NZ791667A - Adenovirus armed with bispecific T-cell activator - Google Patents
Adenovirus armed with bispecific T-cell activatorInfo
- Publication number
- NZ791667A NZ791667A NZ791667A NZ79166717A NZ791667A NZ 791667 A NZ791667 A NZ 791667A NZ 791667 A NZ791667 A NZ 791667A NZ 79166717 A NZ79166717 A NZ 79166717A NZ 791667 A NZ791667 A NZ 791667A
- Authority
- NZ
- New Zealand
- Prior art keywords
- cell
- cells
- bispecific
- seq
- sequence
- Prior art date
Links
- 241000701161 unidentified adenovirus Species 0.000 title claims abstract 24
- 239000012190 activator Substances 0.000 title claims abstract 7
- 210000001744 T-Lymphocytes Anatomy 0.000 title abstract 3
- 239000000427 antigen Substances 0.000 claims abstract 7
- 108091007172 antigens Proteins 0.000 claims abstract 7
- 102000038129 antigens Human genes 0.000 claims abstract 7
- 229950002830 Enadenotucirev Drugs 0.000 claims abstract 5
- 239000000203 mixture Substances 0.000 claims abstract 5
- 201000011510 cancer Diseases 0.000 claims abstract 4
- 230000000174 oncolytic Effects 0.000 claims 14
- 210000004027 cells Anatomy 0.000 claims 6
- -1 A33 Proteins 0.000 claims 5
- 241000726306 Irus Species 0.000 claims 4
- 102100006037 MUC1 Human genes 0.000 claims 4
- 101700052761 MUC1 Proteins 0.000 claims 4
- 125000003275 alpha amino acid group Chemical group 0.000 claims 4
- 102000018651 Epithelial Cell Adhesion Molecule Human genes 0.000 claims 3
- 108010066687 Epithelial Cell Adhesion Molecule Proteins 0.000 claims 3
- 102100005866 ALCAM Human genes 0.000 claims 2
- 101710033748 ALCAM Proteins 0.000 claims 2
- 102100008428 CCL2 Human genes 0.000 claims 2
- 101700006000 CCL2 Proteins 0.000 claims 2
- 102100000197 CD24 Human genes 0.000 claims 2
- 108060001249 CD24 Proteins 0.000 claims 2
- 101700078950 CD44 Proteins 0.000 claims 2
- 102100003735 CD44 Human genes 0.000 claims 2
- 102100004728 CDH1 Human genes 0.000 claims 2
- 101700016900 CDH1 Proteins 0.000 claims 2
- 101710043956 CEACAM5 Proteins 0.000 claims 2
- 101710043948 CEACAM7 Proteins 0.000 claims 2
- 102100016662 ERBB2 Human genes 0.000 claims 2
- 101700025368 ERBB2 Proteins 0.000 claims 2
- 102000027776 ERBB3 Human genes 0.000 claims 2
- 101700041204 ERBB3 Proteins 0.000 claims 2
- 102100009851 ERBB4 Human genes 0.000 claims 2
- 101700023619 ERBB4 Proteins 0.000 claims 2
- 101700036477 FOLH1 Proteins 0.000 claims 2
- 102100008453 FOLH1 Human genes 0.000 claims 2
- 102100014204 IL22 Human genes 0.000 claims 2
- 108060005162 MYDGF Proteins 0.000 claims 2
- 229920001850 Nucleic acid sequence Polymers 0.000 claims 2
- 101700034223 PEM Proteins 0.000 claims 2
- 102100002896 PSG2 Human genes 0.000 claims 2
- 101700004495 PSG2 Proteins 0.000 claims 2
- 101700008337 PSMA Proteins 0.000 claims 2
- 101700044827 RNMT Proteins 0.000 claims 2
- 101710009474 STEAP1 Proteins 0.000 claims 2
- 102100006460 STEAP1 Human genes 0.000 claims 2
- 150000001413 amino acids Chemical class 0.000 claims 2
- 150000001720 carbohydrates Chemical class 0.000 claims 2
- 229920001483 poly(ethyl methacrylate) polymer Polymers 0.000 claims 2
- 229920001481 poly(stearyl methacrylate) Polymers 0.000 claims 2
- 101710040918 shg Proteins 0.000 claims 2
- 102100019492 CCL19 Human genes 0.000 claims 1
- 101700049349 CCL19 Proteins 0.000 claims 1
- 102100012032 CCL20 Human genes 0.000 claims 1
- 101700018681 CCL20 Proteins 0.000 claims 1
- 102100012031 CCL21 Human genes 0.000 claims 1
- 101700070431 CCL21 Proteins 0.000 claims 1
- 102100016449 CCL5 Human genes 0.000 claims 1
- 101700063377 CCL5 Proteins 0.000 claims 1
- 102100006400 CSF2 Human genes 0.000 claims 1
- 102100009641 CXCL10 Human genes 0.000 claims 1
- 101710032181 CXCL10 Proteins 0.000 claims 1
- 102100014691 CXCL12 Human genes 0.000 claims 1
- 101710043128 CXCL12 Proteins 0.000 claims 1
- 102100009639 CXCL13 Human genes 0.000 claims 1
- 101710032192 CXCL13 Proteins 0.000 claims 1
- 102100009686 CXCL9 Human genes 0.000 claims 1
- 101700052645 CXCL9 Proteins 0.000 claims 1
- 102100010782 EGFR Human genes 0.000 claims 1
- 101700039191 EGFR Proteins 0.000 claims 1
- 102100004572 FLT3LG Human genes 0.000 claims 1
- 101710022257 FLT3LG Proteins 0.000 claims 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 claims 1
- 101700086956 IFNG Proteins 0.000 claims 1
- 102100016020 IFNG Human genes 0.000 claims 1
- 101700054270 IL26 Proteins 0.000 claims 1
- 102100005003 IL5 Human genes 0.000 claims 1
- 102100014193 IL7 Human genes 0.000 claims 1
- 102000003996 Interferon beta Human genes 0.000 claims 1
- 108090000467 Interferon beta Proteins 0.000 claims 1
- 102000006992 Interferon-alpha Human genes 0.000 claims 1
- 108010047761 Interferon-alpha Proteins 0.000 claims 1
- 102000011294 Interleukin 1 Receptor Antagonist Protein Human genes 0.000 claims 1
- 108010023402 Interleukin 1 Receptor Antagonist Protein Proteins 0.000 claims 1
- 108090000193 Interleukin-1 beta Proteins 0.000 claims 1
- 102000003777 Interleukin-1 beta Human genes 0.000 claims 1
- 102000003814 Interleukin-10 Human genes 0.000 claims 1
- 108090000174 Interleukin-10 Proteins 0.000 claims 1
- 108010065805 Interleukin-12 Proteins 0.000 claims 1
- 108090000176 Interleukin-13 Proteins 0.000 claims 1
- 102000003812 Interleukin-15 Human genes 0.000 claims 1
- 108090000172 Interleukin-15 Proteins 0.000 claims 1
- 102000013691 Interleukin-17 Human genes 0.000 claims 1
- 108050003558 Interleukin-17 family Proteins 0.000 claims 1
- 108090000171 Interleukin-18 Proteins 0.000 claims 1
- 108010082786 Interleukin-1alpha Proteins 0.000 claims 1
- 102000004125 Interleukin-1alpha Human genes 0.000 claims 1
- 108010002350 Interleukin-2 Proteins 0.000 claims 1
- 102000000588 Interleukin-2 Human genes 0.000 claims 1
- 108010065637 Interleukin-23 Proteins 0.000 claims 1
- 108010066979 Interleukin-27 Proteins 0.000 claims 1
- 108010067003 Interleukin-33 Proteins 0.000 claims 1
- 108700000010 Interleukin-35 Proteins 0.000 claims 1
- 108090000978 Interleukin-4 Proteins 0.000 claims 1
- 102000004388 Interleukin-4 Human genes 0.000 claims 1
- 108010002616 Interleukin-5 Proteins 0.000 claims 1
- 108090001005 Interleukin-6 Proteins 0.000 claims 1
- 108010002586 Interleukin-7 Proteins 0.000 claims 1
- 102000004890 Interleukin-8 Human genes 0.000 claims 1
- 108090001007 Interleukin-8 Proteins 0.000 claims 1
- 108010002335 Interleukin-9 Proteins 0.000 claims 1
- 229940053278 LTA Drugs 0.000 claims 1
- 102000004083 Lymphotoxin-alpha Human genes 0.000 claims 1
- 108090000542 Lymphotoxin-alpha Proteins 0.000 claims 1
- 102100005908 MYDGF Human genes 0.000 claims 1
- 101710037934 QRSL1 Proteins 0.000 claims 1
- 108091008153 T cell receptors Proteins 0.000 claims 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 claims 1
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 claims 1
- 108010001801 Tumor Necrosis Factor-alpha Proteins 0.000 claims 1
- 239000000969 carrier Substances 0.000 claims 1
- 239000003085 diluting agent Substances 0.000 claims 1
- 239000002955 immunomodulating agent Substances 0.000 claims 1
- 230000002584 immunomodulator Effects 0.000 claims 1
- 229940121354 immunomodulators Drugs 0.000 claims 1
- 108010074108 interleukin-21 Proteins 0.000 claims 1
- 108010074109 interleukin-22 Proteins 0.000 claims 1
- 108090000237 interleukin-24 Proteins 0.000 claims 1
- 101700043375 sing Proteins 0.000 claims 1
- 241000700605 Viruses Species 0.000 abstract 8
- 238000000034 method Methods 0.000 abstract 2
- 239000008194 pharmaceutical composition Substances 0.000 abstract 1
Abstract
modified adenovirus, in particular Enadenotucirev (EnAd), armed with a bispecific T-cell activator comprising at least two binding domains, wherein at least one of the domains is specific for a surface antigen on a T-cell of interest. Also provided are a composition, such as a pharmaceutical formulation comprising the virus, use of the virus and virus formulations for treatment, such as in the treatment of cancer. The disclosure also extends to processes for preparing the virus. lation comprising the virus, use of the virus and virus formulations for treatment, such as in the treatment of cancer. The disclosure also extends to processes for preparing the virus.
Description
Adenovirus armed with bispecific T-cell activator
The present disclosure relates to a modified irus, in particular Enadenotucirev
(EnAd), armed with a bispecific T cell activator sing at least two binding domains, wherein at
least one of the domains is specific for a surface antigen on a T-cell of interest. The disclosure further
relates to a composition, such as a pharmaceutical formulation comprising the virus, use of the virus
and virus formulations, ularly in treatment, especially in the treatment of cancer. The
disclosure also extends to processes for preparing the virus and DNA encoding the same.
The present application is a divisional of New Zealand patent application 751071, which is
the national phase entry of PCT international application (published as
BACKGROUND
Cancer is still a huge social burden to society in terms of the hardship and suffering of
ts and their loved ones, and also in terms of the high financial cost of treating, caring for and
supporting patients.
A large variety of therapies have been developed for the treatment of cancer including
chemotherapeutic agents, radiotherapy and more recently ics such as antibodies. Antibodybased
therapy for cancer has become established over the past 15 years and is now one of the most
successful and important strategies for treating patients with haematological malignancies and solid
tumours. Examples of monoclonal antibody based ancer ies currently in clinical use
include rituximab, which targets CD20, bevacizumab which targets VEGF, cetuximab which targets
EGFR and labetuzumab which s CEA.
Amongst the various antibody formats developed, bispecific T-cell activators show much
e. These are vely simple bi-specific molecules that are specific for the CD3ε subunit of
the TCR complex of a T-cell and also a target an antigen of interest, such as a cancer antigen. Since
ific T-cell activators are specific for the TCR complex, this enables bispecific T-cell activators
to activate resident T-cells to kill cells sing a particular target antigen on their cell surface, for
example cancer cells. An important property of bispecific T-cell activators is their ability to make
CD4 + and non-activated CD8+ T-cells target cancer cells. In other words, T-cells activated by
bispecific T-cell activators can be made to kill cells ndent of MHC expression on the cell
surface. This is important because some tumour cells downregulate MHC which makes them
resistant to agents such as CAR-T cells and immTACs.
Unfortunately, bispecific T-cell tors have poor circulation kinetics relative to full length
antibodies. This means that when stered to the patient, a large tion of the bispecific
T-cell activators do not reach their target cells. In addition, the use of high affinity anti-CD3 ScFv as
part of the bispecific T-cell activator can lead to strong binding to T-cells in the blood, which also
interferes with ry to the tumour. As a result, the bispecific T-cell tors are unable to reach
their full potential as an anti-cancer therapy because they cannot be effectively delivered to the
40 tumour cells.
The requirement for effective delivery of therapeutic agents such as bispecific T-cell
[FOLLOWED BY PAGE 1a]
activators to tumour cells has become increasingly important since it is becoming more apparent
that solid tumours protect themselves in vivo in a number of ways, for example by developing stroma
around the tumour. Progression to a carcinoma is associated with proliferation of epithelial cells
(mitotic cells) along with the development of an activated tumour . In this case, extracellular-
matrix (ECM) components such as collagen bundles are degraded, because of increased turnover.
The number of inflammatory cells increases and fibroblasts
differentiate into myofibroblasts, ing in their sion of growth factors,
[FOLLOWED BY PAGE 2]
matrix components and degrading proteases. Angiogenesis is maintained, resulting in a high number of
leaky tumour vessels. Following activation of a tumour stroma with persistent angiogenesis, invasion by
tumour cells begins through the degraded basement membrane, and blood vessels infiltrate the tumour
tissue.
This stroma is a physical protection in that it may have a function of trapping immune cells sent
to fight the tumour. In addition the stroma shields the c microenviroment of the tumour, which is
permissive and sed for the tumour’s growth. There are some theories that cells in the stroma are
a source of energy in the .
A large component of tumour stroma are fibroblasts, which have been corrupted to serve the
purpose of the cancer. Other cells that rate the stroma are tumour associated macrophages ,
which are type 2 (M2) macrophages that can promote tumour growth by secreting cytokines and
chemokines, such as IL-10 that suppress immune responses.
It is especially difficult to target the tumour stroma e the cells that make the environment
are “native” immune or connective tissue cells, which are found throughout the body. Thus targeting
these cells with therapeutic agents can lead to serious off-target effects.
Hence, there is a need for an ed method of delivering a ific T-cell activator directly
to tumour cells where it can provide maximal therapeutic benefit, in particular delivery to tumour cells
surrounded by stromal fibroblasts.
Y OF INVENTION
The present inventors believe that one of the most ive ways to deliver the therapeutic
agents directly to the tumour is with an oncolytic adenovirus engineered to express agents that, for
e activate T cells and target an antigen, such as in the stroma.
Accordingly, the present disclosure provides an adenovirus comprising a sequence of formula (I):
’ITR-B1-BA-B2-BX-BB-BY-B3-3’ITR (I)
wherein:
B1 is bond or comprises: E1A, E1B or B;
BA comprises-E2B-L1-L2-L3-E2A-L4;
B2 is a bond or comprises: E3;
BX is a bond or a DNA sequence comprising: a restriction site, one or more transgenes or both;
BB comprises L5;
BY is a bond or a DNA sequence comprising: a restriction site, one or more transgenes or both;
B3 is a bond or comprises: E4;
wherein the adenovirus encodes a Bispecific T cell activator comprising at least two binding domains
n at least one of the said domains is specific to a surface antigen on an immune cell of interst, such
as a T cell of interest; and
wherein the adenovirus is EnAd or Ad11.
The bispecific T-cell activator or bispecific T-cell activators ing to the present disclosure do not
comprise a transmembrane domain and so are not expressed on the cancer cell surface but rather
comprises a signal sequence to facilitate release of the bispecific T-cell activator molecule from the cancer
cell.
The following paragraphs are a summary of the present disclosure:
1. An adenovirus comprising a sequence of formula (I) :
’ITR-B1-BA-B2-BX-BB-BY-B3-3’ITR (I)
wherein:
B1 is bond or comprises: E1A, E1B or E1A-E1B;
BA comprises-E2B-L1-L2-L3-E2A-L4;
B2 is a bond or comprises: E3;
BX is a bond or a DNA sequence comprising: a restriction site, one or more transgenes or both;
BB comprises L5;
BY is a bond or a DNA sequence sing: a restriction site, one or more transgenes or both;
B3 is a bond or comprises: E4;
wherein the adenovirus encodes a Bispecific T cell activator comprising at least two binding
domains wherein at least one of the said domains is ic to a surface antigen on an immune
cell of interest, such as a T cell of interest; and
n the adenovirus is EnAd or Ad11.
2. An irus according to paragraph 1, wherein the irus is EnAd.
3. An adenovirus according to paragraph 1 or 2, wherein the surface antigen is a component of the
T-cell receptor complex (TCR), such as CD3, TCR-α and TCR-β.
4. An adenovirus according to paragraph 3, wherein the surface n is CD3 such as CD3ε, CD3γ
and CD3δ, in particular CD3ε.
. An irus according to any one of paragraphs 1 to 4, wherein one of the binding domains is
specific to a tumour antigen such as CEA, MUC-1, EpCAM, HER ors HER1, HER2, HER3,
HER4, PEM, A33, G250, carbohydrate antigens Ley, Lex, Leb, PSMA, TAG-72, , CD166, CD24,
CD44, E-cadherin, SPARC, ErbB2 and ErbB3.
6. An adenovirus according to paragraph 5, wherein one of the binding s is specific to EpCAM,
for example an EpCAM sing an amino acid sequence as set forth in SEQ ID NO: 28.
7. An adenovirus according to any one of paragraphs 1 to 4, wherein one of the binding domains is
specific to a tumour stromal antigen, for example fibroblast tion protein (FAP), TREM1,
IGFBP7, FSP-1, platelet-derived growth factor-α receptor (PDGFR-α), platelet-derived growth
factor-β receptor (PDGFR-β) and vimentin.
8. An adenovirus according to paragraph 7, wherein one of the binding domains is specific to FAP, for
example a FAP comprising an amino acid sequence as set forth in SEQ ID NO: 30.
9. A adenovirus according to paragraph 7 or 8, wherein the l antigen is an antigen is selected
from a myeloid derived ssor cell antigen, a tumor associated macrophage, and combinations
thereof.
. An adenovirus according to paragraph 9, wherein the antigen is selected from CD163, CD206,
CD68, CD11c, CD11b, CD14, CSF1 Receptor, CD15, CD33, CD66b and a combination of two or
more of the same.
11. An adenovirus ing to any one of paragraphs 1 to 3 and 5 to 10, wherein one of the
binding domains in the bispecific T-cell activator is specific to a non-TCR activating protein
such as CD31, CD2 and CD277.
12. An adenovirus according to any one of aphs 1 to 11, wherein at least one of BX or BY is
not a bond.
13. An adenovirus according to any one of paragraphs 1 to 12, wherein the adenovirus is ic.
14. An adenovirus according to any one of paragraphs 1 to 13, n the adenovirus is oncolytic.
. An adenovirus according to any one of paragraphs 1 to 14, wherein the adenovirus replication
capable.
16. An adenovirus according to aph 13, wherein the adenovirus is replication competent.
17. An adenovirus according to any one of paragraph s 1 to 14, n the irus is
replication deficient.
18. An adenovirus according to any one of paragraphs 1 to 17, wherein BX comprises one or more
transgenes or a transgene cassette.
19. An adenovirus according to any one of paragraphs 1 to 16, wherein BY ses one or more
transgenes or a transgene cassette.
. An adenovirus according to any one of paragraphs 1 to 19, wherein the one or more
transgenes or transgene cassettes is under the control of an nous or exogenous
promoter, such as an endogenous promotor.
21. An adenovirus according to paragraph 20, wherein the transgene or transgene cassette is
under the control of an endogenous promoter selected from the group consisting of E4
promoter and major late promoter, in particular the major late promoter.
22. An adenovirus according to aph 19, wherein the transgene or ene cassette is
under the control of an exogenous promoter, such as CMV.
23. An adenovirus according to any one of paragraphs 1 to 22, wherein the transgene cassette
further comprises a regulatory t ndently selected from:
a. a splice acceptor sequence,
b. an internal ribosome entry sequence or a high self-cleavage efficiency A peptide,
c. a Kozak sequence, and
d. combinations thereof.
24. An adenovirus according to paragraph 23, wherein the transgene cassette comprises a Kozak
sequence which is at the start of the n coding sequence.
. An adenovirus according to any one of claims 1 to 24, wherein the transgene cassette encodes
a high self-cleavage efficiency A peptide.
26. An adenovirus according to any one of paragraphs 1 to 25, wherein the transgene cassette
further comprises a polyadenylation sequence.
27. An adenovirus according to any one of paragraphs 1 to 26, wherein the transgene cassette
further ses a restriction site at the ’end of the DNA sequence and/or at the ’end of the
DNA ce.
28. An adenovirus according to any of paragraphs 1 to 27, wherein at least one transgene te
encodes monocistronic mRNA.
29. An adenovirus ing to any one of paragraphs 1 to 28, wherein the ific T-cell
activator has short half-life, for example 48 hours or less.
. An adenovirus according to any one of paragraphs 1 to 29, wherein the bispecific T-cell
activator is encoded in a region selected from E1, E3, BX, BY and ations thereof.
31. An adenovirus according to paragraph 30, wherein the bispecific T-cell activator is encoded at
least in position BX, for example under the control of the major late promoter.
32. An adenovirus according to any one of paragraphs 1 to 29, n the adenovirus further
encodes a second bispecific T-cell activator.
33. An adenovirus according to aph 32, wherein the first bispecific T-cell activator molecule
is specific to a tumour antigen, for example a tumor antigen (for e as listed herein) and
the second bispecific T-cell activator le is specific to a tumour stromal antigen, for
example a l antigen (for example as listed herein).
34. An adenovirus according to any one of paragraphs 1 to 33, wherein the adenovirus further
comprises a cytokine or chemokine or an immunomodulator (such as a cytokine or
chemokine).
. An adenovirus according to paragraph 34, wherein the ne or chemokine is selected from
MIP1α, IL-1α, IL-1β, IL-6, IL-9, IL-12, IL-13, IL-17, IL-18, IL-22, IL-23, IL-24, IL-25, IL-26, IL-27,
IL-33, IL-35, IL-2, IL-4, IL-5, IL-7, IL-10, IL-15, IL-21, IL-25, IL-1RA, IFNα, IFNβ, IFNγ, TNFα,
lymphotoxin α (LTA), Flt3L, GM-CSF, IL-8, CCL2, CCL3, CCL5, CCL17, CCL20, CCL22, CXCL9,
CXCL10, CXCL11, CXCL13, CXCL12, CCL2, CCL19, CCL21, (for example IL-1α, IL-1β, IL-6, IL-9,
IL-12, IL-13, IL-17, IL-18, IL-22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-33, IL-35, IL-2, IL-4, IL-5,
IL-7, IL-10, IL-15, IL-21, IL-25, IL-1RA, IFNα, IFNβ, IFNγ, TNFα, lymphotoxin α (LTA), GM-CSF,
IL-8, CCL2, CCL3, CCL5, CCL17, CCL20, CCL22, CXCL9, CXCL10, CXCL11, CXCL13, CXCL12, CCL2,
CCL19, , such as IL-12, IL-18, IL-22, IL-7, IL-15, IL-21, IFNγ, TNFα, lymphotoxin α (LTA),
CCL3, CCL5, CXCL9, CXCL10, CXCL12, CCL2, CCL19 and CCL21.
36. An irus according to any one of paragraphs 1 to 35, wherein the adenovirus further
comprises an immunomodulator, such as an antibody or antibody fragment, or protein or
peptide ligand, specific to a checkpoint protein such as CTLA-4, PD-1, PD-L1, PD-L2, VISTA, B7-
H3, B7-H4, HVEM, ILT-2, ILT-3, ILT-4, TIM-3, LAG-3, BTLA, LIGHT or CD160, for example CTLA-
4, PD-1, PD-L1 and PD-L2, or to a co-stimulatory le, such as CD28, CD80, CD86, CD83,
ICOS, B7H2, TL1A and 4-1BB.
37. An adenovirus according to any one of the paragraphs 1 to 36, wherein the bispecific T-cell
activator comprises a VH domain comprising an amino acid sequence as set forth in any one
40 of SEQ ID NOs: 8, 13 or 18, or an amino acid sequence that is at least 95% identical thereto.
38. An adenovirus according to any one of paragraphs 1 to 37, wherein the bispecific T-cell activator
comprises a VL domain comprising an amino acid sequence as set forth in any one of SEQ ID NOs:
9, 12 or 17, or an amino acid sequence that is at least 95% identical thereto.
39. An adenovirus according to any one of paragraphs 1 to 36, wherein the bispecific T-cell activator
ses a scFv comprising an amino acid ce as set forth in any one of SEQ ID NOs: 7, 11
or 16, or an amino acid sequence that is at least 95% identical thereto.
40. An adenovirus according to any one of paragraphs 1 to 39, n the bispecific T-cell activator
comprises an amino acid ce set forth in SEQ ID NOs: 2 or 4, or an amino acid sequence that
is at least 95% identical thereto, for e an amino acid sequence as set forth in SEQ ID NOs:
73 or 75.
41. An adenovirus according to any one of paragraphs 1 to 40, wherein the adenovirus comprises a
DNA sequence set forth in any one of SEQ ID NOs: 34 to 37, or a DNA acid sequence that is at least
95% identical thereto, for example a DNA sequence as set forth in any one of SEQ ID NOs: 79 to
42. A composition comprising an adenovirus according to any one of paragraphs 1 to 41 and a diluent
or carrier.
43. A method of treating a patient comprising administering a therapeutically effective amount of an
adenovirus of any one of paragraphs 1 to 41 or a composition of paragraph 42.
44. A method according to paragraph 43, for the treatment of cancer, in ular a solid tumour.
In one embodiment the adenovirus according to the present disclosure encodes at least one further
transgene, for example 1, 2 ,3 or 4 r enes.
In one embodiment a different cleavage peptide is encoded between each of the genes.
In one embodiment all the transgenes are in one location in the virus, for example the are in in
position BY.
Advantageously, the present inventors have discovered that arming an adenovirus with a
bispecific T-cell activator le allows the bi-specific dy fragment molecule to ‘piggyback’ on
the ability of the irus to selectively infect cancer cells, thereby enabling the targeted delivery of
the bispecific T-cell activator to tumour cells.
