutrition 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 201000004792 malaria Diseases 0.000 description 1
- 229940049920 malate Drugs 0.000 description 1
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 1
- BJEPYKJPYRNKOW-UHFFFAOYSA-N malic acid Chemical compound OC(=O)C(O)CC(O)=O BJEPYKJPYRNKOW-UHFFFAOYSA-N 0.000 description 1
- IWYDHOAUDWTVEP-UHFFFAOYSA-M mandelate Chemical compound [O-]C(=O)C(O)C1=CC=CC=C1 IWYDHOAUDWTVEP-UHFFFAOYSA-M 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 208000030159 metabolic disease Diseases 0.000 description 1
- 239000002207 metabolite Substances 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 208000004141 microcephaly Diseases 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 230000004001 molecular interaction Effects 0.000 description 1
- 230000000926 neurological effect Effects 0.000 description 1
- 210000002569 neuron Anatomy 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 239000012457 nonaqueous media Substances 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 229960002888 oxitriptan Drugs 0.000 description 1
- LDCYZAJDBXYCGN-UHFFFAOYSA-N oxitriptan Natural products C1=C(O)C=C2C(CC(N)C(O)=O)=CNC2=C1 LDCYZAJDBXYCGN-UHFFFAOYSA-N 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 239000003208 petroleum Substances 0.000 description 1
- 229940124531 pharmaceutical excipient Drugs 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 238000011458 pharmacological treatment Methods 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229950008882 polysorbate Drugs 0.000 description 1
- 230000008092 positive effect Effects 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 229940002612 prodrug Drugs 0.000 description 1
- 239000000651 prodrug Substances 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 235000021075 protein intake Nutrition 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- 208000020016 psychiatric disease Diseases 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 229960004209 sapropterin dihydrochloride Drugs 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 238000009097 single-agent therapy Methods 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- RDZTWEVXRGYCFV-UHFFFAOYSA-M sodium 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonate Chemical compound [Na+].OCCN1CCN(CCS([O-])(=O)=O)CC1 RDZTWEVXRGYCFV-UHFFFAOYSA-M 0.000 description 1
- 239000003549 soybean oil Substances 0.000 description 1
- 235000012424 soybean oil Nutrition 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 1
- 229960004724 sultopride Drugs 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 229940095064 tartrate Drugs 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 238000004448 titration Methods 0.000 description 1
- 238000000954 titration curve Methods 0.000 description 1
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- WBYWAXJHAXSJNI-VOTSOKGWSA-N trans-cinnamic acid Chemical compound OC(=O)\C=C\C1=CC=CC=C1 WBYWAXJHAXSJNI-VOTSOKGWSA-N 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- 239000003656 tris buffered saline Substances 0.000 description 1
- 206010048828 underweight Diseases 0.000 description 1
- 229940064636 valacyclovir hydrochloride Drugs 0.000 description 1
- 229960004983 valganciclovir hydrochloride Drugs 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
Abstract
Description
ОБЛАСТЬ ТЕХНИКИTECHNICAL FIELD
Настоящее изобретение относится к соединениям для применения в лечении и/или профилактики фенилкетонурии.The present invention relates to compounds for use in the treatment and/or prevention of phenylketonuria.
Уровень техникиState of the art
Фенилкетонурия (ФКУ), также известная как дефицит фенилаланингидроксилазы, представляет собой редко встречающееся нарушение обмена веществ, характеризующееся нарушением превращения фенилаланина (Phe) в тирозин (Tyr), вследствие чего повышается уровень фенилаланина в крови. Фенилаланин представляет собой аминокислоту, получаемую с пищей, например, в составе белков и некоторых искусственных подсластителей. При отсутствии лечения ФКУ происходящее вследствие этого накопление излишков фенилаланина в крови может вызвать физиологические, неврологические и умственные нарушения.Phenylketonuria (PKU), also known as phenylalanine hydroxylase deficiency, is a rare metabolic disorder characterized by impaired conversion of phenylalanine (Phe) to tyrosine (Tyr), resulting in elevated levels of phenylalanine in the blood. Phenylalanine is an amino acid obtained from food, such as in proteins and some artificial sweeteners. If PKU is left untreated, the resulting accumulation of excess phenylalanine in the blood can cause physiological, neurological and mental impairment.
Признаки и симптомы ФКУ варьируют от легких до тяжелых. Наиболее тяжелая форма данного расстройства известна как классическая ФКУ. Младенцы с классической ФКУ выглядят нормально до тех пор, пока им не исполнится несколько месяцев. При отсутствии лечения у этих детей развивается стойкая умственная отсталость. Также часто имеют место судороги, задержка развития, поведенческие нарушения и психические расстройства. Менее тяжелые формы данного заболевания, иногда называемые вариантной ФКУ и не связанной с ФКУ гиперфенилаланинемией, представляют меньший риск повреждения головного мозга. Людям с очень легкими формами заболевания может не потребоваться лечение диетой с низким содержанием фенилаланина.Signs and symptoms of PKU range from mild to severe. The most severe form of this disorder is known as classic PKU. Babies with classic PKU appear normal until they are several months old. If left untreated, these children develop permanent mental retardation. Seizures, developmental delays, behavioral disturbances, and mental disorders are also common. Less severe forms of the disease, sometimes called variant PKU and non-PKU hyperphenylalaninemia, pose less risk of brain damage. People with very mild forms of the disease may not need treatment with a diet low in phenylalanine.
Младенцы, рожденные от матерей с ФКУ и неконтролируемым уровнем фенилаланина, имеют значительный риск умственной отсталости, поскольку они подвергаются воздействию очень высоких уровней фенилаланина до рождения. Такие младенцы также могут иметь недостаток веса при рождении и расти медленнее, чем другие дети. Другие характерные проблемы со здоровьем включают пороки сердца или иные проблемы с сердцем, микроцефалию и поведенческие нарушения. Женщины с фенилкетонурией и неконтролируемым уровнем фенилаланина также имеют повышенный риск потери беременности.Infants born to mothers with PKU and uncontrolled phenylalanine levels have a significant risk of intellectual disability because they are exposed to very high levels of phenylalanine before birth. These babies may also be underweight at birth and grow more slowly than other children. Other common health problems include heart defects or other heart problems, microcephaly, and behavioral problems. Women with phenylketonuria and uncontrolled phenylalanine levels also have an increased risk of pregnancy loss.
Мутации в гене PAH вызывают фенилкетонурию, поскольку этот ген отвечает за выработку фенилаланингидроксилазы, которая катализирует пара-гидроксилирование фенилаланина до превращения его в тирозин. В случае если генные мутации снижают активность фенилаланингидроксилазы, получаемый из пищи фенилаланин не перерабатывается эффективно. В результате данная аминокислота может накапливаться до токсичных уровней в крови и других тканях. Поскольку нервные клетки мозга особенно чувствительны к уровню фенилаланина, чрезмерное количество этого вещества может вызвать повреждение мозга.Mutations in the PAH gene cause phenylketonuria because this gene is responsible for the production of phenylalanine hydroxylase, which catalyzes the para-hydroxylation of phenylalanine to convert it to tyrosine. If gene mutations reduce the activity of phenylalanine hydroxylase, dietary phenylalanine is not processed efficiently. As a result, this amino acid can accumulate to toxic levels in the blood and other tissues. Because brain nerve cells are especially sensitive to phenylalanine levels, excessive amounts of this substance can cause brain damage.
ФКУ может быть подразделена на классическую ФКУ (примерно 48% случаев), вариантную (или легкую) ФКУ (примерно 24% случаев) и ГФА (гиперфенилаланинемию), не связанную с ФКУ (или легкую ГФА), соответствующую примерно 16% случаев.PKU can be subdivided into classic PKU (approximately 48% of cases), variant (or mild) PKU (approximately 24% of cases), and HPA (hyperphenylalaninemia) not associated with PKU (or mild HPA), corresponding to approximately 16% of cases.
Классическая ФКУ - наиболее тяжелая форма заболевания развивается, когда активность фенилаланингидроксилазы сильно снижена или отсутствует. Мутации в гене PAH, позволяющие ферменту сохранять некоторую активность, приводят к развитию более легких форм данного заболевания, таких как вариантная ФКУ или не связанная с ФКУ гиперфенилаланинемия.Classic PKU, the most severe form of the disease, occurs when phenylalanine hydroxylase activity is severely reduced or absent. Mutations in the PAH gene that allow the enzyme to retain some activity lead to the development of milder forms of the disease, such as variant PKU or non-PKU hyperphenylalaninemia.
Фенилкетонурия считается классической ФКУ, если уровень фенилаланина в крови у субъектов, не получавших лечение, превышает 1200 мкмоль/л, вариантной ФКУ - если уровень фенилаланина в крови у не получавших лечение субъектов составляет от 600 до 1200 мкмоль/л, и не связанной с ФКУ гиперфенилаланинемией (или легкой гиперфенилаланинемией) - если уровень фенилаланина в крови у не получавших лечение субъектов составляет от 120 до 600 мкмоль/л.Phenylketonuria is considered classic PKU if the blood phenylalanine level in untreated subjects is greater than 1200 µmol/L, variant PKU if the blood phenylalanine level in untreated subjects is between 600 and 1200 µmol/L, and non-associated PKU hyperphenylalaninemia (or mild hyperphenylalaninemia) - if the blood phenylalanine level in untreated subjects is between 120 and 600 µmol/L.
На некоторых пациентов с ФКУ положительный эффект оказывает введение BH4, (также известного как (6R)-L-эритро-5,6,7,8-тетрагидробиоптерин или тетрагидробиоптерин, который является важным кофактором при гидроксилировании фенилаланина, катализируемого фенилаланингидроксилазой) в плане того, что уровень фенилаланина в их крови снижается или даже нормализуется при медикаментозном лечении соединением BH4. Процент отзывчивости на лечение соединением BH4 наиболее высок у пациентов с не связанной с ФКУ ГФА или легкой ФКУ, вызванной мутациями PAH, обеспечивающими остаточную активность фермента. Напротив, у пациентов с классической ФКУ процент отзывчивости на лечение ниже.Some patients with PKU benefit from the administration of BH4, (also known as ( 6R )-L- erythro -5,6,7,8-tetrahydrobiopterin or tetrahydrobiopterin, which is an important cofactor in the hydroxylation of phenylalanine catalyzed by phenylalanine hydroxylase) in terms of that the level of phenylalanine in their blood decreases or even normalizes with drug treatment with the BH4 compound. The response rate to treatment with compound BH4 is highest in patients with non-PKU HFA or mild PKU caused by PAH mutations that provide residual enzyme activity. In contrast, patients with classic PKU have a lower response rate to treatment.
Поскольку фармакотерапия ФКУ все еще находится на начальном этапе развития, лечение ФКУ сводилось главным образом к регулированию рациона, а именно к ограничению потребления фенилаланина путем сокращения потребления белка естественного происхождения и замене его источником белка, лишенным фенилаланина, или модифицированной низкобелковой пищей. Такого лечения трудно придерживаться на протяжении всей жизни, и несоблюдение диеты является обычным явлением.Because pharmacotherapy for PKU is still in its infancy, treatment of PKU has focused primarily on dietary management, namely limiting phenylalanine intake by reducing naturally occurring protein intake and replacing it with a phenylalanine-free protein source or a modified low-protein diet. This treatment is difficult to adhere to throughout life, and non-compliance with the diet is common.
Что касается фармакотерапии, то дигидрохлорид сапроптерина, который представляет собой синтетическое соединение дигидрохлоридной соли тетрагидробиоптерина естественного происхождения (BH4), был первым фармакологическим средством для лечения ФКУ и был одобрен FDA (Управлением по санитарному надзору за качеством пищевых продуктов и медикаментов) в 2007 году.In terms of pharmacotherapy, sapropterin dihydrochloride, which is a synthetic compound of the naturally occurring tetrahydrobiopterin dihydrochloride salt (BH4), was the first pharmacological treatment for PKU and was approved by the FDA (Food and Drug Administration) in 2007.
В качестве средства для лечения ФКУ были предложены большие нейтральные аминокислоты (LNAA) по причине их способности блокировать захват фенилаланина из кишечника и через гематоэнцефалический барьер. Однако лечение большими нейтральными аминокислотами в качестве монотерапии беременным женщинам противопоказано, поскольку оно не снижает уровень фенилаланина в крови в достаточной мере до диапазона, безопасного для развития плода.Large neutral amino acids (LNAAs) have been proposed as a treatment for PKU due to their ability to block the uptake of phenylalanine from the intestine and across the blood-brain barrier. However, treatment with large neutral amino acids as monotherapy is contraindicated in pregnant women because it does not sufficiently reduce blood phenylalanine levels to a range that is safe for fetal development.
Кроме того, конъюгированная с полиэтиленгликолем фенилаланинаммиаклиаза (PEG-PAL), по-видимому, является эффективной для снижения уровня фенилаланина в крови, однако сообщалось о некоторых иммунологических реакциях на данное лекарственное средство, и его следует вводить в качестве ежедневной подкожной инъекции. Тем не менее, в 2018 году Palynziq (пегвалиаза-pqpz), состоящий из рекомбинантной фенилаланинаммиаклиазы (rAvPAL), конъюгированной с N-гидроксисукцинимид (NHS)-метоксиполиэтиленгликолем, был одобрен FDA для лечения взрослых, больных ФКУ.Additionally, polyethylene glycol-conjugated phenylalanine ammonia lyase (PEG-PAL) appears to be effective in reducing blood phenylalanine levels, however, some immunological reactions have been reported with this drug and it should be administered as a daily subcutaneous injection. However, in 2018, Palynziq (pegvaliase-pqpz), consisting of recombinant phenylalanine ammonia lyase (rAvPAL) conjugated to N-hydroxysuccinimide (NHS)-methoxypolyethylene glycol, was approved by the FDA for the treatment of adults with PKU.
В связи с ограниченным выбором фармакологических средств для лечения ФКУ, а также в связи с побочными эффектами существующих средств, имеется потребность в новых фармакологических средствах, эффективных для лечения ФКУ.Due to the limited choice of pharmacological agents for the treatment of PKU, as well as due to the side effects of existing agents, there is a need for new pharmacological agents that are effective in the treatment of PKU.
КРАТКОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯBRIEF DESCRIPTION OF THE INVENTION
Авторы настоящего изобретения неожиданным образом обнаружили новые фармакологические стратегии лечения фенилкетонурии. Указанные соединения продемонстрировали положительное действие на активность фермента фенилаланингидроксилазы в плане его стабильности и/или активности как у дикого типа, так и у мутантного фермента (Arg261Gln, который является наиболее часто встречающейся мутацией, реагирующей на BH4).The inventors of the present invention have unexpectedly discovered new pharmacological strategies for the treatment of phenylketonuria. These compounds showed a positive effect on the activity of the phenylalanine hydroxylase enzyme in terms of its stability and/or activity in both the wild type and the mutant enzyme (Arg261Gln, which is the most common BH4-responsive mutation).
Таким образом, в одном аспекте настоящее изобретение относится к соединению, выбранному из группы, состоящей из триамтерена, нолатрекседа, сульфоприда и гидрастинина или их фармацевтически приемлемой соли, предпочтительно к триамтерену, нолатрекседу или их фармацевтически приемлемой соли для применения в лечении и/или профилактике фенилкетонурии (ФКУ).Thus, in one aspect, the present invention provides a compound selected from the group consisting of triamterene, nolatrexed, sulfopride and hydrastinine or a pharmaceutically acceptable salt thereof, preferably triamterene, nolatrexed or a pharmaceutically acceptable salt thereof, for use in the treatment and/or prevention of phenylketonuria (FKU).
В другом аспекте настоящее изобретение относится к применению соединения, выбранного из группы, состоящей из триамтерена, нолатрекседа, сульфоприда и гидрастинина или их фармацевтически приемлемой соли, предпочтительно триамтерена, нолатрекседа или их фармацевтически приемлемой соли для получения лекарственного средства для лечения и/или профилактики фенилкетонурии (ФКУ).In another aspect, the present invention relates to the use of a compound selected from the group consisting of triamterene, nolatrexed, sulfopride and hydrastinine or a pharmaceutically acceptable salt thereof, preferably triamterene, nolatrexed or a pharmaceutically acceptable salt thereof, for the preparation of a medicament for the treatment and/or prevention of phenylketonuria ( FKU).
В еще одном аспекте настоящее изобретение также относится к способу лечения и/или профилактики фенилкетонурии (ФКУ) у субъекта, включающему введение указанному субъекту терапевтически эффективного количества соединения, выбранного из группы, состоящей из триамтерена, нолатрекседа, сульфоприда и гидрастинина или их фармацевтически приемлемой соли, предпочтительно триамтерена, нолатрекседа или их фармацевтически приемлемой соли.In yet another aspect, the present invention also provides a method for treating and/or preventing phenylketonuria (PKU) in a subject, comprising administering to said subject a therapeutically effective amount of a compound selected from the group consisting of triamterene, nolatrexed, sulfopride and hydrastinine, or a pharmaceutically acceptable salt thereof, preferably triamterene, nolatrexed or a pharmaceutically acceptable salt thereof.
В дополнительном аспекте настоящее изобретение относится к комбинации, содержащей одно или более соединений, выбранных из группы, состоящей из триамтерена, нолатрекседа, сульфоприда, гидрастинина, буфуралола, валганцикловира, рикобендазола, альбендазола, валацикловира, миноксидила, локсорибина, сапроптерина, сепиаптерина, окситриптана, пириметамина, пегвалиаза, или их фармацевтически приемлемой соли для применения в лечении и/или профилактике фенилкетонурии, где по меньшей мере одно соединение выбрано из группы, состоящей из триамтерена, нолатрекседа, сульфоприда и гидрастинина или их фармацевтически приемлемой соли, где предпочтительно по меньшей мере одно соединение выбрано из триамтерена и нолатрекседа или их фармацевтически приемлемой соли.In an additional aspect, the present invention relates to a combination containing one or more compounds selected from the group consisting of triamterene, nolatrexed, sulfopride, hydrastinine, bufuralol, valganciclovir, ricobendazole, albendazole, valacyclovir, minoxidil, loxoribine, sapropterin, sepiapterin, oxytriptan, pyrimethamine , pegvaliase, or a pharmaceutically acceptable salt thereof for use in the treatment and/or prevention of phenylketonuria, wherein at least one compound is selected from the group consisting of triamterene, nolatrexed, sulfopride and hydrastinine or a pharmaceutically acceptable salt thereof, wherein at least one compound is preferred selected from triamterene and nolatrexed or a pharmaceutically acceptable salt thereof.
В еще одном аспекте настоящее изобретение относится к применению комбинации, содержащей одно или более соединений, выбранных из группы, состоящей из триамтерена, нолатрекседа, сульфоприда, гидрастинина, буфуралола, валганцикловира, рикобендазола, альбендазола, валацикловира, миноксидила, локсорибина, сапроптерина, сепиаптерина, окситриптана, пириметамина, пегвалиазы или их фармацевтически приемлемой соли для получения лекарственного средства для лечения и/или профилактики фенилкетонурии (ФКУ), где по меньшей мере одно соединение выбрано из группы, состоящей из триамтерена, нолатрекседа, сульфоприда и гидрастинина или их фармацевтически приемлемой соли, где предпочтительно по меньшей мере одно соединение выбрано из группы, состоящей из триамтерена и нолатрекседа или их фармацевтически приемлемой соли.In yet another aspect, the present invention relates to the use of a combination containing one or more compounds selected from the group consisting of triamterene, nolatrexed, sulfopride, hydrastinine, bufuralol, valganciclovir, ricobendazole, albendazole, valacyclovir, minoxidil, loxoribine, sapropterin, sepiapterin, oxytriptan , pyrimethamine, pegvaliase or a pharmaceutically acceptable salt thereof for the preparation of a medicament for the treatment and/or prevention of phenylketonuria (PKU), wherein at least one compound is selected from the group consisting of triamterene, nolatrexed, sulfopride and hydrastinine or a pharmaceutically acceptable salt thereof, wherein preferably at least one compound is selected from the group consisting of triamterene and nolatrexed or a pharmaceutically acceptable salt thereof.
В еще одном аспекте настоящее изобретение относится к способу лечения и/или профилактики фенилкетонурии (ФКУ) у субъекта, включающему введение указанному субъекту терапевтически эффективного количества комбинации, содержащей одно или более соединений, выбранных из группы, состоящей из триамтерена, нолатрекседа, сульфоприда, гидрастинина, буфуралола, валганцикловира, рикобендазола, альбендазола, валацикловира, миноксидила, локсорибина, сапроптерина, сепиаптерина, окситриптана, пириметамина, пегвалиазы или их фармацевтически приемлемой соли, в которой по меньшей мере одно соединение выбрано из группы, состоящей из триамтерена, нолатрекседа, сульфоприда и гидрастинина или их фармацевтически приемлемой соли, где предпочтительно по меньшей мере одно соединение выбрано из группы, состоящей из триамтерена и нолатрекседа или их фармацевтически приемлемой соли.In yet another aspect, the present invention provides a method for treating and/or preventing phenylketonuria (PKU) in a subject, comprising administering to said subject a therapeutically effective amount of a combination containing one or more compounds selected from the group consisting of triamterene, nolatrexed, sulfopride, hydrastinine, bufuralol, valganciclovir, ricobendazole, albendazole, valacyclovir, minoxidil, loxoribine, sapropterin, sepiapterin, oxytriptan, pyrimethamine, pegvaliase or a pharmaceutically acceptable salt thereof, wherein at least one compound is selected from the group consisting of triamterene, nolatrexed, sulfopride and hydrastinine or a pharmaceutically acceptable salt thereof, where preferably at least one compound is selected from the group consisting of triamterene and nolatrexed or a pharmaceutically acceptable salt thereof.
ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯDETAILED DESCRIPTION OF THE INVENTION
В первом аспекте настоящее изобретение относится к соединению, выбранному из группы, состоящей из триамтерена, нолатрекседа, сульфоприда и гидрастинина или их фармацевтически приемлемой соли, предпочтительно к триамтерену, нолатрекседу или их фармацевтически приемлемой соли для применения в лечении и/или профилактике фенилкетонурии (ФКУ).In a first aspect, the present invention relates to a compound selected from the group consisting of triamterene, nolatrexed, sulfopride and hydrastinine or a pharmaceutically acceptable salt thereof, preferably triamterene, nolatrexed or a pharmaceutically acceptable salt thereof, for use in the treatment and/or prevention of phenylketonuria (PKU). .
Настоящее изобретение также относится к применению соединения, выбранного из группы, состоящей из триамтерена, нолатрекседа, сульфоприда и гидрастинина или их фармацевтически приемлемой соли, предпочтительно триамтерена, нолатрекседа или их фармацевтически приемлемой соли для получения лекарственного средства для лечения и/или профилактики фенилкетонурии (ФКУ).The present invention also relates to the use of a compound selected from the group consisting of triamterene, nolatrexed, sulfopride and hydrastinine or a pharmaceutically acceptable salt thereof, preferably triamterene, nolatrexed or a pharmaceutically acceptable salt thereof, for the preparation of a medicament for the treatment and/or prevention of phenylketonuria (PKU). .
Настоящее изобретение также относится к способу лечения и/или профилактики фенилкетонурии (PKU) у субъекта, включающему введение указанному субъекту терапевтически эффективного количества соединения, выбранного из группы, состоящей из триамтерена, нолатрекседа, сульфоприда и гидрастинина или их фармацевтически приемлемой соли, предпочтительно триамтерена, нолатрекседа или их фармацевтически приемлемой соли.The present invention also provides a method for treating and/or preventing phenylketonuria (PKU) in a subject, comprising administering to said subject a therapeutically effective amount of a compound selected from the group consisting of triamterene, nolatrexed, sulfopride and hydrastinine or a pharmaceutically acceptable salt thereof, preferably triamterene, nolatrexed or a pharmaceutically acceptable salt thereof.
В настоящем изобретении также раскрыто соединение, выбранное из группы, состоящей из буфуралола, валганцикловира, рикобендазола, альбендазола, валацикловира, миноксидила и локсорибина или их фармацевтически приемлемой соли для применения в лечении и/или профилактике фенилкетонурии.The present invention also discloses a compound selected from the group consisting of bufuralol, valganciclovir, ricobendazole, albendazole, valacyclovir, minoxidil and loxoribine or a pharmaceutically acceptable salt thereof for use in the treatment and/or prevention of phenylketonuria.
В настоящем изобретении также раскрыто применение соединения, выбранного из группы, состоящей из буфуралола, валганцикловира, рикобендазола, альбендазола, валацикловира, миноксидила и локсорибина или их фармацевтически приемлемой соли для получения лекарственного средства для лечения и/или профилактики фенилкетонурии (ФКУ).The present invention also discloses the use of a compound selected from the group consisting of bufuralol, valganciclovir, ricobendazole, albendazole, valacyclovir, minoxidil and loxoribine or a pharmaceutically acceptable salt thereof for the preparation of a medicament for the treatment and/or prevention of phenylketonuria (PKU).
Настоящее изобретение также относится к способу лечения и/или профилактики фенилкетонурии (ФКУ) у субъекта, включающему введение указанному субъекту терапевтически эффективного количества соединения, выбранного из группы, состоящей из буфуралола, валганцикловира, рикобендазола, альбендазола, валацикловира, миноксидила и локсорибина или их фармацевтически приемлемой соли.The present invention also provides a method for treating and/or preventing phenylketonuria (PKU) in a subject, comprising administering to said subject a therapeutically effective amount of a compound selected from the group consisting of bufuralol, valganciclovir, ricobendazole, albendazole, valacyclovir, minoxidil and loxoribine, or a pharmaceutically acceptable amount thereof salt.
Термин «лечение» в контексте настоящего описания означает реверсирование, облегчение течения, подавление прогрессирования заболевания или патологического состояния, к которому применяется данный термин, либо одного или более симптомов данного заболевания или патологического состояния, как например снижение уровня фенилаланина в крови по отношению к уровню до начала лечения.The term "treatment" as used herein means reversing, alleviating, suppressing the progression of the disease or condition to which the term applies, or one or more symptoms of the disease or condition, such as reducing the level of phenylalanine in the blood relative to the level before start of treatment.
Термины «предотвращение» и «профилактика» в контексте настоящего документа означает предотвращение или подавление появления одного или более симптомов заболевания или патологического состояния, к которому применяется данный термин, например, подавление повышения уровня фенилаланина в крови выше 120 мкмоль/л.The terms “prevention” and “prophylaxis” as used herein mean preventing or suppressing the occurrence of one or more symptoms of the disease or condition to which the term applies, for example, suppressing an increase in blood phenylalanine levels above 120 μmol/L.
В предпочтительном варианте реализации соединения, раскрытые в настоящем документе, применяют для лечения ФКУ.In a preferred embodiment, the compounds disclosed herein are used for the treatment of PKU.
Триамтерен или 2,4,7-триамино-6-фенилптеридин имеет химическую структуру, представленную ниже.Triamterene or 2,4,7-triamino-6-phenylpteridine has the chemical structure shown below.
Данное соединение было разработано в качестве мочегонного средства. Данное соединение имеется в продаже или может быть синтезировано с помощью соответствующего способа получения, например, такого как способ, раскрытый в GB 982360.This compound was developed as a diuretic. This compound is commercially available or can be synthesized using a suitable preparation method, for example such as the method disclosed in GB 982360.
Нолатрексед или 2-амино-6-метил-5-(4-пиридилтио)-4(3H)-хиназолинон имеет химическую структуру, представленную ниже.Nolatrexed or 2-amino-6-methyl-5-(4-pyridylthio)-4( 3H )-quinazolinone has the chemical structure shown below.
