OA18879A

OA18879A - Stabilized soluble pre-fusion RSV F proteins

Info

Publication number: OA18879A
Application number: OA1201800363
Authority: OA
Inventors: Johannes Petrus Maria Langedijk; Anders Krarup
Original assignee: Janssen Vaccines & Prevention B.V.
Priority date: 2016-04-05
Filing date: 2017-04-04
Publication date: 2019-09-13

Abstract

The present invention provides stable pre-fusion respiratory syncitial virus (RSV) F proteins (or fragment thereof), compositions comprising said proteins and uses thereof for the prevention and/or treatment of RSV infection.

Description

Janssen Vaccines & Prévention B.V.

Stabilized soluble pre-fusion RSV F proteins

The présent invention relates to the field of medicine. The invention in particular relates to recombinant pre-fusion RSV F proteins and uses thereof, e.g. as a vaccine.

Background of the invention

Respiratory syncytial virus (RSV) is a highly contagious childhood pathogen of the respiratory tract which is believed to be responsible for -200,000 childhood deaths annually. In children younger than 2 years, RSV accounts for approximately 50% of the hospitalizations due to respiratory infections, with a peak of hospitalization occurring at 2-4 months of âge. It has been reported that almost ail children will hâve experienced infection with RSV by the âge of two, and rcpeated infection during life is attributed to low natural immunity. In the elderly, the RSV disease burden is similar to those caused by non-pandemic influenza A infections.

To infect a host cell, RSV, like other enveloped viruses such as influenza virus and HIV, require fusion of the viral membrane with a host cell membrane. For RSV the conscrved fusion protein (RSV F protein) fuses the viral and host cell cellular membranes. In currcnt models, based on paramyxovirus studies, the RSV F protein initially folds into a prefusion confonnation. The metastable structure has recently been solved in complex with a stabilizing neutralizîng antibody Fab fragment (McLellan et al., Science 340(6136):! 113-7, 2013). During cell entry, the pre-fusion confonnation undergoes refolding and conformational changes to its post-fusion confonnation (McLellan, J. Virol 85(15):778896, 2010; Swanson, PNAS 108(23):9619-24, 2011). Thus, the RSV F protein is a metastable protein that drives membrane fusion by coupling irréversible protein refolding to membrane juxtaposition by initially folding into a metastable fonn (pre-fusion conformation) that subsequently undergoes discrete/stepwise conformational changes to a lower energy conformation (post-fusion conformation). These observations suggest that pre-fusion and post-fusion RSV F protein are antigenically distinct (Calder, L. J. et al. Virology 271, 122131 (2000)). It is clear from électron microscopy of RSV-F that large structural différences between the pre-fusion and post-fusion F trimer exist, which has recently been confirmed by crystallography (McLellan J.S. et al. Science 340(6136):1113-7 (2013) and McLellan J.S. et al. Science 342(6158): 592-8 (2013)) and it was shown that most of the neutralizîng antibodies in the sérum of RSV-positive individuals are binding to pre-fusion F (Ngwuta et. al., Science Translaiional Medicine, 7(309): 3O9rai62, 1-9)

A vaccine against RSV infection is not currently available, but is desired. Vaccine candidates based on the RSV F protein hâve failed due to problems with e.g. stability, purity, reproducibility, and potency. As indicated above, crystal structures hâve revealed a large conformational change between the pre-fusion and post-fusion States. The magnitude of the rearrangement suggested that only a portion of antibodies directed to the post-fusion conformation of RSV-F will be able to cross react with the native conformation of the prefusion spike on the surface of the virus. Accordingly, efforts to produce a vaccine against RSV hâve focused on developing vaccines that contain pre-fusion forms of RSV F protein (see, e.g., WO20101149745, W02010/1149743, W02009/1079796, WO2012/158613). However, these efforts hâve not yet yielded stable pre-fusion RSV F proteins that could be used as candidates for testing in humans.

Therefore, a need remains for efficient vaccines and methods of vaccinating against RSV, in particular comprising RSV F proteins in the pre-fusion conformation. The présent invention aims at providing such vaccines and methods for vaccinating against RSV in a safe and efficacious m armer.

Summary of the invention

The présent invention provides stable, recombinant, pre-fusion respiratory syncytial virus (RSV) fusion (F) proteins, i.e. recombinant RSV F proteins in soluble form (i.e. not membrane bound) that are stabilized in the pre-fusion conformation, wherein the RSV F protein comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO; 2 and SEQ ID NO: 3, or fragments thereof.

In certain embodiments, the RSV F proteins, or fragments thereof, comprise at least one epitope that is spécifie to the pre-fusion conformation F protein , wherein the at least one epitope is recognized by a pre-fusion spécifie monoclonal antibody comprising a heavy chain CDR1 région of SEQ ID NO: 4, a heavy chain CDR2 région of SEQ ID NO: 5, a heavy chain CDR3 région of SEQ ID NO: 6 and a light chain CDR1 région of SEQ ID NO: 7, a lîght chain CDR2 région of SEQ ID NO: 8, and a light chain CDR3 région of SEQ ID NO: 9, and/or a pre-fusion spécifie monoclonal antibody, comprising a heavy chain CDR1 région of SEQ ID NO: 10, a heavy chain CDR2 région of SEQ ID NO: 11, a heavy chain CDR3 région of SEQ ID NO: 12 and a light chain CDR1 région of SEQ ID NO: 13, a light chain CDR2 région of SEQ ID NO: 14, and a light chain CDR3 région of SEQ ID NO: 15.

In certain embodiments, the RSV F proteins are trimeric.

The invention also provides nucleic acid molécules encoding the pre-fusion RSV F proteins or fragments thereof according to the invention and vectors comprising such nucleic acid molécules.

The invention also relates to compositions, preferably immunogenic compositions, comprising said RSV pre-fusion F protein (or fragments thereof), nucleic acid molécule encoding said RSV pre-fusion F protein, and to the use thereof in inducing an immune response against RSV F protein, in particular to the use thereof as a vaccine. The invention also relates to methods for inducing an anti-respiratory syncytial virus (RSV) immune response in a subject, comprising administering to the subject an effective amount of a prefusion RSV F protein, a nucleic acid molécule encoding said RSV F protein, and/or a vector comprising said nucleic acid molécule. Preferably, the induced immune response is characterized by neutralizing antibodies to RSV and/or protective immunity against RSV. In particular aspects, the invention relates to a method for inducing neutralizing anti-respiratory syncytial virus (RSV) F protein antibodies in a subject, comprising administering to the subject an effective amount of an immunogenic composition comprising a pre-fusion RSV F protein, a nucleic acid molécule encoding said RSV F protein, and/or a vector comprising said nucleic acid molécule.

Brief description of the Figures

FIG l- Schematic représentation of RSV F variants. SCDM - single-chain double mutant, SCTM - single-chain triple mutant, PRQM - processed quadruple mutant and PRPM processed penta-mutant. Secreted proteins are presented without signal peptide and p27 fragment. Fl and F2 domains are indicated, as well as fusion peptide (FP), fibritin trimerization domain (foldon) and the linker in single-chain proteins between F2 and Fl (GSGSG). Three stabilizing mutations (N67I, S215P and D386N) (black diamonds). Two mutations to improve antigenic match to circulating strains (K.66E and I76V) (grey diamonds). The residue position is numbered as in the füll length wild type protein including signal peptide.