Advantageously, bispecific T-cell activator are small and can be made in mammalian cells. Hence
once infected by the adenoviruses of the present disclosure, the bispecific T-cell activator molecules are
synthesized by tumour cells, secreted and can act locally, spreading beyond the immediate int of
the virus. This therefore allows the bispecific T-cell activator to spread beyond the immediate site of
infection but at the same time limits the spread of the virus too far beyond the infected tumour cell nest.
This ses the risk of undesired off-target effects.
In one embodiment, the adenovirus is EnAd. EnAd has been shown to have an enhanced
oncolytic activity compared to prior art adenoviruses. EnAd has also been shown to have a high selectivity
for human epithelial-derived oma cells, such as colon, lung, bladder and renal cancer cells. This
makes it an ideal delivery vehicle for ific T-cell activator molecules because T-cells can be activated
by the bispecific T-cell activator molecule to attack target cells whilst EnAd simultaneously infects and
lyses cancer cells. This results in a two-pronged attack on the tumour which has a synergistic tic
effect.
In one embodiment the surface antigen is a component of the T-cell or complex (TCR),
such as CD3, TCR-α and TCR-β.
In one embodiment the e antigen is CD3 such as CD3ε, CD3γ and CD3δ, in ular
CD3 ε.
In one embodiment one of the binding domains is specific to a tumour antigen such as CEA,
MUC-1, EpCAM, a HER receptor (such as HER1, HER2, HER3, HER4), PEM, A33, G250, carbohydrate
antigens Ley, Lex, Leb, PSMA, TAG-72, STEAP1, CD166, CD24, CD44, E-cadherin, SPARC, ErbB2 and
ErbB3, in particular EpCAM.
In one embodiment one of the binding domains is specific to EpCAM, for example an EpCAM
comprising an amino acid sequence as set forth in SEQ ID NO: 28 or a sequence at least 95% identical
In one embodiment at one of the binding domains is specific to a tumour stroma antigen, for
example fibroblast activation protein (FAP), TREM1, IGFBP7, FSP-1, platelet-derived growth factorα
receptor -α), platelet-derived growth factor-β receptor (PDGFR-β) and vimentin.
ageously, stromal cells (non-transformed cells) expressing these antigens are not subjected
to the same level of mutation-resistance-selection process as transformed cells. Therefore, these
cells are easier to target for cancer therapy since they are not a ‘moving target’. Furthermore, the
types of receptors found in stromal cells are often common across different types of cancer. Hence,
targeting one of the above antigens is likely to be ive for multiple cancer types.
In one embodiment one of the binding domains is specific to FAP, for example a FAP
comprising an amino acid sequence as set forth in SEQ ID NO: 30 or a sequence at least 95%
indentical thereto. Advantageously, FAP is lated on tumour associated fibroblasts.
lasts are a vital component of solid carcinomas supporting growth, invasion and recovery
from interventions. They lly comprise 40-60% of the cells in advanced carcinomas.
Advantageously, fibroblasts are genetically stable cells that are less likely to escape therapy than
cancers cells. Activated lasts are also relatively similar across a variety of tumour types. Thus,
by activating T cells to target and kill FAP expressing tumour associated fibroblasts, the
adenoviruses of the present disclosure can help to diminish a spectrum of immune suppressive
pathways, such as those mediated by IL-10, TGFβ and IDO.
Other stromal targets, include tumor associated macrophages and myeloid derived
suppressor cell antigen, for example CD163, CD206, CD68, CD11c, CD11b, CD14, CSF1 receptor,
CD15, CD33, CD66b and combinations of two or more of the same.
In one embodiment one of the binding domains in the bispecific T-cell activator is specific to
a non-TCR ting protein such as CD31, CD2 and CD277.
In one embodiment one of the binding s is ic to a surface antigen on a T cell of
interest, such as selected from CD3 (such as CD3 delta, CD3 epsilon or CD3 gamma), TCR-α chain and
TCR-β chain, and one binding domain is specific to a tumour antigen.
In one ment one of the binding domains is specific to CD3 and r binding
domain is specific for a tumor n,f or example selected from the group consisting of: CEA, MUC-
1, EpCAM, HER receptors HER1, HER2, HER3, HER4, PEM, A33, G250, carbohydrate antigens Ley, Lex,
Le b, PSMA, TAG-72, STEAP1, CD166, CD24, CD44, E-cadherin, SPARC, ErbB2 and ErbB3.
In one embodiment one of the binding domains is specific to CD3 (such as CD3 delta, CD3
epsilon or CD3 gamma) and another binding domain is specific to EpCAM.
In one embodiment one of the binding domains is specific to CD3ε and another binding
domain is specific to EpCAM.
In one embodiment one of the binding domains is specific to a surface antigen on a T cell of
interest, such as selected from CD3 (such as CD3 delta, CD3 epsilon or CD3 gamma), TCR-α and TCR-
β, and another binding domain is specific to a tumour stromal antigen.
In one embodiment one of the binding domains is specific to CD3 (such as CD3 delta, CD3
epsilon or CD3 gamma) and another g domain is specific to a tumour stromal antigen, for
example selected from the group consisting of: fibroblast activation protein (FAP), TREM1, IGFBP7,
FSP-1, platelet-derived growth factor-α receptor (PDGFR-α), platelet-derived growth factor-β
receptor (PDGFR-β) and vimentin.
In one embodiment one of the binding domains is specific to CD3 (such as CD3 delta, CD3
epsilon or CD3 gamma) and another binding domain is specific to FAP.
In one embodiment one of the binding domains is specific to CD3ε and r binding
domain is specific to FAP.
In one embodiment one of the binding domains is specific to a surface antigen on a T cell of
interest, such as CD3, TCR-α and TCR-β and another binding domain is specific to a non-TCR
activating protein.
In one embodiment one of the binding domains is ic to a CD3 (such as CD3 delta, CD3
epsilon or CD3 gamma) and another binding domain is ic to a non-TCR activating protein
ed from the group consisting of CD31, CD2 and CD277.
In one embodiment one of the binding domains is specific to CD3ε and another binding
domain is ic to non-TCR activating protein selected from the group consisting of CD31, CD2
and CD277.
In one embodiment at least one of BX or BY is not a bond.
In one embodiment BX is not a bond.
In one ment BY is not a bond.
In one embodiment both BX and BY are not bonds.
In one embodiment the adenovirus is ic.
In one embodiment the adenovirus is tic.
In one embodiment the adenovirus is ic and oncolytic.
In one embodiment the irus replication capable.
In one embodiment the adenovirus is chimeric, oncolytic and replication capable.
In one embodiment the adenovirus is replication competent.
In another embodiment the adenovirus is ic, tic and replication competent.
In one embodiment the adenovirus is replication deficient, i.e. is a vector.
In one embodiment BX comprises a transgene or transgene cassette, in particular a
transgene cassette encoding a ific T-cell activator according to the the present disclosure.
In one embodiment BY comprises a transgene or transgene cassette, in particular a
transgene cassette encoding a bispecific T-cell tor according to the the t disclosure.
In one embodiment BY comprises a transgene or ene cassette, in particular a transgene
cassette ng a bispecific T-cell activator according to the the present disclosure and BX represents
a bond.
In one embodimeht both BX and BY comprise a transgene or transgene cassette.
In one embodiment, the one or more transgenes or transgene cassettes is under the l of
an endogenous or exogenous promoter, such as an endogenous promotor. Advantageously, when under
the control of these promoters the virus remains replication competent and is also able to express the
bispecific T-cell activator and/or other protein. Thus the bispecific T-cell activator of choice will be
expressed by the cancer cell. Employing an exogenous promoter may be advantageous in some
embodiments because it can strongly and tutively express the antibody or fragment, which may be
particularly useful in some situations, for example where the t has very pervasive cancer.
Employing an endogenous er may be advantageous because it reduces the size of the transgene
cassette that needs to be incorporated to express the bispecific T-cell activator, i.e. the cassette can be
smaller because no exogenous promoter needs to be included.
ingly, in one embodiment the transgene or transgene cassette is under the control of an
endogenous promoter selected from the group consisting of E4 and major late promoter, in particular
the major late promoter. Employing an endogenous promoter in the virus may also be advantageous in
a therapeutic context because the transgene is only expressed when the virus is replicating in a cancer
cell as opposed to a constitutive exogenous promoter which will continually transcribe the transgene and
may lead to an inappropriate concentration of the antibody or fragment.
In one embodiment, the transgene or transgene cassette(for example ng a ific T-cell
activator) is under the control of an exogenous er, such as CMV. Advantageously, the use of a
constitutive ous promoter results in continuous transcription of the transgene which may be
desirable in certain instances.
In one embodiment one transgene or ene te (for example encoding a bispecific T-
cell activator) is under the control of an endogenous promoter and r transgene or ene
cassette (for example encoding a bispecific T-cell activator) is under the control of an exogenous
promoter.
In one embodiment all of the transgenes or transgene cassettes (for example encoding a
bispecific T-cell activator) in the virus is/are under the control of an endogenous promoter.
In another embodiment all of the transgenes or transgene cassettes (for example encoding a
bispecific T-cell activator) in the virus is/are under the control of an exogenous promoter.
In one embodiment the transgene or transgene cassette further comprises a tory element
independently selected from:
i) a splice acceptor sequence,
ii) an internal ribosome entry sequence or a high leavage efficiency 2A peptide,
iii) a Kozak ce, and
iv) combinations thereof.
Thus in one embodiment the transgene cassette comprises i) or ii) or iii) or iv).
In one embodiment the transgene cassette comprises i) and ii), or i) and iii), or i) and iv), or ii)
and iii), or ii) and iv), or iii) and iv).
In one embodiment the transgene cassette comprises i) and ii) and iii), or i) and ii) and iv), or i)
and iii) and iv), or ii) and iii) and iv).
In one embodiment, the transgene cassette comprises i) and ii) and iii) and iv).
In one embodiment, the transgene cassette comprises a Kozak ce at the start of the
protein (for example bispecific T-cell activator) coding ce, which assists in the translation of mRNA.
In one embodiment, the transgene cassette s a high self-cleavage efficiency 2A peptide.
In one embodiment the transgene cassette further comprises a polyadenylation sequence.
In one embodiment the transgene cassette further comprises a restriction site at the 3’end of
the DNA sequence and/or at the 5’end of the DNA sequence.
In one embodiment at least one transgene cassette encodes monocistronic mRNA.
In one embodiment the ific T-cell activator molecule has short half-life, for example 48
hours or less.
In one embodiment the bispecific T-cell activator molecule is d in a region selected from
E1, E3, BX, BY and combinations f. Advantageously, the present inventors have established that a
variety of transgenes can be inserted into BX and/or BY under the control of an exogenous or endogenous
promoter, without ely affecting the life cycle of the virus or the stability of the vector.
In one embodiment, the bispecific T-cell activator molecule is encoded at least in position BX, for
example under the control of the major late promoter. Advantageously, the transgene or transgene
te allows the bispecific T-cell tor or any additional molecule to be expressed together with
the adenovirus itself. Importantly, the present inventors successfully demonstrated that the expression
of the bispecific T-cell tor did not significantly affect the ability of EnAd to replicate nor negatively
impact its oncolytic activity.
In one embodiment, the bispecific T-cell activator molecule is encoded at least in position BY, for
example under the control of the major late promoter. ageously, the ene or transgene
cassette allows the bispecific T-cell activator or any additional molecule to be expressed together with
the adenovirus itself. Importantly, the present inventors successfully demonstrated that the expression
of the bispecific T-cell activator did not significantly affect the y of EnAd to replicate nor negatively
impact its oncolytic activity.
In one embodiment, the adenovirus further encodes a second bispecific T-cell activator.
In one embodiment, the first bispecific T-cell activator molecule is specific to a tumour antigen,
for example a tumor antigen as described above, and the second bispecific T-cell activator molecule is
specific to a tumour stromal antigen, for example a l n as described above.
In one embodiment the first bispecific T-cell activator molecule is specific to a tumour antigen
selected from the group ting of: CEA, MUC-1, EpCAM, HER receptors HER1, HER2, HER3, HER4,
PEM, A33, G250, carbohydrate antigens Ley, Lex, Leb, PSMA, TAG-72, STEAP1, CD166, CD24, CD44, E-
cadherin, SPARC, ErbB2 and ErbB3 and the second bispecific T-cell activator molecule is ic to a
tumour stromal antigen ed from the group consisting of: fibroblast activation protein (FAP), TREM1,
IGFBP7, FSP-1, platelet-derived growth factor-α receptor (PDGFR-α), platelet-derived growth factor-β
receptor (PDGFR-β) and vimentin.
In one embodiment the first bispecific T-cell activator molecule is specific to EpCAM and the
second bispecific T-cell activator le is specific to a tumour l antigen selected from the group
consisting of: fibroblast activation protein (FAP), TREM1, IGFBP7, FSP-1, platelet-derived growth factorα
receptor (PDGFR-α), platelet-derived growth -β receptor (PDGFR-β) and vimentin.
In one embodiment the first bispecific T-cell activator molecule is specific to a tumour antigen
selected from the group consisting of: CEA, MUC-1, EpCAM, HER receptors HER1, HER2, HER3, HER4,
PEM, A33, G250, carbohydrate ns Ley, Lex, Leb, PSMA, TAG-72, STEAP1, CD166, CD24, CD44, E-
cadherin, SPARC, ErbB2 and ErbB3 and the second ific T-cell activator is specific to FAP.
In one embodiment the first bispecific T-cell activator molecule s specific to EpCAM and the
second bispecific T-cell activator molecule is specific to FAP.
In r embodiment the first bispecific T-cell activator molecule is specific to a tumour
antigen and the second bispecific T-cell activator molecule is specific to a non-TCR ting protein.
In one embodiment the first bispecific T-cell activator molecule is specific to a tumor antigen
selected from the group consisting of: CEA, MUC-1, EpCAM, HER receptors HER1, HER2, HER3, HER4,
PEM, A33, G250, carbohydrate antigens Ley, Lex, Leb, PSMA, TAG-72, STEAP1, CD166, CD24, CD44, E-
in, SPARC, ErbB2 and ErbB3.
In one embodiment the first bispecific T-cell activator molecule is specific to EpCAM and the
second bispecific T-cell activator molecule is specific to a non-TCR activating protein selected from the
group consisting of: CD31, CD2 and CD277.
In one embodiment the first bispecific T-cell activator molecule is specific to a tumour stromal
antigen and the second bispecific T-cell activator molecule is specific to a non-TCR activating protein.
In one embodiment the first ific T-cell activator molecule is specific to a tumour stromal
antigen ed from the group consisting of: last activation protein (FAP), TREM1, IGFBP7, FSP-
1, platelet-derived growth factor-α or (PDGFR-α), platelet-derived growth factor-β receptor
-β) and vimentin and the second bispecific T-cell activator molecule is specific to a non-TCR
ting protein selected from the group consisting of: CD31, CD2 and CD277.
In one embodiment the first bispecific T-cell activator molecule is specific to FAP and the
second bispecific T-cell activator molecule is specific to a non-TCR ting protein selected from the
group consisting of: CD31, CD2 and CD277.
In one embodiment the adenovirus only comprises one bispecific T-cell activator.
In another embodiment the adenovirus comprises two bispecific T-cell activators.
In another embodiment the adenovirus comprises three bispecific T-cell activators.
In addition to encoding one two or three bispecific T-cell activators the virus may also encode a
1, 2, 3 or 4 further transgenes.
In one embodiment the irus further encodes a cytokine or chemokine.
In one embodiment the adenovirus further s a cytokine.
In one embodiment the adenovirus further encodes a chemokine.
In another embodiment the adenovirus further encodes a cytokine and a chemokine.
In one embodiment the adenovirus ses one ific T-cell activator and at least one
cytokine or chemokine, for example 1, 2 or 3 cytokines, 1, 2 or 3 chemokines or a combination of 2 or 3
genes each gene independently encoding a ne of chemokine.
In another embodiment the adenovirus comprises two bispecific T-cell activators and at least
one cytokine or ine for example 1 or 2 cytokines, 1 or 2 chemokines or a combination of a
ne and a ine.
In another embodiment the adenovirus comprises three bispecific T-cell activators and at least
one cytokine or chemokine.
In one embodiment the cytokine or chemokine is selected from IL-1α, IL-1β, IL-6, IL-9, IL-12, IL-
13, IL-17, IL-18, IL-22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-33, IL-35, IL-2, IL-4, IL-5, IL-7, IL-10, IL-15, IL-21,
IL-25, IL-1RA, IFNα, IFNβ, IFNγ, TNFα, lymphotoxin α (LTA) and GM-CSF, IL-8, CCL2, CCL3, CCL5, CCL17,
CCL20, CCL22, CXCL9, CXCL10, CXCL11, CXCL13, CXCL12, CCL2, CCL19, CCL21, for example IL-12, IL-18,
IL-22, IL-7, IL-15, IL-21, IFNγ, TNFα, lymphotoxin α (LTA), CCL3, CCL5, CXCL9, CXCL12, CCL2, CCL19 and
CCL21.
In one embodiment, the the encoded cytokine is selected from TNF alpha super family F
includes TNF-alpha, TNF-C, OX40L, CD154, FasL, LIGHT, TL1A, CD70, Siva, CD153, 4-1BB , TRAIL,
RANKL, TWEAK, APRIL, BAFF, CAMLG, NGF, BDNF, NT-3, NT-4, GITR ligand, EDA-A, EDA-A2), TGF-beta
superfamily, IL-1 family (i.e. IL-1 and IL-8), IL-2 family, IL-10 family, IL-17 family, interferon family.
In one embodiment the chemokine is selected from the group comprising MIP-1 alpha, RANTES,
IL-8, CCL5, CCL17, CCL20, CCL22, CXCL9, CXCL10, CXCL11, CXCL13, CXCL12, CCL2, CCL19 and CCL21.
In one embodiment, the adenovirus further comprises an immunomodulator, such as an
antibody or antibody fragment, or protein or peptide ligand, specific to a checkpoint protein or costimulatory
molecule, or specific binding ligands for such molecules.
In one ment the immunomodulator is an antibody or antibody fragment, or n or
peptide ligand, specific to a checkpoint protein such as , PD-1, PD-L1, PD-L2, VISTA, B7-H3, B7-H4,
HVEM, ILT-2, ILT-3, ILT-4, TIM-3, LAG-3, BTLA, LIGHT or CD160, for example CTLA-4, PD-1, PD-L1 and PDL2.
In one embodiment the immunomodulator is an inhibitor, for example a checkpoint inhibitor.
In one embodiment the immunomodulator is an agonist.
In another embodiment the immunomodulator is an antibody or antibody fragment, or protein
or peptide ligand, specific to a co-stimulatory le such as CD28, CD80, CD86, CD83, ICOS, B7H2,
TL1A and 4-1BB.
In one embodiment the adenovirus comprises a first antibody, antibody fragment, protein or
peptide ligand specific to a checkpoint protein and a second dy, antibody fragment, n or
peptide ligand specific to a mulatory molecule.
In one embodiment the bispecific T-cell activator comprises a VH domain sing an amino
acid sequence as set forth in any one of SEQ ID NOs: 8, 13 or 18, or an amino acid sequence that is at
least 95% identical o.
In one embodiment the bispecific T-cell activator comprises a VL domain comprising an amino
acid sequence as set forth in any one of SEQ ID NOs: 9, 12 or 17, or an amino acid ce that is at
least 95% identical thereto.
In one embodiment the bispecific T-cell activator comprises a scFv sing an amino acid
sequence as set forth in any one of SEQ ID NOs: 7, 11 or 16, or an amino acid sequence that is at least
95% identical thereto.
In one embodiment, a bispecific T-cell activator employed in the present disclosure (i.e encoded
by the adenovirus) comprises a binding domain with a VH domain with a sequence shown in SEQ ID NO:
8 or a sequence at least 95% identical thereto, and a VL domain with a sequence shown in SEQ ID NO: 9
or a sequence at least 95% identical thereto.
In one embodiment, a bispecific T-cell activator employed in the present disclosure (i.e encoded
by the adenovirus) comprises a binding domain with a VH domain with a sequence shown in SEQ ID NO:
13 or a sequence at least 95% identical thereto, and a VL domain with a sequence shown in SEQ ID NO:
12 or a sequence at least 95% identical thereto.
In one embodiment, a bispecific T-cell tor employed in the present disclosure (i.e encoded
by the irus) comprises a binding domain with a VH domain with a sequence shown in SEQ ID NO:
18 or a sequence at least 95% identical thereto, and a VL domain with a sequence shown in SEQ ID NO:
17 or a sequence at least 95% identical thereto.
In one embodiment, a ific T-cell activator employed in the present disclosure (i.e encoded
by the adenovirus) comprises a binding domain with a VH domain with a sequence shown in SEQ ID NO:
8 or a sequence at least 95% identical thereto, and a VL domain with a sequence shown in SEQ ID NO: 9
or a sequence at least 95% identical thereto, and a g domain with a VH domain with a sequence
shown in SEQ ID NO: 13 or a sequence at least 95% identical thereto, and a VL domain with a sequence
shown in SEQ ID NO: 12 or a sequence at least 95% identical thereto.
In one embodiment, a bispecific T-cell activator employed in the present disclosure (i.e encoded
by the adenovirus) comprises a binding domain with a VH domain with a sequence shown in SEQ ID NO:
8 or a sequence at least 95% identical thereto, and a VL domain with a sequence shown in SEQ ID NO: 9
or a sequence at least 95% identical thereto, and a g domain with a VH domain with a sequence
shown in SEQ ID NO: 18 or a sequence at least 95% identical thereto, and a VL domain with a sequence
shown in SEQ ID NO: 17 or a sequence at least 95% identical thereto.
In one ment, a bispecific T-cell tor employed in the present disclosure (i.e encoded
by the adenovirus) comprises a sequence shown in SEQ ID NO: 7, 11, 16 or a sequence at least 95%
identical to any one of the same.
In one embodiment, a ific T-cell activator ed in the present disclosure (i.e encoded
by the adenovirus) comprises a sequence shown in SEQ ID NO: 7 or a sequence at least 95% cal
thereto.
In one embodiment, a bispecific T-cell activator ed in the t disclosure (i.e encoded
by the adenovirus) comprises a ce shown in SEQ ID NO: 11 or a ce at least 95% identical
thereto.
In one embodiment, a bispecific T-cell activator employed in the present disclosure (i.e encoded
by the adenovirus) comprises a sequence shown in SEQ ID NO: 16 or a sequence at least 95% identical
thereto.
In one embodiment the bispecific T-cell activator comprises an amino acid sequence set forth in
SEQ ID NOs: 2 or 4, or an amino acid sequence that is at least 95% identical thereto, for example an amino
acid as set forth in SEQ ID NOs: 73 or 75.
In one embodiment the adenovirus according to the present sure comprises a DNA sequence
set forth in any one of SEQ ID NOs: 34 to 37, or a DNA acid sequence that that hybridises thereto under
stringent conditions.
In one embodiment the adenovirus according to the present disclosure comprises a DNA
sequence set forth in any one of SEQ ID NOs: SEQ ID NOs: 79 to 82.
In one embodiment the adenovirus according to the present disclosure ses a DNA sequence
shown in any one of SEQ ID NO: 34, 35, 36, 37, 79, 80, 82, 96, 97, 98, 99, 100, 101, 102, 103, 120, 298 or
a sequence encoding the same virus, or a sequence that hybrises to the any one of the same under
stringent conditions.
In one embodiment the adenovirus according to the present sure ses a DNA sequence
shown in any one of SEQ ID NO: 34, 35, 36, 37, 79, 80, 82, 96, 97, 98, 99, 100, 101, 102, 103, 120 or 298.
The skilled person is aware that there is reduncy in the DNA code, thus the present disclosure
extends to EnAd or Ad11 encoding a bispecific T-cell activator with an amino acid disclosed herein.
The C-terminal deca-His (HHHHHHHHHH SEQ ID NO: 24) affinity tag is useful for cation of
the bispecific T-cell activator or adenovirus. However, it is optional and may be excluded for example in
the end product. The skilled person would also be aware that other affinity tags other than deca-His can
be used and se may be excluded without affecting the biological on of the bispecific T-cell
activator or adenovirus. Accordingly, in one embodiment the bispecific T-cell activator comprises
an amino acid sequence as set forth in any one of SEQ ID NOs: 2 or 4 but excludes the deca-His affinity
tag at the C-terminal end of the ce, for example as set forth in SEQ ID NOs: 73 or 75. In another
embodiment, the adenovirus comprises a DNA sequence set forth in any one of SEQ ID NOs: 34 to 37 but
excludes the deca-His affinity tag, for example a DNA sequence as set forth in any one of SEQ ID NOs: 79
to 82.
The ion of the deca-His affinity tag r extends to all other sequences disclosed herein
comprising the deca-His affinity tag, i.e. the present disclosure includes the same amino acid or DNA
sequences lacking the C-terminal is tag (HHHHHHHHHH or
CATCACCATCACCATCACCACCATCACCAT), for example as set forth in any one of SEQ ID NOs: 72 to 82.
In one embodiment the bispecific T-cell activator encoded by the virus of the present disclosure
is under the control of an exogenous promoter, for example the CMV promoter. The exogenonus may
be placed n the MPL and the encoded transgene when the transgene is between L5 and E4
regions.
The exogenonus may be placed between the encoded transgene and L5 when the transgene is
between L5 and E3 regions.
In one aspect there is provided a composition sing an adenovirus as described herein and
a diluent or carrier.
In one aspect, there is provided a method of treating a patient comprising administering a
therapeutically effective amount of an adenovirus or a ition as described herein.
In one embodiment the method is for the treatment of , for example an epithelial cancer,
in particular a solid tumour.
In one embodiment there is provide a method of treatment comprising administering a virus
according to the present disclosure in ation with a checkpoint inhibitor (such as a PD-1 or PDL1
inhibitor), in particular wherein the checkpoint inhibitor is encoding in the virus.
In one embodiment there is provide a method of treatment comprising administering a virus
according to the present disclosure which is NOT in combination with a checkpoint inhibitor (for example
as listed elsewhere herein such as a PD-1 or PDL1 inhibitor), in particular wherein the oint inhibitor
is not encoding in the virus.
The bispecific T-cell activators encoded by the virus as per the present disclosure have the y
to potentiate the cytotoxicity of the virus.