Данное соединение было разработано в качестве противоопухолевого средства, в частности, для лечения гепатоцеллюлярной карциномы. Данное соединение имеется в продаже или может быть синтезировано при помощи соответствующего способа получения, например, такого как описанный в патенте США 5430148 (нолатрексед соответствует соединению 14А из настоящего документа).This compound was developed as an antitumor agent, in particular for the treatment of hepatocellular carcinoma. This compound is commercially available or can be synthesized using a suitable preparation method, for example, such as described in US Pat. No. 5,430,148 (nolatrexed corresponds to compound 14A of this document).
Султоприд или N-[(1-этил-2-пирролидинил)метил]-5-(этилсульфонил)-о-анисамид имеет химическую структуру, представленную ниже.Sultopride or N -[(1-ethyl-2-pyrrolidinyl)methyl]-5-(ethylsulfonyl) -o -anisamide has the chemical structure shown below.
Данное соединение было разработано в качестве антидепрессанта. Данное соединение имеется в продаже или может быть синтезировано с помощью соответствующего способа получения, например, такого, как описанный в CN 1706825 A.This compound was developed as an antidepressant. This compound is commercially available or can be synthesized using an appropriate preparation method, such as that described in CN 1706825 A.
Гидрастинин или 6-метил-7,8-дигидро-5H-[1,3]диоксоло[4,5-g]изохинолин-5-ол имеет химическую структуру, представленную ниже.Hydrastinine or 6-methyl-7,8-dihydro- 5H- [1,3]dioxolo[4,5- g ]isoquinolin-5-ol has the chemical structure shown below.
Данное соединение было разработано в качестве кардиотонического и кровоостанавливающего средства. Данное соединение имеется в продаже или может быть синтезировано при помощи соответствующего способа получения, например, такого как раскрытый в GB 14120.This compound was developed as a cardiotonic and hemostatic agent. This compound is commercially available or can be synthesized using a suitable preparation method such as, for example, that disclosed in GB 14120.
Буфуралол или 2-(трет-бутиламино)-1-(7-этил-1-бензофуран-2-ил)этан-1-ол имеет химическую структуру, представленную ниже.Bufuralol or 2-( tert -butylamino)-1-(7-ethyl-1-benzofuran-2-yl)ethan-1-ol has the chemical structure shown below.
Данное соединение было разработано в качестве антагониста бета-адренорецепторов и имеется в свободной продаже. Его используют преимущественно в виде гидрохлоридной соли. Данное соединение можно применять либо в рацемической форме, либо в виде (S)- или (R)-энантиомеров, предпочтительно в виде (S)-энантиомера.This compound was developed as a beta-adrenergic receptor antagonist and is commercially available. It is used primarily in the form of a hydrochloride salt. The compound may be used either in racemic form or as the (S)- or (R)-enantiomer, preferably the (S)-enantiomer.
Валганцикловир или [2-[(2-амино-6-оксо-3H-пурин-9-ил)метокси]-3-гидроксипропил] (2S)-2-амино-3-метилбутаноат имеет химическую структуру, представленную ниже.Valganciclovir or [2-[(2-amino-6-oxo- 3H -purin-9-yl)methoxy]-3-hydroxypropyl]( 2S )-2-amino-3-methylbutanoate has the chemical structure shown below.
Данное соединение было разработано в качестве противовирусного средства, используемого для лечения цитомегаловирусной инфекции у субъектов с ВИЧ/СПИДом или после трансплантации органов, и имеется в свободной продаже. Данное соединение используют преимущественно в виде гидрохлоридной соли.This compound was developed as an antiviral agent used to treat cytomegalovirus infection in subjects with HIV/AIDS or after organ transplantation and is commercially available. This compound is used primarily in the form of its hydrochloride salt.
Рикобендазол или метил[5-(пропан-1-сульфинил)-1H-бензоимидазол-2-ил]-карбамат имеет химическую структуру, представленную ниже.Ricobendazole or methyl[5-(propan-1-sulfinyl)-1H - benzoimidazol-2-yl]-carbamate has the chemical structure shown below.
Данное соединение было разработано в качестве глистогонного средства и имеется в свободной продаже. Данное соединение используют преимущественно в форме свободного основания. Рикобендазол является одним из ключевых метаболитов альбендазола или метилового эфира (5-(пропилтио)-1H-бензимидазол-2-ил)карбаминовой кислоты. Альбендазол имеет химическую структуру, представленную ниже.This compound was developed as an anthelmintic and is commercially available. This compound is preferably used in its free base form. Ricobendazole is one of the key metabolites of albendazole or (5-(propylthio)-1H-benzimidazol-2-yl)carbamic acid methyl ester. Albendazole has the chemical structure shown below.
Альбендазол также был разработан в качестве глистогонного средства и имеется в свободной продаже. Данное соединение можно применять в качестве пролекарства рикобендазола и его используют преимущественно в форме свободного основания.Albendazole has also been developed as an anthelmintic and is commercially available. This compound can be used as a prodrug of ricobendazole and is preferably used in its free base form.
Валацикловир или 2-[(2-амино-6-оксо-3H-пурин-9-ил)метокси]этил (2S)-2-амино-3-метилбутаноат имеет химическую структуру, представленную ниже.Valacyclovir or 2-[(2-amino-6-oxo- 3H -purin-9-yl)methoxy]ethyl ( 2S )-2-amino-3-methylbutanoate has the chemical structure shown below.
Данное соединение было разработано в качестве противовирусного средства, используемого для лечения герпетической инфекции, и имеется в свободной продаже. Данное соединение используют преимущественно в виде гидрохлоридной соли.This compound was developed as an antiviral agent used to treat herpes infection and is commercially available. This compound is used primarily in the form of its hydrochloride salt.
Миноксидил или 2,6-диамино-4-(пиперидин-1-ил) пиримидин-1-оксид имеет химическую структуру, представленную ниже.Minoxidil or 2,6-diamino-4-(piperidin-1-yl)pyrimidin-1-oxide has the chemical structure shown below.
Данное соединение было разработано для лечения гипертонии и выпадения волос и имеется в свободной продаже. Данное соединение используют преимущественно в форме свободного основания.This compound was developed for the treatment of hypertension and hair loss and is commercially available. This compound is preferably used in its free base form.
Локсорибин или 2-амино-9-[(2R,3R,4S,5R)-3,4-дигидрокси-5-(гидроксиметил)оксолан-2-ил]-7-проп-2-енил-3H-пурин-6,8-дион имеет химическую структуру, представленную ниже.Loxoribine or 2-amino-9-[(2 R ,3 R ,4 S ,5 R )-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-7-prop-2-enyl-3H -purine-6,8-dione has the chemical structure shown below.
Данное соединение обладает иммуностимулирующей и иммуномодулирующей активностью и имеется в свободной продаже. Данное соединение используют преимущественно в форме свободного основания.This compound has immunostimulating and immunomodulating activity and is commercially available. This compound is preferably used in its free base form.
Термин «фармацевтически приемлемый» относится к химическим соединениям и композициям, которые являются физиологически переносимыми и обычно не вызывают аллергической или какой-либо аналогичной нежелательной реакции, такой как расстройство желудка, головокружение и т.п. при введении человеку. Предпочтительно в контексте настоящего документа термин «фармацевтически приемлемый» означает одобренный регулирующим органом федерального правительства или правительства штата, либо внесенный в реестр Фармакопеи США или другой общепризнанной фармакопеи для применения на животных и, более конкретно, на людях.The term "pharmaceutically acceptable" refers to chemical compounds and compositions that are physiologically tolerable and do not typically cause an allergic or similar adverse reaction such as upset stomach, dizziness, or the like. when administered to a person. Preferably, as used herein, the term “pharmaceutically acceptable” means approved by a regulatory agency of the federal or state government, or listed in the United States Pharmacopoeia or other generally accepted pharmacopoeia for use in animals and, more specifically, in humans.
Кроме того, термин «фармацевтически приемлемая соль» относится к какой-либо соли, которая при введении реципиенту способна обеспечить наличие (напрямую или опосредованно) соединения в соответствии с описанием в настоящем документе. Например, фармацевтически приемлемые соли соединений, представленных в настоящем документе, могут представлять собой соли присоединения кислоты, соли присоединения основания или соли металлов, а также они могут быть синтезированы из исходного соединения, содержащего основной или кислотный компонент, обычными химическими способами. Обычно такие соли получают, например, в результате реакции свободных кислотных или основных форм указанных соединений со стехиометрическим количеством соответствующего основания или кислоты в воде либо в органическом растворителе или в их смеси. Как правило, предпочтительными являются неводные среды, такие как эфир, этилацетат, этанол, изопропанол или ацетонитрил. Примеры солей присоединения кислоты включают соли присоединения минеральных кислот, например, такие как гидрохлорид, гидробромид, гидроиодид, сульфат, нитрат, фосфат, а также соли присоединения органических кислот, например, такие как, ацетат, малеат, фумарат, цитрат, оксалат, сукцинат, тартрат, малат, манделат, метансульфонат и п-толуолсульфонат. Примеры солей присоединения щелочных металлов включают неорганические соли, например, такие как аммоний, а также органические соли щелочных металлов, например, такие как этилендиамин, этаноламин, N,N-диалкилентаноламин, триэтаноламин, глюкамин и соли основных аминокислот. Примеры солей металлов включают, например, соли натрия, калия, кальция, магния, алюминия и лития.In addition, the term “pharmaceutically acceptable salt” refers to any salt that, when administered to a recipient, is capable of providing (directly or indirectly) a compound as described herein. For example, pharmaceutically acceptable salts of the compounds provided herein may be acid addition salts, base addition salts, or metal salts, or they may be synthesized from a parent compound containing a basic or acid moiety by conventional chemical methods. Typically, such salts are obtained, for example, by reacting the free acid or base forms of these compounds with a stoichiometric amount of the corresponding base or acid in water or an organic solvent or a mixture thereof. Generally, non-aqueous media such as ether, ethyl acetate, ethanol, isopropanol or acetonitrile are preferred. Examples of acid addition salts include mineral acid addition salts, such as hydrochloride, hydrobromide, hydroiodide, sulfate, nitrate, phosphate, and organic acid addition salts, such as acetate, maleate, fumarate, citrate, oxalate, succinate, tartrate, malate, mandelate, methanesulfonate and p-toluenesulfonate. Examples of alkali metal addition salts include inorganic salts, such as ammonium, as well as organic alkali metal salts, such as ethylenediamine, ethanolamine, N,N-dialkylenthanolamine, triethanolamine, glucamine, and basic amino acid salts. Examples of metal salts include, for example, sodium, potassium, calcium, magnesium, aluminum and lithium salts.
В другом конкретном варианте реализации соединение для применения согласно настоящему изобретению представляет собой триамтерен или его фармацевтически приемлемую соль, предпочтительно триамтерен (т.е. свободное основание триамтерена).In another specific embodiment, the compound for use according to the present invention is triamterene or a pharmaceutically acceptable salt thereof, preferably triamterene (ie, triamterene free base).
В конкретном варианте реализации соединение для применения согласно настоящему изобретению представляет собой нолатрексед или его фармацевтически приемлемую соль, предпочтительно дигидрохлорид нолатрекседа.In a specific embodiment, the compound for use according to the present invention is nolatrexed or a pharmaceutically acceptable salt thereof, preferably nolatrexed dihydrochloride.
В другом конкретном варианте реализации соединение для применения согласно настоящему изобретению представляет собой сульфоприд или его фармацевтически приемлемую соль, предпочтительно гидрохлорид сульфоприда.In another specific embodiment, the compound for use according to the present invention is sulfopride or a pharmaceutically acceptable salt thereof, preferably sulfopride hydrochloride.
В еще одном конкретном варианте реализации соединение для применения согласно настоящему изобретению представляет собой гидрастинин или его фармацевтически приемлемую соль, предпочтительно гидрохлорид гидрастинина.In yet another specific embodiment, the compound for use according to the present invention is hydrastinine or a pharmaceutically acceptable salt thereof, preferably hydrastinine hydrochloride.
В еще одном конкретном варианте реализации фенилкетонурия выбрана из вариантной фенилкетонурии, не связанной с фенилкетонурией (или легкой) гиперфенилаланинемии и классической фенилкетонурии; предпочтительно - выбрана из вариантной фенилкетонурии и не связанной с фенилкетонурией (или легкой) гиперфенилаланинемии; еще более предпочтительно фенилкетонурия представляет собой вариантную фенилкетонурию.In yet another specific embodiment, the phenylketonuria is selected from variant phenylketonuria, non-phenylketonuria (or mild) hyperphenylalaninemia and classic phenylketonuria; preferably selected from variant phenylketonuria and non-phenylketonuria (or mild) hyperphenylalaninemia; even more preferably, the phenylketonuria is a variant phenylketonuria.
В еще одном конкретном варианте реализации различных аспектов настоящего изобретения субъекты, страдающие фенилкетонурией, экспрессируют одну или более разновидностей фермента PAH, выбранных из группы, состоящей из R261Q, R408W, IVS10, E390G, D415N, R241H, I306V, L348V, V388M, R158Q, Y414C, A300S, R297H, L48S, I65T, V245A, V106A, A403V, E280K, R252W, P281L, S349P и IVS12; предпочтительно - R261Q, R408W, IVS10, E390G, D415N, R241H, I306V, L348V, V388M, R158Q, Y414C, A300S, R297H, L48S, I65T, V245A, V106A и IVS12; более предпочтительно - из группы, состоящей из R261Q, R408W, IVS10, E390G, D415N, R241H, I306V, L348V, V388M, R158Q, Y414C, A300S, R297H, L48S и I65T; еще более предпочтительно - R261Q.In yet another specific embodiment of various aspects of the present invention, subjects suffering from phenylketonuria express one or more PAH enzyme species selected from the group consisting of R261Q, R408W, IVS10, E390G, D415N, R241H, I306V, L348V, V388M, R158Q, Y414C , A300S, R297H, L48S, I65T, V245A, V106A, A403V, E280K, R252W, P281L, S349P and IVS12; preferably R261Q, R408W, IVS10, E390G, D415N, R241H, I306V, L348V, V388M, R158Q, Y414C, A300S, R297H, L48S, I65T, V245A, V106A and IVS12; more preferably from the group consisting of R261Q, R408W, IVS10, E390G, D415N, R241H, I306V, L348V, V388M, R158Q, Y414C, A300S, R297H, L48S and I65T; even more preferably R261Q.
