RU2725493C2 - System for stable expression of tumor-associated antigens based on lentiviral vector - Google Patents
System for stable expression of tumor-associated antigens based on lentiviral vector Download PDFInfo
- Publication number
- RU2725493C2 RU2725493C2 RU2018147200A RU2018147200A RU2725493C2 RU 2725493 C2 RU2725493 C2 RU 2725493C2 RU 2018147200 A RU2018147200 A RU 2018147200A RU 2018147200 A RU2018147200 A RU 2018147200A RU 2725493 C2 RU2725493 C2 RU 2725493C2
- Authority
- RU
- Russia
- Prior art keywords
- tumor
- mhc
- sequence
- complex
- lentiviral
- Prior art date
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
- C12N15/867—Retroviral vectors
Landscapes
- Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Wood Science & Technology (AREA)
- Organic Chemistry (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Zoology (AREA)
- Molecular Biology (AREA)
- Physics & Mathematics (AREA)
- Microbiology (AREA)
- Plant Pathology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biophysics (AREA)
- Virology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Description
Изобретение относится к области биотехнологии. Может быть использовано для экспрессии опухоль-ассоциированных антигенов с их последующим включением в эндосому через систему комплекса гистосовместимости МНС II.The invention relates to the field of biotechnology. It can be used for expression of tumor-associated antigens with their subsequent incorporation into the endosome through the MHC II histocompatibility complex system.
Ежегодно в мире от злокачественных новообразований умирает около 7 млн. человек. По данным ВОЗ онкологические заболевания по частоте встречаемости стоят на 2 месте, а в некоторых промышленно развитых регионах - на первом месте. Традиционно до недавнего времени основными методами лечения считались: хирургический, цитотоксическая химиотерапия и лучевая терапия.About 7 million people die every year from malignant neoplasms in the world. According to the WHO, oncological diseases are on the second place in frequency of occurrence, and in the first place in some industrialized regions. Traditionally, until recently, the main treatment methods were considered: surgical, cytotoxic chemotherapy and radiation therapy.
Достижения иммунологической науки за последние годы привели к созданию принципиально новых подходов и методов терапии онкологических заболеваний.Advances in immunological science in recent years have led to the creation of fundamentally new approaches and methods for the treatment of cancer.
Так, уже более 40 лет тому назад было показано, что многие опухоли иммуногенны. Однако цитотоксические Т-лимфоциты не активируются при появлении раковых клеток и их специфических антигенов и не способны секретировать цитокины, которые они секретируют при встрече с чужеродными антигенами. Поэтому одна из стратегий борьбы с опухолями заключается в стимулировании иммунной системы к узнаванию опухолевых клеток.So, more than 40 years ago it was shown that many tumors are immunogenic. However, cytotoxic T-lymphocytes are not activated when cancer cells and their specific antigens appear and are not able to secrete cytokines, which they secrete when they encounter foreign antigens. Therefore, one of the strategies for controlling tumors is to stimulate the immune system to recognize tumor cells.
В частности, были предприняты попытки создания индивидуальных противоопухолевых вакцин (А.Ю. Барышников, Принципы и практика вакцинотерапии рака, Бюллетень СО РАМН, №2(112). 2004, стр. 59-63).In particular, attempts were made to create individual antitumor vaccines (A.Yu. Baryshnikov, Principles and Practice of Cancer Vaccine Therapy, Bulletin SB RAMS, No. 2 (112). 2004, pp. 59-63).
В настоящее время значительное внимание уделяется применению дендритных клеток и препаратов (вакцин) на их основе.Currently, considerable attention is paid to the use of dendritic cells and preparations (vaccines) based on them.