Surprisingly the bispecific T-cell activators encoded by a virus as per the present disclosure can
activate CD4+ cells and/or CD8+ cells, for example even cells in the suppressive environment of the
tumor, including T cells in the fluid environment, such as ascites, of the tumor.
Advantageously the bispecific T-cell activators encoded by a virus as per the present disclosure
can activate cytotoxic T cells, for e even T cells in the suppressive environment of the tumor,
including T cells in the fluid environment, such as s, of the tumor.
Even more surprisingly the bispecific T-cell activators encoded by a virus as per the present
disclosure are capable of stimulating (activating) T cell proliferation.
The viruses ng bispecific T-cell activators according to the present disclosure seem to be
able to by-pass, overcome or reverse the immune suppressive microenvironment of the tumor.
In one embodiment the activation of T cells s in upregulation of a T cell , for example
CD25.
In one embodiment a binding of a bispecific T-cell activator in a virus according to the present
disclosure is specific to a neoantigen.
The disclosure also extends to novel sequences, disclosed herein.
DETAILED DESCRIPTION
Immune cell as ed herein is a cell with a funcational role in the immune , including
(but not limited to), macrophages, neutrophils, dendritic cells, NK cells, lymphocytes, such as T
lymphocytes (in particular T cells and NKT cells).
The term antibody as used herein refers to an immunoglobulin molecule capable of specific
binding to a target n, such as a carbohydrate, cleotide, lipid, polypeptide, peptide etc., via
at least one antigen recognition site (also referred to as a binding site herein), located in the variable
region of the immunoglobulin molecule. Unless the context indicates otherwise the term extends to full
length antibodies and multi-specific antibody molecules comprising full length antibodies.
As used herein “antibody molecule” es antibodies and g fragments thereof and
multi-specific formats of any one of the same.
Antigen binding site as employed herein refers to a portion of the le, which comprises a
pair of variable regions, in particular a cognate pair that interact specifically with the target antigen.
ically, as employed herein, is intended to refer to a g site that only recognises
the antigen to which it is specific or a binding site that has icantly higher binding affinity to the
antigen to which is specific compared to affinity to antigens to which it is non-specific, for example
, 6, 7, 8, 9, 10 times higher binding affinity.
Binding fragments or antibody binding nts as employed herein refer to antibody
binding fragments and multi-specific antibody molecules comprising antibody binding fragments
ing but not d to Fab, modified Fab, Fab’, modified Fab’, F(ab’)2, Fv, single domain
antibodies, scFv, bi, tri or tetra-valent antibodies, Bis-scFv, diabodies, triabodies, odies and
epitope-binding fragments of any of the above (see for example er and Hudson, 2005, Nature
Biotech. 23(9):1126-1136; Adair and Lawson, 2005, Drug Design Reviews - Online 2(3), 209-217).
The methods for creating and manufacturing these dy fragments are well known in the art
(see for example Verma et al., 1998, Journal of Immunological Methods, 216:165-181). Other
antibody fragments for use in the present disclosure include the Fab and Fab’ fragments described
in International patent applications WO05/003169, WO05/003170 and WO05/003171. Multivalent
antibodies may comprise multiple specificities e.g. bispecific or may be ecific (see for
example WO92/22853 and WO05/113605).
In one embodiment the adenovirus comprises a specific antibody molecule.
Multi-specific antibody le as employed herein refers to an antibody molecule which
has two or more n binding s, for example two (bispecific) or three (tri-specific) or four
(tetra-specific) binding domains.
Multi-specific antibody les of the present disclosure may be constructed from various
antibody fragments such as those described above. For example a diabody is a bispecific antibody
molecule composed of a non-covalent dimer of ScFv fragments, whilst a F(ab’)2 is a bispecific
antibody molecule composed of 2 Fab fragments linked by a hinge region. The skilled person will
therefore be aware that ent antibody fragments can be arranged in various combinations in
order to produce a bi- or multi-specific antibody molecule.
Examples of ecific or tetra-specific antibody formats include but are not limited to Fab3,
triabody, tetrabody, tribody, DVD-Ig, IgG-scFv, ScFv 2-Fc, tandAbs and DNL-Fab3.
cific dy molecule as employed herein refers to a molecule with two antigen
binding domains, which may bind the same or different antigens. A ific T-cell activator is a
subclass of bispecific antibody molecules.
The domains may bind different antigens.
Alternatively, the domains may all bind the same antigen, including binding the same epitope
on the antigen or binding different epitopes on the same n.
Examples of bispecific antibody formats include but are not limited to bispecific T cell
activator , F(ab’)2, F(ab’)-ScFv2, di-scFv, diabody, minibody, scFv-Fc, DART, TandAb, ScDiabody,
ScDiabody-CH3, Diabody-CH3, triple body, tibody, minibody, TriBi minibody, ScFv-CH3 KIH
(knobs in holes), Fab-ScFv, SCFv-CH-CL-scFv, IH, Fab-scFv-Fc, alent HCAb, scDiabody-
Fc, Diabody-Fc, intrabody, dock and lock antibodies, ImmTAC, HSAbody, ScDiabody-HAS, humabody
and Tandem ScFv-toxic (see for example Christoph Spiess et al, Molecular Immunology 67 (2015)
page 95-106).
The adenovirus of the present disclosure comprises a ific T-cell activator which is
specific for at least a surface antigen on a T cell of interest. es of T cell surface antigens
include but are not limited to: CD3, CD2, VLA-1, CD8, CD4, CCR6, CXCR5, CD25, CD31, CD45RO,
CD197, CD127, CD38, CD27, CD196, CD277 and CXCR3, particularly CD2, CD3, CD31 and CD277.
Bispecific T cell activator as used herein refers to a class of artificial ific onal
antibodies comprising 2 scFvs of different antibodies or amino acid sequences from 4 different genes
on a single peptide chain of about 55 KDa. One of the scFvs is specific for an immune cell, such as a
T cell antigen, such as the CD3 receptor, expressed on the surface of T cells. The other scFv typically
binds to a tumour cell via a tumour-specific molecule. Accordingly, bispecific T-cell activators are
able to form a link between T cells and tumour cells by virtue of their specificities for an antigen on
the T cell and an antigen on the tumour cell. This leads to activation of the T-cells and triggers the T
cells to exert their cytotoxic effects on tumour cells, independently of MHC I or co-stimulatory
molecules. Examples of bispecific T-cell activator based therapies currently approved or undergoing
clinical trials include for example Blinatumomab (Blyncyto®) which targets CD19 and is for the
treatment of non-Hodkin’s lymphoma and acute blastic leukemia and Solitomab which
targets EpCAM and is for treating gastrointestinal and lung cancers.
In one embodiment the immune cell engager (such as T cell engager) is arranged is the
format VL1-linker1-VH1-linker2-VH2-linker3-VL2, for example employing linkers independently
selected from linker ces disclosed herein, for example.
In one embodiment linkers in a bispecific T-cell tor according to the present disclosure
are independently selected from SEQ ID NO: 10, 14, 23, 124 to 162 and 166 to 297.
In one embodiment linker1 and linker3 have the same sequence, for e a ce
shown in any one of SEQ ID NOs: 10, 14, 23, 124 to 162 and 166 to 296, in particular 10, 14 and 23.
In one embodiment linker1 and linker3 have different amino acid sequence, for e
independently selected from SEQ ID NOs: 10, 14, 23, 124 to 162 and 166 to 296, in particular 10, 14
and 23.
In one ment Linker1 is SEQ ID NO: 10.
In one embodiment Linker1 is SEQ ID NO: 14.
In one ment Linker3 is SEQ ID NO: 10.
In one embodiment Linker3 is SEQ ID NO: 14.
In one embodment Linker1 and Linker3 are SEQ ID NO: 10.
In one ent Linker1 and Linker3 are SEQ ID NO: 14.
In one embodiment Linker1 is SEQ ID NO: 10 and Linker 3 is SEQ ID NO: 14.
In one embodment Linker1 is SEQ ID NO: 14 and 3 is SEQ ID NO: 10.
In one embodiment Linker2 is different to both Linker 1 and Linker3.
In one embodimemnt Linker 2 is selected from any one of SEQ ID NOs: 10, 14, 23, 124 to 162
and 166 to 297, such as SEQ ID NO: 297.
In one embodiment Linker1 is in the range 10 to 30 amino acids in length, such as 10, 11, 12,
13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30.
In one embodiment Linker3 is in the range 10 and 30 amino acids in length, such as 10, 11,
12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30.
In one embodiment Linker 2 is in the range 2 to 10 amino acids in length, such as 2, 3, 4, 5,
6, 7, 8, 9 or 10.
In one embodiment VH1 & VL1 are specific to a T cell antigen according to the present
disclosure, such as CD3.
In one mentVH2 & VLZ are specific to an immune cell antigen, such as a T cell antigen,
according to the t disclosure, such as CD3.
In one embodiment VH1 & VL1 are specific to an antigen or interest, such as a cancer antigen
or stromal antigen, etc.
In one embodiment VH2 & VLZ are specific to an antigen or st, such as a cancer antigen
or l antigen, etc.
Stroma or stromal antigen as employed herein refers to an antigen therapeutic target in the
stroma, including expressed in the molecular structure of the stroma matrix, such as connective
tissue molecules or les associated with this matrix or antigens associated with the cellular
components of the stroma, for example expressed on fibroblasts, tumour-associated macrophages,
dendritic cells, NK cells and/or T-cells which have infiltrated the stroma. Examples of stroma
ns include but are not limited to FAP, TGFB, TREMl, , FSP-l, fibroblast associated
antigen, NGZ, endosialin (CD248), platelet-derived growth factor-a or (PDGFR-a), platelet-
derived growth factor-B receptor (PDGFR-B) and vimentin.
Fibroblasts may be targeted by employing the antigen fibroblast activation protein (FAP), in
particular an antibody specific to FAP which does not bind CD26, (see U82012/0258119
incorporated herein by reference).
FAP was originally fied as a serine protease on reactive stromal fibroblasts.
Subsequent molecular cloning revealed that FAP is identical to seprase, a 170 kDa ne
associated nase that is expressed by melanoma cell lines. Full length cDNA encoded a type H
transmembrane protease of 760 amino acids (aa) highly gous to dipeptidyl ase IV
(DPPIV) with a 52% aa identity over the entire sequence and almost 70% identity in the catalytic
domain. USS,587,299, incorporated herein by reference, describes nucleic acid molecules encoding
FAP and applications thereof.
FAP and DPPIV have similar gene sizes and are chromosomally adjacent to each other at
2q24, suggesting a gene duplication event (Genebank accession number ). Both proteins are
members of the prolyl peptidase family. This class of enzymes is inducible, active on the cell surface
or in extracellular fluids, and uniquely capable of cleaving N-terminal dipeptides from ptides
with proline or alanine in the penultimate position. DPPIV, also termed CD26, is constitutively
expressed by several cell types including fibroblasts, endothelial and epithelial cells, leukocyte
subsets like NK-cells, hocytes and macrophages. A small proportion of DPPIV ates as
soluble protein in the blood. In contrast to DPPIV, FAP is typically not expressed in normal adult
tissue and its proteolytically active soluble form is termed iplasmin Cleaving Enzyme (APCE).
Marked FAP expression occurs in conditions associated with activated stroma, including wound
healing, epithelial cancers, osteoarthritis, rheumatoid arthritis, cirrhosis and pulmonary fibrosis.
40 The FAP ure has been solved (PDB ID 1268) and is very similar to that of DPPIV. FAP
is anchored in the plasma membrane by an uncleaved signal sequence of approximately 20 amino
acids and has a short, amino terminal, cytoplasmic domain of six amino acids. The major part of the
protein, including the catalytic domain, is exposed to the ellular environment. The FAP
glycoprotein is a homodimer consisting of two cal 97-kDa subunits. Each FAP-monomer
subunit consists oftwo domains, an ocB hydrolase domain (aa 27-53 and 493-760) and an eight-blade
B propeller domain (aa 54-492) that e a large cavity. A small pocket within this cavity at the
interface of both s contains the catalytic triad (Ser624, Asp702 and His734). FAP gains its
tic activity upon homodimerization of the subunits and beside its dipeptidyl peptidase
activity, FAP also has collagen type 1 specific gelatinase and endopeptidase ty. The B propeller
acts as scaffolding for protein-protein interactions and determines substrate and extracellular
matrix (ECM) binding. Furthermore, the B propeller is involved in forming molecular
xes of FAP with other prolyl peptidases or with other membrane-bound molecules. The
formation of heteromeric or tetrameric complexes of FAP and DPPIV were found to be associated
with invadopodia of migrating cells on a collagen substrate. Type I collagen induces a close
association of FAP with B1 integrins, thereby playing major organizational roles in the formation
and adhesion of invadopodia. Although the involved mechanisms are not understood in detail, the
formation of such proteinase-rich membrane domains at the cellular invasion front contributes to
directed pericellular ECM degradation. This indicates that FAP and ECM interactions may be closely
related to invasive cell behaviour by influencing cell adhesion, migration, proliferation and sis
through integrin pathways and ts 0 role of FAP in disease pathogenesis and progression. In
summary, FAP is recognized as a multifunctional protein that es its ical functions in a
cell dependent manner through a combination of its se activity and its ability to form
complexes with other cell-surface les. Over-expression of FAP in epithelial and fibroblastic
cell lines promotes malignant behaviour, pointing to the clinical situation, where cellular expression
levels of FAP are correlated with worse clinical outcome.
Through paracrine signaling les, cancer cells activate stromal fibroblasts and induce
the expression of FAP, which in turn, s the proliferation, invasion and migration of the cancer
cells. Recent studies have demonstrated that TGF-B is the dominant factor in promoting FAP protein
expression (Chen, H et al (2009) Exp and Molec Pathology, doi: 10.1016/j.yexmp. 2009.09.001). FAP
is heavily expressed on reactive stromal lasts in 90% of human epithelial carcinomas,
including those ofthe breast, lung, colorectum and ovary (Garin-Chesa, P et al (1990) PNAS USA 87:
7236-7239). Chen et al have recently shown that FAPoc influences the invasion, proliferation and
migration of HO-8910PM ovarian cancer cells (Chen, H et al (2009) Exp and Molec Pathology, doi:
.1016/j.yexmp. 2009.09.001).
FAP may be targeted by binding said antigen and sterically blocking its ction with
biologically relevant molecules. Alternatively, or additionally linking the FAP molecule with
another FAP molecule or a ent molecule, for example an antigen on the surface of a cancer cell
may be achieved employing a multispecific, such as a bispecific antibody le. This cross linking
raised the visibility of the cells bearing the antigens to the immune systems, which then may be
activated to neutral or destroy the same.
40 Tumour associated macrophages (TAMs) are thought to express TREMl, CD204, CD68
(alone or in combination with CD163 or . These markers can be used to target the TAMs.
The adenovirus of the present disclosure has the ability to infect tumour cells, and in
particular is chosen to preferentially infect tumour, cells. The oncolytic virus infection causes death
and lysis of the cancer cell with release of newly generated virus particles. Incorporated transgenes
encoding antibodies, bispecific T-cell tors and other “payloads” are newly synthesized and
actively secreted by the tumor cells prior to their death, and some molecules will also be released
upon cell lysis.
Antibody molecules with a short half-life may be particularly suitable for use in the present
disclosure because this minimises off-target effects because the body y clears the molecules if
they become systemically available.
NKT cells have the y to target and destroy tumour associated macrophages. However,
their activity seems to be inhibited by the hypoxic environment of the . This activity can be
restored by providing the NKT cells with IL-2 and/or IL-15, for example encoded in the virus of the
present disclosure.
Thus, in one embodiment the virus according to the t disclosure further encodes a
cytokine to activate and NKT cells, for example selected from IL-2, IL-15 and combinations thereof.
The gene encoding the cytokine may be in the same location or a different location to the gene
encoding the antibody molecule, for example independently selected from E1, E3, E4, BX and BY.
Thus, the adenovirus according to the present disclosure has at least two or three
isms for attacking the , including indirect mechanisms which undermine the tumour
stroma.
Transgene as employed herein refers to a gene that has been inserted into the genome
sequence, which is a gene that is unnatural to the virus nous) or not normally found in that
particular location in the virus. Examples of transgenes are given below. Transgene as ed
herein also includes a functional fragment of the gene that is a portion of the gene which when
ed is suitable to perform the function or most of the function of the full-length gene.
Transgene and coding sequence are used interchangeably herein in the context of inserts
into the viral genome, unless the context indicates otherwise. Coding sequence as employed herein
means, for example a DNA sequence encoding a onal RNA, peptide, polypeptide or protein.
lly, the coding sequence is cDNA for the ene that encodes the functional RNA, peptide,
ptide or protein of interest. Functional RNA, peptides, polypeptide and proteins of st
are described below.
Clearly the virus genome contains coding sequences of DNA. Endogenous (naturally
occurring genes) in the genomic sequence of the virus are not considered a transgene, within the
context of the present specification unless then have been modified by recombinant techniques such
as that they are in a non-natural on or in a non-natural environment.
In one ment transgene, as employed herein refers to a segment of DNA containing a
gene or cDNA sequence that has been isolated from one organism and is uced into a different
organism i.e. the virus of the present disclosure. In one embodiment, this non-native segment of
DNA may retain the ability to produce functional RNA, peptide, polypeptide or protein.
Thus, in one embodiment the transgene inserted encodes a human or humanised protein,
polypeptide or peptide.
In one embodiment, the transgene ed encodes a non-human protein, polypeptide or
peptide (such as a non-human mammalian protein, ptide or peptide) or RNA molecule, for
example from a mouse, rat, rabbit, camel, llama or similar. Advantageously, the viruses of the
present disclosure allow the transgenes to be transported inside the cancerous cell. Thus, responses
generated by the human t to a non-human sequence (such as a protein) can be minimised by
this intra-cellular delivery.
A DNA sequence may comprise more than one transgene, for example, 1, 2, 3 or 4 transgenes,
such as 1 or 2.
A transgene cassette may comprise more than one transgene, for example, 1, 2, 3 or 4
transgenes, such as 1 or 2.
In one or more embodiments, the cassette is arranged as shown in the one or more of the
Figures or the examples.
Transgene cassette as employed herein refers to a DNA sequence encoding one or more
transgenes in the form ofone or more coding sequences and one or more regulatory ts.
A ene cassette may encode one or more monocistronic and/or polycistronic mRNA
sequences.
In one embodiment, the transgene or transgene cassette encodes a monocistronic or
polycistronic mRNA, and for example the cassette is suitable for insertion into the irus
genome at a location under the control of an endogenous promoter or exogenous promoter or a
combination thereof.
Monocistronic mRNA as employed herein refers to an mRNA le encoding a single
functional RNA, peptide, polypeptide or protein.
In one embodiment, the transgene cassette encodes monocistronic mRNA.
In one ment the transgene cassette in the context of a cassette encoding
monocistronic mRNA means a segment of DNA optionally containing an exogenous er
(which is a regulatory sequence that will determine where and when the transgene is active) or a
splice site (which is a regulatory sequence determining when a mRNA molecule will be cleaved by
the spliceosome) a coding sequence (i.e. the transgene), usually derived from the cDNA for the
protein of interest, optionally containing a polyA signal sequence and a terminator sequence.
In one ment, the transgene te may encode one or more polycistronic mRNA
Polycistronic mRNA as employed herein refers to an mRNA le encoding two or more
functional RNA, peptides or proteins or a combination thereof. In one embodiment the transgene
cassette encodes a polycistronic mRNA.
In one embodiment transgene cassette in the context of a cassette encoding polycistronic
mRNA includes a segment of DNA optionally ning an exogenous promoter ( which is a
regulatory sequence that will determine where and when the transgene is active) or a splice site
(which is a regulatory sequence determining when a mRNA molecule will be cleaved by the
osome) two or more coding sequences (i.e. the enes), usually derived from the cDNA for
40 the protein or peptide of interest, for example wherein each coding ce is separated by either
an IRES or a 2A peptide. Following the last coding sequence to be transcribed, the cassette may
optionally contain a polyA sequence and a terminator ce.
In one embodiment, the transgene cassette encodes a monocistronic mRNA followed by a
polycistronic mRNA. In another embodiment the transgene cassette a polycistronic mRNA followed
by a monocistronic mRNA.
In one embodiment, the adenovirus is a human irus. "Adenovirus", "serotype" or
adenoviral serotype" as employed herein refers to any adenovirus that can be assigned to any of the
over 50 currently known adenoviral serotypes, which are classified into subgroups A-F, and further
extends to any, as yet, unidentified or unclassified adenoviral serotypes. See, for example, Strauss,
"Adenovirus infections in humans," in The Adenoviruses, Ginsberg, ea., Plenum Press, New York,
NY, pp. 451-596 (1984) and Shenk, "Adenoviridae: The Viruses and Their Replication," in Fields
Virology, Vol.2, Fourth Edition, Knipe, 35ea., LippincottWilliams &Wilkins, pp. 267 (2001),
as shown in Table 1.
Table 1
SubGroup Adenoviral Serotype
A 12,18,3 1
3,7,11,14,16,21,34,35,51
1,2,5,6
8-10,13,15,17,19,20,22-30,32,33,36-39,42-49,50
40.41
The adenoviruses of the present disclosure are subgroup B , namely, Ad11, in
particular Ad11p (the Slobitski strain) and derivatives f, such as EnAd.
Adenoviruses are designated to their groups/serotypes based on the capsid, such as the
hexon and/or fibre
The adenovirus ofthe present disclosure is not a group A, C, D, E or F Virus. The Viruses of
the present disclosure do not comprise an irus death protein.
In one embodiment, the adenovirus of the present disclosure is chimeric. When an
adenovirus is chimeric then the teristics of the outer capsid will be employed to determine
the serotype. ic as employed herein refers to a Virus that comprises DNA from at least two
different Virus serotypes, including different serotypes within the same group.
In one embodiment, the oncolytic Virus has a fibre, hexon and penton proteins from the same
serotype, for example Ad11, in particular Ad11p, for example found at positions 30812-31789,
18254-21100 and 15367 of the genomic sequence of the latter wherein the tide
positions are ve to genbank ID 217307399 (accession number: GC689208).
In one ment, the adenovirus is otucirev (also known as EnAd and formerly as
EnAd). Enadenotucirev as employed herein refers the chimeric adenovirus of SEQ ID NO: 38. It is a
replication competent oncolytic chimeric adenovirus which has enhanced therapeutic properties
compared to wild type iruses (see W02005/118825). EnAd has a chimeric EZB region, which
features DNA from Ad11p and Ad3, and deletions in E3/E4. The structural changes in enadenotucirev
result in a genome that is approximately 3.5kb smaller than Ad11p thereby providing additional “space”
for the ion of enes.
Enadenotucirev (EnAd) is a chimeric oncolytic adenovirus, formerly known as EnAd
(WO2005/118825), with fibre, penton and hexon from Ad11p, hence it is a subgroup B virus. It has a
chimeric E2B region, which ses DNA from Ad11p and Ad3. Almost all of the E3 region and part of
the E4 region is deleted in EnAd. ore, it has icant space in the genome to accommodate
additional genetic material whilst ing viable. Furthermore, because EnAd is a subgroup B
adenovirus, isting immunity in humans is less common than, for example, Ad5. Other examples of
chimeric oncolytic viruses with Ad11 fibre, penton and hexon include OvAd1 and OvAd2 (see
WO2006/060314).
EnAd seems to preferentially infect tumour cells, ates rapidly in these cells and causes cell
lysis. This, in turn, can generate inflammatory immune responses thereby stimulating the body to also
fight the cancer. Part of the s of EnAd is esised to be related to the fast replication of the
virus in vivo.
Whilst EnAd selectively lyses tumour cells, it may be possible to introduce further cial
properties, for e increasing the therapeutic activity of the virus or reducing side-effects of the
virus by arming it with transgenes, such as a transgene which encodes a cell signalling protein or an
dy, or a transgene which encodes an entity which stimulates a cell ling protein(s).
Advantageously arming a virus, with DNA encoding certain proteins, such as a bispecific T-cell
activator, that can be expressed inside the cancer cell, may enable the body’s own defences to be
employed to combat tumour cells more effectively, for example by making the cells more visible to the
immune system or by delivering a therapeutic gene/protein preferentially to target tumour cells.
Furthermore, the ability to insert transgenes that are reporters into the genome can aid clinical
or pre-clinical studies.
It is important that expression of the transgenes does not adversely affect the replication or other
advantageous properties of the virus. Thus, the gene or genes must be inserted in a location that does
not compromise the replication competence and other ageous properties of the virus. In addition,
the genome of adenoviruses is tightly packed and therefore it can be difficult to find a suitable location
to insert transgenes. This also limits the size of transgenes that can be accommodated.
OvAd1 and OvAd2 are also chimeric adenoviruses similar to enadenotucirev, which also have
additional “space” in the genome (see WO2008/080003). Thus in one embodiment the adenovirus is
OvAd1 or OvAd2.
In one embodiment, the adenovirus is oncolytic. Oncolytic adenovirus as employed herein
means an adenovirus that preferentially kills cancer cells as compared with non-cancer cells.
In one embodiment, the oncolytic virus is apoptotic. That is, it hastens programmed cell death.
In one embodiment, the oncolytic virus is cytolytic. The cytolytic activity of oncolytic
adenoviruses of the disclosure can be determined in representative tumour cell lines and the data
converted to a measurement of potency, for example with an irus belonging to subgroup C,
such as Ad5, being used as a standard (i.e. given a y of 1). A suitable method for determining
cytolytic activity is an MTS assay (see Example 4, Figure 2 ofW02005/118825 incorporated herein
by reference).
In one ment the oncolytic virus is necrolytic. That is, it causes or hastens cell necrosis
or immunogenic cell death. In one ment necrolytic cell death is ageous because it
rs, induces the patients (host) immune responses.
Unless the context indicates otherwise, adenovirus as employed herein refers to a replication
capable virus (such as a ation ent virus) and also replication deficient viral vectors.
Replication capable as employed herein refers to a replication competent virus or a virus
whose replication is dependent on a factor in the cancer cells, for example an upregulated factor,
such as p53 or similar.
In one ment the virus is replication competent. Replication competent in the t
of the t specification refers to a virus that possesses all the necessary machinery to ate
in cells in vitro and in vivo, i.e. without the assistance of a packaging cell line. A viral vector, for
example deleted in the E1 region, capable of replicating in a complementary packaging cell line is
not a replication competent virus in the present context.