Номенклатурное наименование, используемое для вышеперечисленных мутаций, состоит из первой буквы, обозначающей аминокислоту (используется однобуквенный код аминокислоты) в человеческом ферменте PAH дикого типа, числа, обозначающего ее положение в аминокислотной последовательности человеческого фермента PAH дикого типа, и последней буквы, обозначающей аминокислоту, расположенную в данном положении в мутированном ферменте PAH; к примеру, R261Q означает, что аргинин (R) в положении 261 замещен глутамином (Q). R408W означает, что аргинин (R) в положении 408 замещен триптофаном (W). E390G означает, что глутамат (E) в положении 390 замещен глицином (G). D415N означает, что аспартат (D) в положении 415 замещен аспарагином (N). R241H означает, что аргинин (R) в положении 241 замещен гистидином (H). I306V означает, что изолейцин (I) в положении 306 замещен валином (V). L348V означает, что лейцин (L) в положении 348 замещен валином (V). V388M означает, что валин (V) в положении 388 замещен метионином (M). R158Q означает, что аргинин (R) в положении 158 замещен глутамином (Q). Y414C означает, что тирозин (Y) в положении 414 замещен цистеином (C). A300S означает, что аланин (A) в положении 300 замещен серином (S). R297H означает, что аргинин (R) в положении 297 замещен гистидином (H). L48S означает, что лейцин (L) в положении 48 замещен серином (S). I65T означает, что изолейцин (I) в положении 65 замещен треонином (T). V245A означает, что валин (V) в положении 245 замещен аланином (A). V106A означает, что валин (V) в положении 106 замещен аланином (A). A403V означает, что аланин (A) в положении 403 замещен валином (V). E280K означает, что глутамат (E) в положении 280 замещен лизином (K). R252W означает, что аргинин (R) в положении 252 замещен триптофаном (W). P281L означает, что пролин (P) в положении 281 замешен лейцином (L). S349P означает, что серин (S) в положении 349 замещен пролином (P).The nomenclature name used for the above mutations consists of the first letter indicating the amino acid (using a single-letter amino acid code) in the wild-type human PAH enzyme, a number indicating its position in the amino acid sequence of the wild-type human PAH enzyme, and the last letter indicating the amino acid located at this position in the mutated PAH enzyme; for example, R261Q means that the arginine (R) at position 261 is replaced by glutamine (Q). R408W means that the arginine (R) at position 408 is replaced by tryptophan (W). E390G means that glutamate (E) at position 390 is replaced by glycine (G). D415N means that aspartate (D) at position 415 is replaced by asparagine (N). R241H means that the arginine (R) at position 241 is replaced by histidine (H). I306V means that isoleucine (I) at position 306 is replaced by valine (V). L348V means that leucine (L) at position 348 is replaced by valine (V). V388M means that valine (V) at position 388 is replaced by methionine (M). R158Q means that the arginine (R) at position 158 is replaced by glutamine (Q). Y414C means that the tyrosine (Y) at position 414 is replaced by a cysteine (C). A300S means that alanine (A) at position 300 is replaced by serine (S). R297H means that the arginine (R) at position 297 is replaced by histidine (H). L48S means that leucine (L) at position 48 is replaced by serine (S). I65T means that isoleucine (I) at position 65 is replaced by threonine (T). V245A means that the valine (V) at position 245 is replaced by alanine (A). V106A means that valine (V) at position 106 is replaced by alanine (A). A403V means that alanine (A) at position 403 is replaced by valine (V). E280K means that glutamate (E) at position 280 is replaced by lysine (K). R252W means that the arginine (R) at position 252 is replaced by tryptophan (W). P281L means that the proline (P) at position 281 is replaced by leucine (L). S349P means that serine (S) at position 349 is replaced by proline (P).
Мутация IVS10 создает новый акцепторный сайт сплайсинга в интроне 10, вызывая аберрантный сплайсинг, в результате чего происходит транскрипт с 9 нуклеотидами, вставленным между нормальными последовательностями экзона 10 и экзона 11. Это соответствует белку с тремя дополнительными аминокислотами (Gly-Leu-Gln), вставленными между остатками Q355 и Y356.The IVS10 mutation creates a new splice acceptor site in intron 10, causing aberrant splicing, resulting in a transcript with 9 nucleotides inserted between the normal sequences of exon 10 and exon 11. This corresponds to a protein with three additional amino acids (Gly-Leu-Gln) inserted between residues Q355 and Y356.
Мутация IVS12 соответствует замещению GT на AT на 5-праймовом сайте донора сплайсинга интрона 12, что приводит к пропуску предыдущего экзона во время сплайсинга РНК. Соответствующая информационная РНК демонстрирует внутреннюю делецию из 116 оснований, точно соответствующую экзону 12, которая обусловливает синтез усеченного белка, лишенного 52 С-концевых аминокислот. Человеческий фермент PAH дикого типа имеет следующую последовательность, представленную в базе данных UniProt, запись P00439 (редакция 237 от 11 декабря 2019 г.):The IVS12 mutation corresponds to a substitution of GT for AT at the 5-prime splice donor site of intron 12, resulting in skipping of the preceding exon during RNA splicing. The corresponding messenger RNA shows an internal deletion of 116 bases, exactly corresponding to exon 12, which results in the synthesis of a truncated protein lacking the C-terminal 52 amino acids. The wild-type human PAH enzyme has the following sequence, as reported in the UniProt database entry P00439 (revision 237, December 11, 2019):
MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNTQQLKILADSINSEIGILCSALQKIK (SEQ ID NO: 1)MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACY EYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSV RYDPYTQRIEVLDNTQQLKILADSINSEIGILCSALQKIK (SEQ ID NO: 1)
Соединения для применения согласно настоящему изобретению можно вводить любым подходящим путем (через), таким как оральный (например, пероральный, сублингвальный и т.д.), парентеральный (например, подкожный, внутримышечный, внутривенный и т.п.), вагинальный, ректальный, назальный, местный, через глаза и др., предпочтительно - пероральным или парентеральным, более предпочтительно - пероральным путем.Compounds for use according to the present invention can be administered by any suitable route (via), such as oral (eg, oral, sublingual, etc.), parenteral (eg, subcutaneous, intramuscular, intravenous, etc.), vaginal, rectal , nasal, local, through the eyes, etc., preferably by oral or parenteral route, more preferably by oral route.
В частности, соединения для применения согласно изобретению вводятся в форме фармацевтической композиции, которая содержит соответствующее (активное) соединение и один или более фармацевтически приемлемых наполнителей.In particular, the compounds for use according to the invention are administered in the form of a pharmaceutical composition which contains the corresponding (active) compound and one or more pharmaceutically acceptable excipients.
Термин «фармацевтически приемлемый наполнитель» относится к носителю, разбавителю или адъюванту, который вводят вместе с активным ингредиентом. Подобные фармацевтические наполнители могут представлять собой стерильные жидкости, такие как вода и масла, включая масла нефтяного, животного, растительного или синтетического происхождения, такие как арахисовое масло, соевое масло, минеральное масло, кунжутное масло и т.п. В качестве носителей предпочтительно используют воду или водные растворы солей и водные растворы декстрозы и глицерина, в частности для инъекционных растворов. Подходящие фармацевтические носители известны специалистам в данной области техники.The term "pharmaceutically acceptable excipient" refers to a carrier, diluent or adjuvant that is administered along with the active ingredient. Such pharmaceutical excipients may be sterile liquids such as water and oils, including oils of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Preferably, water or aqueous solutions of salts and aqueous solutions of dextrose and glycerol are used as carriers, in particular for injection solutions. Suitable pharmaceutical carriers are known to those skilled in the art.
Фармацевтически приемлемый наполнитель, необходимый для производства желаемой фармацевтической композиции по настоящему изобретению, будет зависеть, помимо прочих факторов, от выбранного пути введения. Указанные фармацевтические композиции могут быть получены обычными способами, известными специалистам в данной области техники.The pharmaceutically acceptable excipient needed to produce the desired pharmaceutical composition of the present invention will depend, among other factors, on the route of administration chosen. These pharmaceutical compositions can be prepared by conventional methods known to those skilled in the art.
Соединения для применения согласно настоящему изобретению можно вводить в «терапевтически эффективном количестве», то есть в нетоксичном, но достаточном количестве соответствующего соединения для обеспечения желаемого эффекта. Количество, которое является «эффективным», будет варьировать для разных субъектов в зависимости от возраста и общего состояния индивида, конкретного вводимого соединения и т.п. Таким образом, не всегда возможно указать точное «терапевтически эффективное количество». Тем не менее, любой рядовой специалист в данной области в каком-либо отдельном случае может определить подходящее количество обычным опытным путем.Compounds for use according to the present invention can be administered in a "therapeutically effective amount", that is, a non-toxic but sufficient amount of the corresponding compound to provide the desired effect. The amount that is "effective" will vary among subjects depending on the age and general condition of the individual, the particular compound administered, and the like. Thus, it is not always possible to specify a precise “therapeutically effective amount.” However, one of ordinary skill in the art can determine the appropriate amount in any particular case by routine experimentation.
Соединения для применения согласно настоящему изобретению обычно вводят один или более раз в сутки, например 1, 2, 3 или 4 раза в сутки в стандартных общих суточных дозах в зависимости от конкретного соединения и тяжести заболевания, и могут быть легко определены квалифицированным специалистом. К примеру, стандартные общие суточные дозы сульфоприда или его фармацевтически приемлемой соли варьируют в диапазоне от 0,1 до 18000 мг/сутки (в пересчете на свободное основание сульфоприда), предпочтительно от 0,1 до 1800 мг/сутки, более предпочтительно от 1 до 1800 мг/сутки. Стандартные общие суточные дозы нолатрекседа или его фармацевтически приемлемой соли, вводимые перорально, варьируют в диапазоне от 0,2 до 14000 мг/сутки (в пересчете на свободное основание нолатрекседа), предпочтительно от 0,2 до 1400 мг/сутки, более предпочтительно - от 1 до 1400 мг/сутки. Стандартные общие суточные дозы нолатрекседа или его фармацевтически приемлемой соли, вводимые парентерально, варьируют в диапазоне от 0,1 до 8000 мг/м2/сутки (в пересчете на свободное основание нолатрекседа), предпочтительно от 0,1 до 800 мг/м2/сутки, более предпочтительно - от 1 до 800 мг/м2/сутки. Стандартные общие суточные дозы триамтерена или его фармацевтически приемлемой соли варьируют в диапазоне от 0,1 до 10000 мг/сутки (в пересчете на свободное основание триамтерена), предпочтительно от 0,1 до 300 мг/сутки, более предпочтительно - от 1 до 300 мг/сутки. Стандартные общие суточные дозы гидрастина или его фармацевтически приемлемой соли варьируют в диапазоне от 0,1 до 5000 мг/сутки (в пересчете на свободное основание гидрастина), предпочтительно от 0,1 до 500 мг/сутки, более предпочтительно - от 1 до 500 мг/сутки. Стандартные общие суточные дозы буфуралола или его фармацевтически приемлемой соли варьируют в диапазоне от 0,1 до 1200 мг/сутки (в пересчете на свободное основание буфуралола), предпочтительно от 0,1 до 120 мг/сутки, более предпочтительно - от 1 до 120 мг/сутки. Стандартные общие суточные дозы валганцикловира или его фармацевтически приемлемой соли варьируют в диапазоне от 0,1 до 18000 мг/сутки (в пересчете на свободное основание валганцикловира), предпочтительно от 0,1 до 1800 мг/сутки, более предпочтительно - от 1 до 1800 мг/сутки. Стандартные общие суточные дозы альбендазола или рикобендазола или их фармацевтически приемлемой соли варьируют в диапазоне от 0,1 до 4000 мг/сутки (в пересчете на свободное основание рикобендазола или альбендазола), предпочтительно от 0,1 до 400 мг/сутки, более предпочтительно - от 1 до 400 мг/сутки. Стандартные общие суточные дозы валацикловира или его фармацевтически приемлемой соли варьируют в диапазоне от 0,1 до 20000 мг/сутки (в пересчете на свободное основание валацикловира), предпочтительно от 0,1 до 2000 мг/сутки, более предпочтительно - от 1 до 2000 мг/сутки. Стандартные общие суточные дозы миноксидила или его фармацевтически приемлемой соли варьируют в диапазоне от 0,1 до 1000 мг/сутки (в пересчете на свободное основание миноксидила), предпочтительно от 0,1 до 100 мг/сутки, более предпочтительно - от 1 до 100 мг/сутки. Стандартные общие суточные дозы локсорибина или его фармацевтически приемлемой соли варьируют в диапазоне от 0,1 до 100 мг/сутки (в пересчете на свободное основание локсорибина), предпочтительно от 0,1 до 10 мг/сутки, более предпочтительно - от 1 до 10 мг/сутки.Compounds for use according to the present invention are typically administered one or more times per day, for example 1, 2, 3 or 4 times per day in standard total daily doses depending on the specific compound and the severity of the disease, and can be easily determined by a skilled practitioner. For example, standard total daily doses of sulfopride or a pharmaceutically acceptable salt thereof range from 0.1 to 18,000 mg/day (based on sulfopride free base), preferably from 0.1 to 1800 mg/day, more preferably from 1 to 1800 mg/day. Typical total daily doses of nolatrexed or a pharmaceutically acceptable salt thereof, administered orally, range from 0.2 to 14,000 mg/day (based on nolatrexed free base), preferably from 0.2 to 1,400 mg/day, more preferably from 1 to 1400 mg/day. Standard total daily doses of nolatrexed or a pharmaceutically acceptable salt thereof administered parenterally range from 0.1 to 8000 mg/m 2 /day (based on nolatrexed free base), preferably from 0.1 to 800 mg/m 2 /day. day, more preferably from 1 to 800 mg/m 2 /day. Typical total daily doses of triamterene or a pharmaceutically acceptable salt thereof range from 0.1 to 10,000 mg/day (based on triamterene free base), preferably from 0.1 to 300 mg/day, more preferably from 1 to 300 mg /day. Typical total daily doses of hydrastine or a pharmaceutically acceptable salt thereof range from 0.1 to 5000 mg/day (based on hydrastine free base), preferably from 0.1 to 500 mg/day, more preferably from 1 to 500 mg /day. Typical total daily doses of bufuralol or a pharmaceutically acceptable salt thereof range from 0.1 to 1200 mg/day (based on bufuralol free base), preferably from 0.1 to 120 mg/day, more preferably from 1 to 120 mg /day. Standard total daily doses of valganciclovir or a pharmaceutically acceptable salt thereof range from 0.1 to 18,000 mg/day (based on valganciclovir free base), preferably from 0.1 to 1800 mg/day, more preferably from 1 to 1800 mg /day. Typical total daily doses of albendazole or ricobendazole or a pharmaceutically acceptable salt thereof range from 0.1 to 4000 mg/day (based on ricobendazole or albendazole free base), preferably from 0.1 to 400 mg/day, more preferably from 1 to 400 mg/day. Standard total daily doses of valacyclovir or a pharmaceutically acceptable salt thereof range from 0.1 to 20,000 mg/day (based on valacyclovir free base), preferably from 0.1 to 2000 mg/day, more preferably from 1 to 2000 mg /day. Typical total daily doses of minoxidil or a pharmaceutically acceptable salt thereof range from 0.1 to 1000 mg/day (based on minoxidil free base), preferably from 0.1 to 100 mg/day, more preferably from 1 to 100 mg /day. Typical total daily doses of loxoribine or a pharmaceutically acceptable salt thereof range from 0.1 to 100 mg/day (based on loxoribine free base), preferably 0.1 to 10 mg/day, more preferably 1 to 10 mg /day.