Дендритные клетки являются профессиональными антиген-презентирующими клетками (АПК) и играют ключевую роль в формировании первичного иммунного ответа. Важной особенностью дендритных клеток является их способность захватывать из окружающей среды различные антигены при помощи пино- и эндоцитоза. После поглощения антигена дендритные клетки мигрируют в лимфоидные органы, где презентируют антигенные детерминанты в контексте главного комплекса гистосовместимости (МНС) различным популяциям Т-лимфоцитов. Существует два типа рецепторов главного комплекса гистосовместимости. Рецепторы МНС I экспрессируются во всех ядерных клетках организма, осуществляя механизм распознавания «свой-чужой» и презентируют эндогенные антигены, такие как вирусные или раковые антигены. В данном случае связывание рецептора и антигена происходит в эндоплазматическом ретикулуме. Рецепторы МНС II экспрессируются антигенпрезентирующими клетками и другими типами клеток крови, например В-клетками, и презентируют экзогенные антигены, поглощенные в результате эндоцитоза. В отличие от МНС I, связывание МНС II и антигена происходит в области эндосомы. В случае МНС I презентация чужеродного антигена, например, вирусного пептида, вызывает активацию CD8+ цитотоксических Т-лимфоцитов и приводит к немедленному иммунному ответу. В результате происходит уничтожение зараженной клетки. Презентация чужеродного экзогенного пептида молекулами комплекса МНС II вызывает активацию как CD8+ цитотоксических Т-лимфоцитов, так и активацию CD4+ хэлперных Т-лимфоцитов, что приводит к возникновению механизма «иммунной памяти». Такой механизм характеризуется возникновением популяции В-лимфоцитов, продуцирующих специфические антитела и популяции более специфичных цитотоксических Т-лимфоцитов, нацеленных на чужеродный антиген.Dendritic cells are professional antigen-presenting cells (APCs) and play a key role in the formation of the primary immune response. An important feature of dendritic cells is their ability to capture various antigens from the environment through pinotomy and endocytosis. After antigen uptake, dendritic cells migrate to the lymphoid organs, where antigenic determinants are presented in the context of the main histocompatibility complex (MHC) to various populations of T-lymphocytes. There are two types of receptors for the major histocompatibility complex. MHC I receptors are expressed in all nuclear cells of the body, implementing a “friend or foe” recognition mechanism and presenting endogenous antigens, such as viral or cancer antigens. In this case, the binding of the receptor and antigen occurs in the endoplasmic reticulum. MHC II receptors are expressed by antigen-presenting cells and other types of blood cells, such as B cells, and present exogenous antigens absorbed as a result of endocytosis. Unlike MHC I, the binding of MHC II and antigen occurs in the region of the endosome. In the case of MHC I, the presentation of a foreign antigen, for example, a viral peptide, activates CD8 + cytotoxic T-lymphocytes and leads to an immediate immune response. The result is the destruction of the infected cell. The presentation of a foreign exogenous peptide by MHC II complex molecules activates both CD8 + cytotoxic T-lymphocytes and activation of CD4 + helper T-lymphocytes, which leads to the emergence of an “immune memory” mechanism. Such a mechanism is characterized by the emergence of a population of B-lymphocytes that produce specific antibodies and populations of more specific cytotoxic T-lymphocytes aimed at a foreign antigen.
Известен способ индукции высокого уровня CD4+ и CD8+ Т-клеточного ответа и специфических типов цитокинов с целью достижения высокого уровня защиты и терапевтической активности за счет иммуногенных HER2-специфичных конструкций полиэпитопа, содержащих CTL и/или эпитопы Th и оптимизированные последовательности спейсера. Конструкции могут использоваться для продуцирования антигенпредставляющих клеток, например, дендритных клеток (DC), для представления желаемых эпитопов лимфоцитам (заявка ЕА 201290813 (А1), опубл. 2013-04-30).A known method of inducing a high level of CD4 + and CD8 + T-cell response and specific types of cytokines in order to achieve a high level of protection and therapeutic activity due to immunogenic HER2-specific polyepitope constructs containing CTL and / or Th epitopes and optimized spacer sequences. Designs can be used to produce antigen-presenting cells, for example, dendritic cells (DC), to present the desired epitopes to lymphocytes (application EA 201290813 (A1), publ. 2013-04-30).
Известен способ экспрессии полиэпитопных опухоль-ассоциированных антигенов в дендритных клетках, способных стимулировать специфические цитотоксические клетки, основанный на использовании рекомбинантной плазмидной ДНК pCI-UB-POLYEPI, которая содержит 11 эпитопов опухоль-ассоциированных антигенов колоректального рака, имеет размер 6355 п.н. (патент РФ 2507265, опубл. 20.02.2014). Данный источник может быть указан в качестве ближайшего аналога-прототипа.A known method of expression of polyepitope tumor-associated antigens in dendritic cells capable of stimulating specific cytotoxic cells based on the use of recombinant plasmid DNA pCI-UB-POLYEPI, which contains 11 epitopes of tumor-associated antigens of colorectal cancer, has a size of 6355 bp (RF patent 2507265, publ. 02.20.2014). This source can be indicated as the closest analogue prototype.