Viral vectors are replication deficient and require a packaging cell to provide a
complementary gene to allow replication.
Adenovirus genome as employed herein means the DNA sequence encoding the structural
proteins and elements relevant to the function/life cycle of an adenovirus.
All human adenovirus genomes examined to date have the same general organisation i.e.,
the genes encoding specific functions are located at the same position in the viral genome (referred
to herein as structural elements). Each end of the viral genome has a short sequence known as the
inverted terminal repeat (or ITR), which is required for viral replication. The viral genome ns
five early transcription units (E1A, ElB, E2, E3, and E4), three delayed early units (IX, IVa2 and E2
late) and one late unit (major late) that is processed to generate five families of late mRNAs (Ll-L5).
Proteins encoded by the early genes are primarily involved in replication and modulation of the host
cell response to infection, whereas the late genes encode viral ural proteins. Early genes are
prefixed by the letter E and the late genes are prefixed by the letter L.
The genome of adenoviruses is tightly packed, that is, there is little non-coding sequence,
and therefore it can be difficult to find a suitable location to insert transgenes. The present inventors
have identified two DNA regions where transgenes are tolerated, in particular the sites identified
are suitable for accommodating cated transgenes, such as those encoding antibodies. That is,
the transgene is expressed without adversely affecting the virus' viability, native properties such as
oncolytic properties or ation.
In one embodiment the oncolytic or partial oncolytic virus according to the sure may
be as a result ofdeletion in the E4 and/or E3 , for example d in part ofthe E4 region or
fully deleted in the E3 region, or alternatively deleted in part of the E4 region (such as E4orf4) and
fully deleted in the E3 region, for example as exemplified in the sequences disclosed herein.
In one ment the oncolytic virus of the disclosure is ic. Chimeric as employed herein
refers to virus that comprises DNA from two or more different serotypes and has oncolytic virus
properties.
In one embodiment the oncolytic virus is EnAd or an active derivate thereof which retains the
essential beneficial properties of the virus. EnAd is disclosed in WO2005/118825 porated herein by
reference) and the full sequence for the virus is ed herein SEQ ID NO: 38. The chimeric E2B region
is disclosed herein as SEQ ID NO: 71.
Alternative oncolytic viruses include OvAd1 and OvAd2, which are respectively disclosed as SEQ
ID NO: 2 and 3 in WO2008/080003 and incorporated herein by reference.
Advantageously, the adenoviruses of the present disclosure exhibit similar virus activity, for
example replication and/or infectivity, profiles to EnAd following infection of a variety of different colon
cancer cell lines in vitro.
STRUCTURAL ELEMENTS OF ADENOVIRUSES
The present disclosure also relates to the novel sequences of viruses or viral
components/constructs, such as plasmids, disclosed herein.
In one embodiment, the adenovirus comprises a genome comprising the ce of formula (I)
’ITR-B1-BA-B2-BX-BB-BY-B3-3’ITR (I)
wherein: B1 comprises E1A, E1B or E1A-E1B; BA comprises E2B-L1-L2-L3-E2A-L4; B2 is a bond or
comprises E3; BX is a bond or a DNA sequence comprising a restriction site, one or more transgenes (in
particular a transgene encoding at least one bispecific T-cell activator according to the present disclosure,
for example under the control of an exogenous promoter) or both; BB comprises L5; BY is a bond or a
DNA sequence comprising: a restriction site, one or more enes (in particular a transgene encoding
at least one bispecific T-cell activator according to the present disclosure, for example under the control
of an endogenous promoter, such as the MPL or under the control of an exogenous er, such as
the CMV promoter) or both; B3 is a bond or ses E4; wherein at least one of BX and BY is not a bond
and comprises a transgene or a restriction site or both; and encodes a multispecific antigen le
comprising at least two binding s and at least one of the said domains is specific for a surface
antigen on a T cell of interest. In one embodiment, the irus comprises a genome sing the
sequence of a (I) wherein B1 BX is a bond.
In one embodiment, the adenovirus comprises a genome comprising the sequence of a (I)
wherein: BY is a bond.
In one embodiment, the adenovirus comprises a genome comprising the sequence of formula
(Ia) :
’ITR-BA-B2-BX-BB-BY-B3-3’ITR (Ia)
wherein: BA comprises E2B-L1-L2-L3-E2A-L4; B2 is a bond or comprises E3; BX is a bond or a DNA
sequence comprising a restriction site, one or more enes (in particular a transgene encoding at
least one bispecific T-cell activator ing to the present disclosure, for example under the control of
an exogenous promoter) or both; BB comprises L5; BY is a bond or a DNA sequence comprising: a
restriction site, one or more transgenes (in particular a transgene encoding at least one bispecific T-cell
activator according to the present disclosure, for example under the control of an endogenous promoter,
such as the MPL or under the control of an exogenous promoter, such as the CMV promoter) or both; B3
is a bond or comprises E4; wherein at least one of B X and BY is not a bond and at least one comprises a
transgene or a restriction site, such as a transgene.
In one ment, the adenovirus ses a genome comprising the sequence of formula
(Ia) whereinBX is a bond.
In one embodiment the adenovirus comprises a genome comprising the sequence of formula (Ia)
n BY is a bond.
In one embodiment, the adenovirus comprises a genome comprising the sequence of formula
(Ib) :
’ITR-BA-BX-BB-BY-B3-3’ITR (Ib)
wherein: BA comprises E2B-L1-L2-L3-E2A-L4; BX is a bond or a DNA sequence comprising a restriction
site, one or more transgenes (in ular a transgene encoding at least one bispecific T-cell activator
according to the present disclosure, for example under the control of an exogenous promoter) or both;
BB comprises L5; BY is a bond or a DNA sequence comprising: a restriction site, one or more transgenes
(in particular a transgene encoding at least one bispecific T-cell activator ing to the present
disclosure, for example under the control of an endogenous promoter, such as the MPL or under the
control of an exogenous promoter, such as the CMV promoter) or both; B3 is a bond or ses E4;
wherein at least one of BX and BY is not a bond and comprises a transgene or a restriction site or both,
such as a ene.
In one embodiment, the adenovirus comprises a genome comprising the sequence of formula
(Ib) whereinBX is a bond.
In one embodiment, the adenovirus comprises a genome comprising the ce of formula
(Ib) wherein BY is a bond.
In one embodiment, the adenovirus comprises a genome comprising the sequence of formula
(Ic) :
’ITR-BA-B2-BX-BB-BY-3’ITR (Ic)
n: BA comprises -L2-L3-E2A-L4; B2 is E3; BX is a bond or a DNA sequence comprising a
restriction site, one or more transgenes (in particular a transgene encoding at least one bispecific T-cell
activator according to the present disclosure, for example under the control of an exogenous
promoter)or both; BB comprises L5; BY is a bond or a DNA ce comprising: a restriction site, one or
more enes (in particular a transgene encoding at least one bispecific T-cell activator according to
the present disclosure, for example under the control of an endogenous promoter, such as the MPL or
under the control of an exogenous promoter, such as the CMV promoter) or both; wherein at least one
of BX and BY is not a bond and comprises a transgene or a restriction site or both, such as a transgene.
In one ment, the adenovirus comprises a genome comprising the ce of formula
(Ic) wherein BX is a bond.
In one embodiment, the adenovirus comprises a genome comprising the sequence of formula
(Ic) whereinBY is a bond.
In one embodiment the adenovirus comprises a genome comprising the ce of formula
(Id) :
’ITR-B1-BA-BX-BB-BY-B3-3’ITR (Id)
wherein: B1 comprises E1A, E1B or E1A-E1B; BA comprises E2B-L1-L2-L3-E2A-L4; BX is a bond or a DNA
sequence comprising a restriction site, one or more transgenes (in particular a transgene encoding at
least one bispecific T-cell activator according to the t disclosure, for e under the control of
an ous promoter) or both; BB comprises L5; BY is a bond or a DNA sequence comprising: a
restriction site, one or more transgenes (in particular a transgene encoding at least one bispecific T-cell
activator according to the present sure, for example under the control of an endogenous promoter,
such as the MPL or under the control of an exogenous promoter, such as the CMV promoter) or both; B3
is a bond or comprises E4; wherein at least one of B X and BY is not a bond and comprises a transgene a
restriction site or both.
In one embodiment the adenovirus comprises a genome sing the sequence of formula (Id)
wherein BX is a bond.
In one embodiment the adenovirus comprises a genome comprising the sequence of formula (Id)
whereinB Y is a bond.
In one embodiment the adenovirus ses a genome sing the sequence of formula
(Ie) :
’ITR-B1-BA-B2- BB-BY-3’ITR (Ie)
wherein: B1 comprises E1A, E1B or E1A-E1B; BA comprises E2B-L1-L2-L3-E2A-L4; B2 comprises E3;; BB
comprises L5; BY is a bond or a DNA ce comprising: one or more transgenesencoding at least one
bispecific T-cell activator ing to the present disclosure (for e under the l of an
endogenous promoter, such as the MPL or under the control of an exogenous promoter, such as the CMV
er); wherein at least one of BX and BY is not a bond and comprises a transgene a restriction site
or both.
In one embodiment there is provided a compound of formula (I), (Ia), (Ib), (Ic), (Id) or (Ie) wherein
BX and BY is not a bond and comprises a transgene a restriction site or both, such as BX and BY are both
a transgene.
In one embodiment of formula (I), (Ia), (Ib), (Ic) or (Id) only BX encodes one or two bispecific T-cell
activators, for example one ific T-cell activator (and BY does not encode a bispecific T-cell
activator), in particular said bispecific T-cell activator or bispecific T-cell activators are under the control
of an exogenous promoter, such as the CMV promoter. In one embodiment of formula (I), (Ia), (Ib), (Ic)
or (Id) only BY encodes one or two bispecific T-cell activators, for example one bispecific T-cell activator
(and BX does not encode a bispecific T-cell activator), in particular said bispecific T-cell activator or
bispecific T-cell activators are under the control of an endogenous promoter, such as the MPL or under
the control of an exogenous promoter, such as a CMV promoter. In one embodiment of formula (I), (Ia),
(Ib), (Ic) or (Id) BX encodes a bispecific T-cell tor (for example under the control of an exogenous
promoter such as a CMV promoter) and BY encodes a ific T-cell tor (for example under the
control of an endogenous promoter, such as the MPL or under the control of an exogenous promoter
such as a CMV promoter).
A bond refers to a covalent bond connecting one DNA sequence to another DNA sequence, for
example connecting one section of the virus genome to r. Thus when a variable in formula (I) (Ia),
(Ib), (Ic), (Id) or (Ie) herein represents a bond the feature or element represented by the bond is absent
i.e. deleted.
As the structure of adenoviruses is, in general, similar the elements below are discussed in terms
of the structural elements and the commonly used nomenclature referring thereto, which are known to
the skilled person. When an element is referred to herein then we refer to the DNA sequence encoding
the element or a DNA sequence encoding the same structural protein of the element in an adenovirus.
The latter is relevant because of the redundancy of the DNA code. The viruses’ preference for codon
usage may need to be considered for optimised results.
Any structural element from an adenovirus ed in the viruses of the present sure
may comprise or consist of the natural sequence or may have similarity over the given length of at least
95%, such as 96%, 97%, 98%, 99% or 100%. The original sequence may be modified to omit 10%, 9%, 8%,
7%, 6%, 5%, 4%, 3%, 2% or 1% of the genetic material. The skilled person is aware that when making
changes the g frames of the virus must be not disrupted such that the expression of structural
proteins is disrupted.
In one ment the given t is a full-length sequence i.e. the full-length gene.
In one embodiment the given element is less than a full-length and retains the same or
corresponding function as the full-length sequence.
In one embodiment for a given element which is optional in the constructs of the present
disclosure, the DNA sequence may be less than a full-length and have no functionality.
The structural genes encoding structural or functional ns of the adenovirus are lly
linked by non-coding regions of DNA. Thus there is some flexibility about where to “cut” the genomic
sequence of the ural element of st (especially ding regions f) for the purpose of
inserting a transgene into the viruses of the present disclosure. Thus for the purposes of the present
specification, the element will be considered a structural element of nce to the extent that it is fit
for purpose and does not encode extraneous material. Thus, if appropriate the gene will be associated
with suitable non-coding s, for example as found in the natural structure of the virus.
Thus in one embodiment an , such as DNA encoding a restriction site and/or transgene, is
inserted into a non-coding region of genomic virus DNA, such as an intron or intergenic sequence. Having
said this some non-coding regions of adenovirus may have a function, for example in alternative splicing,
transcription regulation or translation regulation, and this may need to be taken into consideration.
The sites identified herein, that are associated with the L5 region (for example between L5 and
the E4 region), are suitable for accommodating a variety of DNA sequences encoding complex entities
such as RNAi, cytokines, single chain or multimeric proteins, such as dies, such as a bispecific T-cell
activator.
Gene as employed herein refers to coding and any non-coding sequences ated therewith,
for example introns and associated exons. In one embodiment a gene comprises or consists of only
essential structural components, for example coding region.
Below follows a sion relating to specific structural ts of adenoviruses.
The Inverted Terminal Repeat (ITR) sequences are common to all known adenoviruses and
were so named because of their symmetry, and are the viral chromosome origins of replication.
r property of these sequences is their y to form a hairpin.
The 5'ITR as employed herein refers to part or all of an ITR from the 5' end ofan adenovirus,
which retains the function of the ITR when incorporated into an adenovirus in an appropriate
location. In one embodiment the 5'ITR comprises or consists of the sequence from about 1bp to
138bp of SEQ ID NO: 38 or a ce 90, 95, 96, 97, 98 or 99% identical thereto along the whole
length, in particular the sequence consisting of from about 1bp to 138bp of SEQ ID NO: 38.
The 3'ITR as employed herein refers to part or all of an ITR from 3' end of an irus
which retains the function of the ITR when orated into an adenovirus in an appropriate
location. In one embodiment the 3'ITR comprises or consists of the sequence from about 32189bp
to 32326bp of SEQ ID NO: 38 or a sequence 90, 95, 96, 97, 98 or 99% identical thereto along the
whole , in particular the sequence consisting of from about 32189bp to 32326bp of SEQ ID
NO: 38.
B1 as employed herein refers to the DNA sequence encoding: part or all of an E1A from an
adenovirus, part or all of the E13 region of an adenovirus, and independently part or all of E1A and
E13 region ofan adenovirus.
When B1 is a bond then E1A and E13 sequences will be omitted from the virus. In one
embodiment B1 is a bond and thus the virus is a vector.
In one embodiment B1 further comprises a transgene. It is known in the art that the E1
region can accommodate a transgene which may be inserted in a disruptive way into the E1 region
(i.e. in the "middle" of the sequence) or part or all of the E1 region may be deleted to provide more
room to accommodate genetic material.
E1A as employed herein refers to the DNA ce encoding part or all of an adenovirus
E1A region. The latter here is referring to the polypeptide/protein E1A. It may be mutated such that
the protein encoded by the E1A gene has conservative or nservative amino acid changes, such
that it has: the same function as wild-type (i.e. the corresponding non-mutated protein); increased
function in comparison to wild-type protein; decreased function, such as no function in comparison
to wild-type protein; or has a new function in comparison to wild-type protein or a ation of
the same as riate.
ElB as employed herein refers to the DNA sequence ng part or all of an adenovirus
ElB region (i.e. polypeptide or protein), it may be mutated such that the n encoded by the E13
gene/region has conservative or non-conservative amino acid changes, such that it has: the same
function as wild-type (i.e. the corresponding non-mutated protein); increased function in
comparison to wild-type protein; decreased function, such as no function in comparison to wild-type
protein; or has a new function in comparison to wild-type protein or a combination of the same as
appropriate.
Thus B1 can be modified or unmodified relative to a wild-type E1 region, such as a ype
E1A and/or ElB. The d person can easily identify r E1A and/or ElB are present or
40 (part) deleted or mutated.
Wild-type as employed herein refers to a known adenovirus. A known adenovirus is one
that has been identified and named, regardless of whether the ce is available.
In one embodiment B1 has the sequence from 139bp to 3932bp of SEQ ID NO: 38.
BA as employed herein refers to the DNA ce encoding the EZB-Ll-LZ-L3-E2A-L4
regions including any non-coding sequences, as appropriate. lly this sequence will not
comprise a transgene. In one embodiment the sequence is substantially similar or identical to a
contiguous sequence from a known adenovirus, for example a pe shown in Table 1, in
ular a group B virus, for e Ad3, Ad7, Ad11, Ad14, Ad16, Ad21, Ad34, Ad35, Ad51 or a
combination thereof, such as Ad3, Ad11 or a combination thereof In one embodiment is -
L2-L3-E2A-L4 refers to comprising these elements and other structural elements associated with
the region, for example BA will generally include the sequence encoding the protein IV2a, for
example as follows: IV2A IV2a-EZB-L1-L2-L3-E2A-L4
In one embodiment the EZB region is chimeric. That is, comprises DNA sequences from two
or more different adenoviral serotypes, for e from Ad3 and Ad11, such as Ad11p. In one
embodiment the EZB region has the sequence from 5068bp to 10355bp of SEQ ID NO: 38 or a
sequence 95%, 96%, 97%, 98% or 99% identical thereto over the whole length.
In one embodiment the EZB in component BA comprises the sequences shown in SEQ ID NO:
71 (which ponds to SEQ ID NO: 3 disclosed in W02005/118825).
In one embodiment BA has the sequence from 3933bp to 27184bp of SEQ ID NO: 38.
E3 as employed herein refers to the DNA sequence encoding part or all ofan adenovirus E3
region (i.e. protein/polypeptide), it may be mutated such that the protein encoded by the E3 gene
has conservative or non-conservative amino acid changes, such that it has the same function as wild-
type (the corresponding unmutated protein); increased function in comparison to wild-type protein;
decreased function, such as no function in ison to wild-type n or has a new function in
comparison to wild-type protein or a combination ofthe same, as appropriate.
In one embodiment the E3 region is form an adenovirus serotype given in Table 1 or a
combination thereof, in particular a group B serotype, for example Ad3, Ad7, Ad11 (in ular
Ad11p), Ad14, Ad16, Ad21, Ad34, Ad35, Ad51 or a combination thereof, such as Ad3, Ad11 (in
particular Ad11p) or a combination thereof.
In one embodiment the E3 region is partially deleted, for example is 95%, 90%, 85%, 80%,
75%, 70%, 65%, 60%, 55%, 50%, 45%, 40%, 35%, 30%, 25%, 20%, 15%, 10%, 5% deleted.
In one embodiment B2 is a bond, wherein the DNA ng the E3 region is absent.
In one embodiment the DNA encoding the E3 region can be replaced or interrupted by a
transgene. As employed herein "E3 region replaced by a transgene as employed herein includes part
or all of the E3 region is replaced with a transgene.
In one embodiment the B2 region comprises the sequence from 27185bp to 28165bp of SEQ
ID NO: 38.
In one embodiment B2 ts ofthe sequence from p to 28165bp ofSEQ ID NO: 38.
BX as employed herein refers to the DNA sequence in the vicinity ofthe 5' end ofthe L5 gene
40 in 33. In the vicinity ofor proximal to the 5' end ofthe L5 gene as employed herein refers to: adjacent
(contiguous) to the 5' end of the L5 gene or a non-coding region ntly associated herewith i.e.
abutting or contiguous to the 5' prime end of the L5 gene or a non-coding region inherently
associated ith. Alternatively, in the vicinity of or proximal to may refer to being close the L5
gene, such that there are no coding sequences between the BX region and the 5' end of L5 gene.
Thus in one ment BX is joined directly to a base of L5 which represents, for example
the start ofa coding sequence of the L5 gene.
Thus in one ment BX is joined directly to a base of L5 which represents, for example
the start of a non-coding sequence, or joined directly to a non-coding region naturally associated
with L5. A non-coding region naturally associated L5 as employed herein refers to part of all of a
non-coding regions which is part of the L5 gene or contiguous therewith but not part of another
gene.
In one embodiment BX comprises the sequence of SEQ ID NO: 39. This sequence is an
artificial non-coding ce wherein a DNA ce, for example comprising a transgene (or
transgene cassette), a restriction site or a combination thereof may be inserted therein. This
ce is advantageous because it acts as a buffer in that allows some flexibility on the exact
location of the transgene whilst minimising the disruptive effects on virus stability and viability.
The insert(s) can occur anywhere within SEQ ID NO: 39 from the 5' end, the 3' end or at any
point between bp 1 to 201, for example between base pairs 1/2, 2/3, 3/4, 4/5, 5/6, 6/7, 7/8, 8/9,
9/10, 10/11, 11/12, 12/13, 13/14, 14/15, 15/16, 16/17, 17/18, 18/19, 19/20, 20/21, 21/22,
22/23, 23/24, 24/25, 25/26, 26/27, 27/28, 28/29, 29/30, 30/31, 31/32, 32/33, 33/34, 34/35,
35/36, 36/37, 37/38, 38/39, 39/40, 40/41, 41/42, 42/43, 43/44, 44/45, 45/46, 46/47, 47/48,
48/49, 49/50, 50/51, 51/52, 52/53, 53/54, 54/55, 55/56, 56/57, 57/58, 58/59, 59/60, 60/61,
61/62, 62/63, 63/64, 64/65, 65/66, 66/67, 67/68, 68/69, 69/70, 70/71, 71/72, 72/73, 73/74,
74/75, 75/76, 76/77, 77/78, 78/79, 79/80, 80/81, 81/82, 82/83, 83/84, 84/85, 85/86, 86/87,
87/88, 88/89, 89/90, 90/91, 91/92, 92/93, 93/94, 94/95, 95/96, 96/97, 97/98, 98/99, 99/100,
100/101,101/102,102/103,103/104,104/105,105/106,106/107,107/108,108/109,109/110,
110/111,111/112,112/113,113/114,114/115,115/116,116/117,117/118,118/119,119/120,
120/121,121/122,122/123,123/124,124/125,125/126,126/127,127/128,128/129,129/130,
130/131,131/132,132/133,133/134,134/135,135/136,136/137,137/138,138/139,139/140,
140/141,141/142,142/143,143/144,144/145,145/146,146/147,147/148,148/149,150/151,
151/152,152/153,153/154,154/155,155/156,156/157,157/158,158/159,159/160,160/161,
161/162,162/163,163/164,164/165,165/166,166/167,167/168,168/169,169/170,170/171,
171/172,172/173,173/174,174/175,175/176,176/177,177/178,178/179,179/180,180/181,
181/182,182/183,183/184,184/185,185/186,186/187,187/188,189/190,190/191,191/192,
192/193, 193/194,194/195,195/196, 7,197/198,198/199, 0 or 200/201.
In one embodiment BX comprises SEQ ID NO: 39 with a DNA ce inserted between bp
27 and bp 28 or a place ponding to between positions 28192bp and 28193bp of SEQ ID NO:
In one embodiment the insert is a restriction site . In one embodiment the restriction
site insert comprises one or two restriction sites. In one embodiment the restriction site is a 19bp
40 restriction site insert comprising 2 restriction sites. In one embodiment the restriction site insert is
a 9bp restriction site insert comprising 1 restriction site. In one embodiment the restriction site
insert comprises one or two restriction sites and at least one transgene, for example one or two
transgenes. In one embodiment the ction site is a 19bp restriction site insert comprising 2
ction sites and at least one transgene, for e one or two transgenes. In one embodiment
the restriction site insert is a 9bp restriction site insert comprising 1 restriction site and at least one
transgene, for example one, two or three transgenes, such as one or two. In one embodiment two
restriction sites sandwich one or more, such as two transgenes (for example in a transgene cassette).
In one embodiment when BX comprises two restrictions sites the said restriction sites are different
from each other. In one embodiment said one or more restrictions sites in BX are non-naturally
occurring in the particular adenovirus genome into which they have been ed. In one
embodiment said one or more restrictions sites in BX are different to other restrictions sites located
elsewhere in the adenovirus genome, for example ent to naturally occurring restrictions sites
and/or restriction sites introduced into other parts of the , such as a restriction site
introduced into By. Thus in one embodiment the restriction site or sites allow the DNA in the section
to be cut specifically.
Advantageously, use of "unique" restriction sites provides selectivity and control over the
where the virus genome is cut, simply by using the appropriate restriction enzyme.
Cut specifically as employed herein refers to where use of an enzyme specific to the
restriction sites cuts the virus only in the d location, y one on, although
occasionally it may be a pair of locations. A pair of locations as employed herein refers to two
restrictions sites in proximity of each other that are designed to be cut by the same enzyme (i.e.
cannot be differentiated from each .
In one embodiment the restriction site insert is SEQ ID NO: 50.
In one embodiment BX has the sequence from 28166bp to 28366bp of SEQ ID NO: 38.
In one embodiment BX is a bond.
In one embodiment BX comprises a restriction site, for example 1, 2, 3 or 4 restriction sites,
such as 1 or 2. In one embodiment BX comprises at least one transgene, for example 1 or 2
transgenes. In one embodiment BX comprises at least one transgene, for example 1 or 2 transgenes
and one or more ction sites, for example 2 or 3 restriction sites, in particular where the restrict
sites sandwich a gene or the DNA ce comprising the genes to allow it/them to be specifically
excised from the genome and/or replaced. Alternatively, the restriction sites may sandwich each
gene, for example when there are two transgenes three ent restriction sites are ed to
ensure that the genes can be ively excised and/or replaced. In one embodiment one or more,
for example all the transgenes are in the form a transgene cassette. In one embodiment BX
comprises SEQ ID NO: 39. In one embodiment SEQ ID NO: 39 is interrupted, for example by a
transgene. In embodiment SEQ ID NO: 39 is uninterrupted. In one embodiment BX does not
se a restriction site. In one embodiment BX is a bond. In one ment Bx comprises or
consists of one or more transgenes.
In one embodiment BY comprises a restriction site, for example 1, 2, 3 or 4 restriction sites,
such as 1 or 2. In one embodiment BY comprises at least one transgene, for example 1 or 2
40 transgenes. In one embodiment BY comprises at least one transgene, for example 1 or 2 transgenes
and one or more restriction sites, for example 2 or 3 restriction sites, in particular where the restrict
WO 41838
sites sandwich a gene or the DNA sequence comprising the genes to allow it/them to be specifically
d from the genome and/or replaced. Alternatively the restriction sites may sandwich each
gene, for example when there are two enes three different restriction sites are ed to
ensure that the genes can be selectively excised and/or ed. In one embodiment one or more,
for example all the transgenes are in the form a transgene cassette. In one embodiment BY
comprises SEQ ID NO: 40. In one embodiment SEQ ID NO: 40 is interrupted, for example by a
transgene. In embodiment SEQ ID NO: 40 is uninterrupted. In one embodiment BY does not
comprise a restriction site. In one embodiment BY is a bond. In one ment BY comprises or
consists ofone or more transgenes.