Фармацевтические композиции могут быть получены стандартными методами, как например те, которые описаны или ссылки на которые содержатся в Фармакопеях Испании и США и аналогичных справочных текстах.Pharmaceutical compositions can be prepared by standard methods, such as those described or referenced in the Spanish and US Pharmacopoeias and similar reference texts.
Термин «субъект» относится к млекопитающему, например человеку.The term "subject" refers to a mammal, such as a human.
Соединения для применения согласно настоящему изобретению можно вводить в качестве единственного активного ингредиента или в комбинации с другими активными ингредиентами. В конкретном варианте реализации настоящего изобретения соединения используют в качестве единственного активного ингредиента. В другом конкретном варианте реализации соединения используют в сочетании с другими активными ингредиентами.The compounds for use according to the present invention can be administered as the sole active ingredient or in combination with other active ingredients. In a specific embodiment of the present invention, the compounds are used as the sole active ingredient. In another specific embodiment, the compounds are used in combination with other active ingredients.
В еще одном аспекте настоящее изобретение относится к комбинации, содержащей одно или более соединений, выбранных из группы, состоящей из триамтерена, нолатрекседа, сульфоприда, гидрастинина, буфуралола, валганцикловира, рикобендазола, альбендазола, валацикловира, миноксидила, локсорибина, сапроптерина, окситриптана, пириметамина, пегвалиазы или их фармацевтически приемлемой соли для применения в лечении и/или профилактике фенилкетонурии, в которой по меньшей мере одно соединение выбрано из группы, состоящей из триамтерена, нолатрекседа, сульфоприда и гидрастинина или их фармацевтически приемлемой соли, где предпочтительно по меньшей мере одно соединение выбрано из группы, состоящей из триамтерена и нолатрекседа или их фармацевтически приемлемой соли.In yet another aspect, the present invention provides a combination containing one or more compounds selected from the group consisting of triamterene, nolatrexed, sulfopride, hydrastinine, bufuralol, valganciclovir, ricobendazole, albendazole, valacyclovir, minoxidil, loxoribine, sapropterin, oxytriptan, pyrimethamine, pegvaliase or a pharmaceutically acceptable salt thereof for use in the treatment and/or prevention of phenylketonuria, wherein at least one compound is selected from the group consisting of triamterene, nolatrexed, sulfopride and hydrastinine or a pharmaceutically acceptable salt thereof, wherein preferably at least one compound is selected from the group consisting of triamterene and nolatrexed or a pharmaceutically acceptable salt thereof.
Настоящее изобретение также относится к применению комбинации, содержащей одно или более соединений, выбранных из группы, состоящей из триамтерена, нолатрекседа, сульфоприда, гидрастинина, буфуралола, валганцикловира, рикобендазола, альбендазола, валацикловира, миноксидила, локсорибина, сапроптерина, окситриптана, пириметамина, пегвалиазы или их фармацевтически приемлемой соли для получения лекарственного средства для лечения и/или профилактики фенилкетонурии (ФКУ), причем по меньшей мере одно соединение выбрано из группы, состоящей из триамтерена, нолатрекседа, сульфоприда и гидрастинина или их фармацевтически приемлемой соли, где предпочтительно по меньшей мере одно соединение выбрано из группы, состоящей из триамтерена и нолатрекседа или их фармацевтически приемлемой соли.The present invention also relates to the use of a combination containing one or more compounds selected from the group consisting of triamterene, nolatrexed, sulfopride, hydrastinine, bufuralol, valganciclovir, ricobendazole, albendazole, valacyclovir, minoxidil, loxoribine, sapropterin, oxytriptan, pyrimethamine, pegvaliase or a pharmaceutically acceptable salt thereof for the preparation of a medicament for the treatment and/or prevention of phenylketonuria (PKU), wherein at least one compound is selected from the group consisting of triamterene, nolatrexed, sulfopride and hydrastinine or a pharmaceutically acceptable salt thereof, where preferably at least one the compound is selected from the group consisting of triamterene and nolatrexed or a pharmaceutically acceptable salt thereof.
Настоящее изобретение также относится к способу лечения и/или профилактики фенилкетонурии (ФКУ) у субъекта, включающему в себя введение указанному субъекту терапевтически эффективного количества комбинации, содержащей одно или более соединений, выбранных из группы, состоящей из триамтерена, нолатрекседа, сульфоприда, гидрастинина, буфуралола, валганцикловира, рикобендазола, альбендазола, валацикловира, миноксидила, локсорибина, сапроптерина, окситриптана, пириметамина, пегвалиазы или их фармацевтически приемлемой соли, в которой по меньшей мере одно соединение выбрано из группы, состоящей из триамтерена, нолатрекседа, сульфоприда и гидрастинина или их фармацевтически приемлемой соли, где предпочтительно по меньшей мере одно соединение выбрано из группы, состоящей из триамтерена и нолатрекседа или их фармацевтически приемлемой соли.The present invention also provides a method for treating and/or preventing phenylketonuria (PKU) in a subject, comprising administering to said subject a therapeutically effective amount of a combination containing one or more compounds selected from the group consisting of triamterene, nolatrexed, sulfopride, hydrastinine, bufuralol , valganciclovir, ricobendazole, albendazole, valacyclovir, minoxidil, loxoribine, sapropterin, oxytriptan, pyrimethamine, pegvaliase or a pharmaceutically acceptable salt thereof, wherein at least one compound is selected from the group consisting of triamterene, nolatrexed, sulfopride and hydrastinine or a pharmaceutically acceptable salt thereof salts, where preferably at least one compound is selected from the group consisting of triamterene and nolatrexed or a pharmaceutically acceptable salt thereof.
Термин «комбинация» относится к продукту, содержащему одно или более определенных соединений в одной композиции или в нескольких композициях (или единицах), и в этом случае соответствующие соединения распределены между несколькими композициями. В предпочтительном варианте реализации комбинация относится к нескольким композициям, в частности, содержащим одну композицию (или единицу) на одно соединение (соединение в соответствии с определением выше) комбинации. Выражение «один или более» применительно к характеристике комбинации относится по меньшей мере к одному, предпочтительно к 1, 2, 3, 4 или 5 соединениям, более предпочтительно - к 1, 2 или 3 соединениям, еще более предпочтительно - к 1 или 2 соединениям.The term "combination" refers to a product containing one or more specified compounds in one composition or in several compositions (or units), in which case the corresponding compounds are distributed among several compositions. In a preferred embodiment, a combination refers to multiple compositions, in particular containing one composition (or unit) per compound (compound as defined above) of the combination. The expression "one or more" in relation to a combination characteristic refers to at least one, preferably 1, 2, 3, 4 or 5 compounds, more preferably 1, 2 or 3 compounds, even more preferably 1 or 2 compounds .
Если комбинация представляет собой единую композицию, соединения, содержащиеся в комбинации, всегда вводят одновременно.If the combination is a single composition, the compounds contained in the combination are always administered simultaneously.
Если комбинация состоит из нескольких композиций (или единиц), каждая из которых содержит по крайней мере одно из соединений комбинации, композиции (или единицы) можно вводить одновременно, последовательно или раздельно.If the combination consists of multiple compositions (or units), each of which contains at least one of the compounds of the combination, the compositions (or units) can be administered simultaneously, sequentially or separately.
Одновременное введение означает, что соединения или композиции (или единицы) вводят в одно и то же время.Simultaneous administration means that the compounds or compositions (or units) are administered at the same time.
Последовательное введение означает, что соединения или композиции (или единицы) вводят в разное время в хронологическом порядке.Sequential administration means that the compounds or compositions (or units) are administered at different times in chronological order.
Раздельное введение означает, что соединения или композиции (или единицы) вводят в разное время независимо друг от друга.Split administration means that the compounds or compositions (or units) are administered at different times independently of each other.
Триамтерен, нолатрексед, сульфоприд, гидрастинин, буфуралол, валганцикловир, рикобендазол, альбендазол, валацикловир, миноксидил, локсорибин, включая их фармацевтически приемлемые соли, были подробно описаны выше.Triamterene, nolatrexed, sulfopride, hydrastinine, bufuralol, valganciclovir, ricobendazole, albendazole, valacyclovir, minoxidil, loxoribine, including their pharmaceutically acceptable salts, have been described in detail above.
Сапроптерин или (-)-(6R)-2-амино-6-((1R,2S)-1,2-дигидроксипропил)-5,6,7,8-тетрагидро-4(3H)-птеридинон имеет химическую структуру, представленную ниже.Sapropterin or (-)-( 6R )-2-amino-6-(( 1R , 2S )-1,2-dihydroxypropyl)-5,6,7,8-tetrahydro-4(3H)-pteridinone has chemical structure shown below.
Данное соединение было разработано для лечения гиперфенилаланинемии у пациентов с фенилкетонурией и/или дефицитом тетрагидробиоптерина и имеется в свободной продаже. Данное соединение используют преимущественно в виде гидрохлоридной соли, в частности дигидрохлоридной соли.This compound was developed for the treatment of hyperphenylalaninemia in patients with phenylketonuria and/or tetrahydrobiopterin deficiency and is commercially available. This compound is preferably used in the form of a hydrochloride salt, in particular a dihydrochloride salt.
Сепиаптерин или S-(-)-2-амино-7,8-дигидро-6-(2-гидрокси-1-оксопропил)-4(1H)-птеридинон имеет химическую структуру, представленную ниже.Sepiapterin or S -(-)-2-amino-7,8-dihydro-6-(2-hydroxy-1-oxopropyl)-4( 1H )-pteridinone has the chemical structure shown below.
Данное соединение является стабильным предшественником тетрагидробиоптерина и внутри клеток превращается в указанное соединение. Данное соединение имеется в свободной продаже. Сепиаптерин используют преимущественно в качестве свободного основания.This compound is a stable precursor of tetrahydrobiopterin and is converted into this compound inside cells. This connection is commercially available. Sepiapterin is used primarily as a free base.
Окситриптан или (2S)-2-амино-3-(5-гидрокси-1H-индол-3-ил)пропановая кислота имеет химическую структуру, представленную ниже.Oxytriptan or ( 2S )-2-amino-3-(5-hydroxy- 1H -indol-3-yl)propanoic acid has the chemical structure shown below.
Данное соединение имеется в продаже на некоторых рынках (Тайвань) и используется для лечения ФКУ. Окситриптан в настоящее время находится в разработке как антидепрессант и средство для подавления аппетита.This compound is commercially available in some markets (Taiwan) and is used to treat PKU. Oxitriptan is currently in development as an antidepressant and appetite suppressant.
Пириметамин или 5-(4-хлорфенил)-6-этилпиримидин-2,4-диамин имеет химическую структуру, представленную ниже.Pyrimethamine or 5-(4-chlorophenyl)-6-ethylpyrimidine-2,4-diamine has the chemical structure shown below.
Данное соединение является противопаразитарным средством, используемым для лечения токсоплазмоза, и имеется в свободной продаже. Ранее его использовали для лечения малярии, но было продемонстрировано, что он оказывает некоторый эффект при лечении фенилкетонурии. Данное соединение используют преимущественно в виде свободного основания.This compound is an antiparasitic drug used to treat toxoplasmosis and is commercially available. It was previously used to treat malaria, but has been shown to have some effect in the treatment of phenylketonuria. This compound is used preferably in the form of a free base.
Пегвалиаза представляет собой пегилированную рекомбинантную фенилаланинаммиаклиазу, которая превращает фенилаланин в безвредные метаболиты: транс-коричную кислоту и аммиак, снижая уровень фенилаланина. Данный продукт используют для лечения ФКУ и он имеется в свободной продаже.Pegvaliase is a PEGylated recombinant phenylalanine ammonia lyase that converts phenylalanine into the harmless metabolites trans-cinnamic acid and ammonia, reducing phenylalanine levels. This product is used to treat PKU and is commercially available.
Комбинация содержит по меньшей мере одно соединение, выбранное из группы, состоящей из триамтерена, нолатрекседа, сульфоприда и гидрастинина или их фармацевтически приемлемой соли, предпочтительно по меньшей одно соединение, выбранное из группы, состоящей из триамтерена и нолатрекседа или фармацевтически приемлемой соли.The combination contains at least one compound selected from the group consisting of triamterene, nolatrexed, sulfopride and hydrastinine or a pharmaceutically acceptable salt thereof, preferably at least one compound selected from the group consisting of triamterene and nolatrexed or a pharmaceutically acceptable salt.