Задачей изобретения является создание системы, способной включать специфические антигенные детерминанты через систему комплекса МНС II, что позволяет значительно расширить возможности применения дендритных клеток пациента, и тем самым увеличить эффективность противораковой терапии.The objective of the invention is to create a system that can include specific antigenic determinants through the complex system of MHC II, which can significantly expand the possibilities of using dendritic cells of the patient, and thereby increase the effectiveness of anticancer therapy.
Задача решается ДНК конструкцией на основе лентивирусого вектора для экспрессии опухоль-ассоциированных антигенов с последующим их транспортом в эндосому через систему комплекса МНС П.The problem is solved by a DNA construct based on a lentiviral vector for the expression of tumor-associated antigens with their subsequent transport to the endosome through the MHC complex system P.
Предлагаемые плазмидные лентивирусные конструкции включают последовательность инвариантного домена CD74/Ii комплекса МНС II, в качестве лидирующей сигнальной области, присоединенной к целевым полипептидам (антигенам). CD74/Ii выступает в роли сигнальной последовательности, направляющей транспортировку комплекса МНС II в эндосомальный компартмент.The proposed plasmid lentiviral constructs include the sequence of the invariant domain of the CD74 / Ii complex of the MHC II complex, as the leading signal region attached to the target polypeptides (antigens). CD74 / Ii acts as a signal sequence directing the transport of the MHC II complex to the endosomal compartment.
Техническим результатом изобретения является создание универсальной лентивирусной системы, позволяющей транспортировать широкий спектр слитых белков-антигенов в эндосому, где они будут расщеплены и презентированы молекулами комплекса МНС II.The technical result of the invention is the creation of a universal lentiviral system that allows you to transport a wide range of fused protein antigens to the endosome, where they will be cleaved and presented by molecules of the MHC II complex.
В отличие от случая с комплексом МНС I, МНС II препятствует присоединению эндогенных пептидных молекул в области шероховатого ЭПР (эндоплазматического ретикулума). Также CD74/Ii выступает в роли сигнальной последовательности, направляющей транспортировку комплекса МНС II в эндосомальный компартмент. В эндосоме МНС II претерпевает протеолитическое расщепление, в результате которого происходит отщепление Ii домена и присоединение уже протеолизированных экзогенных пептидов (антигенов). Таким образом, использование последовательности CD74/Ii в качестве лидирующей сигнальной области, присоединенной к целевым полипептидам (антигенам), экспрессированным с плазмидных ДНК или из генома дендритной клетки, позволит транспортировать такие слитые белки в эндосому, где они будут расщеплены и презентированы молекулами комплекса МНС II.Unlike the case with the complex of MHC I, MHC II prevents the attachment of endogenous peptide molecules in the region of rough EPR (endoplasmic reticulum). CD74 / Ii also acts as a signal sequence directing the transport of the MHC II complex to the endosomal compartment. In the endosome, MHC II undergoes proteolytic cleavage, as a result of which the Ii domain is cleaved and the already proteolized exogenous peptides (antigens) are attached. Thus, the use of the CD74 / Ii sequence as the leading signal region attached to the target polypeptides (antigens) expressed from plasmid DNA or from the dendritic cell genome will allow such fusion proteins to be transported to the endosome, where they will be cleaved and presented by MHC II complex molecules .
Согласно изобретению экспрессии может подлежать широкий спектр опухоль-ассоциированных антигенов, например: СБА, TGF-PRII (колоректальная карцинома), TAG-72 (карцинома простаты), HPV Е6, Е7 (цервикальная карцинома), BING-4, SSX-2, TRP-1/-2 ( меланома), Cyclin-B1, EphA3, Her2/neu (мульти рак), Ер-САМ (рак груди), простато-специфический антиген (рак простаты), BRCA1/2 (карцинома груди и яичников), MUC1 ( дуктальная карцинома), Ig, ТСЯ(лимфома) и т.п.According to the invention, a wide range of tumor-associated antigens can be expressed, for example: SBA, TGF-PRII (colorectal carcinoma), TAG-72 (prostate carcinoma), HPV E6, E7 (cervical carcinoma), BING-4, SSX-2, TRP -1 / -2 (melanoma), Cyclin-B1, EphA3, Her2 / neu (multi cancer), Ep-CAM (breast cancer), prostate-specific antigen (prostate cancer), BRCA1 / 2 (breast and ovarian carcinoma), MUC1 (ductal carcinoma), Ig, TSJA (lymphoma), etc.