In one embodiment BX and BY each comprises a restriction site, for example 1, 2, 3 or 4
restriction sites, such as 1 or 2. In one embodiment BX and BY each comprises at least one transgene,
for example 1 or 2 transgenes. In one embodiment BX and BY each comprises at least one transgene,
for example 1 or 2 transgenes and one or more restriction sites, for example 2 or 3 restriction sites,
in particular where the restriction sites sandwich a gene or the DNA sequence comprising the genes
to allow it to be specifically excised from the genome and/or replaced. Alternatively the restriction
sites may sandwich each gene, for e when there are two transgenes three ent restriction
sites are required to ensure that the genes can be selectively excised and/or replaced. In one
embodiment one or more, for example all the transgenes are in the form a transgene cassette. In
one embodiment BX and BY comprises SEQ ID NO: 39 and SEQ ID NO: 40 respectively. In one
embodiment BX and BY do not comprise a restriction site. In one embodiment BX is a bond and BY
is not a bond. In one embodiment BY is a bond and BX is not a bond.
BB as employed herein refers to the DNA sequence encoding the L5 region. As ed
herein the L5 region refers to the DNA sequence containing the gene encoding the fibre
polypeptide/protein, as appropriate in the context. The fibre gene/region encodes the fibre protein
which is a major capsid component of adenoviruses. The fibre functions in receptor recognition and
contributes to the adenovirus' ability to selectively bind and infect cells.
In viruses of the present disclosure the fibre can be from any adenovirus strain of pe
11, such as Ad11p.
In one embodiment BB has the sequence from 28367bp to 29344bp ofSEQ ID NO: 38.
DNA sequence in relation to BY as employed herein refers to the DNA ce in the vicinity
of the 3' end of the L5 gene of 33. In the ty of or proximal to the 3' end of the L5 gene as
employed herein refers to: adjacent (contiguous) to the 3' end of the L5 gene or a non-coding region
ntly associated therewith i.e. abutting or contiguous to the 3' prime end of the L5 gene or a
non-coding region inherently associated therewith (i.e. all or part of an non-coding sequence
endogenous to L5). Alternatively, in the vicinity of or proximal to may refer to being close the L5
gene, such that there are no coding sequences between the BY region and the 3' end of the L5 gene.
Thus, in one embodiment BY is joined directly to a base of L5 which represents the "end" of
a coding sequence.
Thus, in one embodiment BY is joined directly to a base of L5 which represents the "end" of
40 a non-coding ce, or joined directly to a non-coding region naturally associated with L5.
Inherently and naturally are used interchangeably herein. In one embodiment BY comprises
the sequence of SEQ ID NO: 40. This sequence is a non-coding sequence wherein a DNA sequence,
for example sing a transgene (or ene cassette), a restriction site or a combination
thereof may be inserted. This sequence is advantageous because it acts a buffer in that allows some
flexibility on the exact location of the transgene whilst minimising the disruptive effects on virus
stability and viability.
The insert(s) can occur anywhere within SEQ ID NO: 40 from the 5' end, the 3' end or at any
point between bp 1 to 35, for example between base pairs 1/2, 2/3, 3/4, 4/5, 5/6, 6/7, 7/8, 8/9,
9/10, 10/11, 11/12, 12/13, 13/14, 14/15, 15/16, 16/17, 17/18, 18/19, 19/20, 20/21, 21/22,
22/23, 23/24, 24/25, 25/26, 26/27, 27/28, 28/29, 29/30, 30/31, 31/32, 32/33, 33/34, or 34/35.
In one embodiment BY comprises SEQ ID NO: 40 with a DNA sequence inserted between
positions bp 12 and 13 or a place corresponding to 29356bp and p in SEQ ID NO: 38. In one
embodiment the insert is a restriction site insert. In one embodiment the ction site insert
comprises one or two restriction sites. In one embodiment the restriction site is a 19bp restriction
site insert comprising 2 restriction sites. In one embodiment the restriction site insert is a 9bp
restriction site insert comprising 1 restriction site. In one embodiment the restriction site insert
comprises one or two restriction sites and at least one ene, for example one or two or three
transgenes, such as one or two transgenes. In one embodiment the ction site is a 19bp
ction site insert comprising 2 restriction sites and at least one transgene, for example one or
two transgenes. In one embodiment, the restriction site insert is a 9bp restriction site insert
comprising 1 restriction site and at least one transgene, for example one or two transgenes. In one
ment two restriction sites sandwich one or more, such as two transgenes (for example in a
transgene cassette). In one embodiment when BY ses two ctions sites the said
restriction sites are different from each other. In one embodiment said one or more restrictions
sites in BY are non-naturally occurring (such as unique) in the particular adenovirus genome into
which they have been inserted. In one ment said one or more restrictions sites in BY are
different to other restrictions sites located elsewhere in the irus genome, for example
different to naturally occurring restrictions sites or restriction sites introduced into other parts of
the genome, such as BX- Thus, in one embodiment the restriction site or sites allow the DNA in the
section to be cut specifically.
In one embodiment, the restriction site insert is SEQ ID NO: 51.
In one embodiment BY has the sequence from 29345bp to 29379bp of SEQ ID NO: 38.
In one embodiment BY is a bond.
In one embodiment, the insert is after bp 12 in SEQ ID NO: 40.
In one embodiment ,the insert is at about position 29356bp ofSEQ ID NO: 38.
In one embodiment, the insert is a transgene cassette comprising one or more transgenes,
for e 1, 2 or 3, such as 1 or 2.
E4 as ed herein refers to the DNA sequence encoding part or all of an adenovirus E4
region (i.e. polypeptide/protein region), which may be mutated such that the protein d by
40 the E4 gene has conservative or non-conservative amino acid changes, and has the same function as
ype (the corresponding non-mutated protein); increased function in comparison to wild-type
protein; decreased function, such as no function in comparison to wild-type protein or has a new
function in comparison to wild-type protein or a combination of the same as appropriate. In one
embodiment the E4 region has E4orf4 deleted.
In one ment the E4 region is partially deleted, for example is 95%, 90%, 85%, 80%,
75%, 70%, 65%, 60%, 55%, 50%, 45%, 40%, 35%, 30%, 25%, 20%, 15%, 10% or 5% deleted. In
one embodiment the E4 region has the sequence from 32188bp to 29380bp of SEQ ID NO: 38.
In one embodiment B3 is a bond, i.e. wherein E4 is absent.
In one embodiment 133 has the sequence consisting of from 32188bp to 29380bp of SEQ ID
NO: 38.
As employed herein number ranges are inclusive of the end points.
The skilled person will appreciate that the elements in the formulas herein, such as a
(I), (la), (Ib), (Ic), (Id) and (Ie) are contiguous and may embody non-coding DNA sequences as well
as the genes and coding DNA ces (structural features) ned herein. In one or more
embodiments, the formulas of the present disclosure are attempting to describe a lly
ing sequence in the adenovirus genome. In this context, it will be clear to the skilled person
that the formula is referring to the major elements characterising the relevant section of genome
and is not intended to be an exhaustive description of the genomic h of DNA.
E1A, ElB, E3 and E4 as employed herein each independently refer to the wild-type and
equivalents thereof, d or partially deleted forms of each region as described herein, in
particular a wild-type sequence from a known adenovirus.
"Insert" as employed herein refers to a DNA sequence that is orated either at the 5'
end, the 3' end or within a given DNA sequence reference segment such that it interrupts the
reference sequence. The latter is a reference sequence employed as a reference point relative to
which the insert is located. In the context of the present disclosure inserts generally occur within
either SEQ ID NO: 10 or SEQ ID NO: 11. An insert can be either a restriction site insert, a transgene
cassette or both. When the sequence is interrupted the virus will still comprise the original
sequence, but generally it will be as two fragments sandwiching the insert.
In one embodiment the transgene or transgene cassette does not comprise a non-biased
ing transposon, such as a TN7 transposon or part thereof. Tn7 transposon as employed herein
refers to a non-biased insertion transposon as described in W02008/080003.
In one embodiment one or more restrictions sites in BX and BY are independently ed
from a restriction site specific to an enzyme described , for example NotI, FseI, AsiSI, ngl and
Sbe, in particular the restriction sites inserted are all different, such as sites specific for NotI and
sites ic for FseI located in BX and ngl and 5be located in By.
As discussed above in one embodiment the region BX and/or BY do not comprise a
restriction site. Advantageously, the viruses and constructs of the present disclosure can be
prepared without restriction sites, for example using synthetic techniques. These techniques allow
a great flexibility in the creation of the viruses and constructs. Furthermore, the present inventors
have established that the properties of the viruses and constructs are not shed when they are
40 ed by tic techniques.
Promoters
Promoter as employed herein means a region of DNA that initiates transcription of a
particular gene or genes. Promoters are generally located proximal to the genes they transcribe, on
the same strand and am (i.e. 5') on the DNA. Proximal as employed in this context means
sufficiently close to function as a promoter. In one embodiment, the promoter is within 100 bp of
the transcription start site. Thus, endogenous promoter as employed herein refers to a promoter
that naturally occurs in (i.e. is native to) the adenovirus (or construct) into which the transgene, is
being inserted. In one or more embodiments, the endogenous promoter employed is the naturally
occurring promoter in the virus in its al location in the virus genome, in particular this is the
primary or only promoter employed in the expression of the transgene or transgenes. In one
embodiment the endogenous promoter used to promote the translation and optionally the
transcription of the transgene is one nt, i.e. is one integrated in the genome ofthe adenovirus
and not previously introduced by inant techniques.
Under the control of an endogenous promoter as ed herein refers to where the
transgene/transgene cassette is inserted in the appropriate orientation to be under the control of
said endogenous promoter. That is, where the promoter is generally on the antisense strand, the
cassette is ed, for example in the antisense orientation.
Having said this, genes can be expressed in one of two ations. However, lly one
orientation provides sed levels of expression over the other orientation, for a given
(particular) transgene.
In one ment, the cassette is in the sense ation. That is, is ribed in a 5' to 3'
direction. In one embodiment, the cassette is in the antisense orientation. That is, transcribed in the
3' to 5' orientation.
The endogenous promoters in the virus can, for example, be utilised by employing a gene
encoding a transgene and a splice acceptor sequence. Thus in one embodiment the cassette will
comprise a splice acceptor sequence when under the control of an endogenous promoter. Thus in
one embodiment the coding sequence, for example the sequence encoding the antibody or antibody
binding fragment further comprises a splice acceptor sequence.
In one embodiment the transgene, transgenes, or transgene cassette are under the control
of an E4 promoter or a major late er, such as the major late promoter (ML promoter).
Under the l of as employed herein means that the transgene is activated, i.e.
transcribed, when a particular promoter dictates.
The Major Late Promoter (ML er or MLP) as employed herein refers to the
adenovirus promoter that controls expression of the "late expressed" genes, such as the L5 gene.
The MLP is a "sense strand" promoter. That is, the promoter influences genes that are downstream
of the promoter in the 5'-3' direction. The major late promoter as employed herein refers the
original major late promoter located in the virus genome.
E4 er as employed herein refers to the adenovirus promoter of the E4 region. The E4
region is an antisense region; therefore the er is an antisense promoter. That is, the promoter
40 is upstream of the E4 region in the 3'-5' direction. Therefore any transgene te under control
of the E4 promoter may need to be oriented appropriately. In one ment the cassette under
the control of the E4 promoter is in the antisense orientation. In one embodiment the cassette is
under the control of the E4 promoter in the sense orientation. The E4 promoter as employed herein
refers to the original E4 promoter located in the virus genome.
Thus in one embodiment there is provided a replication competent oncolytic irus
serotype 11 (such as Ad11p) or virus-derivative thereof wherein the fibre, hexon and capsid are
serotype 11 (such as Ad11p), wherein the virus genome comprises a DNA sequence encoding a
therapeutic antibody or dy-binding fragment (such as a bispecific T-cell activator), wherein
said DNA ce under the control of a promoter endogenous to the irus selected from
consisting of E4 and the major late promoter (i.e. the E4 promoter or the major late promoter), such
that the transgene does not interfere with virus replication, for example is associated with the L5
region (i.e. before or after said region), such as located after L5 in the virus genome, in particular
located between L5 and the E4 region.
In one ment, an endogenous promoter is introduced into the viral genome at a
desired location by recombinant techniques, for example is introduced in the transgene cassette.
r, in the context of the present specification this arrangement will generally be ed to
as an exogenous er.
In one embodiment, the transgene cassette comprises an exogenous promoter. Exogenous
promoter as employed herein refers to a promoter that is not naturally occurring in the adenovirus
into which the transgene is being ed. Typically, exogenous promoters are from other s
or are mammalian promoters. Exogenous promoter as employed herein means a DNA element,
usually located upstream of the gene of interest, that regulates the ription of the gene.
In one embodiment, the regulator of gene expression is an exogenous promoter, for example
CMV (cytomegalovirus promoter), CBA (chicken beta actin promoter) or PGK hoglycerate
kinase 1 promoter), such as CMV promoter.
In one embodiment, the CMV ous promoter employed has the nucleotide sequence of
SEQ ID NO: 52. In one embodiment the PGK ous promoter employed has the nucleotide
sequence of SEQ ID NO: 53. In one ment the CBA exogenous promoter employed has the
tide sequence of SEQ ID NO: 54.
In one embodiment there is provided a replication competent oncolytic adenovirus serotype
11 (such as Ad11p) or virus-derivative f wherein the fibre, hexon and capsid are serotype 11
(such as Ad11p), wherein the virus genome comprises a DNA sequence encoding a therapeutic
antibody or antibody-binding fragment (such as a bispecific T-cell activator ing to the t
disclosure) located in a part of the virus genome which is expressed late in the virus replication cycle
and such that the transgene does not interfere with virus replication, wherein said DNA ce
under the control of a promoter ous to the adenovirus (for example the CMV promoter). In
one embodiment the DNA sequence encoding an antibody or fragment (such as a bispecific T-cell
activator according to the present disclosure) is associated with the L5 region as described
elsewhere herein, in particular located between L5 and E4 region.
In one embodiment, the exogenous promoter is an antigen-presenting cell promoter.
Antigen-presenting cell promoter as employed herein refers to a promoter for a gene that is
selectively expressed by antigen-presenting cells, such as dendritic cells or macrophages. Such
genes e but are not limited to: FLT-3, FLT-3 ligand, TLRs, CD1a, CD1c, CD11b, CD11c, CD80,
CD83, CD86, CD123, CD172a, CD205, CD207, CD209, CD273, CD281, CD283, CD286, CD289, CD287,
CXCR4, GITR Ligand, IFN-oc2, IL-12, IL-23, ILT1, ILT2, ILT3, ILT4, ILT5, ILT7, TSLP Receptor, CD141,
CD303, CADM1, CLEC9a, XCR1 or CD304; antigen processing and presentation mediators such as
CTIIA or GILT. Thus in one embodiment the ous promoter is le for selective expression
of transgenes in said antigen-presenting cells.
Other Regulatory Sequences
"Regulator of gene expression" (or regulator/regulatory element) as employed herein refers
to a genetic feature, such as a promoter, enhancer or a splice acceptor sequence that plays a role in
gene expression, typically by initiating or enhancing transcription or translation.
"Splice acceptor sequence", "splice or" or "splice site" as employed herein refers to a
regulatory sequence determining when an mRNA molecule will be recognised by small nuclear
ribonucleoproteins of the spliceosome complex. Once led the spliceosome catalyses splicing
between the splice or site of the mRNA molecule to an upstream splice donor site producing
a mature mRNA molecule that can be translated to produce a single polypeptide or protein.
Different sized splice acceptor sequences may be employed in the present invention and
these can be described as short splice or (small), splice acceptor (medium) and branched
splice acceptor (large).
SSA as employed herein means a short splice acceptor, typically comprising just the splice
site, for example 4 base pairs. SA as employed herein means a splice acceptor, typically comprising
the short splice acceptor and the polypyrimidine tract, for example 16 bp. bSA as employed herein
means a branched splice acceptor, typically comprising the short splice or, polypyrimidine
tract and the branch point, for example 26 base pairs.
In one embodiment, the splice acceptor employed in the constructs of the disclosure are
shown in SEQ ID NO: 55 to 57. In one embodiment, the SSA has the nucleotide sequence of SEQ ID
NO: 55. In one embodiment the SA has the nucleotide sequence of SEQ ID NO: 56. In one
embodiment the bSA has the nucleotide sequence of SEQ ID NO: 57. In one embodiment the splice
acceptor ce is independently selected from the group comprising: TGCTAATCTT
CCTTTCTCTC TTCAGG (SEQ ID NO: 57), CCTTTCTCTCTT CAGG (SEQ ID NO: 56), and CAGG (SEQ ID
NO: 55).
In one embodiment the splice site is immediately ded (i.e. followed in a 5' to 3'
direction) by a consensus Kozak sequence comprising CCACC. In one embodiment the splice site
and the Kozak ce are interspersed by up to 100 or less base pairs. In one embodiment the
Kozak sequence has the nucleotide sequence of SEQ ID NO: 58.
Typically, when under the control of an endogenous or exogenous promoter (such as an
endogenous promoter), the coding sequence will be ately ed by a Kozak sequence.
The start ofthe coding region is indicated by the initiation codon (AUG), for example is in the t
of the sequence (gcc)gccRccAUGg [SEQ ID NO: 59] the start of the "start" of the coding sequences is
40 indicated by the bases in bold. A lower case letter denotes common bases at this position (which
can nevertheless vary) and upper case letters indicate highly-conserved bases, i.e. the 'AUGG'
sequence is constant or rarely, if ever, changes; 'R' indicates that a purine (adenine or guanine) is
usually observed at this position and the sequence in ts (gcc) is of uncertain significance. Thus
in one embodiment the initiation codon AUG is incorporated into a Kozak sequence.
al Ribosome Entry DNA Sequence as employed herein refers to a DNA sequence
encoding an Internal me Entry Sequence (IRES). IRES as employed herein means a nucleotide
sequence that allows for initiation of translation a messenger RNA (mRNA) ce, including
tion starting within an mRNA sequence. This is particularly useful when the cassette encodes
polycistronic mRNA. Using an IRES results in a polycistronic mRNA that is translated into multiple
individual proteins or peptides. In one embodiment the Internal Ribosome Entry DNA sequence has
the nucleotide sequence of SEQ ID NO: 60. In one embodiment a particular IRES is only used once
in the genome. This may have ts with respect to stability of the .
“High self-cleavage efficiency 2A peptide” or “2A peptide” as employed herein refers to a
peptide which is efficiently cleaved following translation. le 2A peptides include P2A, F2A, E2A
and T2A. The present inventors have noted that once a specific DNA sequence encoding a given 2A
peptide is used once, the same ic DNA sequence may not be used a second time. However,
redundancy in the DNA code may be utilised to generate a DNA sequence that is translated into the
same 2A peptide. Using 2A peptides is ularly useful when the cassette encodes polycistronic
mRNA. Using 2A peptides results in a single polypeptide chain being translated which is modified
post-translation to generate multiple individual proteins or peptides.
In one embodiment the d P2A peptide employed has the amino acid sequence of SEQ
ID NO: 61. In one embodiment the encoded F2A peptide employed has the amino acid sequence of
SEQ ID NO: 62. In one embodiment the encoded E2A peptide employed has the amino acid sequence
of SEQ ID NO: 63. In one embodiment the d T2A peptide employed has the amino acid
sequence of SEQ ID NO: 64.
In one embodiment an mRNA or each mRNA encoded by a transgene(s) comprise a
polyadenylation signal sequence, such as typically at the end of an mRNA sequence, for example as
shown in SEQ ID NO: 65. Thus one embodiment the transgene or the transgene te comprises
at least one sequence encoding a polyadenylation signal sequence.
“PolyA”, denylation signal” or “polyadenylation sequence” as employed herein means
a DNA sequence, usually containing an AATAAA site, that once ribed can be recognised by a
multiprotein complex that cleaves and polyadenylates the nascent mRNA molecule.
In one embodiment the enylation sequence has the nucleotide sequence of SEQ ID NO:
In one ment the construct does not include a polyadenylation sequence. In one
embodiment the regulator of gene expression is a splice acceptor sequence.
In one embodiment the sequence encoding a protein/polypeptide/peptide, such as an
antibody or antibody fragment (such as a bispecific T-cell activator according to the present
disclosure) further comprises a polyadenylation signal.
Molecules encoded by ene
As described herein the at least one transgene in the virus encodes a bispecific T-cell activator,
wherein one binding domain is ic for T cell surface antigen. The second g domain may target
and suitable antigen, for example a pathogen antigen, a cancer antigen, a stromal antigen.
Cancer ns (also referred to as tumor antigens) are one category of particular interest and
include for example selected from CEA, MUC-1, EpCAM, HER receptors HER1, HER2, HER3, HER4, PEM,
A33, G250, carbohydrate antigens Ley, Lex, Leb, PSMA, TAG-72, STEAP1, CD166, CD24, CD44, E-cadherin,
SPARC, ErbB2, ErbB3, WT1, MUC1, LMP2, idiotype, HPV E6&E7, EGFRvIII, HER-2/neu, MAGE A3, p53
nonmutant, p53 mutant, NY-ESO-1, GD2, PSMA, PCSA, PSA, MelanA/MART1, Ras mutant, proteinase3
(PR1), bcr-abl, tyrosinase, in, PSA, hTERT, particularly WT1, MUC1, HER-2/neu, -1, survivin
and hTERT.
Stromal antigens include fibroblast antigens for example those bed herein such as FAP,
tumor associated hage antigens, and myeloid derived suppressor cell antigens, for example
include CD163, CD206, CD68, CD11c, CD11b, CD14, CSF1 receptor, CD15, CD33 and CD66b.
The targets list below may, if appropriate, be encoded in bispecific T-cell activator according to
the present disclore or alternatively may be provided as a further eutic transgene, or both.
In one embodiment, the transgene or transgenes independently encode a protein, peptide, RNA
molecule, such as an RNA molecule. ageously the transgene can be delivered intra-cellularly and
can subsequently be ribed and if appropriate translated. Examples of genetic material encoded by
a transgene e, for example antibodies or binding fragments thereof, chemokines, cytokines,
immunmodulators, enzymes (for example capable of converting pro-drug in the active agent) and an
RNAi molecule.
Peptide as employed herein refers to an amino acid sequence of 2 to 50 residues, for e 5
to 20 residues. ptide as employed herein refers to an amino acid sequence of more than 50
residues t tertiary structure, in particular without secondary and tertiary structure. Protein refers
to an amino acid sequence of more than 50 residues, with secondary and/or tertiary structure, in
particular with second and tertiary structure.
In one embodiment, the coding sequence s a therapeutic RNA, therapeutic peptide,
therapeutic polypeptide or therapeutic protein (i.e. is a eutic gene).
Immunomodulator gene or transgene as employed here means a gene that encodes a peptide or
n molecule that can atively or quantitatively modify an activity or activities of cells of the
immune system.
Therapeutic gene as employed herein means a gene that encodes an entity that may be useful in
the treatment, amelioration or prevention of disease, for example the gene expresses a therapeutic
protein, polypeptide, peptide or RNA, which at least slows down, halts or reverses the progression of a
disease, such as .
In one embodiment the entity encoded by the ene when transcribed or translated in a cell,
such as a cancer cell, increases production of danger signals by the cell. “Danger signals” as employed
herein refers to a variety of molecules produced by cells undergoing injury, stress or non-apoptotic death
that act as alarm signals, for example by stimulating cells of the innate immune system to respond directly
as well as serving to enhance activation of cells of the adaptive immune system.
It is known that the microenvironment of tumours often changes such that natural human
immune responses are down regulated. Thus the ability to re-start the immune responses from within
the tumour is potentially very interesting in the treatment of cancer.
In one embodiment the encoded therapeutic e or n is designed to be ed into
the extracellular nment. In one embodiment the functional RNA, peptide, ptide or protein,
such as the antibody is released into the external microenvironment of the cell, for e into the
culture supernatant, or in vivo: tissue, stroma, circulation, blood and/or lymphatic system.
In one embodiment the peptide, polypeptide or protein (including a bispecific T-cell activator
according to the present sure), encoded by the transgene, comprises a signal sequence. Signal
peptide as employed herein refers to a short 13-36 residue peptide sequence d at the N-terminal
of proteins which assist the entry of the protein into the secretory pathway for secretion or ne
expression. In one embodiment, the leader sequence (signal peptide) has the amino acid sequence of
SEQ ID NO: 66 or 67.
In another embodiment the encoded therapeutic peptide or protein, such as an antibody is
designed to be expressed as a membrane-anchored form in the surface membrane of the cell, for
example by including encoding a transmembrane domain in the protein or a site for attachment of a lipid
membrane anchor. Generally the bispecific T-cell activator or bispecific T-cell activators of the present
sure are not expressed as a cell surface anchor format.
In one embodiment the functional RNA, peptide, polypeptide or protein, such as an antibody is
released from the cell infected by the adenovirus, for example by active ion or as a result of cell
lysis. Thus in one embodiment the adenovirus lyses the cell, thereby releasing the functional RNA,
peptide, polypeptide or protein, such as the antibody.
In another embodiment the encoded further therapeutic peptide or protein, such as an antibody
is designed to be retained within the intact cell.
Advantageously, functional RNA, peptide, polypeptide or protein, such as dies expressed
by adenoviruses of the present disclosure can be detected in tissue in vivo as both mRNA and antibody
protein. Furthermore, the expressed onal RNA, peptide or protein, such as the antibody can bind
its ligand in ELISA. Yet further, the functional RNA, peptide, polypeptide or n, such as the antibody
is detectable early (e.g. within 3 days of infection) and the expression is sustained over l weeks.
In one embodiment adenoviruses of the present disclosure express functional RNA, peptide,
polypeptide or protein, such as antibodies within about 3 days or more of infection, such as within about
36, 48, 60 or 72 hours, or such as 2, 3, 4, 5 or 6 days.