FIG. 2. Protein expression levels and pre-fusion stability of processed RSV F PR-A2 variants with multiple amino acid substitutions. Protein expression levels in cell culture supematants were tested 72 hours post transfection by quantitative octet (Q-Octet) with CR9501 and CR9503 (bars to the left) and fraction of RSV F protein binding to pre-fusion spécifie CR9501 antibody on the day of harvest and after storage at 4 °C for indicated period of time (bars to the right). Bars represent average of 2-4 measurements, lines represent range of values.

E-^lG- ³- Melting températures (Tm) of the purified RSV-F proteins. Each measurement is represented by a dot.

^FIG· ⁴· K66E and I76V amino acid substitutions did not hâve effect on F protein expression levels and pre-fusion stability. Protein expression levels in cell culture supematants were tested 96 hours post transfection by Q-Octet with CR9501 and CR9503 (bars to the left) and fraction of RSV F protein binding to pre-fijsion spécifie CR9501 antibody on the day of harvest and after storage at 4 °C for indicated period of time (bars to the right). Bars represent average of 2 measurements, lines represent range of values.

E-IG· 5: Pre-fusion stability of the F protein variants in CHO cell culture supematant. Protein expression levels in cell culture supematants were tested 96 hours post transfection by QOctet with CR9501 and CR9503 and fraction of RSV F protein binding to pre-fusion spécifie CR9501 antibody on the day of harvest and after storage at 4 °C for indicated period of time. Bars represent average of 2 measurements, lines represent range of values. PRQM - PR-A2 with N67I, S215P, K66E, and I76V; PRPM - PR-A2 with N67I, S215P, K66E, I76V and D486N.

F^ÏG- 6: RSV F proteins of the invention stay intact in CHO cell culture supematant at pH5. pH of the cell culture supematants containing F protein variants was adjusted to pH5 and the samples were incubated at 7 days with or without protease inhibitors. The samples were analyzed on SDS-PAGE under reducing conditions. The first lane of each gel is molecular weight standard marker; the size of the standard proteins is indicated. The samples: l - day 0 sample; 2 - day 7 sample incubated at 4 °C;3 - day 7 sample incubated at 4 °C with protease inhibitors; 4 - day 0 sample; 5 - day 7 sample incubated at room température; 6 - day 7 sample incubated at room température with protease inhibitors; 7 - day 0 sample; 8 - day 7 sample incubated at 37 °C; 9 - day 7 sample incubated at 37 °C with protease inhibitors. In the processed protein samples, the lower band represents the Fl domain and the upper band represents partially processed protein (Fl +p27) or unprocessed protein F1+F2). In the singlechain protein sample, the band is F1+F2 domains. PRQM - PR-A2 with N67I, S215P, K.66E, and I76V; PRPM - PR-A2 with N67I, S215P, K.66E, I76V and D486N. LNR: K683-065.

^FIG- ⁷ Température stability of RSV F proteins in CHO cell culture supematant. The supematant samples were subjected to heat treatment for 30 min at températures 45-65 °C. The amount of pre-fusion protein in the sample was measured in ELISA with CR9501 antibodies. The values were normalized to untreated sample (20 °C). The curves are shown for each protein individually and an overlay of ail curves (on the lower right). Each point represents a replicate measurement. Two assays were performed with 2 technical replicates each. The curves were fitted using Nonlinear régression variable slope équation (GraphPad Prism); melting températures (Tm) were calculated as IC50 values. PRQM - PR-A2 with N67I, S215P, K66E, and I76V; PRPM-PR-A2 withN67I, S215P, K66E, I76V and D486N.

FIG. 8: RSV titers in lungs and nose 5 days after challenge with RSV A2. RSV titers in lungs (upper panel) and nose (lower panel) 5 days after challenge with RSV A2. The lower level of détection (LOD) is indicated by a dotted line. Mean titers (logl 0 pfti per gram of tissue) are indicated with horizontal bars. Adjuvanted and non-adjuvanted PRPM groups were compared across dose by a Cochran-Mantel-Haenszel test and statistical différences are indicated in the figure, i.m.: întramuscular; i.n: intranasal.

^FIG- ^{9: RSV} neutralizing titers against RSV A Long in cotton rats sera at day 49 after priming. RSV neutralizing titers (IC50 (log2)) against RSV A Long using an ELISA-based readout were determined in cotton rats sera at day 49 after priming. The mean of each group is indicated with a horizontal bar. The limit of détection (LOD) is set on 3.0 (log2 and indicated with a dashed line). VNA titers induced PRPM by adjuvanted and non-adjuvanted were compared across dose by ANOVA and the results are indicated in the figure, i.m.: întramuscular; i.n: intranasal.

Detailed description of the invention

The fusion protein (F) of the respiratory syncictial virus (RSV) is involved in fusion of the viral membrane with a host cell membrane, which is required for infection. The RSV F mRNA is translated into a 574 amino acid precursor protein designated F0, which contains a signal peptide sequence of26 amino acids at the N-terminus that is removed by a signal peptidase in the endoplasmic reticulum. F0 is cleaved at two sites (between amino acid residues 109/110 and 136/137) by cellular ftirin-like proteases in the trans-Golgi, removing a short glycosylated intervenîng sequence (also referred to a p27 région, comprising the amino acid residues 110 to 136, and generating two domains or subunits designated Fl and F2. The Fl domain (amino acid residues 137-574) contains a hydrophobie fusion peptide at its Nterminus and the C-terminus contains the transmembrane (TM) (amino acid residues 530550) and cytoplasmic région (amino acid residues 551-574). The F2 domain (amino acid residues 27-109) is covalently linked to Fl by two disulfide bridges. The F1-F2 heterodimers are assembled as homotrimers in the virion.

A vaccine against RSV infection is not currently available, but is desired. One potential approach to producing a vaccine is a subunit vaccine based on purified RSV F protein. However, for this approach it is désirable that the purified RSV F protein is in a conformation which resembles the conformation of the pre-fusion state of RSV F protein, and which is stable over time, and can be produced in sufficient quantities. In addition, for a subunit-based vaccine, the RSV F protein needs to be truncated by délétion of the transmembrane (TM) and the cytoplasmic région to create a soluble secreted F protein (sF). Because the TM région is responsible for membrane anchoring and trimerization, the anchorless soluble F protein is considerably more labile than the full-length protein and will readily refold into the post-fusion end-state. In order to obtain soluble F protein in the stable pre-fusion conformation that shows high expression levels and high stability, the pre-fusion conformation thus needs to be stabilized.

Several mutations stabilizing RSV F protein in the pre-fusion conformation hâve previously been described in WO2014/174018 and W02014/202570. The RSV F proteins according to the présent invention comprise a unique and spécifie subset of mutations described earlier in combination with two further mutations. According to the invention it has been shown that this unique combination of mutations of the présent invention results in increased RSV F protein expression levels and stability of the pre-fusion conformation.

The présent invention thus provides novel stable soluble pre-fusion RSV F proteins,

i.e. soluble RSV F proteins that are stabilized in the pre-fusion conformation, or fragments thereof. The RSV F proteins according to the présent invention comprise an amino acid sequence selected from the group consîsting of SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 3.