Для доставки последовательностей антигенов, слитых с сигнальными последовательностями CD74/Ii цепей, в антигенпрезентирующие дендритные клетки использована методика лентивирусного переноса целевых последовательностей.To deliver the sequences of antigens fused to the signal sequences of CD74 / Ii chains into antigen-presenting dendritic cells, the lentiviral transfer technique of the target sequences was used.
Использование лентивирусных векторов имеет несколько значительных преимуществ по сравнению с такими подходами, как трансфекционный перенос плазмидных ДНК или электропорирование клеток ДНК конструкциями:The use of lentiviral vectors has several significant advantages compared to such approaches as transfection transfer of plasmid DNA or electroporation of DNA cells with constructs:
- лентивирусные векторы способны быстро интегрироваться в геном клетки-мишени, обеспечивая стабильную экспрессию трансгена;- lentiviral vectors are able to quickly integrate into the genome of the target cell, ensuring stable transgene expression;
- лентивирусные векторы позволяют клонировать достаточно длинные последовательности ДНК до 10 т.п.о, при этом сохраняют высокий уровень упаковки вирусных частиц и свою трансдукционную способность;- lentiviral vectors allow cloning rather long DNA sequences up to 10 kb, while maintaining a high level of packaging of viral particles and their transduction ability;
- лентивирусные векторы обладают широким тропизмом за счет внедрения типирующих белков в оболочку вирусных частиц. Данное свойство позволяет значительно увеличить трансдукционную способность вируса для определенного типа клеток, что крайне важно в работе с труднотрансфецируемыми первичными культурами клеток крови;- lentiviral vectors have a wide tropism due to the introduction of typing proteins into the envelope of viral particles. This property allows you to significantly increase the transduction ability of the virus for a certain type of cell, which is extremely important in working with hardly transfected primary blood cell cultures;
- лентивирусные векторы позволяют доставить ДНК даже в труднотрансфецируемые, неделящиеся клетки, в том числе, первичные дифференцированные клетки, такие как дендритные клетки и лимфоциты.- lentiviral vectors make it possible to deliver DNA even to hardly transfected, non-dividing cells, including primary differentiated cells, such as dendritic cells and lymphocytes.
В качестве основного генетического каркаса, формирующего лентивирусную векторную систему использовалась ранее сконструированная нами универсальная плазмидная лентивирусная ДНК конструкция (Фиг. 1). Изображение иллюстрирует схему плазмидной лентивирусной ДНК-конструкции pLA-CMV-ELuc-puro.As the main genetic framework forming the lentiviral vector system, we used the previously constructed universal plasmid lentiviral DNA construct (Fig. 1). The image illustrates the scheme of the plasmid lentiviral DNA construct pLA-CMV-ELuc-puro.
В состав данной плазмиды входит ряд ключевых генетических элементов:The composition of this plasmid includes a number of key genetic elements:
- AmpR - последовательность устойчивости к ампициллину, необходимая для амплификации плазмидной ДНК в клетках бактериального штамма E. coli;- AmpR - ampicillin resistance sequence necessary for amplification of plasmid DNA in cells of a bacterial strain of E. coli;
- HIV 5' и 3' LTR - длинные концевые повторы ретровирусов (в частности, вируса иммунодефицита человека), обеспечивают встраивание последовательности генома вируса в геном клетки хозяина;- HIV 5 'and 3' LTR - long terminal repeats of retroviruses (in particular, human immunodeficiency virus), ensure the integration of the sequence of the virus genome into the genome of the host cell;
- сРРТ (central polypurine tract) - центральный полипуриновый тракт, способствует встраиванию ДНК вируса в геном митотически неактивных клеток;- CPPT (central polypurine tract) - the central polypurine tract, promotes the incorporation of virus DNA into the genome of mitotically inactive cells;
- CMV - промотерный регион, обеспечивает стабильный и высокий уровень экспрессии 3' нижележащей последовательности ДНК;- CMV - promoter region, provides a stable and high level of expression of the 3 'underlying DNA sequence;
- NLuc - участок N-концевой области люциферазы, на 5' и 3' концах содержит ряд консенсусных участков, распознаваемых ферментами рестрикции-модификации;- NLuc - section of the N-terminal region of luciferase, at the 5 'and 3' ends contains a number of consensus regions recognized by restriction-modification enzymes;
- WPRE (Woodchuck hepatitis virus Posttranscriptional Regulatory Element) - энхансерный регион, способствует повышению уровня экспрессии целевых белков.- WPRE (Woodchuck hepatitis virus Posttranscriptional Regulatory Element) - an enhancer region that enhances the expression of target proteins.