In one embodiment adenoviruses of the present disclosure express functional RNA, peptide,
polypeptide or protein, such as antibodies for several weeks, such as about 1, 2, 3, 4, 5 or 6 weeks. Such
as 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35,
36, 37, 38, 39, 40, 41 or 42 days.
Advantageously, functional RNA, peptide or protein expression, such as antibody expression is
sufficiently high to be able to detect the functional RNA, peptide, polypeptide or protein, such as the
dy in the blood.
In one ment, functional RNA, peptide or protein, such as antibodies expressed by the
adenovirus of the present disclosure enter the blood stream and/or tic system.
In one embodiment, the irus of the present disclosure is an oncolytic virus which has an
enhanced therapeutic index for cancer cells.
In one embodiment, the coding sequence further encodes functional RNA, for example
therapeutic RNA.
Functional RNA as employed herein refers to RNA which has a on other than to encode a
protein or e and includes for examples include RNA constructs suitable for inhibiting or reducing
gene activity, ing RNAi, such as shRNA and miRNA. shRNA as employed herein refers to short
hairpin RNA which is a sequence of RNA that makes a tight hairpin turn that can be used to silence target
gene sion via RNA interference (RNAi). miRNA RNA) as employed herein refers to a small
non-coding RNA molecule (containing about 22 nucleotides) which functions, via base-pairing with
complementary sequences within mRNA molecules, to regulate gene expression at the riptional or
post-transcriptional level. mRNA strands bound by miRNA are ed because they can no longer be
translated into proteins by ribosomes, and such complexes are often actively disassembled by the cell.
In one embodiment, the transgene encodes a protein. Protein as employed herein includes a
protein ligand, a protein receptor, or an antibody molecule.
Protein ligand as ed herein refers to cell surface membrane or secreted proteins binding
fragments thereof, that bind to or otherwise engage with the cellular receptors to influence the function
of the cell, for example by stimulating intracellular signalling and modulating gene transcription within
the cell. In one embodiment the protein expressed is engineered to be expressed on the surface of the
cell and/or secreted from the cell.
In one embodiment the protein encoded is a bi-specific antibody, such as a bispecific T-cell
activator.
In one embodiment the transgene further encodes an enzyme, for example an enzyme that
assists in degrading the extra-cellular matrix of the , for example a DNAse, a collagenase, a matrix
metalloproteinase (such as MMP2 or 14) or similar.
Suitable dies and dy fragments may be agonistic or antagonistic and include those
with anticancer activity and those which modify host cell ses to the cancer, for example: an agonist
or antagonistic antibody or antibody fragment may se vascularization or normalise vascularization
of the tumour. In one embodiment agonistic antibodies or other encoded proteins may render the host
cell more visible to the host’s innate and adaptive immune responses, for example by expressing
antigens, danger signals, nes or chemokines to attract and activate the same, or by binding to costimulatory
or checkpoint pathway molecules to enhance adaptive immune responses.
Therapeutic antibody or dy-binding nt as employed herein refers to antibody or
antibody-binding fragment which, when inserted in to the oncolytic virus, has a beneficial impact on a
pathology in the patient, for example on the cancer being treated.
Beneficial impact as employed herein refers to a desirable and/or advantageous effect of the
antibody being expressed in vivo.
Classes of therapeutic antibodies and antibody-binding fragments include: anti-EGF
antibodies, anti-VEGF antibodies, anti-PDGF antibodies, anti-CTLA antibodies, anti-PD1 antibodies,
DLl antibodies and anti-FGF antibodies.
ered therapeutic antibodies suitable for incorporation into viruses of the present
disclosure include: abciximab, adalimumab, alemtzumab, basiliximab, mab, bevacizumab,
brentuximab vedotin, canakinumab, cetuximab, certolzumab, daclizumab, denosumab, eculzumab,
efalixumab, umab, mab, ibritumomab tiuxetan, infliximab, ipilimumab, muromonab-
CD3, ofatumumab, zumab, panitumumab, ranibizumab, rituximab, zumab, tositumomab
and trastuzumab.
In one ment, the antibody le region sequences of an antibody or antibody
fragment employed are between 95 and 100% similar or identical to the le regions of
bevacizumab (also known as n®), such as 96, 97, 98 or 99% similar or identical.
Also suitable for incorporation into s of the present disclosure are the coding
sequences for those antibodies and binding fragments thereof which are approved for a cancer
indications, for example trastuzumab, tositumomab, rituximab, panitumumab, ofatumumab,
ipilimumab, ibritumomab tiuxetan, gemtuzumab, denosumab, cetuximab, brentuximab vedotin,
n and adalimumab.
In one embodiment, the antibody variable region sequences of an antibody or antibody
fragment employed are between 95 and 100% similar or identical to the le regions of a known
antibody or an antibody disclosed herein.
As used herein "antibody molecule" includes antibodies and g fragments thereof.
Antibody as employed herein generally refers to a full length antibody and bispecific or
multi-specific formats comprising the same.
Antibody-binding fragments includes an antibody fragment able to target the antigen with
the same, similar or better specificity to the original "antibody" from which it was derived. Antibody
fragments include: Fab, modified Fab, Fab', modified Fab', F(ab')2, Fv, single domain antibodies (e.g.
VH or VL or VHH), scFv, bi, tri or tetra-valent dies, Bis-scFv, diabodies, triabodies, tetrabodies
and epitope-binding nts of any of the above (see for example Holliger and Hudson, 2005,
Nature Biotech. 23(9):1126-1136; Adair and Lawson, 2005, Drug Design Reviews - Online 2(3), 209-
217). The methods for creating and manufacturing these antibody fragments are well known in the
art (see for example Verma et al., 1998, Journal of Immunological Methods, 216, 165-181). Other
antibody fragments for use in the present invention e the Fab and Fab' fragments bed in
international patent applications W02005/003 169, W02005/003 170 and W02005/003171. Multi-
valent antibodies may comprise multiple specificities e.g. bispecific or may be monospecific (see for
example WO 92/22853, W005/113605, W02009/040562 and /035012).
Specific as employed herein is intended to refer to an antibody or nt that only
recognises the antigen to which it is specific or to an antibody or fragment that has significantly
40 higher binding affinity to the antigen to which is specific in comparison to its binding affinity to
antigens to which it is not specific, for e 5, 6, 7, 8, 9, 10 times higher binding affinity.
Known antibodies or antibody-binding fragments can be employed to generate alternative
antibody formats with the same CDRs or the same variable regions, for example, a full-length
antibody can readily be converted into a Fab, Fab' or scFv nt.
A wide range of different forms of antibody may be employed in constructs of the present
disclosure including antibody molecules from non-human animals, human antibody molecules,
humanised antibody molecules and chimeric antibody molecules.
In one embodiment, the antibody or binding fragment is monoclonal. Monoclonal antibodies
may be prepared by any method known in the art such as the hybridoma technique (Kohler &
Milstein, 1975, Nature, 256:495-497), the trioma technique, the human B-cell hybridoma que
(Kozbor et al., 1983, Immunology Today, 4:72) and the EBV—hybridoma technique (Cole et al.,
Monoclonal Antibodies and Cancer Therapy, pp77-96, Alan R Liss, Inc., 1985).
In one embodiment, the antibody or binding fragment is non-human, i.e. completely from
man . This is possible because the antibodies and fragments can be delivered inside
the cancer cell by the virus.
In one embodiment the antibody is chimeric, for example has human constant (s) and
non-human variable regions.
In one embodiment, the dy or binding fragment is human, i.e. from completely human
origin.
In one embodiment, the antibody or binding fragment is humanised. Humanised antibodies
(which include CDR-grafted antibodies) are antibody molecules having one or more
complementarity determining regions (CDRs) from a non-human species and a framework region
from a human globulin molecule (see, for example US 5,585,089; WO91/09967). It will be
appreciated that it may only be necessary to transfer the specificity determining residues of the
CDRs rather than the entire CDR (see for example, Kashmiri et al., 2005, Methods, 36, 25-34).
Humanised dies may optionally further comprise one or more framework residues derived
from the non-human species, for example from which the CDRs were derived.
In one embodiment, the coding sequence encodes an antibody heavy chain an antibody light
chain or an antibody nt. Heavy chain (HC) as employed herein refers to the large ptide
subunit of an antibody. Light chain (LC) as employed herein refers to the small ptide subunit
of an antibody. In one embodiment, the dy light chain comprises a CL domain, either kappa
or lambda.
Antibodies for use in the present sure may be ed using any suitable a method
known in the art. The antigen polypeptide/protein including fusion proteins, including cells
(recombinantly or naturally) expressing the polypeptide (such as activated T cells) can be used to
produce antibodies which specifically ise the antigen. The polypeptide may be the e'
polypeptide or a ically active fragment or derivative thereof.
Screening for antibodies can be performed using assays to measure binding to antigen
and/or assays to measure the ability to antagonise the receptor. An example ofa binding assay is an
ELISA, in ular, using a fusion protein (optionally comprising a reporter), which is immobilized
40 on plates, and employing a conjugated ary antibody to detect anti-antigen antibody bound to
the fusion protein.
The constant region domains of the antibody molecule of the present invention, if present,
may be selected having regard to the proposed function of the antibody molecule, and in particular
the effector functions which may be required. For e, the constant region s may be
human IgA, IgD, IgE, IgG or IgM domains. In particular, human IgG constant region domains may be
used, especially of the IgG1 and IgG3 isotypes when the antibody molecule is intended for
therapeutic uses and antibody effector functions are required. atively, IgG2 and IgG4 isotypes
may be used when the antibody molecule is intended for therapeutic purposes and antibody effector
functions are not ed, e.g. for simply agonising activity or for target neutralization. It will be
appreciated that sequence variants of these nt region domains may also be used. For example
IgG4 molecules in which the serine at position 241 has been changed to e as described in Angal
et al., Molecular Immunology, 1993, 30 (1), 105-108 may be used.
For certain antibody ons, for example for delivering activation signals to cells bearing
the antibody’s target molecule, such as cells of the immune system, it may be advantageous to use
ne-anchored versions of the antibody such that the antibody will be expressed on the
surface of the expressing cell. Such cell surface expressed binding molecules enable efficient
multimeric interactions between the target signalling molecule on the surface of another cell which
enhances delivery of activation signals from the target molecule into the recipient cell.
Advantageously, the adenoviruses of the present disclosure can express full length
antibodies, antibody fragments such as scFvs, multispecific antibodies, in ular bispecific
antibodies such as bispecific T-cell activators as described herein.
In one embodiment the sequence encoding the antibody or antibody fragment (such as a
bispecific T-cell activator according to the present disclosure) comprise or further comprises an
internal ribosome entry sequence. al ribosome entry sequence (IRES) as employed herein
means a nucleotide sequence that allows for translation initiation in the middle of a messenger RNA
(mRNA) sequence.
In one embodiment the encoded therapeutic ns or peptides are target specific
proteins, polypeptides or peptides.
Target specific proteins or peptides as employed herein refers to either the target proteins
themselves, or different proteins or peptides that directly bind (for example are specific to the
target) to or otherwise modify the levels of the target proteins or es. An example of the former
would be a cytokine, whilst an e of the latter would be an antibody against that ne.
s of interest generally relate to ular cells, ar products, antigens or
ling pathways associated with disease, particularly cancer. Target, depending on the context,
also s to mRNA or r transcribed from the gene encoding the protein or polypeptide,
which for example can be inhibited by RNAi type technology. Thus, in the context of RNA, such as
RNAi technology the target is the mRNA which is encoded by the gene of the target.
Examples of targets of interest include, but are not limited to, stimulatory T-cell co-receptors
and ligands thereto, checkpoint inhibitory T-cell co-receptor molecules and ligands thereto,
receptors and ligands thereto sed by regulatory T-cells, myeloid derived suppressor cells and
immunosuppressive immune cells, dendritic cell and n-presenting cell receptors and ligands
thereto, antigen processing and tation mediators, cytokines and cytokine receptors,
chemokines and chemokine receptors, transcription factors and regulators of transcription,
intracellular trafficking molecules and regulators of cell function, tumour cell and tumour
microenvironmental receptors and products, ellular tumour cell enzymes such as IDO,
antigens for recognition by immune cells.
Thus in one embodiment target as employed herein refers to a protein or polypeptide which
can, for example be inhibited, neutralised or activated by, for example an antibody or binding
fragment there, as appropriate. Target in the t of cytokines refers to a cytokine per se or an
antibody or binding fragment thereof specific to the cytokine. Thus, the virus may encode and
express the cytokine itself as e of f may stimulate "host" immune responses. In the
context of ligands, mutated forms of the ligand can be encoded by the virus which e with the
l ligand to bind the receptor. The mutated ligand may have increased binding affinity for the
receptor, for example such that it has a slow te thereby occupying the receptor and increasing
or decreasing signalling therefrom. Alternatively, the activity of the d ligand may be reduced
in comparison to the wild-type ligand, y reducing the binding and overall activity through the
receptor from the natural ligand.
In one embodiment, the virus or construct according to the present disclosure encodes a pro-
drug, an immunomodulator and/or an enzyme.
Pro-drug as employed herein means a molecule that is administered as an inactive (or less
than fully active) derivative that is subsequently converted to an active cological agent in the
body, often through normal metabolic processes. A pro-drug serves as a type of precursor to the
intended drug. A pro-drug converting enzyme serves as the enzyme that converts a pro-drug to its
cologically active form.
Immunomodulator as employed herein means a modulator of immune response.
Immunomodulators function in adjustment of the immune response to a desired level, as in
immunopotentiation, immunosuppression, or induction of immunologic tolerance.
T cells require two signals to become fully activated. A first signal, which is n-specific,
is provided through the T cell receptor which cts with peptide-MHC molecules on the
membrane of antigen presenting cells (APC). A second signal, the co-stimulatory signal, is antigen
nonspecific and is provided by the interaction between co-stimulatory molecules expressed on the
ne of APC and the T cell. Thus, co-stimulatory molecule as employed herein means a
molecule that provides a complementary signal to the n-specific signal required by T cells for
activation, proliferation and survival. Examples of co-stimulatory molecules include but are not
limited to CD28, CD80, CD86, CD83 and 4-1BB.
Enzyme as employed herein means a nce that acts as a catalyst in living sms,
regulating the rate at which chemical ons proceed without itself being altered in the process.
The following is a non-exhaustive discussion of exemplary target peptides/polypeptides and
proteins.
In one embodiment the target is a checkpoint protein, such as an immune checkpoint or cell
cycle checkpoint protein. Examples of checkpoint proteins include but are not limited to: CTLA-4,
PD-1, PD-Ll, PD-LZ, VISTA, B7-H3, B7-H4, HVEM, ILT-Z, ILT-3, ILT-4, TIM-3, LAG-3, BTLA, LIGHT or
40 CD160, for example CTLA-4, PD-1, PD-Ll and PD-LZ. In one embodiment there is ed an
antibody or binding fragment thereofwhich is specific to one ofthe same. Thus in one embodiment
a ene or transgene cassette encodes an antibody or antibody nt specific to , PD-
1, PD-L1 or PD-L2. In one embodiment, the adenovirus expresses an antibody or antibody fragment
ic to CTLA-4, PD-1, PD-L1 or PD-L2.
In one embodiment, the antibody is a checkpoint inhibitor antibody, for example anti-PD-L1.
In one embodiment, the adenovirus expresses full length anti-human PD-L1 dy. In one
embodiment, the expression of full length anti-human PD-L1 antibody is under the control of an
endogenous promoter, such as the major late promoter (MLP), in particular in position BY. In one
embodiment, the adenovirus expresses the scFv form of anti-human PD-L1 antibody. In one
embodiment, the expression of a scFv form of uman PD-L1 antibody is under the control of an
endogenous promoter, such as the Major late promoter, in particular in position BY.
In one embodiment, there is provided a virus or construct according to the t
disclosure encoding an dy or binding fragment thereof, for a full-length antibody or scFv
specific to CTLA-4, for example as exemplified herein.
In one embodiment the target, is one or more independently selected from the group
comprising CD16, CD25, CD33, CD332, CD127, CD31, CD43, CD44, CD162, CD301a, CD301b and
Galectin-3. In one embodiment, there is provided an antibody or binding fragment thereof specific
thereto, for example a full-length antibody or a scFv.
In one embodiment the target, for example which may be ed by an antibody or binding
fragment, is one or more independently selected from the group sing: FLT-3, FLT-3 ligand,
TLRs, TLR ligands, CCR7, CD1a, CD1c, CD11b, CD11c, CD80, CD83, CD86, CD123, CD172a, CD205,
CD207, CD209, CD273, CD281, CD283, CD286, CD289, CD287, CXCR4, GITR Ligand, IFN-α2, IL-12,
IL-23, ILT1, ILT2, ILT3, ILT4, ILT5, ILT7, TSLP Receptor, CD141, CD303, CADM1, CLEC9a, XCR1 and
CD304.
In one embodiment the target, of a bispecific T-cell activator employed in the present
sure, is a tumour cell antigen.
In one embodiment, the target is one or more independently selected from the group
comprising: CEA, MUC-1, EpCAM, HER receptors HER1, HER2, HER3, HER4, PEM, A33, G250,
carbohydrate antigens Ley, Lex, Leb, PSMA, TAG-72, STEAP1, CD166, CD24, CD44, E-cadherin, SPARC,
ErbB2, ErbB3.
In one embodiment the target, of a bispecific T-cell activator employed in the present
disclosure, is a tumour stroma antigen.
In one embodiment, the target of a bispecific T-cell activator employed in the present
sure is one or more independently selected from the group comprising: FAP, TREM1, IGFBP7,
FSP-1, platelet-derived growth -α receptor (PDGFR-α), platelet-derived growth factor-β
receptor (PDGFR-β) and vimentin.
In one ment the , for example which may be targeted by an dy or binding
fragment (such as a bispecific T-cell activator), is a cancer target.
In one embodiment, the target is one or more independently selected from the group
comprising: OX40, OX40 ligand, CD27, CD28, CD30, CD40, CD40 ligand, TL1A, CD70, CD137, GITR, 4-
1BB, ICOS or ICOS , for example CD40 and CD40 ligand.
In one embodiment the transgene cassette s a ligand comprising CD40 or CD40
ligand, or an antibody, dy fragment or shRNA targeted to CD40 or CD40 ligand. In one
embodiment the adenovirus expresses a ligand comprising CD40 or CD40 ligand, or an antibody,
antibody fragment or shRNA targeted to (specific to) CD40 or CD40 ligand.
In one embodiment the target is one or more cytokines independently selected from the
group comprising: IL—loc, IL-1B, IL-6, IL-9, IL-12, IL-13, IL-17, IL-18, IL-22, IL-23, IL-24, IL-25, IL-26,
IL-27, IL-33, IL-35. Interleukin-2 (IL-2), IL-4, IL-5, IL-7, IL-10, IL-15, IL-21, IL-25, IL-1RA, IFNoc,
IFNB, IFNy, TNFoc, TGFB, lymphotoxin a (LTA) and GM-CSF.
In one embodiment the transgene cassette encodes an antibody or antibody nt
specific to IL-12, IL-18, IL-22, IL-7, IL-15, IL-21, IFNoc, IFNy, TNFoc, TGFB or lymphotoxin a (LTA). In
one embodiment the adenovirus expresses IL-12, IL-18, IL-22, IL-7, IL-15, IL-21, IFNoc, IFNy, TNFoc,
TGFB or lymphotoxin a (LTA).
In one embodiment, the amino acid sequence of IFNy is SEQ ID NO: 68. In one embodiment
the amino acid sequence of IFNOL is SEQ ID NO: 69. In one ment the amino acid ce of
TNFoc is SEQ ID NO: 70.
In one embodiment, the target is a ine, for example one or more independently
selected from the group comprising: IL-8, CCL3, CCL5, CCL17, CCL20, CCL22, CXCL9, CXCL10,
CXCL11, CXCL13, , CCL2, CCL19, CCL21, CXCRZ, CCRZ, CCR4, CCR5, CCR6, CCR7, CCR8,
CXCR3, CXCR4, CXCR5 and CRTHZ.
In one embodiment, the transgene cassette encodes an antibody or dy fragment
specific to CCL5, CXCL9, CXCL12, CCL2, CCL19, CCL21, CXCRZ, CCRZ, CCR4 or CXCR4. In the context
of the chemokines target includes where the viruses encodes and expresses the chemokine, for
example to induce or augment host immune responses to the cancer.
In one embodiment, the irus expresses an antibody or dy fragment specific to
CCL5, CXCL9, CXCL12, CCL2, CCL19, CCL21, CXCRZ, CCRZ, CCR4 or CXCR4.
In one embodiment, the target is one or more independently selected from the group
comprising: STAT3, STAT1, STAT4, STAT6, CTIIA, MyD88 and NFKB family members, for example
the protein is targeted with an inhibitor, for example an antibody or bind fragment thereof, or mRNA
transcribed from the relevant gene is inhibited by a mechanism, such as RNAi.
In one embodiment, the target is HSp70 or a regulator of cell survival and death such as
in, for example the protein is targeted with an inhibitor, for example an antibody or bind
fragment thereof, or mRNA transcribed from the relevant gene is inhibited by a mechanism, such as
RNAi.
In one embodiment, the target is one or more independently selected from the group
comprising: egulin, BTC, NRGla, NRGlb, NRG3, TGFoc, LRIGl, LRIG3, EGF, , Epigen,
HB-EGF, EGFR, Her2, Her3 and Her4, for e the protein is targeted with an inhibitor, for
example an antibody or bind fragment thereof, or mRNA transcribed from the relevant gene is
inhibited by a mechanism, such as RNAi.
In one embodiment, the target is a ligand or receptor for one or more ndently selected
40 from the group comprising: hedgehog, FGF, IGF, Wnt, VEGF, TNF, TGFB, PDGF and Notch.
In one embodiment the adenovirus expresses an antibody or antibody fragment ic to VEGF.
In one embodiment the antibody is an anti-VEGF antibody. For example, such as an antibody having the
amino acid sequence of the antibody Bevacizumab or equivalent thereto. In one embodiment the
adenovirus expresses full length anti-human VEGF antibody. In one embodiment, the expression of full
length anti-human VEGF antibody is under the l of an endogenous promoter, such as the Major
late promoter (MLP), in particular in position BY. In one embodiment, the adenovirus expresses the scFv
form of anti-human VEGF antibody. In one embodiment, the expression of the scFv form of anti-human
VEGF antibody is under the control of an nous er, such as the Major late er, in
particular in position BY.
In one embodiment, the target is IDO.
In one embodiment the target is an antigen for recognition by immune cells (such as a T cell
engaged by a bispecific T-cell activator) is one or more proteins or peptides independently selected from
the group comprising: immunogenic proteins from infectious organisms, such as cytomegalovirus
antigens, influenza antigens, hepatitis B surface and core antigens, diphtheria toxoid, Crm197, tetanus
toxoid; peptides derived from such antigens which are known T-cell or antibody epitopes, or genetically
engineered composites or multimers of such antigens; tumour-derived ns as antigens; peptides
derived from such ns which are known T-cell or antibody epitopes; and genetically engineered
composites or multimers of such antigens for example WT1, MUC1, LMP2, idiotype, HPV E6&E7, EGFRvIII,
HER-2/neu, MAGE A3, p53 nonmutant, p53 mutant, NY-ESO-1, GD2, PSMA, PCSA, PSA, gp100, CEA,
MelanA/MART1, Ras mutant, proteinase3 (PR1), bcr-abl, tyrosinase, survivin, PSA, hTERT, particularly
WT1, MUC1, HER-2/neu, NY-ESO-1, in or hTERT.
The skilled person will appreciate that many possibilities exist for nucleic acid sequences that
encode a given amino acid sequence due to codon redundancy, that silent c acid base pair
mutations are tolerated and all nucleic acid ces that encode a given amino acid sequence as
defined in any of the SEQ ID NO’s are envisioned by the present sure.
In one embodiment the peptide, polypeptide or protein encoded by a transgene is a mimotope.
As ed herein a mimotope is a molecule, often a peptide, which mimics the structure of an epitope.
The latter property causes an antibody response similar to the one elicited by the epitope. An antibody
for a given epitope antigen will recognize a mimotope which mimics that epitope. Mimotopes are
commonly obtained from phage display libraries through biopanning. es utilizing mimotopes are
being ped. Thus antibodies of known specificity may be used to screen ies (e.g peptide
ies in phage display – for example Ab sequence libraries or non-antibody peptide libraries,
particularly those optimized for producing peptides with more stable 3D conformations) – Generation of
mimotopes is well described in the art (see Tribbick G, Rodda S. Combinatorial methods for ery of
peptide ligands which bind to antibody-like molecules. J Mol Recognit. 2002 306-10; Masuko T,
Ohno Y, Masuko K, Yagi H, Uejima S, Takechi M, oto Y. Towards eutic antibodies to
membrane oncoproteins by a robust strategy using rats immunized with transfectants expressing target
molecules fused to green fluorescent protein. Cancer Sci. 2011 102(1):25-35).
In one embodiment, a mimotope or other designed vaccine antigens are encoded by a transgene
and expressed in order to induce an antibody response in the recipient patient, wherein the antibodies
induced have the desired therapeutic effect. In one embodiment ptide fusion proteins, with
peptide sequences from desired human ligand, are used to induce anti-self target antibody responses,
for example a e region of PD-L1 that is known to be important for binding to target molecule PD-1
may be genetically linked with GFP or other highly immunogenic foreign carrier proteins such that an
immune antibody response to the peptide es dies that cross-react with the native PDL1
molecule and thus serve to block PD-L1:PD-1 interactions in the same way as directly encoding an anti-
PDL1 antibody would. Concepts for vaccines inducing ant-self therapeutic antibody responses are well
described in the art (see Spohn G, Bachmann MF. Therapeutic vaccination to block receptor-ligand
interactions. Expert Opin Biol Ther. 2003 3(3):469-76; Link A, Bachmann MF. Immunodrugs: breaking B-
but not T-cell tolerance with therapeutic anticytokine vaccines. therapy 2010 2(4):561-74;
Delavallée L, Assier E, Semerano L, Bessis N, Boissier MC. Emerging applications of anticytokine vaccines .
Expert Rev es. 2008 7(10):1507-17).
In one or more embodiments, the transgene employed encodes a sequence shown in any one of
SEQ ID NOs: 2, 4, 7, 11 or 16.