In the research that led to the présent invention, a unique combination of mutations was introduced together with a heterologous trimerization domain in order to obtain said stable soluble pre-fusion RSV F proteins. The stable pre-fusion RSV F proteins of the invention are in the pre-fusion conformation, i.e. they comprise (display) at least one epitope that is spécifie to the pre-fusion conformation F protein. An epitope that is spécifie to the pre fusion conformation F protein is an epitope that is not presented in the post-fusion conformation. Without wishing to be bound by any particular theory, it is believed that the pre-fusion conformation of RSV F protein may contain epitopes that are the same as those on the RSV F protein expressed on naturel RSV virions, and therefore may provide advantages for eliciting protective neutralizing antibodies.

In certain embodiments, the RSV pre-fusion F proteins (or fragments thereof) of the invention comprise at least one epitope that is recognized by a pre-fusion spécifie monoclonal antibody, comprising a heavy chain CDRl région of SEQ ID NO: 4, a heavy chain CDR2 région of SEQ ID NO: 5, a heavy chain CDR3 région of SEQ ID NO: 6 and a light chain CDRl région of SEQ ID NO: 7, a light chain CDR2 région of SEQ ID NO: 8, and a light chain CDR3 région of SEQ ID NO: 9 (hereafter referred to as CR950I) and/or a pre-fusion spécifie monoclonal antibody, comprising a heavy chain CDRl région of SEQ ID NO: 10, a heavy chain CDR2 région of SEQ ID NO: 11, a heavy chain CDR3 région of SEQ ID NO: 12 and a light chain CDRl région of SEQ ID NO; 13, a light chain CDR2 région of SEQ ID NO: 14, and a light chain CDR3 région of SEQ ID NO: 15 (referred to as CR9502). CR9501 and CR9502 comprise the heavy and light chain variable régions, and thus the binding specificîties, of the antibodies 58C5 and 3OD8, respectively, which hâve previously been shown to bind specifically to RSV F protein in its pre-fusion conformation and not to the post-fusion conformation (as disclosed in WO2012/006596).

In certain embodiments, the recombinant pre-fusion RSV F proteins are trimeric.

As used throughout the present application nucléotide sequences are provided from 5’ to 3’ direction, and amino acid sequences from N-terminus to C-terminus, as custom in the art.

As indicated above, fragments of the pre-fusion RSV F protein are also encompassed by the present invention. The fragment may resuit from either or both of amino-terminal (e.g. by cleavîng off the signal sequence) and carboxy-terminal délétions. The fragment may be chosen to comprise an immunologically active fragment of the F protein, i.e. a part that will give rise to an immune response in a subject. This can be easily determined using in silico, in vitro and/or in vivo methods, ail routine to the skilled person.

In certain embodiments, the encoded proteins according to the invention comprise a signal sequence, also referred to as leader sequence or signal peptide, corresponding to amino acids 1-26 of SEQ ID NO: I, SEQ ID NO: 2 or SEQ ID NO: 3. Signal sequences typically are short (e.g. 5-30 amino acids long) amino acid sequences present at the N-terminus of the majority of newly synthesized proteins that are destined towards the secretory pathway, and are typically cleaved by signal peptidase to generate a free signal peptide and a mature protein.

In certain embodiments, the proteins according to the invention do not comprise a signal sequence.

The present invention further provides nucleic acid molécules encoding the RSV prefusion F proteins, or fragments thereof, according to the invention.

In preferred embodiments, the nucleic acid molécules encoding the RSV F proteins according to the invention are codon-optimized for expression in mammalian cells, preferably human cells. Methods of codon-optimization are known and hâve been described previously (e.g. WO 96/09378). A sequence is considered codon-optimized if at least one non-preferred codon as compared to a wild type sequence is replaced by a codon that is more preferred. Herein, a non-preferred codon is a codon that is used less frequently in an organism than another codon coding for the same amino acid, and a codon that is more preferred is a codon that is used more frequently in an organism than a non-preferred codon. The frequency of codon usage for a spécifie organism can be found in codon frequency tables, such as in http://www.kazusa.or.jp/codon. Preferably more than one non-preferred codon, preferably most or ail non-preferred codons, are replaced by codons that are more preferred. Preferably the most frequently used codons in an organism are used in a codon-optimized sequence. Replacement by preferred codons generally leads to higher expression.

It will be understood by a skilled person that numerous different polynucleotides and nucleic acid molécules can encode the same protein as a resuit of the degeneracy of the genetic code. It is also understood that skilled persons may, using routine techniques, make nucléotide substitutions that do not affect the protein sequence encoded by the nucleic acid molécules to reflect the codon usage of any particular host organism in which the proteins are to be expressed. Therefore, unless otherwise specified, a nucléotide sequence encoding an amino acid sequence includes ail nucléotide sequences that are degenerate versions of each other and that encode the same amino acid sequence. Nucléotide sequences that encode proteins and RNA may or may not include introns.

Nucleic acid sequences can be cloned using routine molecular biology techniques, or generated de novo by DNA synthesis, which can be performed using routine procedures by service companies having business in the field of DNA synthesis and/or molecular cloning (e.g. GeneArt, GenScripts, Invitrogen, Eurofins).

In certain embodiments, the nucleic acid molécules comprise a nucléotide sequence of SEQ ID NO. 21,22 or 23.

The invention also provides vectors comprising a nucleic acid molécule as described above. In certain embodiments, a nucleic acid molécule according to the invention thus is part of a vector. Such vectors can easily be manipulated by methods well known to the person skilled in the art, and can for instance be designed for being capable of réplication in prokaryotic and/or eukaryotic cells. In addition, many vectors can be used for transformation of eukaryotic cells and will integrate in whole or in part into the genome of such cells, resulting in stable host cells comprising the desired nucleic acid in their genome. The vector used can be any vector that is suitable for cloning DNA and that can be used for transcription of a nucleic acid of interest. The person skilled in the art is capable of choosing suitable expression vectors, and inserting the nucleic acid sequences of the invention in a functional m aimer.

Host cells comprising the nucleic acid molécules encoding the pre-fusion RSV F proteins form also part of the invention. The pre-fusion RSV F proteins may be produced through recombinant DNA technology involving expression of the molécules in host cells, e.g. Chinese hamster ovary (CHO) cells, tumor cell lines, BHK cells, human cell lines such as HEK293 cells, PER.C6 cells, or yeast, fungi, insect cells, and the like, or transgenic animais or plants. In certain embodiments, the cells are from a multicellular organism, in certain embodiments they are of vertebrate or invertebrate origin. In certain embodiments, the cells are mammalian cells. In certain embodiments, the cells are human cells. In general, the production of a recombinant proteins, such the pre-fusion RSV F proteins of the invention, in a host cell comprises the introduction of a heterologous nucleic acid molécule encoding the protein in expressible format into the host cell, culturing the cells under conditions conducive to expression of the nucleic acid molécule and allowing expression of the protein in said cell. The nucleic acid molécule encoding a protein in expressible format may be in the form of an expression cassette, and usually requires sequences capable of bringing about expression of the nucleic acid, such as enhancer(s), promoter, polyadenylation signal, and the like. The person skilled in the art is aware that varions promoters can be used to obtain expression of a gene in host cells. Promoters can be constitutive or regulated, and can be obtained from varions sources, including viruses, prokaryotic, or eukaryotic sources, or artificially designed.