Презентация опухоль-ассоциированных антигенов, опосредованная молекулами главного комплекса гистосовместимости II, напрямую зависит от эффективного переноса новоэксперссированного антигена в область эндосомального компартмента. В связи с тем, что одним из основных регуляторов транспортировки МНС II в эндосому является белок CD74/Ii, который используют в качестве сигнальной последовательности, направляющей антиген в эндосому. Однако, большая часть последовательности полипептида служит для формирования особой пространственной структуры белка, необходимой для его взаимодействия с молекулой МНС II. За саму транспортировку CD74 отвечает лишь небольшая функциональная область, которая может использоваться отдельно.The presentation of tumor-associated antigens mediated by the molecules of the main histocompatibility complex II directly depends on the effective transfer of the newly-expressed antigen to the region of the endosomal compartment. Due to the fact that one of the main regulators of the transport of MHC II to the endosome is CD74 / Ii protein, which is used as a signal sequence directing the antigen to the endosome. However, most of the polypeptide sequence serves to form a special spatial structure of the protein necessary for its interaction with the MHC II molecule. Only the small functional area that can be used separately is responsible for the transport of the CD74 itself.
Более того, в данный N-концевой домен может входить несколько вариантов еще более коротких последовательностей, отвечающих за перенос CD74/Ii-MHC II. Для определения сигнальной последовательности, приводящей к наилучшей загрузке в МНС II было протестировано несколько вариантов сигнальных пептидов CD74/Ii-рецептора.Moreover, several variants of even shorter sequences responsible for the transfer of CD74 / Ii-MHC II may be included in this N-terminal domain. To determine the signal sequence leading to the best loading in MHC II, several variants of the signal peptides of the CD74 / Ii receptor were tested.
Для амплификации была использована серия праймеров (табл). Изображение иллюстрирует последовательности праймеров для амплификации различных сигнальных участков N-концевого домена инвариантной цепи.For amplification, a series of primers was used (table). The image illustrates primer sequences for amplification of various signal regions of the N-terminal domain of an invariant chain.
Схема последовательности белка CD74 с отмеченными участками сигнальных пептидов эндосомальной локализации представлена на фиг. 2The sequence diagram of the CD74 protein with marked portions of signal peptides of endosomal localization is shown in FIG. 2
В качестве наиболее оптимального варианта отобран удлиненный вариант сигнального участка Ii key (далее в тексте обозначается как "Ii key long"). В качестве опухолевого антигена используют белок ERBB2 (HER2/neu). Рецептор ERBB2 является одним из высокоспецифичных онкологических маркеров, за счет того, что повышенная амплификация и экспрессия данного рецептора характерна для ряда агрессивных типов рака молочной железы и некоторых других видов злокачественных опухолеобразований. Рецептор также ERBB2 является одним из самых больших специфичных опухолевых антигенов, поэтому успешная презентация антигенных детерминант такой молекулы позволит судить об успешности загрузки остальных опухоль-ассоциированных антигенов.As the most optimal option, an elongated version of the Ii key signal section was selected (hereinafter referred to as "Ii key long"). As a tumor antigen, the ERBB2 protein (HER2 / neu) is used. The ERBB2 receptor is one of the highly specific oncological markers, due to the fact that increased amplification and expression of this receptor is characteristic of a number of aggressive types of breast cancer and some other types of malignant tumors. The receptor also ERBB2 is one of the largest specific tumor antigens, therefore, the successful presentation of the antigenic determinants of such a molecule will make it possible to judge the success of loading the remaining tumor-associated antigens.