In another embodiment, the transgene employed encodes a ce which excludes the deca-
His affinity tag at the C-terminal end for example as shown in a virus set forth in any one of SEQ ID NOs:
72 to 78.
Advantageously adenoviruses of the present sure express and release dy forms (such
as a ific T-cell activator) and other proteins, such as cytokines, encoded by a transgene therein into
the culture supernatant in vitro or into tumour tissue stroma in vivo. Leader sequences may assist the
encoded proteins/polypeptide or peptide exiting the cancer cell. Therefore, in one embodiment the
encoded “protein” comprises a leader sequence. Leader sequence as employed herein refers to a
polynucleotide sequence located n the promoter sequence and the coding region which can
regulate gene sion at the level of transcription or translation.
In one embodiment the coding sequence encodes a peptide. e as employed herein refers
to an amino acid chain which is not a complete functional protein. Typically, a fragment which retains
some or all of the function of the protein that it is a fragment of, or can be recognized by the immune
system, for example peptides of 8 or more amino acids that can be recognized by T-cells.
In one embodiment, the transgene is a reporter gene encoding, for example an imaging agent
including bioluminescent, scent imaging agents (including activatable scent imaging ),
such as luciferase, GFP or eGFP or red fluorescent protein.
Reporter gene or reporter sequence as employed herein means a gene or DNA sequence that
produces a product easily detected in eukaryotic cells and may be used as a marker to determine the
activity of another gene with which its DNA has been closely linked or combined. Reporter genes confer
characteristics on cells or organisms expressing them that are easily identified and ed, or are
selectable markers. Reporter genes are often used as an indication of whether a certain gene has been
taken up by or expressed in the cell or sm population. Examples of common reporter genes e,
but are not d to, LacZ, luciferase, GFP, eGFP, neomycin phosphotransferase, chloramphenicol
acetyltransferase, sodium iodide symporter (NIS), nitroreductase (e.g. NfsA, NfsB) intracellular
metalloproteins, HSV1-tk or oestrogen receptor.
In one embodiment the genetic material (in particular the transgene) does not encode or
express a reporter gene such as an imaging agent, luciferase, GFP or eGFP.
Viruses according to the present disclosure can be investigated for their preference for a
specific tumour type by examination of its lytic potential in a panel oftumour cells, for example colon
tumour cell lines include HT-29, DLD-1, LSl74T, L81034, SW403, HCT116, SW48, and Colo320DM.
Any available colon tumour cell lines would be equally useful for such an evaluation.
Prostate cell lines include DU145 and PC-3 cells. Pancreatic cell lines include Panc-1 cells.
Breast tumour cell lines include MDA231 cell line and ovarian cell lines include the OVCAR-3 cell
line. Hemopoietic cell lines include, but are not limited to, the Raji and Daudi B-lymphoid cells, K562
erythroblastoid cells, U937 myeloid cells, and HSB2 T-lymphoid cells. Other available tumour cell
lines are equally useful.
The present disclosure also extends to novel sequences disclosed herein. In one
embodiment the virus is shown in any one of sequences disclosed herein, for example any one of
SEQ ID N05: 34 to 37 or a sequence at least 95% identical o, for example as set forth in any
one of SEQ ID N05: 79 to 82.
ations
The present disclosure relates also extends to a pharmaceutical formulation of a virus as
described herein.
In one embodiment there is provided a liquid parenteral formulation, for example for
infusion or ion, of a replication capable oncolytic according to the present disclosure wherein
the formulation provides a dose in the range of 1x1010 to 1x1014 viral particles per volume of dose.
Parenteral ation means a formulation designed not to be delivered through the GI
tract. l parenteral delivery routes include injection, implantation or infusion. In one
embodiment the formulation is provided in a form for bolus delivery.
In one embodiment the parenteral ation is in the form of an injection. Injection
includes intravenous, subcutaneous, intra-tumoural or intramuscular injection. Injection as
employed herein means the insertion of liquid into the body via a syringe. In one ment, the
method of the t disclosure does not involve intra-tumoural injection.
In one ment the parenteral formulation is in the form of an infusion.
Infusion as employed herein means the stration of fluids at a slower rate by drip,
infusion pump, syringe driver or equivalent . In one embodiment, the infusion is stered
over a period in the range of 1.5 minutes to 120 minutes, such as about 3, 4, 5, 6, 7, 8, 9, 10, 11, 12,
13,14 15,16,17,18,19 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 65, 80, 85, 90, 95, 100, 105, 110 or
115 minutes.
In one embodiment one dose of the formulation less than 100mls, for example 30mls, such
as administered by a syringe . In one embodiment one dose of the formulation is less than 10
mls, for example 9, 8, 7, 6, 5, 4, 3, 2 or 1 mls. In one embodiment one dose of the ation is less
than 1 ml, such as 0.9, 0.8, 0.7, 0.6, 0.5, 0.4, 0.3, 0.2 or 0.1 mls.
40 In one embodiment, the injection is administered as a slow injection, for example over a
period of 1.5 to 30 minutes.
In one embodiment, the formulation is for intravenous (iv) administration. This route is
particularly effective for delivery of oncolytic virus because it allows rapid access to the majority of
the organs and tissue and is particular useful for the treatment of metastases, for example
established metastases especially those located in highly vascularised regions such as the liver and
lungs.
Therapeutic formulations typically will be sterile and stable under the conditions of
manufacture and storage. The composition can be formulated as a solution, microemulsion,
liposome, or other parenteral formulation suitable for administration to a human and may be
formulated as a pre-filled device such as a syringe or vial, particular as a single dose.
The formulation will generally comprise a pharmaceutically acceptable diluent or carrier,
for e a non-toxic, isotonic carrier that is compatible with the virus, and in which the virus is
stable for the requisite period of time.
The carrier can be a solvent or dispersion medium ning, for example, water, ethanol,
polyol (for e, glycerol, ene glycol, and liquid polyethylene glycol, and the like), and
suitable mixtures thereof. The proper y can be maintained, for example, by the use of a
sant or surfactant such as lecithin or a non-ionic surfactant such as rbate 80 or 40. In
dispersions the maintenance of the required particle size may be ed by the presence of a
surfactant. Examples of ic agents include sugars, polyalcohols such as mannitol, sorbitol, or
sodium chloride in the composition.
In one embodiment, parenteral formulations employed may comprise one or more of the
following a buffer, for example 4-(2-hydroxyethyl)piperazineethanesulfonic acid, a phosphate
buffer and/or a Tris buffer, a sugar for example dextrose, mannose, sucrose or similar, a salt such as
sodium de, magnesium chloride or potassium chloride, a detergent such as a non-ionic
surfactant such as briji, PS—80, PS—40 or similar. The formulation may also comprise a preservative
such as EDTA or ethanol or a combination of EDTA and ethanol, which are thought to prevent one
or more pathways of possible degradation.
In one embodiment, the formulation will comprise ed oncolytic virus according to the
present disclosure, for example 1x1010 to 1x1014 viral particles per dose, such as 1x1010 to 1x1012
viral particles per dose. In one embodiment the concentration of virus in the ation is in the
range 2 x 108 to 2 x 1014 vp/mL, such as 2 x 1012 vp/ml.
In one embodiment, the parenteral formulation ses glycerol.
In one embodiment, the formulation comprises tic adenovirus as described herein,
HEPES (N-Z-hydroxyethylpiperazine-N'ethanesulfonic acid), glycerol and buffer.
In one embodiment, the parenteral formulation consists of virus of the disclosure, HEPES for
example 5mM, glycerol for example 5-20% (v/v), hydrochloric acid, for example to adjust the pH
into the range 7-8 and water for ion.
In one embodiment 0.7 mL s of the disclosue at a concentration of 2 x 1012 vp/mL is
formulated in 5 mM HEPES, 20% ol with a final pH of 7.8.
A thorough discussion of pharmaceutically able carriers is available in Remington's
40 Pharmaceutical Sciences (Mack Publishing Company, N.]. 1991).
In one embodiment, the formulation is provided as a formulation for topical administrations
including inhalation.
Suitable inhalable ations include inhalable powders, ng aerosols containing
propellant gases or inhalable solutions free from propellant gases. Inhalable powders according to
the disclosure will generally contain a virus as described herein with a physiologically acceptable
excipient.
These inhalable s may include monosaccharides (e.g. glucose or arabinose),
disaccharides (e.g. lactose, saccharose, maltose), oligo- and polysaccharides (e.g. dextranes),
polyalcohols (e.g. sorbitol, ol, xylitol), salts (e.g. sodium chloride, calcium carbonate) or
mixtures of these with one another. Mono- or disaccharides are suitably used, the use of lactose or
glucose, particularly but not exclusively in the form of their hydrates.
Particles for deposition in the lung require a particle size less than 10 microns, such as 1-9
microns for example from 0.1 to 5 pm, in particular from 1 to 5 pm. The le size ofthe carrying
the virus is of primary importance and thus in one embodiment the virus according to the t
disclosure may be adsorbed or absorbed onto a particle, such as a lactose particle of the given size.
The propellant gases which can be used to prepare the ble aerosols are known in the
art. Suitable propellant gases are selected from among hydrocarbons such as n-propane, n-butane
or isobutane and halohydrocarbons such as nated and/or fluorinated derivatives of methane,
ethane, propane, , cyclopropane or utane. The mentioned lant gases may
be used on their own or in mixtures thereof.
Particularly suitable propellant gases are halogenated alkane derivatives selected from
among TG 11, TG 12, TG 134a and TG227. Of the abovementioned halogenated arbons,
TG134a ,2-tetrafluoroethane) and TG227 (1,1,1,2,3,3,3-heptafluoropropane) and mixtures
thereof are particularly suitable.
The lant gas-containing inhalable aerosols may also contain other ingredients, such as
cosolvents, stabilisers, e-active agents (surfactants), antioxidants, lubricants and means for
adjusting the pH. All these ingredients are known in the art.
The lant gas-containing inhalable aerosols according to the invention may contain up
to 5 % by weight of active substance. Aerosols according to the invention contain, for e, 0.002
to 5 % by weight, 0.01 to 3 % by weight, 0.015 to 2 % by weight, 0.1 to 2 % by weight, 0.5 to 2 % by
weight or 0.5 to 1 % by weight of active ingredient.
Alternatively topical administrations to the lung may also be by administration of a liquid
solution or suspension formulation, for example employing a device such as a nebulizer, for example,
a nebulizer connected to a compressor (e.g., the Pari LC-Iet Plus(R) nebulizer connected to a Pari
Master(R) compressor manufactured by Pari Respiratory ent, Inc., Richmond, Va.).
The virus of the invention can be delivered dispersed in a solvent, e.g. in the form of a
solution or a suspension, for example as already described above for parenteral formulations. It can
be suspended in an appropriate physiological solution, e.g., saline or other pharmacologically
acceptable solvent or a buffered solution. Buffered solutions known in the art may contain 0.05 mg
40 to 0.15 mg disodium edetate, 8.0 mg to 9.0 mg NaCl, 0.15 mg to 0.25 mg polysorbate, 0.25 mg to 0.30
mg anhydrous citric acid, and 0.45 mg to 0.55 mg sodium citrate per 1 ml ofwater so as to e a
pH of about 4.0 to 5.0.
The therapeutic suspensions or solution formulations can also contain one or more
excipients. Excipients are well known in the art and include buffers (e.g., citrate buffer, phosphate
buffer, acetate buffer and bicarbonate buffer), amino acids, urea, alcohols, ascorbic acid,
phospholipids, ns (e.g., serum albumin), EDTA, sodium chloride, liposomes, mannitol, sorbitol,
and glycerol. Solutions or suspensions can be encapsulated in liposomes or biodegradable
microspheres. The ation will generally be provided in a substantially sterile form employing
sterile manufacture processes.
This may include production and sterilization by filtration of the buffered solvent/solution
used for the formulation, aseptic suspension of the antibody in the sterile buffered solvent solution
and dispensing of the formulation into sterile receptacles by methods ar to those of ordinary
skill in the art.
Nebulisable formulation according to the present disclosure may be provided, for example,
as single dose units (e.g., sealed plastic containers or vials) packed in foil envelopes. Each vial
contains a unit dose in a volume, e.g., 2 mL, of solvent/solution buffer.
Treatment
In a further aspect, the present disclosure extends to a virus or a formulation thereof as
described herein for use in treatment, in particular for the treatment of cancer.
In one embodiment, the method of treatment is for use in the ent of a , in
particular a solid tumour.
Tumour as employed herein is intended to refer to an abnormal mass of tissue that results
from excessive cell on that is rolled and ssive, also called a neoplasm. Tumours
may be either benign (not cancerous) or malignant. Tumour encompasses all forms of cancer and
metastases.
In one embodiment, the tumour is a solid tumour. The solid tumour may be localised or
metastasised.
In one embodiment, the tumour is of epithelial origin.
In one embodiment, the tumour is a malignancy, such as colorectal cancer, ma,
prostate cancer, pancreatic cancer, breast cancer, ovarian cancer, thyroid cancer, renal cancer,
bladder cancer, head and neck cancer or lung cancer.
In one embodiment, the tumour is a colorectal malignancy.
Malignancy as employed herein means ous cells.
In one embodiment, the oncolytic irus is employed in the treatment or prevention of
metastasis.
In one embodiment, the method or formulation herein is employed in the treatment of drug
resistant cancers.
In one embodiment, the virus is stered in ation with the administration of a
40 further cancer treatment or therapy.
In one embodiment, there is provided a virus or formulation according to the present
sure for use in the manufacture of a medicament for the treatment of cancer, for example a
cancer described above.
In a further aspect, there is provide a method oftreating cancer comprising administering a
therapeutically ive amount of a virus or formulation ing to the present disclosure to a
t in need thereof, for example a human patient.
In one embodiment, the oncolytic virus or formulation herein is administered in
combination with another therapy.
"In combination" as employed herein is intended to encompass where the oncolytic virus is
administered before, concurrently and/or post cancer treatment or therapy.
Cancer therapy includes surgery, radiation therapy, targeted therapy and/or chemotherapy.
Cancer ent as employed herein refers to treatment with a therapeutic compound or biological
agent, for example an antibody intended to treat the cancer and/or maintenance therapy thereof.
In one embodiment, the cancer treatment is selected from any other anti-cancer therapy
including a chemotherapeutic agent, a targeted ncer agent, radiotherapy, radio-isotope
therapy or any ation thereof.
In one embodiment, the virus of the present disclosure such as an oncolytic adenovirus may
be used as a pre-treatment to the therapy, such as a surgery (neoadjuvant therapy), to shrink the
tumour, to treat metastasis and/or prevent metastasis or further metastasis. The tic
adenovirus may be used after the therapy, such as a surgery (adjuvant therapy), to treat metastasis
and/or prevent metastasis or further metastasis.
Concurrently as employed herein is the administration of the additional cancer treatment at
the same time or approximately the same time as the oncolytic adenovirus formulation. The
treatment may be contained within the same formulation or stered as a separate ation.
In one embodiment, the virus is administered in ation with the administration of a
chemotherapeutic agent.
Chemotherapeutic agent as employed herein is intended to refer to specific antineoplastic
chemical agents or drugs that are selectively destructive to malignant cells and s. For example,
ting agents, antimetabolites, anthracyclines, plant alkaloids, omerase inhibitors, and
other antitumour agents. Other examples of chemotherapy include doxorubicin, 5-fluorouracil (5-
FU), axel, tabine, irinotecan, and platins such as cisplatin and oxaliplatin. The preferred
dose may be chosen by the tioner based on the nature of the cancer being treated.
In one embodiment the therapeutic agent is ganciclovir, which may assist in controlling
immune responses and/or tumour vascularisation.
In one embodiment one or more therapies employed in the method herein are metronomic,
that is a continuous or frequent treatment with low doses of anticancer drugs, often given
concomitant with other methods of therapy.
up B oncolytic adenoviruses, in particular Ad11 and those derived therefrom such as
EnAd may be ularly synergistic with chemotherapeutics because they seem to have a
40 mechanism of action that is largely independent of apoptosis, killing cancer cells by a predominantly
necrolytic mechanism. Moreover, the immunosuppression that occurs during chemotherapy may
allow the oncolytic virus to function with greater efficiency.
eutic dose as employed herein refers to the amount of virus, such as oncolytic
adenovirus that is suitable for ing the intended therapeutic effect when ed in a suitable
treatment regimen, for example ameliorates symptoms or conditions of a disease. A dose may be
considered a therapeutic dose in the treatment of cancer or metastases when the number of viral
particles may be sufficient to result in the following: tumour or metastatic growth is slowed or
stopped, or the tumour or metastasis is found to shrink in size, and/or the life span ofthe t is
ed. Suitable therapeutic doses are generally a balance between therapeutic effect and
tolerable toxicity, for example where the side-effect and toxicity are tolerable given the benefit
achieved by the therapy.
In one embodiment, a virus or therapeutic construct according to the present disclosure
(including a ation comprising same) is administered weekly, for example one week 1 the dose
is administered on day 1, 3, 5, followed by one dose each subsequent week.
In one embodiment, a virus or therapeutic construct according to the present disclosure
(including a ation comprising same) is administered bi-weekly or tri-weekly, for example is
administered in week 1 one on days 1, 3 and 5, and on week 2 or 3 is also administered on days 1, 3
and 5 thereof. This dosing regimen may be ed as many times as riate.
In one embodiment, a virus or therapeutic construct according to the t disclosure
(including a formulation comprising same) is administered monthly.
In one embodiment, the viruses and constructs of the present disclosure are prepared by
recombinant techniques. The skilled person will appreciate that the armed adenovirus genome can
be manufactured by other technical means, ing ly synthesising the genome or a plasmid
comprising part of all of the genome. The skilled person will appreciate that in the event of
synthesising the genome the region of insertion may not comprise the restriction site nucleotides as
the latter are artefacts following insertion of genes using cloning methods.
In one embodiment the armed adenovirus genome is entirely synthetically manufactured,
for example as per SEQ ID N05: 34 to 37.
The disclosure herein further extends to an adenovirus of formula (I) or a subformula
thereof, obtained or obtainable from inserting a transgene or ene cassette.
"Is" as employed herein means comprising.
In the t of this specification "comprising" is to be reted as "including".
Embodiments of the invention comprising certain features/elements are also intended to
extend to alternative embodiments "consisting" or "consisting essentially" of the relevant
elements/features.
Where technically appropriate, embodiments of the invention may be combined.
Technical references such as patents and applications are orated herein by reference.
Any embodiments specifically and explicitly recited herein may form the basis of a
disclaimer either alone or in combination with one or more r embodiments.
The present application claims priority from GB1614607.8, GB1700663.6, GB1706219.1 and
GB1713765.4 incorporated herein by reference. These documents may be employed to t
errors in the present ication, in particular an error in the sequence listing.
The present invention is further described by way of illustration only in the following
examples, which refer to the accompanying Figures, in which:
DESCRIPTION OF THE FIGURES
Figure 1 (A) schematic representation of a bispecific T-cell activator antibody of the present
disclosure comprising or lacking an optional decahistidine affinity tag. Ig SP: signal
peptide; 10His: decahistidine affinity tag; L: GS linker; VL: variable light domain; VH
variable heavy domain. (B) plasmid map for pSF-CMV-EpCAMbispecific T-cell
activator. (C) plasmid map for pSF-CMV-FAPbispecific T-cell activator. (D) plasmid
map for pSF-CMV-Controlbispecific T-cell tor.
Figure 2 (A) dot blot showing the quantification of the recombinant bispecific T-cell
activators. (B) shows a graph showing the ELISA results for FAP. (C) graph showing
the ELISA results for EpCAM.
Figure 3 shows a graph showing the expression levels of CD69 (A) and CD25 (B) for T cells
co-cultured alone or with NHDF cells in the presence of FAP bispecific T-cell activator
and control bispecific T-cell activator measured using flow cytometry.
Figure 4 (A) graph showing the levels of IFN γ expression for T cells co-cultured alone or with
NHDF cells in the presence of FAP bispecific T-cell activator and control bispecific T-
cell activator measured by intracellular ne ng. Graphs (B) & (C) show the
expression levels of CD69 and CD25 for T cells co-cultured alone or with DLD cells in
the presence of EpCAM ific T-cell activator and control bispecific T-cell
activator ed using flow cytometry.
Figure 5 (A) graph showing the levels of IFN γ expression for T cells co-cultured with DLD
cells in the presence of EpCAM ific T-cell activator and control bispecific T-cell
activator measured by intracellular cytokine ng. Graphs (B) & (C) showing the
levels of CD69 and CD25 for PBMCs co-cultured with DLD cells in the presence of
EpCAM bispecific T-cell activator and control bispecific T-cell activator measured by
flow cytometry.
Figure 6 (A) graph showing the results of a LDH assay showing the city of NHDF cells
which have been tured with T cells and FAP bispecific T-cell activator or
control bispecific T-cell activator. (B) graph showing the s of a LDH assay
showing the cytoxicity of BTC100 cells which have been co-cultured with T cells and
FAP bispecific T-cell activator or control bispecific T-cell activator. (C) Images of
NHDF cells after co-culture with T cells and FAP bispecific T-cell tor vs control
bispecific T-cell activator.
Figure 7 (A) r plots showing FAP expression in multiple t-derived cells. (B) graph
showing the % of cells expressing EpCAM and FAP across multiple cells and cell lines.
Figure 8 (A) graph showing the NHDF dose response for FAP ific T-cell activator with
increasing bispecific T-cell activator tration. Graph (B) & (C) showing the
results of a LDH assay showing the cytoxicity of DLD cells which have been cocultured
with T cells and EpCAM bispecific T-cell activator or control bispecific T-cell
activator.
Figure 9 (A) graph showing the results of a LDH assay showing the cytoxicity of SKOV cells
which have been co-cultured with T cells and EpCAM bispecific T-cell activator or
control bispecific T-cell activator. (B) graph showing the results of a LDH assay
showing the cytoxicity of MCF7 cells which have been co-cultured with T cells and
EpCAM ific T-cell activator or control bispecific T-cell activator.
Figure 10 shows a graph showing the NHDF dose response for EpCAM ific T-cell
activator with increasing ific T-cell tor concentration.
Figure 11 (A) graph showing FAP expression in CHO cells determined by FAP or isotope
control antibody and analysed by flow cytometry. (B) shows a graph showing the
results of a LDH assay showing the cytoxicity of CHO or CHO-FAP cells which have
been co-cultured with T cells and FAP ific T-cell activator or control bispecific
T-cell tor.
Figure 12 shows a graph showing T-cell activation (based onCD69 and CD25 expression levels)
by CHO vs CHO-FAP cells, analysed using flow cytometry.
Figure 13 (A) graphs showing EpCAM expression of the parental cell lines vs stable transfected
variant ined by staining with EpCAM or isotope control antibody and
ed using flow cytometry. (B) graph showing the results of a LDH assay
showing the cytoxicity of CHO or CHO-EpCAM cells which have been co-cultured with
T cells and EpCAM bispecific T-cell activator or control bispecific T-cell activator.
Figure 14 shows graph showing T-cell activation (based onCD69 and CD25 expression )
by CHO vs CHO-EpCAM cells, analysed using flow try.
Figure 15 (A) graph showing the ability of FAP bispecific T-cell activator to activate CD4+ or
CD8+ T-cells (based on CD69 and CD25 expression levels), analysed using flow
cytometry. (B) graph showing the results of a LDH assay showing the cytoxicity of
NHDF cells which have been co-cultured with CD4+ or CD8+ T cells and FAP
bispecific T-cell activator or control bispecific T-cell activator.
Figure 16 (A) graph showing CD4+ and CD8+ T-cell activation (based on CD69 and CD25
expression levels) by DLD cells in the presence of EpCAM or control bispecific T-cell
activator analysed using flow cytometry. (B) graph g the results of a LDH
assay showing the cytoxicity of DLD cells which have been co-cultured with CD4+ or
CD8+ T cells and EpCAM bispecific T-cell activator or control bispecific T-cell
activator.
Figure 17 (A) graph showing the number of CD3+ T cells from ascites cultured with control or
FAP bispecific T-cell activator. (B) graph showing the CD25 expression levels of T
cells from ascites cultured with control or FAP bispecific T-cell activator. (C) graph
showing the number of FAP+ cells from ascites cultured with control or FAP
bispecific T-cell activator.
Figure 18 (A) schematic representation of the genome of the adenoviruses of the present
disclosure. (B) graphs comparing the kinetics of CMV vs SA promoter driven
expression.
Figure 19 (A) graph showing the quantification of the number of detected virus genomes per
cell for , NG-602, NG-603, NG-604, NG-605, NG-606 and EnAd. (B) graphs
showing the tic activity of NG-601, NG-602, NG-603, NG-604, NG-605, NG-606
or EnAd assessed by infection of A549 cells.
Figure 20 (A) graphs showing T-cell tion (based on CD69 and CD25 expression levels) by
NG-601, NG-602, NG-605 and NG-606 when co-cultured with P, analysed
using flow cytometry. (B) graphs showing T-cell tion (based on CD69 and CD25
expression levels) by NG-601, NG-602, NG-605 and NG-606 when tured with
CHO-EpCAM, analysed using flow try.
Figure 21 shows graphs showing the s of experiments to determine the quantity of FAP
bispecific T-cell activator produced from NG-605 and NG-606.
Figure 22 shows graphs showing the results of experiments to determine the quantity of
EpCAMbispecific T-cell activator produced from NG-601 and NG-602.
Figure 23 shows microscopy images of Ad293 cells infected with NG-607, NG-608, NG-609 and
NG-610.
Figure 24 (A) graph indicating the cytotoxicity of DLD cells infected with EnAd, analysed using
XCELLigence. (B) graph indicating the cytotoxicity of SKOV cells ed with EnAd,
analysed using XCELLigence. (C) graph indicating the xicity of NHDF cells
infected with EnAd, analysed using XCELLigence.
Figure 25 (A) graph ting the ability of NG-603, NG-604, NG-605, NG-606 and EnAd to kill
NHDF cells, analysed using XCELLigence. (B) graph indicating the ability of NG-603,
NG-604, NG-605, NG-606 and EnAd to kill NHDF cells, analysed using an LDH assay.
Figure 26 shows graphs showing T-cell activation (based on CD69 and CD25 expression levels)
by NG-603, NG-604, NG-605, NG-606 co-cultured with NHDF cells, SKOV and T cells,
ed using flow cytometry.