Cell culture media are available from varions vendors, and a suitable medium can be routinely chosen for a host cell to express the protein of interest, here the pre-fusion RSV F proteins. The suitable medium may or may not contaîn sérum.

A “heterologous nucleic acid molécule” (also referred to herein as ‘transgene’) is a nucleic acid molécule that is not naturally présent in the host cell. It is introduced into for instance a vector by standard molecular biology techniques. A transgene is generally operably linked to expression control sequences. This can for instance be done by placing the nucleic acid encoding the transgene(s) under the control of a promoter. Further regulatory sequences may be added. Many promoters can be used for expression of a transgene(s), and are known to the skilled person, e.g. these may comprise viral, mammalian, synthetic promoters, and the like. A non-limiting example of a suitable promoter for obtaining expression in eukaryotic cells is a CMV-promoter (US 5,385,839), e.g. the CMV immédiate early promoter, for instance comprising nt. —735 to +95 from the CMV immédiate early gene enhancer/promoter. A polyadenylation signal, for example the bovine growth hormone polyA signal (US 5,122,458), may be présent behind the transgene(s). Altematively, several widely used expression vectors are available in the art and from commercial sources, e.g. the pcDNA and pEF vector sériés of Invitrogen, pMSCV and pTK-Hyg from BD Sciences, pCMV-Script from Stratagene, etc, which can be used to recombinantly express the protein of interest, or to obtain suitable promoters and/or transcription terminator sequences, polyA sequences, and the like.

The cell culture can be any type of cell culture, including adhèrent cell culture, e.g. cells attached to the surface of a culture vessel or to microcarriers, as well as suspension culture. Most large-scale suspension cultures are operated as batch or fed-batch processes because they are the most straightforward to operate and scale up. Nowadays, continuous processes based on perfusion principles are becoming more common and are also suitable. Suitable culture media are also well known to the skilled person and can generally be obtained from commercial sources in large quantifies, or custom-made according to standard protocols. Culturing can be done for instance in dishes, roller bottles or in bioreactors, using batch, fed-batch, continuous Systems and the like. Suitable conditions for culturing cells are known (see e.g. Tîssue Culture, Academie Press, Kruse and Paterson, editors (1973), and R.I. Freshney, Culture of animal cells: A manual of basic technique, fourth édition (Wiley-Liss Inc., 2000, ISBN 0-471-34889-9)).

The invention further provides compositions comprising a pre-fusion RSV F protein and/or a nucleic acid molécule, and/or a vector, as described above. The invention thus provides compositions comprising a pre-fusion RSV F protein that displays an epitope that is présent in a pre-fusion conformation of the RSV F protein but is absent in the post-fusion conformation, or a fragment thereof. The invention also provides compositions comprising a nucleic acid molécule and/or a vector, encoding such pre-fusion RSV F protein or fragment thereof. The compositions preferably are immunogenic compositions comprising a pre-fusion

RSV F protein, and/or a nucleic acid molécule, and/or a vector, as described above. The invention also provides the use of a stabilized pre-fusion RSV F protein or a nucleic acid molécule encoding said RSV F protein according to the invention, for inducing an immune response against RSV F protein in a subject. Further provided are methods for inducing an immune response against RSV F protein in a subject, comprising administering to the subject a pre-fusion RSV F protein, and/or a nucleic acid molécule, and/or a vector, according to the invention. Also provided are pre-fusion RSV F proteins, nucleic acid molécules, and/or vectors, according to the invention for use in inducing an immune response against RSV F protein in a subject. Further provided is the use of the pre-fusion RSV F proteins, and/or nucleic acid molécules, and/or vectors according to the invention for the manufacture of a médicament for use in inducing an immune response against RSV F protein in a subject.

The pre-fusion RSV F proteins, nucleic acid molécules, or vectors of the invention may be used for prévention (prophylaxis) and/or treatment of RSV infections. In certain embodiments, the prévention and/or treatment may be targeted at patient groups that are susceptible RSV infection. Such patient groups include, but are not limited to e.g., the elderly (e.g. > 50 years old, > 60 years old, and preferably > 65 years old), the young (e.g. < 5 years old, < l year old), hospitalized patients and patients who hâve been treated with an antiviral compound but hâve shown an inadéquate antiviral response.

The pre-fusion RSV F proteins, nucleic acid molécules and/or vectors according to the invention may be used e.g. in stand-alone treatment and/or prophylaxis of a disease or condition caused by RSV, or in combination with other prophylactic and/or therapeutic treatments, such as (existing or future) vaccines, antiviral agents and/or monoclonal antibodies.

The invention further provides methods for preventing and/or treating RSV infection in a subject utilizing the pre-fusion RSV F proteins, nucleic acid molécules and/or vectors according to the invention. In a spécifie embodiment, a method for preventing and/or treating RSV infection in a subject comprises administering to a subject in need thereof an effective amount of a pre-fusion RSV F protein, nucleic acid molécule and/or a vector, as described above. A therapeutically effective amount refers to an amount of a protein, nucleic acid molécule or vector, which is effective for preventing, ameliorating and/or treating a disease or condition resulting from infection by RSV. Prévention encompasses inhibiting or reducing the spread of RSV or inhibiting or reducing the onset, development or progression of one or more of the symptoms associated with infection by RSV. Amelioration as used in herein may refer to the réduction of visible or perceptible disease symptoms, viremia, or any other measurable manifestation of influenza infection.

For administering to subjects, such as humans, the invention may employ pharmaceutical compositions comprising a pre-fusion RSV F protein, a nucleic acid molécule and/or a vector as described herein, and a pharmaceutically acceptable carrier or excipient. In the présent context, the term pharmaceutically acceptable means that the carrier or excipient, at the dosages and concentrations employed, will not cause any unwanted or harmful effects in the subjects to which they are administered. Such pharmaceutically acceptable carriers and excipients are well known in the art (see Remington's Pharmaceutical Sciences, I8th édition, A. R. Gennaro, Ed., Mack Publishing Company [ 1990]; Pharmaceutical Formulation Development of Peptides and Proteins, S. Frokjaer and L. Hovgaard, Eds., Taylor & Francis [2000]; and Handbook of Pharmaceutical Excipients, 3rd édition, A. Kibbe, Ed., Pharmaceutical Press [2000]). The RSV F proteins, or nucleic acid molécules, preferably are formulated and administered as a stérile solution although it may also be possible to utilize lyophilized préparations. Stérile solutions are prepared by stérile filtration or by other methods known per se in the art. The solutions are then lyophilized or filled into pharmaceutical dosage containers. The pH of the solution generally is in the range of pH 3.0 to 9.5, e.g. pH 5.0 to 7.5. The RSV F proteins typically are in a solution having a suitable pharmaceutically acceptable buffer, and the composition may also contain a sait. Optionally stabilizing agent may be présent, such as albumin. In certain embodiments, detergent is added. In certain embodiments, the RSV F proteins may be formulated into an injectable préparation.