Таким образом, получена лентивирусная ДНК-конструкция, несущая в своем составе последовательность опухоль-ассоциированного антигена ERBB2/HER2 и последовательность сигнального участка гена CD74, обеспечивающего транспорт данного антигена в эндосому (фиг. 3). Изображение иллюстрирует схему лентивирусной плазмидной ДНК конструкции pLA-CMV-Ii-key-long-ERBB2, содержащей последовательность сигнального участка Ii key long. Данная конструкция является одним из предпочтительных, но не ограничивающих изобретение вариантов.Thus, a lentiviral DNA construct was obtained that contained the sequence of the tumor-associated antigen ERBB2 / HER2 and the sequence of the signal region of the CD74 gene, which ensures the transport of this antigen to the endosome (Fig. 3). The image illustrates the lentiviral plasmid DNA construct of pLA-CMV-Ii-key-long-ERBB2 containing the sequence of the Ii key long signal region. This design is one of the preferred, but not limiting the invention options.
Изобретение иллюстрировано следующим графическим материалом:The invention is illustrated by the following graphic material:
Фиг. 1 - Схема плазмидной лентивирусной ДНК-конструкции pLA-CMV-ELuc-puroFIG. 1 - Scheme of the plasmid lentiviral DNA construct pLA-CMV-ELuc-puro
Фиг. 2 - Схема последовательности белка CD74 с отмеченными участками сигнальных пептидов эндосомальной локализацииFIG. 2 - The sequence diagram of the protein CD74 with marked sections of the signal peptides of endosomal localization
Фиг. 3 - Схема лентивирусной плазмидной ДНК конструкции pLA-CMV-Ii-key-long-ERBB2, содержащей последовательность сигнального участка Ii key long.FIG. 3 - Scheme of lentiviral plasmid DNA construct pLA-CMV-Ii-key-long-ERBB2 containing the sequence of the signal region Ii key long.
Табл. - Последовательности праймеров для амплификации различных сигнальных участков N-концевого домена инвариантной цепи.Tab. - Primer sequences for amplification of various signal regions of the N-terminal domain of an invariant chain.
SEQ ID№1 CD74 N-концевой участокSEQ ID NO: 1 CD74 N-terminal portion
Нуклеотидная последовательностьNucleotide sequence
ATGGATGACCAGCGCGACCTTATCTCCAACAATGAGCAACTGCCCATGCTGGGCCGGCGCCCTGGGGCCCCGGAGAGCAAGTGCAGCCGCGGAGCCCTGTACACAGGCTTTTCCATCCTGGTGACTCTGCTCCTCGCTGGCCAGGCCACCACCGCCTACTTCCTGTACCAGCAGCAGGGCCGGCTGGACAAACTGACAGTCACCTCCCAGAACCTGCAGCTGGAGAACCTGCGCATGAAGCTTCCCAAGCCTCCCAAGCCTGTGAGCAAGATGCGCATGGCCACCCCGCTGCTGATGCAGGCGCTGCCCATGGGAGCCCTGCCCCAGGGGCCCATGCAGAATGCCACCAAGTATGGCAACATGACAGAGGACCATGTGATGCACCTGCTCCAGAATGCTGACCCCCTGAAGGTGTACCCGCCACTGAAGGGGAGCTTCCCGGAGAACCTGAGACACCTTAAGAACACCATGGAGACCATAGACTGGAAGGTCTTTGAGAGCTGGATGCACCATTGGCTCCTGTTTGAAATGAGCAGGCACTCCTTGGAGCAAAAGCCCACTGACGCTCCACCGATGGATGACCAGCGCGACCTTATCTCCAACAATGAGCAACTGCCCATGCTGGGCCGGCGCCCTGGGGCCCCGGAGAGCAAGTGCAGCCGCGGAGCCCTGTACACAGGCTTTTCCATCCTGGTGACTCTGCTCCTCGCTGGCCAGGCCACCACCGCCTACTTCCTGTACCAGCAGCAGGGCCGGCTGGACAAACTGACAGTCACCTCCCAGAACCTGCAGCTGGAGAACCTGCGCATGAAGCTTCCCAAGCCTCCCAAGCCTGTGAGCAAGATGCGCATGGCCACCCCGCTGCTGATGCAGGCGCTGCCCATGGGAGCCCTGCCCCAGGGGCCCATGCAGAATGCCACCAAGTATGGCAACATGACAGAGGACCATGTGATGCACCTGCTCCAGAATGCTGACCCCCTGAAGGTGTACCCGCCACTGAAGGGGAGCTTCCCGGAGAACCTGAGACACCTTAAGAACACCATGGAGACCATAGACTGGAAGGTCTTTGAGAGCTGGATGCACCATTGGCTCCTGTTTGAAATGAGCAGGCACTCCTTGGAGCAAAAGCCCACTGACGCTCCACCG
Аминокислотная последовательностьAmino Acid Sequence
MDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPHLKLKFLPLKLKFLFNLFHLFLFNLFLFNFLFNLFLFNFLFLFNLFLFNFLFLFNFLFLFNFLFLFNFLFNFLFNFLFNFLFNFLFNFLFINF
SEQ ID №2 Ii-ER сигнальная последовательностьSEQ ID No. 2 Ii-ER signal sequence