В предпочтительном варианте реализации комбинация содержит по меньшей мере триамтерен или его фармацевтически приемлемую соль, предпочтительно триамтерен (т.е. свободное основание триамтерена). Соответственно, комбинация содержит триамтерен или его фармацевтически приемлемую соль (предпочтительно свободное основание триамтерена) и одно или более (предпочтительно одно) соединение, выбранное из нолатрекседа, сульфоприда, гидрастинина, буфуралола, валганцикловира, рикобендазола, альбендазола, валацикловира, миноксидила, локсорибина, сепиаптерина, окситриптана, пириметамина, пегвалиазы или их фармацевтически приемлемой соли.In a preferred embodiment, the combination contains at least triamterene or a pharmaceutically acceptable salt thereof, preferably triamterene (ie triamterene free base). Accordingly, the combination contains triamterene or a pharmaceutically acceptable salt thereof (preferably triamterene free base) and one or more (preferably one) compound selected from nolatrexed, sulfopride, hydrastinine, bufuralol, valganciclovir, ricobendazole, albendazole, valacyclovir, minoxidil, loxoribine, sepiapterin, oxytriptan, pyrimethamine, pegvaliase or a pharmaceutically acceptable salt thereof.
В другом предпочтительном варианте реализации комбинация содержит по меньшей мере нолатрексед или его фармацевтически приемлемую соль, предпочтительно дигидрохлорид нолатрекседа. Соответственно, комбинация содержит нолатрексед или его фармацевтически приемлемую соль (предпочтительно дигидрохлорид нолатрекседа) и одно или более (предпочтительно одно) соединений, выбранных из триамтерена, сульфоприда, гидрастинина, буфуралола, валганцикловира, рикобендазола, альбендазола, валацикловира, миноксидила, локсорибина, сапроптерина, сепиаптерина, окситриптана, пириметамина, пегвалиазы или их фармацевтически приемлемой соли.In another preferred embodiment, the combination contains at least nolatrexed or a pharmaceutically acceptable salt thereof, preferably nolatrexed dihydrochloride. Accordingly, the combination contains nolatrexed or a pharmaceutically acceptable salt thereof (preferably nolatrexed dihydrochloride) and one or more (preferably one) compounds selected from triamterene, sulfopride, hydrastinine, bufuralol, valganciclovir, ricobendazole, albendazole, valaciclovir, minoxidil, loxoribine, sapropterin, sepiapterin , oxytriptan, pyrimethamine, pegvaliase or a pharmaceutically acceptable salt thereof.
В другом предпочтительном варианте реализации комбинация содержит по меньшей мере сульфоприд или его фармацевтически приемлемую соль, предпочтительно гидрохлорид сульфоприда. Соответственно, комбинация содержит сульфоприд или его фармацевтически приемлемую соль (предпочтительно гидрохлорид сульфоприда) и одно или более (предпочтительно одно) соединений, выбранных из триамтерена, нолатрекседа, гидрастинина, буфуралола, валганцикловира, рикобендазола, альбендазола, валацикловира, миноксидила, локсорибина, сепиаптерина, окситриптана, пириметамина, пегвалиазы или их фармацевтически приемлемой соли.In another preferred embodiment, the combination contains at least sulfopride or a pharmaceutically acceptable salt thereof, preferably sulfopride hydrochloride. Accordingly, the combination contains sulfopride or a pharmaceutically acceptable salt thereof (preferably sulfopride hydrochloride) and one or more (preferably one) compounds selected from triamterene, nolatrexed, hydrastinine, bufuralol, valganciclovir, ricobendazole, albendazole, valacyclovir, minoxidil, loxoribine, sepiapterin, oxytriptan , pyrimethamine, pegvaliase or a pharmaceutically acceptable salt thereof.
В другом предпочтительном варианте реализации комбинация содержит гидрастинин или его фармацевтически приемлемую соль, предпочтительно гидрохлорид гидрастинина. Соответственно, комбинация содержит гидрастинин или его фармацевтически приемлемую соль (предпочтительно гидрохлорид гидрастинина) и одно или более (предпочтительно одно) соединений, выбранных из триамтерена, нолатрекседа, сульфоприда, буфуралола, валганцикловира, рикобендазола, альбендазола, валацикловира, миноксидила, локсорибина, сепиаптерина, окситриптана, пириметамина, пегвалиазы или их фармацевтически приемлемой соли.In another preferred embodiment, the combination contains hydrastinine or a pharmaceutically acceptable salt thereof, preferably hydrastinine hydrochloride. Accordingly, the combination contains hydrastinine or a pharmaceutically acceptable salt thereof (preferably hydrastinine hydrochloride) and one or more (preferably one) compounds selected from triamterene, nolatrexed, sulfopride, bufuralol, valganciclovir, ricobendazole, albendazole, valaciclovir, minoxidil, loxoribine, sepiapterin, oxytriptan , pyrimethamine, pegvaliase or a pharmaceutically acceptable salt thereof.
В частности, комбинации для применения согласно настоящему изобретению вводят в виде фармацевтических композиций, которые содержат соответствующие (активные) соединения и фармацевтически приемлемый наполнитель, как было определено ранее.In particular, the combinations for use according to the present invention are administered in the form of pharmaceutical compositions that contain the appropriate (active) compounds and a pharmaceutically acceptable excipient, as previously defined.
Комбинации для применения согласно настоящему изобретению обычно будут вводить один или более раз в сутки, например 1, 2, 3 или 4 раза в сутки в стандартных общих суточных дозах в зависимости от конкретного соединения и тяжести заболевания, и могут быть легко определены квалифицированным специалистом.Combinations for use according to the present invention will generally be administered one or more times per day, for example 1, 2, 3 or 4 times per day in standard total daily dosages depending on the specific compound and the severity of the disease, and can be readily determined by one skilled in the art.
Соединения и комбинации для применения в соответствии с настоящим изобретением используют преимущественно в сочетании с диетой с ограничением фенилаланина, в которой потребление фенилаланина частично или полностью исключается путем ограничения потребления натурального белка и обеспечения вместо него заменителем белка, в котором отсутствует фенилаланин, но который обогащен тирозином.The compounds and combinations for use in accordance with the present invention are used advantageously in combination with a phenylalanine-restricted diet in which the intake of phenylalanine is partially or completely eliminated by limiting the intake of natural protein and instead providing a protein substitute that lacks phenylalanine but is enriched with tyrosine.
В предпочтительном варианте реализации фенилкетонурия выбрана из вариантной фенилкетонурии, не связанной с фенилкетонурией (или легкой) гиперфенилаланинемии и классической фенилкетонурии; предпочтительно фенилкетонурия выбрана из вариантной фенилкетонурии и не связанной с фенилкетонурией (или легкой) гиперфенилаланинемии; более предпочтительно фенилкетонурия представляет собой вариантную фенилкетонурию.In a preferred embodiment, the phenylketonuria is selected from variant phenylketonuria, non-phenylketonuria (or mild) hyperphenylalaninemia and classic phenylketonuria; preferably the phenylketonuria is selected from variant phenylketonuria and non-phenylketonuria (or mild) hyperphenylalaninemia; more preferably, the phenylketonuria is variant phenylketonuria.
В конкретном варианте реализации субъекты, страдающие фенилкетонурией, экспрессируют одну или более разновидностей фермента PAH, выбранных из группы, состоящей из R261Q, R408W, IVS10, E390G, D415N, R241H, I306V, L348V, V388M, R158Q, Y414C, A300S, R297H, L48S, I65T, V245A, V106A, A403V, E280K, R252W, P281L, S349P и IVS12; предпочтительно R261Q, R408W, IVS10, E390G, D415N, R241H, I306V, L348V, V388M, R158Q, Y414C, A300S, R297H, L48S, I65T, V245A, V106A и IVS12; более предпочтительно из группы, состоящей из R261Q, R408W, IVS10, E390G, D415N, R241H, I306V, L348V, V388M, R158Q, Y414C, A300S, R297H, L48S и I65T; еще более предпочтительно - R261Q. Указанные разновидности были определены ранее.In a specific embodiment, subjects suffering from phenylketonuria express one or more PAH enzyme species selected from the group consisting of R261Q, R408W, IVS10, E390G, D415N, R241H, I306V, L348V, V388M, R158Q, Y414C, A300S, R297H, L48S , I65T, V245A, V106A, A403V, E280K, R252W, P281L, S349P and IVS12; preferably R261Q, R408W, IVS10, E390G, D415N, R241H, I306V, L348V, V388M, R158Q, Y414C, A300S, R297H, L48S, I65T, V245A, V106A and IVS12; more preferably from the group consisting of R261Q, R408W, IVS10, E390G, D415N, R241H, I306V, L348V, V388M, R158Q, Y414C, A300S, R297H, L48S and I65T; even more preferably R261Q. These varieties have been identified previously.
Нижеследующие примеры представляют конкретные варианты реализации настоящего изобретения. Они не предназначены для ограничения каким-либо образом объема настоящего изобретения, определенного в настоящем описании.The following examples represent specific embodiments of the present invention. They are not intended to limit in any way the scope of the present invention as defined herein.
ПримерыExamples
Материалы и методыMaterials and methods
1. Анализ изменения термостабильности1. Analysis of changes in thermal stability
В работе и др. (Biochemistry, 2002, 41 (24), 7573-7585) показано, что термическая денатурация hPAH происходит в три этапа: (i) развертывание четырех регуляторных доменов, которое отвечает за низкотемпературный калориметрический переход (ii) развертывание двух (из четырех) каталитических доменов, ответственных за высокотемпературный переход; и (iii) необратимая денатурация белка. Наиболее важным доменом для стабилизации является регуляторный домен.In progress et al. (Biochemistry, 2002, 41 (24), 7573-7585) showed that thermal denaturation of hPAH occurs in three stages: (i) deployment of four regulatory domains, which is responsible for the low-temperature calorimetric transition (ii) deployment of two (out of four ) catalytic domains responsible for the high-temperature transition; and (iii) irreversible protein denaturation. The most important domain for stabilization is the regulatory domain.
Таким образом, с целью изучить влияние соединений на термостабильность целевого белка, был проведен анализ изменения термостабильности (также называемый дифференциальной сканирующей флуориметрией (DSF)) [Niesen F.H. et al., Nat Protoc., 2007, 2(9), 2212-2221; Gersting S.W. et al., Human Molecular Genetics, 2010, 19(10), 2039-2049; and Gersting S.W. et al., J. Biol Chem. 2010, 285(40), 30686-30697]. DSF контролирует тепловое разворачивание белков в присутствии флуоресцентного красителя (SYPRO Orange; λexc=465 нм, λem=610 нм) и выполняется с помощью прибора для ПЦР в режиме реального времени (Applied BioSystems 7000HT Fast Real-Time PCR System). Считается, что соединения, повышающие средние точки термической денатурации (Tm), связывают и стабилизируют белок.Therefore, in order to study the effect of compounds on the thermostability of the target protein, a thermostability change assay (also called differential scanning fluorimetry (DSF)) was performed [Niesen FH et al., Nat Protoc., 2007, 2 (9), 2212-2221; Gersting SW et al., Human Molecular Genetics , 2010, 19 (10), 2039-2049; and Gersting SW et al., J. Biol Chem. 2010, 285 (40), 30686-30697]. DSF monitors the thermal unfolding of proteins in the presence of a fluorescent dye (SYPRO Orange; λexc=465 nm, λem=610 nm) and is performed using a real-time PCR instrument (Applied BioSystems 7000HT Fast Real-Time PCR System). Compounds that increase mean thermal denaturation points (Tm) are thought to bind and stabilize protein.
Вкратце, очищенные белки дикого типа или Arg261Gln (который является наиболее часто встречающейся мутацией, реагирующей на BH4) (разбавленные в 20 мМ NaHEPES (4-(2-гидроксиэтил)-1-пиперазин-этансульфоната натрия), pH 7,0 и 200 мМ NaCl, 2 мМ DTT (дитиотреитол) до концентрации 2 мг/мл) использовали при конечной концентрация белка 0,2 мг/мл на образец. Соединения тестировали при конечной концентрации 30 мкМ. Контроль, не содержащий соединение, (NCC) использовали в соответствии с растворителем соединения при конечной концентрации 2% (H2O, ДМСО, этанол, метанол). В качестве положительного контроля использовали природный кофактор 6R-L-эритро-5,6,7,8-тетрагидробиоптерин (BH4, номер CAS 69056-38-8), стабилизированный в 100 мМ дитиотреитола (DTT), в конечной концентрации 43 мкМ. Чтобы исключить неспецифическое воздействие соединения на краситель, добавляли контроль, не содержащий белков (NPC) (буфер, соединение, краситель). Измерение проводили в двух повторениях, и образцы денатурировали путем сканирования в диапазоне температур от 20 до 75°C со скоростью сканирования 0,5°C/мин.Briefly, purified wild-type or Arg261Gln proteins (which is the most common BH4-responsive mutation) (diluted in 20 mM NaHEPES (sodium 4-(2-hydroxyethyl)-1-piperazine-ethanesulfonate), pH 7.0 and 200 mM NaCl, 2 mM DTT (dithiothreitol) to a concentration of 2 mg/ml) was used at a final protein concentration of 0.2 mg/ml per sample. Compounds were tested at a final concentration of 30 μM. A no compound control (NCC) was used according to the compound solvent at a final concentration of 2% (H 2 O, DMSO, ethanol, methanol). The natural cofactor 6R-L-erythro-5,6,7,8-tetrahydrobiopterin (BH4, CAS number 69056-38-8) stabilized in 100 mM dithiothreitol (DTT) at a final concentration of 43 μM was used as a positive control. To exclude nonspecific effects of the compound on the dye, a protein-free control (NPC) (buffer, compound, dye) was added. The measurement was performed in duplicate and the samples were denatured by scanning over a temperature range of 20 to 75°C at a scan rate of 0.5°C/min.