in certain embodiments, a composition according to the invention further comprises one or more adjuvants. Adjuvants are known in the art to further increase the immune response to an applied antigenic déterminant. The tenus “adjuvant” and immune stimulant are used interchangeably herein, and are defined as one or more substances that cause stimulation of the immune System. In this context, an adjuvant is used to enhance an immune response to the RSV F proteins of the invention. Examples of suitable adjuvants include aluminium salts such as aluminium hydroxide and/or aluminium phosphate; oil-emulsion compositions (or oil-in-water compositions), including squalene-water émulsions, such as MF59 (see e.g. WO 90/I4837); saponin formulations, such as for example QS2l and Immunostimulating Complexes (ISCOMS) (see e.g. US 5,057,540; WO 90/03184, WO 96/l I7l l, WO 2004/004762, WO 2005/002620); bacterial or microbial dérivatives, examples of which are monophosphoryl lipid A (MPL), 3-O-deacylated MPL (3dMPL), CpG-motif containing oligonucleotides, ADP-ribosylating bacterial toxins or mutants thereof, such as E.

coli heat labile enterotoxin LT, choiera toxîn CT, and the like; eukaryotic proteins (e.g. antibodies or fragments thereof (e.g. directed against the antigen itself or CD la, CD3, CD7, CD80) and ligands to receptors (e.g. CD40L, GMCSF, GCSF, etc), which stimulate immune response upon interaction with récipient cells. In certain embodiments the compositions of the invention comprise aluminium as an adjuvant, e.g. in the form of aluminium hydroxide, aluminium phosphate, aluminium potassium phosphate, or combinations thereof, in concentrations of 0.05 - 5 mg, e.g. from 0.075-1.0 mg, of aluminium content per dose.

The pre-fusion RSV F proteins may also be administered in combination with or conjugated to nanopart ici es, such as e.g. polymers, liposomes, virosomes, virus-like particles or self-assembling protein particles. The pre-fusion F proteins may be combined with, encapsidated in or conjugated to the nanoparticles with or without adjuvant. Encapsulation within liposomes is described, e.g. in US 4,235,877. Conjugation to macromolecules is disclosed, for example in US 4,372,945 or US 4,474,757.

In other embodiments, the compositions do not comprise adjuvants.

In certain embodiments, the invention provides methods for making a vaccine against respiratory syncytial virus (RSV), comprising providing a composition according to the invention and formulating it into a pharmaceutically acceptable composition. The term vaccine refers to an agent or composition containing an active component effective to induce a certain degree of immunity in a subject against a certain pathogen or disease, which will resuit in at least a decrease (up to complété absence) of the severity, duration or other manifestation of symptoms associated with infection by the pathogen or the disease. In the present invention, the vaccine comprises an effective amount of a pre-fusion RSV F protein and/or a nucleic acid molécule encoding a pre-fusion RSV F protein, and/or a vector comprising said nucleic acid molécule, which results in an immune response against the F protein of RSV. This provides a method of preventing serious lower respiratory tract disease leading to hospitalization and the decrease in frequency of complications such as pneumonia and bronchiolitis due to RSV infection and réplication in a subject. The term “vaccine” according to the invention implies that it is a pharmaceutical composition, and thus typically includes a pharmaceutically acceptable diluent, carrier or excipient. It may or may not comprise further active ingrédients. In certain embodiments it may be a combination vaccine that further comprises other components that induce an immune response, e.g. against other proteins of RSV and/or against other infectious agents. The administration of further active components may for instance be donc by separate administration or by admînistering combination products of the vaccines of the invention and the further active components.

Compositions may be administered to a subject, e.g. a human subject. The total dose of the RSV F proteins in a composition for a single administration can for instance be about 0.01 pg to about 10 mg, e.g. 1 pg - l mg, e.g. 10 pg- 100 pg. Determining the recommended dose will be carried out by expérimentation and is routine for those skilled in the art.

Administration of the compositions according to the invention can be performed using standard routes of administration. Non-limiting embodiments include parentéral administration, such as intradermal, intramuscular, subcutaneous, transcutaneous, or mucosal administration, e.g. intranasal, oral, and the like. In one embodiment a composition is administered by intramuscular injection. The skilled person knows the various possibilities to administer a composition, e.g. a vaccine in order to induce an immune response to the antigen(s) in the vaccine.

A subject as used herein preferably is a mammal, for instance a rodent, e.g. a mouse, a cotton rat, or a non-human-primate, or a human. Preferably, the subject is a human subject.

The proteins, nucleic acid molécules, vectors, and/or compositions may also be administered, either as prime, or as boost, in a homologous or heterologous prime-boost regimen. If a boosting vaccination is performed, typically, such a boosting vaccination will be administered to the same subject at a time between one week and one year, preferably between two weeks and four months, after administering the composition to the subject for the first time (which is in such cases referred to as ‘priming vaccination’). In certain embodiments, the administration comprises a prime and at least one booster administration.

In addition, the proteins of the invention may be used as diagnostic tool, for example to test the immune status of an individual by establishing whether there are antibodies in the sérum of such individual capable of binding to the protein of the invention. The invention thus also relates to an in vitro diagnostic method for detecting the presence of an RSV infection in a patient said method comprising the steps of a) contacting a biologicai sample obtained from said patient with a protein according to the invention; and b) detecting the presence of antibodyprotein complexes.

Examples

EXAMPLE 1: Génération of the stable pre-fusion RSV Fprotein

Several pre-fusion RSV F protein variants were produced, which are schematically represented in Fig. 1. Ail candidates comprise a fibritin trimerization domain (foldon) (GYIPEAPRDGQAYVRKDGEWVLLSTFL; SEQ ID NO: 20), linked to the amino acid residue 495 of the RSV A2 Fl domain.

In the processed versions of RSV F (i.e. the versions which are cleaved removing the p27 région) the N67I substitution had the strongest effect on both the expression level and stability but fully stable pre-fusion F protein was obtained only when the 67 and 215 substitutions were combined, resulting in a 20-fold expression level increase (Fig. 2). Addition of a third amino acid substitution did not improve expression level or stability as measured by storage stability at 4°C. However, when the RSV F proteins were purified and further characterized, it tumed out that the extra third substitution significantly stabilizes the pre-fusion F protein as measured by the more stringent température stability test (by Differential Scanning Fluorimetry assay - DSF) (Fig. 3).

Because the A2 strain that was used as a parental sequence for the RSV F protein variants described previously (W02014/174018 and WO2014/202570) is a cell line adapted laboratory strain which had accumulated two unique and rare mutations in the apex K66 and I76), it was decided to mutate these two residues to match the naturel clinical isolâtes (K.66E, I76V). The K.66E and I76V mutations were included in the new processed protein design to make the sequence doser to the naturel virus isolâtes. The K66E+I76V substitutions were tested in selected stabilized variants to demonstrate that the amino acid substitutions did not hâve négative effect on protein expression or stability. It was shown that the proteins were stable in cell culture supematants for longer than 2 weeks. There was no négative effect on the expression level of the F proteins, on the contrary, RSV F protein with N67I, S215P, K66E and 176V mutations expressed to a higher level than protein with only N67I and S215P (Fig. 4).