Нуклеотидная последовательностьNucleotide sequence
ATGGATGACCAGCGCGACCTTATCTCCAACAATGAGCAACTGCCCATGCTGGGCCGGCGCCCTGGGGCCCCGGAGAGCAAGTGCAGCCGCATGGATGACCAGCGCGACCTTATCTCCAACAATGAGCAACTGCCCATGCTGGGCCGGCGCCCTGGGGCCCCGGAGAGCAAGTGCAGCCGC
Аминокислотная последовательностьAmino Acid Sequence
MDDQRDLISNNEQLPMLGRRPGAPESKCSRMDDQRDLISNNEQLPMLGRRPGAPESKCSR
SEQ ID №3 Ii key сигнальная последовательностьSEQ ID No. 3 Ii key signal sequence
Нуклеотидная последовательностьNucleotide sequence
CTGCGCATGAAGCTGCGCATGAAG
Аминокислотная последовательностьAmino Acid Sequence
LRMKLrmk
SEQ ID №4SEQ ID No. 4
Ii key long (удлиненная сигнальная последовательность)Ii key long (extended signal sequence)
Нуклеотидная последовательностьNucleotide sequence
CTGCGCATGAAGCTTCCCAAGCCTCCCAAGCTGCGCATGAAGCTTCCCAAGCCTCCCAAG
Аминокислотная последовательностьAmino Acid Sequence
LRMKLPKPPKLRMKLPKPPK
SEQ ID №5 CLIP сигнальная последовательностьSEQ ID No. 5 CLIP signal sequence
Нуклеотидная последовательностьNucleotide sequence
CCTGTGAGCAAGATGCGCATGGCCACCCCGCTGCTGATGCAGGCGCCTGTGAGCAAGATGCGCATGGCCACCCCGCTGCTGATGCAGGCG
Аминокислотная последовательностьAmino Acid Sequence
PVSKMRMATPLLMQAPVSKMRMATPLLMQA
Claims (5)
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
RU2018147200A RU2725493C2 (en) | 2018-12-28 | 2018-12-28 | System for stable expression of tumor-associated antigens based on lentiviral vector |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
RU2018147200A RU2725493C2 (en) | 2018-12-28 | 2018-12-28 | System for stable expression of tumor-associated antigens based on lentiviral vector |
Publications (3)
Publication Number | Publication Date |
---|---|
RU2018147200A RU2018147200A (en) | 2020-06-30 |
RU2018147200A3 RU2018147200A3 (en) | 2020-06-30 |
RU2725493C2 true RU2725493C2 (en) | 2020-07-02 |
Family
ID=71509391
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
RU2018147200A RU2725493C2 (en) | 2018-12-28 | 2018-12-28 | System for stable expression of tumor-associated antigens based on lentiviral vector |
Country Status (1)
Country | Link |
---|---|
RU (1) | RU2725493C2 (en) |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1997049430A1 (en) * | 1996-06-26 | 1997-12-31 | Antigen Express, Inc. | Immunotherapy by modulation of antigen presentation |
WO2010057501A1 (en) * | 2008-11-21 | 2010-05-27 | Københavns Universitet (University Of Copenhagen) | Priming of an immune response |
US20100278904A1 (en) * | 2005-11-30 | 2010-11-04 | Copenhagen University | Nucleotide vaccine |
RU2012119658A (en) * | 2012-05-12 | 2013-11-20 | Федеральное государственное бюджетное учреждение "Научно-исследовательский институт клинической иммунологии" Сибирского отделения Российской академии медицинских наук (ФГБУ "НИИКИ" СОРАМН) | RECOMBINANT PLASMAID DNA pCI-UB-POLYEPI, CONTAINING EPITOPS OF TUMOR-ASSOCIATED ANTIGENS FOR COLORECTAL CANCER, AND METHOD OF ITS APPLICATION FOR STIMULATION OF SPECIFIC ANTIVECIOLOMATIS |
-
2018
- 2018-12-28 RU RU2018147200A patent/RU2725493C2/en active
Patent Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1997049430A1 (en) * | 1996-06-26 | 1997-12-31 | Antigen Express, Inc. | Immunotherapy by modulation of antigen presentation |
US20100278904A1 (en) * | 2005-11-30 | 2010-11-04 | Copenhagen University | Nucleotide vaccine |
WO2010057501A1 (en) * | 2008-11-21 | 2010-05-27 | Københavns Universitet (University Of Copenhagen) | Priming of an immune response |