Данные нормализовали, и соответствующие значения Tm рассчитывали с помощью двухфазного уравнения для определения температур, при которых происходит 50%-ная денатурация (программное обеспечение GraphPadPrism). Для определения воздействия каждого конкретного соединения на термостабильность целевого белка использовали эталонную Tm (NCC) для расчета разницы температур между белком, обработанным соединением, и необработанным белком (Tm-TmNCC) из повторений, чтобы обеспечить смещение средних точек перехода (ΔTm1 and ΔTm2). Tm1 и Tm2 представляют собой две разные средние точки перехода процесса разворачивания белка, поскольку тетрамерный белок PAH разворачивается в два этапа из-за его доменов. Изменение Tm1 на 2°C отражает соответствующее повышение термостабильности регулирующего домена и, таким образом, считается положительным результатом.The data were normalized and the corresponding T m values were calculated using a two-phase equation to determine the temperatures at which 50% denaturation occurs (GraphPadPrism software). To determine the effect of each specific compound on the thermal stability of the target protein, the reference T m (NCC) was used to calculate the temperature difference between the compound-treated protein and the untreated protein (T m -T mNCC ) from replicates to provide offset midpoint transition points (ΔT m1 and ΔT m2 ). T m1 and T m2 represent two different transition midpoints of the protein unfolding process, since the tetrameric PAH protein unfolds in two steps due to its domains. A change in T m1 of 2°C reflects a corresponding increase in the thermostability of the regulatory domain and is thus considered a positive result.
2. Анализ активности фермента фенилаланингидроксилазы2. Analysis of the activity of the enzyme phenylalanine hydroxylase
Данный анализ проводили на культуре клеток с целью проанализировать активность фермента в присутствии соединений. Вкратце, конструкции PAH дикого типа или PAH Arg261Gln в течение короткого времени экспрессировались в клетках линии COS7 на 96-луночном планшете, отражающем генотип PAH (клеточная линия COS7 не имеет эндогенного PAH). Клетки обрабатывали соединениями при конечной концентрации 10 мкМ и анализировали ферментативную активность PAH через 48 часов после трансфекции. Действие соединений на остаточную ферментативную активность определяли в сравнении с необработанными клетками (NCC, только конечные 0,1% растворителя соединений). Для нормализации клеточного фонового сигнала нетрансфицированные клетки (контроль NT) обрабатывали соединением или растворителем в равной степени в течение 48 часов. В качестве положительного контроля авторы изобретения использовали сепиаптерин - стабильный предшественник BH4 (номер CAS 17094-01-8), стабилизированный в 100 мМ DTT, в конечной концентрации 5 мкМ.This assay was performed on cell culture to analyze enzyme activity in the presence of compounds. Briefly, wild-type PAH or PAH Arg261Gln constructs were expressed briefly in COS7 cells in a 96-well plate reflecting the PAH genotype (the COS7 cell line does not have endogenous PAH). Cells were treated with compounds at a final concentration of 10 μM and PAH enzymatic activity was analyzed 48 hours after transfection. The effect of compounds on residual enzymatic activity was determined in comparison with untreated cells (NCC, final 0.1% compound solvent only). To normalize the cellular background signal, untransfected cells (NT control) were treated equally with compound or vehicle for 48 hours. As a positive control, we used sepiapterin, a stable BH4 precursor (CAS number 17094-01-8), stabilized in 100 mM DTT at a final concentration of 5 μM.
Активность PAH определяли при 25°C, как было описано выше (Gersting, S.W., J. Biol. Chem., 2010, 285(40), 30686-30697) с некоторыми изменениями. Стандартная смесь содержала 22,35 мМ NaHEPES, pH 7,0, 2 ед./мкл мг/мл каталазы, 10 мкМ cульфата железа(II)-аммония и 1 мМ L-Phe (L-фенилаланин). Анализируемую смесь и фермент клеточной культуры предварительно инкубировали в течение 5 минут, и реакцию инициировали добавлением 75 мкМ BH4 (стабилизированного в 100 мМ дитиотреитола). Реакция протекала в течение 60 минут и была остановлена добавлением уксусной кислоты. Количество полученного L-тирозина определяли и количественно оценивали с помощью ВЭЖХ, проводимой в трех повторностях.PAH activity was determined at 25°C as described previously (Gersting, SW, J. Biol. Chem. , 2010, 285 (40), 30686-30697) with some modifications. The standard mixture contained 22.35 mM NaHEPES, pH 7.0, 2 units/μl mg/ml catalase, 10 μM iron(II)-ammonium sulfate, and 1 mM L-Phe (L-phenylalanine). The assay mixture and cell culture enzyme were pre-incubated for 5 minutes and the reaction was initiated by adding 75 µM BH4 (stabilized in 100 mM dithiothreitol). The reaction proceeded for 60 minutes and was stopped by adding acetic acid. The amount of L-tyrosine produced was determined and quantified by HPLC performed in triplicate.
Действие соединения на активность фермента PAH рассчитывали в трех повторностях следующим образом: вначале вычитали исходные данные нетрансфицированных клеток из трансфицированных клеток (обработанных или NCC (контроля без соединения)), а затем определяли процент обработанных (соединением) по сравнению с NCC. Активность фермента, превышающая 100%, показывает повышение активности фермента по отношению к NCC.The effect of a compound on PAH enzyme activity was calculated in triplicate as follows: first, the raw data of untransfected cells was subtracted from the transfected cells (treated or NCC (no compound control)), and then the percentage of treated (compound) versus NCC was determined. Enzyme activity greater than 100% indicates increased enzyme activity toward NCC.
ВЭЖХ проводили при следующих лабораторных условиях:HPLC was carried out under the following laboratory conditions:
1) Оборудование:1) Equipment:
ВЭЖХ: UltiMate 3000 (Dionex)HPLC: UltiMate 3000 (Dionex)
Колонка: ODS-2 Hypersil™; 50×4,6 мм; размер частиц 3 мкм; Thermo Scientific (Кат. №31603-054630)Column: ODS-2 Hypersil™; 50×4.6 mm; particle size 3 microns; Thermo Scientific (Cat. No. 31603-054630)
Предколонки: Accucore XL C18, 4 мкм, 10×4 мм; Thermo Scientific (Кат. №74104-014001)Pre-columns: Accucore XL C18, 4 µm, 10×4 mm; Thermo Scientific (Cat. No. 74104-014001)
2) Рабочий буфер для ВЭЖХ PAH (pH 4,6):2) HPLC running buffer PAH (pH 4.6):
15,7 мл NH3, 20 мл уксусной кислоты доведенные до 1 л деионизированной H2O (при необходимости pH корректируется при помощи уксусной кислоты)15.7 ml NH 3 , 20 ml acetic acid adjusted to 1 liter deionized H 2 O (pH adjusted with acetic acid if necessary)
3) Нормы для тирозина:3) Standards for tyrosine:
60 мкМ, 30 мкМ, 15 мкМ, 7,5 мкМ, 3,75 мкМ тирозина в 0,1 М HCl60 µM, 30 µM, 15 µM, 7.5 µM, 3.75 µM tyrosine in 0.1 M HCl
4) Рабочие условия:4) Working conditions:
Флуоресцентное обнаружение тирозина: возбуждение 275 нм, испускание 305 нм с помощью хроматографа UltiMate 3000 RSFluorescent detection of tyrosine: excitation 275 nm, emission 305 nm using an UltiMate 3000 RS chromatograph
Детектор флуоресценции (Dionex)Fluorescence detector (Dionex)
Элюент: Рабочий буфер для ВЭЖХ PAHEluent: HPLC Running Buffer PAH
Поток: 2 мл/минFlow: 2ml/min
Продолжительность рабочего цикла (эталоны): 1 минутаCycle time (references): 1 minute
Продолжительность рабочего цикла (образец PAH): 2,5 минутыCycle time (PAH sample): 2.5 minutes
Элюирование пика тирозина: около 0,7 минутTyrosine peak elution: about 0.7 minutes
Во время рабочего цикла образцы содержатся в автоматическом пробоотборнике при 4°C.During the operating cycle, samples are kept in the autosampler at 4°C.
В полости колонки поддерживается 25°C.The column cavity is maintained at 25°C.
3. Остаточное количество белка фенилаланингидроксилазы3. Residual amount of phenylalanine hydroxylase protein
Анализ остаточного количества белка PAH основывался на методе, описанном в Gersting S.W. et al., Human Molecular Genetics, 2010, 19 (10), 2039-2049 с некоторыми изменениями.PAH protein residue analysis was based on the method described in Gersting S.W. et al., Human Molecular Genetics, 2010, 19(10), 2039-2049 with some modifications.
Определение остаточного количества белка PAH производили методом дот-блоттинга при помощи лизатов, полученных из клеточной культуры, где трансфицированные на короткое время клетки линии COS-7 (с PAH дикого типа или разновидностью PAH) подвергались действию соединений в течение 48 часов. Эксперимент проводили на тех же образцах, которые использовали для определения активности ферментов.Residual PAH protein was determined by dot blot analysis using cell culture lysates where transiently transfected COS-7 cells (with wild-type or PAH variant) were exposed to compounds for 48 hours. The experiment was carried out on the same samples that were used to determine enzyme activity.
2 мкл лизата по каплям наносили на нитроцеллюлозную мембрану. Мембрану сушили на воздухе при комнатной температуре в течение 30 минут, а затем на 40 минут залили 5%-ным раствором молока в TBS-Tween (смесь трис-буферного солевого раствора и полисорбата) комнатной температуры. Мембрану инкубировали с мышиным первичным моноклональным антителом, специфичным к PAH (Millipore, Кат. № MAB5278, разведение 1:1000 в 5%-ном растворе молока в TBS-Tween) в течение ночи при 4°C. Затем мембрану промывали (3×10 минут в TBS-Tween) и инкубировали с вторичным антителом, конъюгированным с HRP (противомышиное антитело; Santa Cruz Botechnology, Inc., Кат. № sc-2005; разведение 1:1000 в 5%-ном растворе молока в TBS-Tween) с последующей тщательной промывкой в TBS-Tween (3×10 минут) и дистиллированной воде (1×10 минут). Блоты визуализировали с помощью субстрата Pierce™ ECL (ThermoFisher Scientific, Кат. №32106), а хемилюминесценцию отслеживали с помощью системы визуализации DIANA III или системы визуализации ChemiDoc™ MP (BioRad). Для анализа влияния соединения на количество белка PAH провели денситометрический анализ с помощью программного обеспечения ImageJ.2 μl of lysate was dropped onto a nitrocellulose membrane. The membrane was air dried at room temperature for 30 minutes and then soaked in a 5% milk solution in TBS-Tween (a mixture of Tris-buffered saline and polysorbate) at room temperature for 40 minutes. The membrane was incubated with PAH-specific mouse primary monoclonal antibody (Millipore, Cat. No. MAB5278, diluted 1:1000 in 5% milk in TBS-Tween) overnight at 4°C. The membrane was then washed (3 x 10 minutes in TBS-Tween) and incubated with HRP-conjugated secondary antibody (anti-mouse antibody; Santa Cruz Botechnology, Inc., Cat. No. sc-2005; 1:1000 dilution in 5% solution milk in TBS-Tween) followed by a thorough rinse in TBS-Tween (3×10 minutes) and distilled water (1×10 minutes). Blots were visualized using Pierce™ ECL Substrate (ThermoFisher Scientific, Cat. #32106) and chemiluminescence was monitored using a DIANA III Imaging System or a ChemiDoc™ MP Imaging System (BioRad). To analyze the effect of the compound on the amount of PAH protein, densitometric analysis was performed using ImageJ software.
Действие соединения на количество белка PAH определяли в трех повторностях. При определении активности фермента исходные данные нетрансфицированных клеток (NT) вычитали из трансфицированных клеток (NCC или обработанных соединением). На следующем этапе вычисляли изменение значений NCC по сравнению с клетками, обработанными соединением. Остаточное количество белка, превышающее 100%, показывает повышение стабильности фермента по отношению к NCC.The effect of the compound on the amount of PAH protein was determined in triplicate. When determining enzyme activity, raw data from non-transfected cells (NT) was subtracted from transfected cells (NCC or compound-treated). The next step was to calculate the change in NCC values compared to cells treated with the compound. Protein residues greater than 100% indicate an increase in enzyme stability towards NCC.
4. Изотермическая титрационная калориметрия4. Isothermal titration calorimetry
Изотермическая титрационная калориметрия (ITC) представляет собой физический метод количественного определения, используемый для определения аффинности связывания небольших молекул с белками или иными более крупными молекулами [Freyer M.W. and Lewis E.A., Methods in Cell Biology, 2008, Том 4, глава 4, стр. 79-113]. Данное измерение определяет изменения тепла, выделяемого или поглощаемого при взаимодействии молекул, генерирует кинетику связывания и термодинамический профиль молекулярного взаимодействия. Isothermal titration calorimetry (ITC) is a physical quantification method used to determine the binding affinity of small molecules to proteins or other larger molecules [Freyer MW and Lewis EA, Methods in Cell Biology , 2008, Volume 4, Chapter 4, p. 79 -113]. This measurement determines changes in the heat generated or absorbed when molecules interact, generating binding kinetics and a thermodynamic profile of the molecular interaction.
Определяются следующие параметры:The following parameters are defined:
KD (равновесная константа диссоциации), N (стехиометрия взаимодействия (моль лиганда/моль комплекса)), ΔH (изменение энтальпии), ΔG (энергия Гиббса), T (температура) и ΔS (изменение энтропии).KD (equilibrium dissociation constant), N (interaction stoichiometry (mol of ligand/mol of complex)), ΔH (enthalpy change), ΔG (Gibbs energy), T (temperature), and ΔS (entropy change).