The processed RSV F proteins with N67I, S215P, K66E and I76V (named PRQM for processed quadruple-mutant) and with N67I, S215P, K66E, I76V and D486N (named PRPM for processed penta-mutant) were purified and further characterized.

The screening of the stabilizing mutations for the RSV F protein was performed in suspension HEK cells (FreeStyle 293F). These cells are convenient to use in a research laboratory because they are adapted to simple transfection protocol and express proteins at a high level. For big scale and GMP protein production CHO cells are often the cell line of choice. Therefore expression and stability of several preferred F protein designs was tested in suspension CHO cells (FreeStyle CHO-S). CHO-S cells are difficult to transfert and therefore overall expression levels were expected to be lower than in HEK cells. During analysis therefore we focused on relative expression of the proteins and their stability.

Five processed proteins were selected for the test. The 5 variants ail contained the substitutions K66E, I76V, N67I and S215P. As described above, the latter 2 are required to stabihze the protein in pre-fusion conformation; the former two were included to make the sequence doser to naturally occurring isolâtes (as was described in the previous section). The proteins differed by the additional mutations E161P, D486N and E487Q. These were chosen because of high expression level, storage stability and low impact on antigenicity. Ail proteins were expressed in CHO cells and had comparable storage stability. The RSV F proteins were stable in pre-fusion conformation when stored in cell culture supematants for 2 weeks at 4°C (Fig. 5). Also, the stability of the RSV F proteins in CHO cell culture supematant at pH5 was tested. As shown in Fig. 6 no dégradation after incubation of protein samples for 7 days at different températures was detected.

In conclusion, the RSV F proteins of the invention expressed in CHO cells and were stable in cell culture supematants. Additionally, the température stability of the protein was tested. The cell culture supematants were subjected to heat treatment and amount of prefusion protein in the samples was measured in ELIS A with CR9501 antibody (Fig. 7).

The variant with D486N (PRPM protein) was most stable against température stress. Addition of K.498R mutation seemed to hâve no advantage compared to protein with minimal amount of modification (PRQM). The variants with E16IP mutation had highest expression levels (data not shown), However the drawback of this amino acid substitution was that the residue 161 is located on the surface of the protein and on the fringe of epitope for CR9501 antibody.

According to the présent invention, it thus was shown that the PRPM (RSV F protein with fibritin foldon trimerization domain and with mutations N67I, S215P, K.66E, [76V and D486N, SEQ ID NO: l) and the PRQM (RSV F protein with fibritin foldon trimerization domain and with N67I, S215P, K66E, and I76V, SEQ ID NO: 2) as a processed pre-fùsion protein with minimum of required sequence modifications, as well as the PRQM +S46G or PRPM +S46G variant ail are stabilized in the pre-fusion conformation and show a high Tm (Table l). The latter variants with the S46G substitution hâve a significantly higher expression level.

Table l.

Protein ID	Freeze-thaw stability'	Tm (°C)
PRQM S46G	Stable for 3 cycles, aggregation after 5 cycles	56.2
PRPM S46G	Stable for 5 cyles	63.6
PRPM______________	Stable for 5 cycles	65.0

EXAMPLE 2: Immunogenicity and protection induced by PRPM with and without adjuvant

An experiment was conducted to détermine the immunogenic and prophylactic efficacy of the recombinant PRPM protein in the presence or absence of an adjuvant in a homologous RSV-A2 challenge cotton rat model. The animais were immunized i.m. on day 0 and 28 with 2 doses of PRPM (5 and 0.5 pg), non-adjuvanted or adjuvanted with 100 pg Adjuphos. The animais were challenged on day 49 with 10⁵ (pfu) of RSV A2. Animais were sacrificed 5 days after challenge and titers were measured in lungs and nose.

Results

Immunization with adjuvanted PRPM induced complété protection in the lungs and nose, with the exception of l animal that showed breakthrough in the nose. Most of the animais receiving 5 and 0.5 pg non-adjuvanted PRPM showed breakthrough in the lungs and noses and there was a significant différence between the groups receiving the adjuvanted and the non-adjuvanted protein (Figure 8). The adjuvanted protein induced significantly higher VNA titers compared to the non-adjuvanted protein at day 49 after immunization (Figure 9).

Table 1. Antibody sequences

Ab	VH domain	VH CDR1	VH CDR2	VH CDR3
CR9501	Amino acids 1-125 ofSEQID NO: 16	GASINSDNYYWT (SEQ ID NO:4)	HISYTGNTYYTPSLKS (SEQ JD NOS)	CGAYVLISNCGWFDS (SEQID NOS)
CR9502	Amino acids 1-121 ofSEQID NO:18	GFTFSGHTIA (SEQIDNO:10)	WVSTNNGNTEYAQKIQ G (SEQ ID NO:11)	EWLVMGGFAFDH (SEQ ID NO:12)

Ab	VL domain	VL CDR1	VLCDR2	VL CDR3
CR9501	Amino acids 1-107	QASQDISTYLN (SEQ	GASNLET	QQYQYLPYT
ofSEQID NO: 17	ID NO: 7)	(SEQID NOS)	(SEQ ID NOS)
CR9502	Amino acids 1-110 ofSEQID NO: 19	GANNIGSQNVH (SEQID NO:13)	DDRDRPS (SEQID NO:14)	QVWDSSRDQAVI (SEQID NO:15)

Sequences

SEQ ID NO: 1: PRPM

MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIE

LSNIKE1KCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARRELPRFMN YTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLS TNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSIPNIETVIEFQQKNNRLLE ITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSI IKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGS VSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSV ITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQE GKSLYVKGEPIINFYDPLVFPSNEFDASISQVNEKINQSLAFIRKSDELLSAIGGYIPEAP

RDGQAYVRKDGEWVLLSTFL

SEQ ID NO: 2 PRQM

MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIE LSNIKEIKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARRELPRFMN YTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLS TNKAWSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSIPNIETVIEFQQKNNRLLE ITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSI IKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGS VSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSV ITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQE GKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLSAIGGYIPEAP RDGQAYVRKDGEWVLLSTFL

SEQ ID NO: 3 PRPM + S46G

MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLGALRTGWYTSVITI ELSNIKEIKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARRELPRFMN YTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLS TNKAWSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSIPNIETVIEFQQKNNRLLE ITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSI IKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGS

VSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKJMTSKTDVSSSV

ITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQE

GKSLYVKGEPIINFYDPLVFPSNEFDASISQVNEKINQSLAFIRKSDELLSAIGGY1PEAP RDGQAYVRKDGEWVLLSTFL

CR9501 heavy chain (SEQ ID NO: 16):

QVQLVQSGPGLVKPSQTLALTCNVSGASINSDNYYWTWIRQRPGGGLEWIGHISYTG NTYYTPSLKSRLSMSLETSQSQFSLRLTSVTAADSAVYFCAACGAYVLISNCGWFDS WGQGTQVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGAL TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK.KVEPKSC

CR9501 light chain (SEQ ID NO: 17):

EIVMTQSPSSLSASIGDRVTITCQASQDISTYLNWYQQKPGQAPRLLIYGASNLETGVP SRFTGSGYGTDFSVTISSLQPEDIATYYCQQYQYLPYTFAPGTKVEIKRTVAAPSVFIF PPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYS LSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