RU2012119658A (en) * | 2012-05-12 | 2013-11-20 | Федеральное государственное бюджетное учреждение "Научно-исследовательский институт клинической иммунологии" Сибирского отделения Российской академии медицинских наук (ФГБУ "НИИКИ" СОРАМН) | RECOMBINANT PLASMAID DNA pCI-UB-POLYEPI, CONTAINING EPITOPS OF TUMOR-ASSOCIATED ANTIGENS FOR COLORECTAL CANCER, AND METHOD OF ITS APPLICATION FOR STIMULATION OF SPECIFIC ANTIVECIOLOMATIS |
Non-Patent Citations (7)
Also Published As
Publication number | Publication date |
---|---|
RU2018147200A (en) | 2020-06-30 |
RU2018147200A3 (en) | 2020-06-30 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Li et al. | Molecular mechanisms for enhanced DNA vaccine immunogenicity | |
US20200165302A1 (en) | Modified vsv-g and vaccines thereof | |
JP4580410B2 (en) | Expression vector capable of inducing improved immune response and method of using this vector | |
Ciernik et al. | Induction of cytotoxic T lymphocytes and antitumor immunity with DNA vaccines expressing single T cell epitopes. | |
He et al. | Immunization with lentiviral vector-transduced dendritic cells induces strong and long-lasting T cell responses and therapeutic immunity | |
Hu et al. | Immunization delivered by lentiviral vectors for cancer and infectious diseases | |
Hung et al. | A DNA vaccine encoding a single-chain trimer of HLA-A2 linked to human mesothelin peptide generates anti-tumor effects against human mesothelin-expressing tumors | |
CN111358953A (en) | Vaccine vector for efficiently inducing humoral immune response of organism, preparation method and application thereof | |
US9402888B2 (en) | Methods and compositions for treating cancer | |
CA3015530A1 (en) | Virus vectors expressing multiple epitopes of tumor associated antigens for inducing antitumor immunity | |
US20110305749A1 (en) | HIV-1 Envelope Polypeptides for HIV Vaccine | |
CN104039833A (en) | Vaccines against HPV | |
Bolhassani et al. | DNA immunization as an efficient strategy for vaccination | |
Ramirez et al. | Therapeutic and prophylactic DNA vaccines for HIV-1 | |
Kim et al. | Induction of therapeutic antitumor immunity by in vivo administration of a lentiviral vaccine | |
Lin et al. | DNA vaccines encoding IL-2 linked to HPV-16 E7 antigen generate enhanced E7-specific CTL responses and antitumor activity | |
Mohit et al. | Immunomodulatory effects of IP-10 chemokine along with PEI600-Tat delivery system in DNA vaccination against HPV infections | |
Lode et al. | Tyrosine hydroxylase‐based DNA‐vaccination is effective against murine neuroblastoma | |
Kramer et al. | Functionalisation of virus-like particles enhances antitumour immune responses | |
Huang et al. | Intradermal administration of DNA vaccines combining a strategy to bypass antigen processing with a strategy to prolong dendritic cell survival enhances DNA vaccine potency | |
RU2725493C2 (en) | System for stable expression of tumor-associated antigens based on lentiviral vector | |
JP5938143B2 (en) | Lentiviral vector containing MHC class I promoter | |
Tenbusch et al. | Coexpression of GM-CSF and antigen in DNA prime-adenoviral vector boost immunization enhances polyfunctional CD8+ T cell responses, whereas expression of GM-CSF antigen fusion protein induces autoimmunity | |
US20090170800A1 (en) | Genetic constructs and compositions comprising rre and cte and uses thereof | |
Kumar et al. | Immunogenicity testing of a novel engineered HIV-1 envelope gp140 DNA vaccine construct |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
QB4A | Licence on use of patent |
Free format text: LICENCE FORMERLY AGREED ON 20210628 Effective date: 20210628 |