Эксперименты с ITC проводили при 25°C с использованием микрокалориметра MicroCal PEAQ-ITC (Malvern). Белки PAH получали в буфере HEPES (HEPES 20 мМ Hepes, 0,2 М NaCl, 1 мМ DTT, pH 7,0), содержащем 5% ДМСО для приведения в соответствие с конечной концентрацией ДМСО в растворах соединений. Используемую концентрацию белка (30 мкМ) определяли за счет поглощения ультрафиолета (УФ) при 280 нм. Соединения (500 мМ) подготавливали, используя тот же самый буфер. Двенадцать инъекций по 3 мкл смеси соединение/лиганд титровали в ячейку с образцом (содержащую белок) в течение 31 минуты при скорости перемешивания 750 об/мин. Данные корректировали по отношению к базовым значениям путем вычитания исходных данных, полученных при равнозначных инъекциях соединения в буферный раствор. Кривые титрования анализировали с помощью аналитической программы MicroCal PEAQ-ITC (версия 1.1.0.1262, Malvern Instruments Ltd.) используя модель, за которую принимается набор идентичных участков связывания, где общая теплота раствора рассчитывается следующим образом:ITC experiments were performed at 25°C using a MicroCal PEAQ-ITC microcalorimeter (Malvern). PAH proteins were prepared in HEPES buffer (HEPES 20 mM Hepes, 0.2 M NaCl, 1 mM DTT, pH 7.0) containing 5% DMSO to match the final DMSO concentration in the compound solutions. The protein concentration used (30 μM) was determined by ultraviolet (UV) absorbance at 280 nm. Compounds (500 mM) were prepared using the same buffer. Twelve 3 μl injections of the compound/ligand mixture were titrated into the sample cell (containing the protein) over 31 minutes at a stirring speed of 750 rpm. The data were adjusted to the baseline values by subtracting the baseline data obtained from equal injections of the compound into the buffer solution. Titration curves were analyzed using the analytical software MicroCal PEAQ-ITC (version 1.1.0.1262, Malvern Instruments Ltd.) using a model that takes a set of identical binding sites, where the total heat of the solution is calculated as follows:
где n - количество сайтов связывания, Mt - общая концентрация белков в клетке, ΔH - мольная теплота связывания лиганда, Xt - общая концентрация лиганда и K - константа связывания (K=1/KD). Тепло, выделяемое на каждую инъекцию (i), ΔQ(i), рассчитывается в соответствии с приведенным ниже уравнением, в котором компенсируется объем, прибавляемый при каждой инъекции (ΔVi). V0 - первоначальный объем в ячейке.where n is the number of binding sites, M t is the total concentration of proteins in the cell, ΔH is the molar heat of binding of the ligand, X t is the total concentration of the ligand and K is the binding constant (K=1/KD). The heat generated per injection (i), ΔQ(i), is calculated according to the equation below, which compensates for the volume added with each injection (ΔVi). V 0 is the initial volume in the cell.
Параметры n, K и ΔH определяют посредством нелинейной аппроксимации по методу наименьших квадратов с использованием алгоритма Левенберга-Марквардта.The parameters n, K and ΔH are determined by nonlinear least squares fitting using the Levenberg-Marquardt algorithm.
5. Тестируемые соединения5. Test connections
Триамтерен (Santa Cruz Biotechnology), нолатретекса дигикрохлорид (Carbosynth), сульфоприда гидрохлорид (Carbosynth), гидрастинина гидрохлорид (Santa Cruz Biotechnology), буфуралола гидрохлорид (Santa Cruz Biotechnology), S-буфуралола гидрохлорид (Santa Cruz Biotechnology), локсорибин (Tocris, Biogen), валганцикловира гидрохлорид (Santa Cruz Biotechnology), валацикловира гидрохлорид (Santa Cruz Biotechnology) и миноксидил (Sigma Aldrich) тестировали в соответствии с одним или несколькими анализами, описанными выше. В качестве контрольных соединений использовали сепиаптерин (Santa Cruz Biotechnology) или BH4 (Carbosynth).Triamterene (Santa Cruz Biotechnology), nolatretex dihydrochloride (Carbosynth), sulfopride hydrochloride (Carbosynth), hydrastinine hydrochloride (Santa Cruz Biotechnology), bufuralol hydrochloride (Santa Cruz Biotechnology), S-bufuralol hydrochloride (Santa Cruz Biotechnology), loxoribine (Tocris, Biogen ), valganciclovir hydrochloride (Santa Cruz Biotechnology), valacyclovir hydrochloride (Santa Cruz Biotechnology), and minoxidil (Sigma Aldrich) were tested according to one or more of the assays described above. Sepiapterin (Santa Cruz Biotechnology) or BH4 (Carbosynth) were used as control compounds.
Результатыresults
Пример 1. Анализ изменения термостабильностиExample 1: Analysis of Thermal Stability Changes
Определяли смещения средних точек перехода 1 и 2 (ΔTm1 и ΔTm2) обработанных соединением (30 мкМ) целевых белков PAH дикого типа (PAH ДТ) и Arg261Gln (R261Q PAH). В качестве положительного контроля использовали 6R-L-эритро-5,6,7,8-тетрагидробиоптерин (BH4) (43 мкМ). Результаты представлены в таблице ниже.The displacements of transition midpoints 1 and 2 (ΔT m1 and ΔT m2 ) of compound-treated (30 μM) wild-type PAH (WT PAH) and Arg261Gln (R261Q PAH) target proteins were determined. 6 R -L-erythro-5,6,7,8-tetrahydrobiopterin (BH4) (43 μM) was used as a positive control. The results are presented in the table below.
Результаты показывают, что данные соединения способны стабилизировать фермент с такой же эффективностью, что и природный кофактор BH4, которые в исследованиях термостабильности демонстрируют более высокую стабилизирующую активность в отношении мутантного PAH, чем в отношении белка дикого типа. Для применения в лечении ФКУ наиболее подходящими результатами являются результаты по мутантному белку и, в частности, по стабилизации регуляторного домена (Tm1).The results indicate that these compounds are capable of stabilizing the enzyme with the same efficiency as the natural cofactor BH4, which in thermostability studies demonstrate higher stabilizing activity against the mutant PAH than against the wild-type protein. For use in the treatment of PKU, the most relevant results are those for the mutant protein and, in particular, for the stabilization of the regulatory domain (T m1 ).
Пример 2. Анализ активности фермента фенилаланингидроксилазыExample 2: Phenylalanine hydroxylase enzyme activity assay
Определяли влияние соединений на активность фермента PAH в клетках, временно экспрессирующих PAH дикого типа (PAH ДТ) или Arg261Gln (R261Q), в течение 48 часов. Результаты представлены в таблице ниже. Данные представляют собой среднее значение и стандартное отклонение (SD) процента образования L-тирозина в клетках, обработанных соединением (10 мкМ), по сравнению с необработанными клетками (NCC). В качестве положительного контроля использовали сепиаптерин (5 мкМ).The effect of the compounds on PAH enzyme activity was determined in cells transiently expressing wild-type PAH (WT PAH) or Arg261Gln (R261Q) for 48 hours. The results are presented in the table below. Data represent the mean and standard deviation (SD) of the percentage of L-tyrosine production in cells treated with compound (10 μM) compared to untreated cells (NCC). Sepiapterin (5 μM) was used as a positive control.
значение
[% NCC]Average
meaning
[%NCC]
[% NCC]CO
[%NCC]
значение
[% NCC]Average
meaning
[%NCC]
[% NCC]CO
[%NCC]
Результаты показывают, что обработка вышеуказанными соединениями значительно увеличивает ферментативную активность PAH дикого типа и мутантного PAH, экспрессируемых в клетках линии COS7, хотя и в меньшей степени, чем сепиаптерин, использованный в качестве положительного контроля.The results show that treatment with the above compounds significantly increases the enzymatic activity of wild-type and mutant PAH expressed in COS7 cells, although to a lesser extent than sepiapterin used as a positive control.
Пример 3. Остаточное количество белка фенилаланингидроксилазыExample 3 Residual amount of phenylalanine hydroxylase protein
Определяли влияние соединений на уровень белка PAH в клетках, временно экспрессирующих PAH дикого типа (PAH ДТ) или Arg261Gln (R261Q), в течение 48 часов. Результаты представлены в таблице ниже. Данные представляют собой среднее значение и стандартное отклонение (SD) процента сигнала иммунных блотов PAH клеток, обработанных соединением (10 мкМ), по сравнению с необработанными клетками (NCC). В качестве положительного контроля использовали сепиаптерин (5 мкМ).The effect of the compounds on PAH protein levels was determined in cells transiently expressing wild-type PAH (WT PAH) or Arg261Gln (R261Q) for 48 hours. The results are presented in the table below. Data represent the mean and standard deviation (SD) of the percent signal of PAH immunoblots of cells treated with compound (10 μM) compared to untreated cells (NCC). Sepiapterin (5 μM) was used as a positive control.
значение
[% NCC]Average
meaning
[%NCC]
[% NCC]CO
[%NCC]
значение
[% NCC]Average
meaning
[%NCC]
[% NCC]CO
[%NCC]
Результаты показывают, что обработка вышеуказанными соединениями значительно повышает уровень белка PAH дикого типа и мутантного PAH, экспрессируемых в клетках линии COS7, что свидетельствует о повышении стабильности белка PAH или синтеза белка.The results show that treatment with the above compounds significantly increases the level of wild-type and mutant PAH protein expressed in COS7 cells, indicating an increase in PAH protein stability or protein synthesis.
Пример 4. Изотермическая титрационная калориметрияExample 4: Isothermal Titration Calorimetry
Проведен анализ и получены данные изотермической калориметрии при титровании триамтерена и гидрохлорида гидрастинина в PAH дикого типа (PAH ДТ). В качестве положительного контроля использовали BH4. Результаты представлены в таблице ниже.An analysis was carried out and isothermal calorimetry data were obtained during the titration of triamterene and hydrastinine hydrochloride in wild-type PAH (WT PAH). BH4 was used as a positive control. The results are presented in the table below.
(мкМ)KD
(µM)
(сайты)N
(sites)
(кДж/моль)ΔH
(kJ/mol)
(кДж/моль)ΔG
(kJ/mol)
(кДж/моль)-TΔS
(kJ/mol)
Результаты показывают, что триамтерен и гидрохлорид гидрастинина с высокой аффинностью связываются с рекомбинантным PAH при Kd в низком микромолярном диапазоне.The results show that triamterene and hydrastinine hydrochloride bind with high affinity to recombinant PAH at a Kd in the low micromolar range.
Claims (22)
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP19382102.2 | 2019-02-14 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| RU2021123366A RU2021123366A (en) | 2023-03-14 |
| RU2815197C2 true RU2815197C2 (en) | 2024-03-12 |
Family
ID=
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2553343C2 (en) * | 2007-08-17 | 2015-06-10 | Байомарин Фармасьютикал Инк. | Compositions of prokaryotic phenylalanine-ammonia-lyase and method of cancer treatment with application of such compositions |
| WO2017029202A1 (en) * | 2015-08-14 | 2017-02-23 | Bergen Teknologioverføring As | Hyperphenylalaninemia and treatments thereof |
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2553343C2 (en) * | 2007-08-17 | 2015-06-10 | Байомарин Фармасьютикал Инк. | Compositions of prokaryotic phenylalanine-ammonia-lyase and method of cancer treatment with application of such compositions |
| WO2017029202A1 (en) * | 2015-08-14 | 2017-02-23 | Bergen Teknologioverføring As | Hyperphenylalaninemia and treatments thereof |
Non-Patent Citations (1)
| Title |
|---|
| KOCHHAR, J.S. et al. Clinical therapeutics for phenylketonuria. Drug Deliv. and Transl. Res. 2012, vol. 2, pp.223-237. GLADYS HO, JOHN CHRISTODOULOU. Phenylketonuria: translating research into novel therapies, 2014, Vol. 3, No. 2, p. 49-62. STEINBERG, P., RUBIO, M.C. Effect of triamterene on tyrosine hydroxylase activity. Naunyn-Schmiedeberg's Arch. Pharmacol. 1984, vol.327, pp.119-123. * |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10265303B2 (en) | Hyperphenylalaninemia and treatments thereof | |
| CN113727733B (en) | Triamterene or nolatrexed for treating phenylketonuria | |
| JP2023116556A (en) | Pharmaceutical compositions comprising sepiapterin and uses thereof | |
| US8338423B2 (en) | Compositions for the treatment of hyperphenylalaninemia | |
| US20080021013A1 (en) | JAK inhibitors for treatment of myeloproliferative disorders | |
| US9012471B2 (en) | Glucose metabolism modulating compounds | |
| JP2007516227A (en) | Pyrrole compounds and uses thereof | |
| BR112019010222A2 (en) | sepiapterine polymorphs and salts thereof | |
| JP2016504389A (en) | Methods and compositions for the treatment of demyelinating diseases | |
| RU2815197C2 (en) | Triamterene or nolatrexed for use in treating phenylketonuria | |
| EP1377279A2 (en) | Inhibition of erk to reduce or prevent tolerance to and dependence on opioid analgesics | |
| US20110200687A1 (en) | Bifeprunox mesylate maintenance dose compositions and methods for using the same | |
| JP2022552831A (en) | Aldose reductase inhibitors for the treatment of phosphomannommutase 2 deficiency | |
| US20130338116A1 (en) | Compounds and methods for the treatment of pain and other diseases | |
| TW201625264A (en) | Inhibitor for lens hardness | |
| CA3176768A1 (en) | Aldose reductase inhibitors for treating sorbitol dehydrogenase deficiency | |
| KR101325058B1 (en) | A novel compound, 3',4'-difluoroquercetin, preparation method thereof and use thereof | |
| JP2022544803A (en) | Compounds suitable for treating and preventing muscle wasting and other conditions | |
| CN101489562B (en) | Jak inhibitors for treatment of myeloproliferative disorders | |
| EP2992883B1 (en) | Pharmaceutical use of hexahydro-dibenzo[a,g]quinolizine compounds | |
| WO2023182298A1 (en) | Therapeutic or prophylactic medicine for fragile x syndrome | |
| WO2020188100A2 (en) | Roscovitine analogues and use thereof for treating rare biliary diseases | |
| TW201238964A (en) | Use for improving 5-HT and eNOS activity of KMUPS piperazinium salts | |
| KR20100029827A (en) | Stable formulations of thiadiazole derivative | |
| EA042976B1 (en) | PHARMACEUTICALLY ACCEPTABLE SALTS OF SEPIAPTERIN |