CR9502 heavy chain (SEQ ID NO: 18):

EVQLLQSGAELKKPGASVKISCKTSGFTFSGHTIAWVRQAPGQGLEWMGWVSTNNG NTEYAQKIQGRVTMTMDTSTSTVYMELRSLTSDDTAVYFCAREWLVMGGFAFDHW GQGTLLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC

CR9502 light chain (SEQ ID NO: 19):

QSVLTQASSVSVAPGQTARITCGANNIGSQNVHWYQQKPGQAPVLVVYDDRDRPSG

IPDRFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSRDQAVIFGGGTKLTVLGQPK AAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQS NNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTIAPTECS

Nucléotide sequence encoding PRPM (SEQ ID NO: 20):

ATGGAACTGCTGATCCTGAAGGCCAACGCCATCACCACCATCCTGACCGCCGTGACCTTCTGCTTCGCCAGCG GCCAGAACATCACCGAGGAATTCTACCAGAGCACCTGTAGCGCCGTGTCCAAGGGCTACCTGAGCGCCCTGA GAACCGGCTGGTACACCAGCGTGATCACCATCGAGCTGAGCAACATCAAGGAAATCAAGTGCAACGGCACCG ACGCCAAGGTCAAGCTGATCAAGCAGGAACTGGACAAGTACAAGAACGCCGTGACCGAGCTGCAGCTGCTG ATGCAG AG CACCCCCG CCACCAACAACCG GGCCAG ACGCG AG CTG CCCCG GTTCATG AACTACACCCTG AAC AACGCCAAAAAGACCAACGTGACCCTGAGCAAGAAGCGGAAGCGGCGGTTCCTGGGCTTCCTGCTGGGCGT GGGCTCTGCCATTGCTAGCGGCGTGGCCGTGTCTAAGGTGCTGCACCTGGAAGGCGAAGTGAACAAGATCAA GAGCGCCCTGCTGAGCACCAACAAGGCCGTGGTGTCCCTGAGCAACGGCGTGTCCGTGCTGACCAGCAAGGT GCTGGATCTGAAGAACTACATCGACAAGCAGCTGCTGCCCATCGTGAACAAGCAGAGCTGCAGCATCCCCAA CATCGAGACAGTGATCGAGTTCCAGCAGAAGAACAACCGGCTGCTGGAAATCACCCGCGAGTTCAGCGTGAA CGCTGGCGTGACCACCCCCGTGTCCACCTACATGCTGACCAACAGCGAGCTGCTGAGCCTGATCAACGACATG CCCATCACCAACGACCAGAAAAAGCTGATGAGCAACAACGTGCAGATCGTGCGGCAGCAGAGCTACTCCATC ATGAGCATCATCAAAGAAGAGGTGCTGGCCTACGTGGTGCAGCTGCCCCTGTACGGCGTGATCGACACCCCC TGCTGGAAGCTGCACACCAGCCCCCTGTGCACCACCAACACCAAAGAGGGCAGCAACATCTGCCTGACCCGG ACCGACCGGGGCTGGTACTGCGATAATGCCGGCTCCGTGTCATTCTTTCCACAGGCCGAGACATGCAAGGTGC AGAGCAACCGGGTGTTCTGCGACACCATGAACAGCCTGACCCTGCCCTCCGAAGTGAACCTGTGCAACGTGG ACATCTTCAACCCTAAGTACGACTGCAAGATCATGACCAGCAAGACCGACGTGTCCAGCTCCGTGATCACCTC CCTGGGCGCCATCGTGTCCTGCTACGGCAAGACCAAGTGCACCGCCAGCAACAAGAACCGGGGCATCATCAA GACCTTCAGCAACGGCTGCGACTACGTGTCCAACAAGGGGGTGGACACCGTGTCCGTGGGCAACACCCTGTA CTACGTGAACAAACAGGAAGGCAAGAGCCTGTACGTGAAGGGCGAGCCCATCATCAACTTCTACGACCCCCT GGTGTTCCCCAGCAACGAGTTCGACGCCAGCATCAGCCAGGTCAACGAGAAGATCAACCAGAGCCTGGCCTT CATCAGAAAGAGCGACGAGCTGCTGTCCGCCATCGGCGGCTACATCCCCGAGGCCCCTAGAGATGGCCAGGC CTACGTGCGGAAGGACGGCGAGTGGGTGCTGCTGTCTACCTTCCTG

Nucléotide sequence encoding PRQM (SEQ ID NO: 21):

ATGGAACTGCTGATCCTGAAGGCCAACGCCATCACCACCATCCTGACCGCCGTGACCTTCTGCTTCGCCAGCG GCCAGAACATCACCGAGGAATTCTACCAGAGCACCTGTAGCGCCGTGTCCAAGGGCTACCTGAGCGCCCTGA GAACCGGCTGGTACACCAGCGTGATCACCATCGAGCTGAGCAACATCAAGGAAATCAAGTGCAACGGCACCG ACGCCAAGGTCAAGCTGATCAAGCAGGAACTGGACAAGTACAAGAACGCCGTGACCGAGCTGCAGCTGCTG ATGCAGAGCACCCCCGCCACCAACAACCGGGCCAGACGCGAGCTGCCCCGGTTCATGAACTACACCCTGAAC AACGCCAAAAAGACCAACGTGACCCTGAGCAAGAAGCGGAAGCGGCGGTTCCTGGGCTTCCTGCTGGGCGT GGGCTCTGCCATTGCTAGCGGCGTGGCCGTGTCTAAGGTGCTGCACCTGGAAGGCGAAGTGAACAAGATCAA

GAGCGCCCTGCTGAGCACCAACAAGGCCGTGGTGTCCCTGAGCAACGGCGTGTCCGTGCTGACCAGCAAGGT

GCTGGATCTGAAGAACTACATCGACAAGCAGCTGCTGCCCATCGTGAACAAGCAGAGCTGCAGCATCCCCAA CATCGAGACAGTGATCGAGTTCCAGCAGAAGAACAACCGGCTGCTGGAAATCACCCGCGAGTTCAGCGTGAA CGCTGGCGTGACCACCCCCGTGTCCACCTACATGCTGACCAACAGCGAGCTGCTGAGCCTGATCAACGACATG CCCATCACCAACGACCAGAAAAAGCTGATGAGCAACAACGTGCAGATCGTGCGGCAGCAGAGCTACTCCATC ATGAGCATCATCAAAGAAGAGGTGCTGGCCTACGTGGTGCAGCTGCCCCTGTACGGCGTGATCGACACCCCC TGCTGG AAGCTG CACACCAG CCCCCT GTGCACCACCAACACCAAAG AGG GCAG CAACATCTG CCTG ACCCGG ACCGACCGGGGCTGGTACTGCGATAATGCCGGCTCCGTGTCATTCTTTCCACAGGCCGAGACATGCAAGGTGC AGAGCAACCGGGTGTTCTGCGACACCATGAACAGCCTGACCCTGCCCTCCGAAGTGAACCTGTGCAACGTGG ACATCTTCAACCCTAAGTACGACTGCAAGATCATGACCAGCAAGACCGACGTGTCCAGCTCCGTGATCACCTC CCTGGGCGCCATCGTGTCCTGCTACGGCAAGACCAAGTGCACCGCCAGCAACAAGAACCGGGGCATCATCAA GACCTTCAGCAACGGCTGCGACTACGTGTCCAACAAGGGGGTGGACACCGTGTCCGTGGGCAACACCCTGTA CTACGTGAACAAACAGGAAGGCAAGAGCCTGTACGTGAAGGGCGAGCCCATCATCAACTTCTACGACCCCCT GGTGTTCCCCAGCGACGAGTTCGACGCCAGCATCAGCCAGGTCAACGAGAAGATCAACCAGAGCCTGGCCTT CATCAGAAAGAGCGACGAGCTGCTGTCCGCCATCGGCGGCTACATCCCCGAGGCCCCTAGAGATGGCCAGGC CTACGTGCGGAAGGACGGCGAGTGGGTGCTGCTGTCTACCTTCCTG

Nucléotide sequence encoding PRPM + S46G (SEQ ID NO: 22):

AT G G AACT G CTG ATCCTG AAG G CCAACG CCAT CACCACCATCCTG ACCGCCGTG ACCTTCTG CTTTGCCAG CG GCCAGAACATCACCGAGGAATTCTACCAGAGCACCTGTAGCGCCGTGTCCAAGGGCTATCTGGGCGCCCTGA GAACCGGCTGGTACACCAGCGTGATCACCATCGAGCTGAGCAACATCAAAGAAATCAAGTGCAACGGCACCG ACGCCAAAGTGAAGCTGATCAAGCAGGAACTGGACAAGTACAAGAATGCCGTGACCGAACTGCAGCTGCTGA TGCAGAGCACCCCCGCCACCAACAACCGGGCCAGAAGAGAACTGCCCAGATTCATGAACTACACCCTGAACA ACGCCAAAAAGACCAACGTGACCCTGAGCAAGAAGCGGAAGCGGCGGTTCCTGGGCTTTCTGCTGGGAGTG GGAAGCGCCATTGCTAGCGGAGTGGCCGTGTCTAAGGTGCTGCACCTGGAAGGCGAAGTGAACAAGATCAA GAGCGCCCTGCTGAGCACCAACAAGGCCGTGGTGTCTCTGAGCAACGGCGTGTCCGTGCTGACCAGCAAGGT GCTGGATCTGAAGAACTACATCGACAAACAGCTGCTGCCCATCGTGAACAAGCAGAGCTGCAGCATCCCCAAC ATCGAGACAGTGATCGAGTTCCAGCAGAAGAACAACCGGCTGCTGGAAATCACCCGCGAGTTCAGCGTGAAC GCTGGCGTGACCACCCCCGTGTCCACCTACATGCTGACCAACAGCGAGCTGCTGTCCCTGATCAACGACATGC CCATCACCAACGACCAGAAAAAGCTGATGAGCAACAACGTGCAGATCGTGCGGCAGCAGAGCTACTCCATCA TGAGCATTATCAAAGAAGAGGTGCTGGCCTACGTGGTGCAGCTGCCTCTGTACGGCGTGATCGACACCCCCTG CTGGAAGCTGCACACCAGCCCTCTGTGCACCACCAACACCAAAGAGGGCAGCAACATCTGCCTGACCCGGACC GACAGAGGCTGGTACTGCGATAATGCCGGCTCCGTCTCATTCTTTCCACAAGCCGAGACATGCAAGGTGCAGA

GCAACCGGGTGTTCTGCGACACCATGAACAGCCTGACCCTGCCCTCCGAAGTGAATCTGTGCAACGTGGACAT CTT C AACCCTAAGT ACG ACT G CAAG AT CATG ACCT CCAAG ACCG ACGTGTCCAG CTCCGTG ATCACAAGCCTG GGCGCCATCGTGTCCTGCTACGGCAAGACCAAGTGCACCGCCAGCAACAAGAACCGGGGCATCATCAAGACC TTCAGCAACGGCTGCGACTACGTGTCCAACAAGGGGGTGGACACCGTGTCTGTGGGCAACACCCTGTACTAC

GTGAACAAACAGGAAGGCAAGAGCCTGTACGTGAAGGGCGAGCCCATCATCAACTTCTACGACCCCCTGGTG TTCCCCAGCAACGAGTTCGACGCCAGCATCAGCCAAGTGAACGAGAAGATCAACCAGAGCCTGGCCTTCATCA GAAAGTCCGATGAGCTGCTGAGCGCCATCGGCGGCTACATCCCTGAGGCCCCTAGAGATGGCCAGGCCTATG TG CGG AAGG ACG GCG AATG G GTG CTG CTG TCTACCTTTCTG

Claims

Claims

1. A recombinant pre-fusion respiratory syncytial virus (RSV) Fusion (F) protein, comprising an amino acid sequence selected from the group consisting of SEQ [D NO: l, SEQ ID NO: 2 and SEQ ID NO: 3, or a fragment thereof.
2. Pre-fusion RSV F protein, or fragment thereof, according to claim l, comprising at least one epitope that is spécifie to the pre-fusion conformation F protein, wherein the at least one epitope is recognized by a pre-fusion spécifie monoclonal antibody, comprising a heavy chain CDRl région of SEQ ID NO: 4, a heavy chain CDR2 région of SEQ ID NO: 5, a heavy chain CDR3 région of SEQ ID NO: 6 and a light chain CDRl région of SEQ ID NO: 7, a light chain CDR2 région of SEQ ID NO: 8, and a light chain CDR3 région of SEQ ID NO: 9 and/or a pre-fusion spécifie monoclonal antibody, comprising a heavy chain CDRl région of SEQ ID NO; 10, a heavy chain CDR2 région of SEQ ID NO: 11, a heavy chain CDR3 région of SEQ ID NO: 12 and a light chain CDRl région of SEQ ID NO: 13, a light chain CDR2 région of SEQ ID NO: 14, and a light chain CDR3 région of SEQ ID NO: 15.
3. Pre-fusion RSV F protein, or fragment thereof, according to claim l or 2, wherein the protein is trimeric.
4. Nucleic acid molécule encoding a pre-fusion RSV F protein, or fragment thereof, according to any claim l, 2 or 3.
5. Nucleic acid molécule according to claim 4, wherein the nucleic acid molécule has been codon-optimized for expression in mammalian cells.
6. Nucleic acid moiecule according to claim 4 or 5, comprising a nucléotide sequence selected from the group consisting of SEQ ID NO: 21, SEQ ID NO: 22 and SEQ ID NO: 23.
7. Vector comprising a nucleic acid moiecule according to claim 4, 5 or 6.
8. Composition comprising a pre-fusion RSV F protein, or fragment thereof, according to claim l, 2 or 3, a nucleic acid molécule according to claim 4, 5 or 6, and/or a vector according to daim 7.
9. Composition according to claim 8 for use in inducing an immune response against RSV F protein.
10. Composition according to claim 8 or 9 for use in the prophyiaxis and/or treatment of RSV infection.
11. Vaccine against RSV comprising a pre-fusion RSV protein, or fragment thereof, according to claim l, 2 or 3, a nucleic acid molécule according to claim 4, 5 or 6 and/or a vector according to claim 7.