Figure 27 (A) graph showing T-cell activation (based on CD69 and CD25 expression levels) by
NG-603, NG-604, NG-605, NG-606 co-cultured with NHDF and SKOV cells vs. SKOV
alone, analysed using flow cytometry. (B) graph indicating the cytotoxicity of NHDF
cells infected with NG-605 and NG-606, analysed using an LDH assay
Figure 28 shows still frame images from timelapse videos of lysis of NHDF cells by recombinant
FAP bispecific T-cell activator, EnAd, NG-603 or .
Figure 29 shows still frame images from timelapse videos of lysis of NHDF cells by NG-607, NG-
608, NG-609 or NG-610.
Figure 30 shows a graph indicating the cytotoxicity of DLD cells infected with EnAd, NG-601,
NG-602, NG-603 and NG-604 in the presence of T cells or absence of T cells, analysed
using XCELLigence.
Figure 31 shows a graph indicating the cytotoxicity of DLD cells infected with EnAd, NG-601,
NG-602, NG-603 and NG-604 in the presence of T cells or absence of T cells, analysed
using an LDH assay.
Figure 32 shows a graph showing T-cell activation (based on CD69 and CD25 expression levels)
by EnAd, NG-601, NG-602, NG-603 and NG-604, ed by flow cytometry.
Figure 33 shows the results of experiments to determine the ability of NG-601 to kill DLD
tumour cells at varying multiplicity of infection (MOI) in the ce or e of
CD3 + T-cells, assessed using xCELLigence.
Figure 34 shows graphs ting the ability of EnAd and , NG-602, NG-603 and NG-
604 to kill SKOV tumour cells in the presence or absence of CD3+ s, assessed
using xCELLigence.
Figure 35 shows graphs indicating the ability of EnAd and NG-601, NG-602, NG-603 and NG-
604 to kill SKOV tumour cells in the presence or absence of CD3+ T-cells, assessed
using an LDH assay.
Figure 36 shows a graph showing T-cell tion (based on CD69 and CD25 expression levels)
by EnAd, NG-601, NG-602, NG-603 and NG-604 co-cultured with SKOV tumour cells,
analysed using flow cytometry.
Figure 37 shows a graph showing T-cell activation (based on CD69 and CD25 expression levels)
by EnAd, NG-601, NG-602, NG-603 and NG-604 co-cultured with ascites cells,
analysed using flow cytometry.
Figure 38 shows still frame images from timelapse videos of lysis of NHDF cells by EpCAM
bispecific T-cell activator, EnAd, NG-601 or NG-603.
Figure 39 shows microscopy images of ascites cells obtained from a patient, infected with
s of the present disclosure and d with EnAd-CMV-GFP and EnAd-SA-GFP
as a reporters to determine infection and late stage viral gene expression.
Figure 40 (A) graph indicating the expression levels of CD25 on CD3+ T cells in ascites samples
which were infected with viruses of the t sure. (B) graph indicating the
number of FAP+ cells in ascites samples which were infected with viruses of the
present disclosure.
Figure 41 shows microscopy images of ascites cells obtained from a cancer patient, ed
with viruses of the present disclosure and stained with EnAd-CMV-GFP and EnAd-
SA-GFP as a reporters to determine infection and late stage viral gene expression.
Figure 42 shows a graph indicating the number of CD3+ T cells in ascites samples obtained
from a cancer t and infected with viruses of the present disclosure.
Figure 43 shows a graph indicating the CD25 expression levels on CD3+ T cells in ascites
samples obtained from a cancer patient and infected with viruses of the present
disclosure.
Figure 44 shows a graph ting the number of FAP+ cells in ascites samples obtained from
a cancer patient and infected with viruses of the present disclosure.
Figure 45 Characterisation of EpCAM bispecific T-cell activator and its effects on PBMC-
derived T cells
(A) Schematic of the structure of the EpCAM-targeted bispecific T-cell activator and
non-specific control bispecific T-cell activator. The VL and VH domains are connected
with flexible peptide linkers (L) rich in serine and glycine for flexibility and solubility.
Ig SP, Light chain immunoglobulin signal peptide; 10His, decahistidine affinity tag.
(B) Induction of activation markers CD69 and (C) CD25 on CD3-purified PBMC
ed alone or with DLD cells (5:1) in the presence of bispecific T-cell activatorcontaining
supernatants. CD69 and CD25 were measured by flow cytometry after 24
h of co-culture. Significance was assessed versus IgG isotype (D) Percent of IFNγpositive
T-cells after 6 h in co-culture with DLD cells (5:1) and ific T-cell
tor-containing supernatants. (E) Proliferation, represented by division index
and tage of parental T cell population entering proliferation, of CFSE-stained
T-cells in co-culture with DLD cells (5:1) and bispecific T-cell activator-containing
supernatants. Fluorescence was measured by flow cytometry 5 days after co-culture.
Division index was modelled using FlowJo proliferation tool. (F) Degranulation of T-
cells, measured by CD107a externalisation, in co-culture with DLD cells (5:1) and
bispecific T-cell activator-containing supernatants. Externalisation was assessed by
co-culture with a CD107a-specific antibody for 6 h followed by flow cytometry
is. (G) Cytokine levels were measured by LEGENDplex human Th cytokine
panel using supernatants from co-cultures of T-cells with DLD cells (5:1) in the
presence of bispecific T-cell activator-containing supernatants for 48 h. Each
condition was measured in biological triplicate and data represented as mean ± SD.
Significance was assessed versus untreated unless stated otherwise using a one-way
ANOVA test with s Post Hoc analysis, *p<0.05, **p<0.01, .001.
Figure 46 Characterisation of recombinant EpCAM bispecific T-cell activator
(A) Dot blot to te the quantity of EpCAM bispecific T-cell activator produced
by ected HEK293A cells. (B) ELISA measuring the level of EpCAM binding by
controls or recombinant EpCAM or non-specific bispecific T-cell activator.
Significance was ed by comparison to empty vector control sample using a
one-way ANOVA test with Tukey’s Post Hoc analysis, ***p<0.001
Figure 47 Assessment of antigen-specificity of EpCAM ific T-cell activatormediated
T cell cytotoxicity
(A) Induction of tion marker CD25 on CD3+ T-cells in co-culture with CHO or
CHO-EpCAM cells (5:1) and ific T-cell activator-containing supernatants,
measured by FACS analysis after 24 h of co-culture. (B) xicity of CHO or CHOEpCAM
cells cultured with bispecific T-cell activator-containing supernatants alone
or in coculture with T-cells. Cytotoxicity was assessed by release of LDH into the
culture supernatants after 24 h of incubation. (C) Cytotoxicity of multiple EpCAM-
positive oma cells after 24 h in ture with T-cells (1:5) and bispecific T-
cell activator-containing supernatants. Viability was ed by MTS assay after 24
h of co-culture. (D) Levels of EpCAM expression (N=1) assessed by FACS analysis of
EpCAM-positive cell lines in (C), compared to ound fluorescence measured by
using an isotype control antibody. (AC) Each condition was measured in biological
triplicate and represented as mean ± SD. icance was assessed versus untreated
or T-cell only controls using a one-way ANOVA test with Tukey’s Post Hoc analysis,
*p<0.05, **p<0.01, ***p<0.001.
Figure 48 Cytotoxicity of EnAd-expressing EpCAM bispecific T-cell activator in SKOV3
cells
SKOV3 cells were incubated with EnAd or recombinant viruses in the e (A) or
presence (B) of T cells and cytotoxicity was measured by LDH release at the ied
time-points. Significance was ed by comparison to uninfected control wells
using a one-way ANOVA test with Tukey’s Post Hoc analysis, ***p<0.001
Figure 49 Identification of which T cells are sible for bispecific T-cell activatormediated
cytotoxicity
(A) Bispecific T-cell tor-mediated T-cell tion of CD4 and CD8 cells 24 h
after co-culture of CD3 T-cells with DLD cells (5:1) and bispecific T-cell activatorcontaining
atant. Activation was assessed by surface expression of CD69 and
CD25 and measured by flow cytometry. (B) Proliferative se of CFSE-stained
CD4 and CD8 T-cells in co-culture with DLD cells and incubated with T-cell activatorcontaining
supernatants. Fluorescence was measured after 5 days incubation, by
FACS is. (C) Degranulation of CD4 and CD8 cells following 6 h ture with
DLD cells and bispecific T-cell activator-containing supernatants. A CD107a-specific
antibody is added to the culture media for the duration of the co-culture and
degranulation is assessed by flow try. (D) Cytotoxicity by either the CD4 or
CD8 T-cell subset is assessed by LDH release into supernatant, following 24 h
incubation of DLD cells with CD4- or CD8-purified T-cells (1:5) and bispecific T-cell
activator containing supernatant. Each condition was measured in biological
triplicate and represented as mean ± SD. EpCAM bispecific T-cell activator treatment
was compared to control bispecific T-cell activator unless stated otherwise and
significance was assessed using a one-way ANOVA test with Tukey’s Post Hoc
analysis, 5, **p<0.01, ***p<0.001.
Figure 50 Cytotoxicity and T cell activation by EnAd-expressing EpCAM bispecific T-cell
activator in DLD cells
Cytotoxicity for infected DLD cells in absence (A) or presence of T-cells (B) . DLD cells
were infected and co-cultured with s and cytotoxicity was ed by LDH
release at the specified timepoints. (C-D) T-cells from (B) were harvested and
stained for activation markers CD69 (C) or CD25 (D) and analysed via flow
cytometry. (E-F) Quantification of EpCAM bispecific T-cell activator-produced from
DLD cells ed with recombinant viruses. Standard curve of LDH released (Abs)
of DLD in co-culture with CD3+ cells and g known quantities of recombinant
EpCAM bispecific T-cell activator (E) . In parallel, co-cultures were incubated with
diluted supernatants (10,000-fold) from 3 day infected DLD cells (F) . Standard curve
allowed the approximate determination of EpCAM bispecific T-cell activator
produced at 165 μg and 50 μg per n DLD cells for EnAd-CMV-EpCAMbispecific
T-cell activator and EnAd-SA-EpCAMbispecific T-cell activator, respectively.
Significance was assessed by comparison to uninfected control wells using a oneway
ANOVA test with Tukey’s Post Hoc analysis, ***p<0.001
Figure 51 terisation of oncolytic virus EnAd expressing EpCAM ific T-cell
activator using cell lines and PBMC derived T cells
(A) DLD cells were infected with parental EnAd or inant virus (100 vp/cell)
and wells harvested at 24 or 72 h. Replication was assessed by measuring genomes
using qPCR against viral hexon. (B) Cytotoxicity of DLD cells infected with EnAd or
recombinant virus at increasing concentrations of virus. Cytotoxicity was measured
by MTS assay after 5 days infection. (C) Supernatants from day 3 uninfected or virusinfected
HEK293A cells were assessed for transgene expression by immunoblot
analysis and probed with an anti-His antibody. (D) ion of activation marker
CD25 of CD3-positive T-cells cultured with CHO or CHO-EpCAM (E:T 5:1) and diluted
HEK293A supernatants from (D). Activation was measured by surface expression of
CD25 by flow cytometry. (E) Cytotoxicity of CHO or CHO-EpCAM cells incubated with
HEK293A supernatants from (D) alone or in co-culture with CD3-purified PBMC (E:T
:1). HEK293A supernatants were diluted 300-fold. Cytotoxicity was assessed by
LDH released into the supernatant after 24 h incubation. Each ion was
measured in ical triplicate and ented as mean ± SD. icance was
assessed using a one-way ANOVA test with Tukey’s Post Hoc analysis with each
condition compared to untreated, *p<0.05, 01, ***p<0.001.
Figure 52 Cellular composition of the malignant exudates
(A) Representative image al effusion sample, t 3 from Figure 57)
demonstrating screening of ascites and exudate fluids for their cellular composition,
as assessed by flow cytometry. (B) Absolute number of each cell type (in 10,000 cell
sample size) is documented in the table.
Figure 53 Superior potency of EnAd expressing EpCAM ific T-cell activator in
partially EnAd-resistant cancer cell line
(A-B) Viability of SKOV3 cells were monitored in real-time over 160 h by
xCELLigence-based cytotoxicity assay. SKOV3 cells were seeded and infected with
EnAd or bispecific T-cell activator-armed EnAd viruses at 0 h, with uninfected cells
serving as a negative control. In (B) CD3-purified PBMC (5:1) were added 2 h postinfection
and impedance was measured at 15 min intervals. (C-D) CD3-purified
PBMC were cultured with SKOV3 cells (5:1) that were infected with parental EnAd
or recombinant armed viruses. At each time-point, T cells were harvested and
analysed for surface expression of CD69 (C) or CD25 (D) by flow cytometry. (E)
Time-lapse ces showing co-cultures of SKOV3 carcinoma cells (unstained),
NHDF fibroblasts (red) and CD3-purified PBMC (blue), infected with EnAd, EnAd-
CMVEpCAMbispecific T-cell activator or cted. Apoptosis was visualised using
CellEvent Caspase 3/7 detection reagent (green). Images were taken on a Nikon TE
2000-E Eclipse inverted microscope at intervals of 15 min covering a period of 96 h.
Representative images were ed at the times displayed; original magnification
×10; scale bar 100 μm. (A-D) Each condition was measured in biological triplicate
and represented as mean ± SD. Significance was assessed by comparison to
uninfected control using a oneway ANOVA test with Tukey’s Post Hoc analysis,
*p<0.05, **p<0.01, ***p<0.001.
Figure 54 Expression of PD1 and the effect of PD1 dies on bispecific T-cell
activator-mediated T cell activation
(A) The expression of PD1 by endogenous T cells following their initial isolation from
pleural effusions was assessed by flow cytometry. (B-D) Unpurified total cells from
pleural effusions (from three different patients) were incubated in 100% fluid from
the same l exudate in the presence of free bispecific T-cell activator, EnAd or
recombinant virus. After 5 days, the total cell population was ted, and the
number of (B) CD3+ T cells and those which were (C) CD25+ were quantified. (D)
The number of EpCAM+ cells was measured using flow cytometry. Significance was
assessed by comparison to untreated control wells using a one-way ANOVA test with
Tukey’s Post Hoc analysis, ***p<0.001
Figure 55 EnAd expressing EpCAM bispecific T-cell activator can selectively kill primary
human tumour cells from chemotherapy-pretreated ts
(A) Cytotoxicity of EpCAM+ cells or (B) FAP+ lasts, first isolated from three
patients’ ascites and expanded ex vivo, then incubated with recombinant bispecific
T-cell activator, or infected with EnAd or recombinant virus. Cytotoxicity was
measured by flow cytometry after 5 days. (C) Induction of activation marker CD25
on CD3-positive T-cells cultured with ascites derived EpCAM+ and FAP+ cells from
(A+B) . Each ion was measured in ical triplicate and represented as
mean ± SD. Significance was assessed by ison to untreated using a y
ANOVA test with s Post Hoc analysis, *p<0.05, **p<0.01, ***p<0.001.
Figure 56 EpCAM bispecific T-cell activator can me immune suppressive effects of
ascites fluid and activate endogenous T cells
(A-B) PBMC-derived T cells were incubated with anti-CD3 antibodies in RPMI
culture medium or the ce of 100% neal ascites fluid from five ovarian
cancer patients. (A) At 24 h induction of T cell activation markers CD69 and CD25
were analysed, and (B) degranulation of T-cells measured by CD107a
externalisation, using flow cytometry. (C) Viability of MCF7 cells were monitored in
real-time over 60 h by xCELLigence-based cytotoxicity assay. MCF7 cells were
seeded and incubated with control or EpCAM bispecific T-cell activator at 25 h, in the
presence of RPMI medium or 100% ascites fluid #1 or #2. Untreated cells served as
a negative control. CD3-purified PBMC (5:1) were added at the same time and
impedance was measured at 15 min intervals. (D) Endogenous unpurified total cells
from neal ascites were incubated in 100% ascites fluid in the presence of free
EpCAM or control bispecific T-cell activator. After 24 h, the total cell population was
harvested, and the number of CD3+/CD69+ and CD3+/CD25+ cells measured by flow
cytometry. Each condition was ed in biological triplicate and represented as
mean ± SD. icance was assessed by comparison to RPMI (A+B), untreated (D)
or control bispecific T-cell tor (E) using a oneway ANOVA test with Tukey’s
Post Hoc analysis, *p<0.05, **p<0.01, ***p<0.001.
Figure 57 EnAd expressing EpCAM bispecific T-cell activator can activate nous T
cells to kill endogenous tumour cells within malignant pleural exudates
Unpurified total cells from pleural effusions (from four different patients) were
incubated in 100% fluid from the same pleural exudate in the presence of free
bispecific T-cell activator, EnAd or recombinant virus. After 5 days, the total cell
population was harvested, and the number of (A) CD3+ T cells and those which were
(B) CD25+ were quantified. (C) The number of EpCAM+ cells was measured using
flow cytometry. (D) Representative images (magnification ×10; scale bar 100 μm)
and flow cytometry analysis of pleural effusion cells of Patient 3 (cancer cells and
lymphocytes) following ent with EnAd or EnAd-CMVEpCAM bispecific T-cell
activator. (E) At 5 days cytokine levels were ed by LEGENDplex human Th
cytokine panel using pleural effusion cultures following incubation with free
inant bispecific T-cell activator or infection with EnAd or recombinant virus.
Each condition was measured in biological triplicate and represented as mean ± SD.
Significance was assessed by comparison to untreated control s using a oneway
ANOVA test with s Post Hoc analysis, *p<0.05, **p<0.01, .001.
Figure 58 shows quantity of IL-10 measured in normal serum (NS) or patient malignant
exudate fluids (A: peritoneal ascites, P: pleural effusions) using Human IL-10 ELISA
MAX kit gend, 430604).
Figure 59 shows CD3/28 ediated PBMC T-cell activation (based on CD69/CD25 levels)
in t fluids vs normal serum measured by flow cytometry. A: patient exudate
fluid, P: pleural fluid.
Figure 60 shows CD3/28 bead-mediated PBMC T-cell degranulation (based on CD107a
expression) in patient fluids. A: ascites, P: pleural fluid.
Figure 61 shows the correlation between IL-10 levels in patient fluids and CD3/CD28 beadmediated
T-cell nulation.
Figure 62 shows EpCAM bispecific T-cell activator bead-mediated PBMC T-cell activation
(based on CD69/CD25 expression) in patient fluids. A: s, P: pleural fluid.
Figure 63 shows EpCAM bispecific T-cell activator bead-mediated PBMC T-cell degranulation
(based on CD107a expression) in patient fluids. A: ascites, P: pleural fluid.
Figure 64 shows EpCAM bispecific T-cell activator bead-mediated cytotoxicity of SKOV3 in
patient fluids. A: ascites, P: pleural fluids.
Figure 65 shows EpCAM bispecific T-cell activator-mediated T-cell activation (based on
D69 expression) in RPMI media vs ascites fluid.
Figure 66 shows the ability of EnAd-SA-EpCAMbispecific T-cell activator and EnAd-SAControlbispecific
T-cell activator to induce T cell-mediated target cell lysis in RPMI
media vs ascites fluid. ((A) number of CD3+. (B) CD25 expression of T-cells. (C)
number of EpCAM+ cells ined by flow try.
Figure 67 shows the ability of EnAd-SA-EpCAMbispecific T-cell tor and EnAd-SAControlbispecific
T-cell activator to induce T cell-mediated target cell lysis in ascites
fluid (7 t samples).
(A) number of CD3+. (B) CD25 expression of T-cells. (C) number of EpCAM+ cells
ined by flow cytometry. See Figure 67A for legend.
Figure 68 shows a comparison of activation of T-cell cytokine production by recombinant FAP
bispecific T-cell activator n in the presence of human fibroblasts and by
polyclonal activation with anti-CD3/CD28 beads. (A) IFNγ levels measured by ELISA.
(B) Cytokine levels measured by cytokine bead array.
Figure 69 FAP-targeted bispecific T-cell activator induces T-cell degranulation and
specific xicity of FAP+ cells
(A) Degranulation of T-cells in culture with NHDF cells (5:1) and (B) bispecific T-cell
activator-containing supernatants. Degranulation was assessed by externalisation of
CD107a following 6 h culture with a CD107a-specific antibody and measured by flow
try. CD3/CD28 Dynabeads were used as a positive control. (C) xicity of
NHDF cells after 24 h in co-culture with T-cells (1:5) and 10-fold serial dilutions of
bispecific T-cell activator-containing supernantants. xicity was assessed by
release of LDH into culture supernatants. (D) Lysis of NHDF by LDH release (left) and
CD25 induction on T-cells (right) was assessed after 24 h co-culture with PBMC-
derived T-cells (1:5) from six healthy donors and bispecific T-cell activatorcontaining
supernatants.
Figure 70 EnAd expressing FAP bispecific T-cell activator selectively kills FAP+
fibroblasts and decreases TGFb in peritoneal ascites samples
(A,B) Number of of FAP+ fibroblasts (A) and EpCAM+ tumour cells (B) after 72 h
culture with PBMC-derived T-cells and EnAd or inant viruses. Ascites cells
were first isolated from three patients ascites and expanded ex vivo. Cell number was
ed at 72 h post-infection by flow cytometry. (C) Induction of activation
marker CD25 on PBMC-derived CD3 cells from (A) was measured at 72 h postinfection.
(D) Levels of TGFb were ed by ELISA using supernatants harvested
from (A).
Figure 71 shows the activation of nous tumor associated T-cells and associated killing
of FAP+ cells in patient malignant ascites biopsy samples by FAP bispecific T-cell
tor protein and EnAd-FAPbispecific T-cell activator viruses. (A) T cell
activation measured by CD25 expression. (B) residual number of FAP+ cells
measured by flow cytometry.
Figure 72 Effect of PD-L1 blocking antibodies on bispecific T-cell activator-mediated T
cell activation in patient sample
(A) Expression of PD1 by endogenous T cells and PD-L1 on FAP+ cells following their
initial isolation from peritoneal ascites was assessed by flow cytometry. (B)
Unpurified total cells from peritoneal ascites were ted in 50% fluid from the
same exudate in the presence of free bispecific T-cell activator, EnAd or recombinant
virus, with or without anti-PD-L1 blocking antibody. After 2 days, the total cell
population was harvested, and the number of CD25+ s was quantified by flow
cytometry. (C) Quantity of interferon gamma in culture supernatants from (B, D)
measured by ELISA. (D) The number of residual FAP+ cells in (B) was measured
using flow cytometry.
Figure 73 EnAd expressing bispecific T-cell tors activate and redirect T-cells from
patient biopsy samples to lyse NHDF fibroblasts
(A) The expression of PD-1 by endogenous T cells ing isolation from healthy
donors or malignant exudate cancer biopsy samples. PD-1 expression was measured
by flow cytometry. (B) The proportion of CD3+ cells within the fied cell
population of PBMC and cancer biopsy samples as measured by flow cytometry. (C)
Levels of interferon gamma measured by ELISA in culture supernatants harvested
from (B) at 120 h post-treatment. (D) Viability of NHDF fibroblasts were monitored
in real time over 130 h by xCELLigence cytotoxicity assay in co-culture with PBMC or
total cancer biopsy cells (1:5) and ific T-cell tor-containing supernatant.
Figure 74 shows the effect of immunosuppressive ascites fluid samples on FAP bispecific T-cell
activator- and anti-CD3/CD28 bead-mediated activation of PBMC T-cells. (A) PBMC
T cells activated with anti-CD3/Cd28 Dynabeads. (B) PBMC T cells activated with
control or FAP bispecific T-cell activators in the presence of NHDF cells. NS: normal
serum, A: peritoneal ascites.
Figure 75 FAP bispecific T-cell tor expressing EnAd polarises CD11b+ macrophage
in patient ascites to a more inflammatory phenotype
(A) Unpurified total cells from ascites sample were incubated in 50% ascites fluid in
the presence of free bispecific T-cell activator or bispecific T-cell tor sing
virus. Interferon gamma treatment was used as a positive control. After 3 days, the
total cell population was harvested and the induction of activation marker CD25 on
CD3 + cells was measured by flow cytometry. (B) Levels of interferon gamma in
culture supernatants from (A) were measured by ELISA. (C) At 3 days, the expression
levels of CD68, CD86, CD206 and CD163 on CD11b+ cells from (A) were measured
by flow cytometry. Representative flow try spectra from triplicates is shown
ide the complete data set.
Figure 76 Characterisation of architecture and cellular composition of solid prostate
tumour
(A) EpCAM staining, (B) CD8 ng, (C) FAP staining. (D) Representative
immunohistochemistry images of CD25 induction within prostate tumour slices
following treatment with bispecific T-cell activator expressing viruses. Tumour cores
were sliced at 300 uM ess with a Leica vibratome, cultured and infected in
inserts and harvested after 7 days treatment. (E) Levels of IFNg in tissue slice e
medium measured by ELISA. Supernatants were harvested from slices cultures of
malignant and benign tissue at the specified time-point. (F) Levels of IL-2 in tissue
culture medium of malignant and benign tissue measured by ELISA.
Figure 77A-C shows a schematic representation of the transgene cassettes used in e 33.
Figure 77D shows a graph indicating the number of viral genomes detected per cell in NG-611,
NG-612 and NG-617 treated tumour cells.
Figure 78 shows the percentage of T cells sing CD69 (a), CD25 (b) HLA-DR (c) , CD40L
(d) or cell surface CD107a (e) following co-culture with EpCam expressing SKOV
cells and supernantants harvested from A549 cells at 24, 48 or 72hrs post-treatment
with NG-611 viurs particles compared to NG-612, enadenotucirev or untreated
control supernatants.
Figure 79 shows the percentage of T cells expressing CD69 (a), CD25 (b) HLA-DR (c) , CD40L
(d) or cell surface CD107a (e) following ture with FAP expressing MRC-5 cells
and supernatants harvested from A549 cells at 24, 48, or 72hrs post-treatment with
NG-612 virus particles compared to NG-611, enadenotucirev or untreated control
supernatants.
Figure 80 shows the percentage of MRC-5 cells that s EpCAM and FAP
Figure 81 shows IFNγ expression in the supernatants of T cell tures with SKOV cells (A)
or MRC-5 cells (B) incubated with supernatants harvested from A549 cells at 24, 48
or 72hrs post-treatment with NG-611, NG-612 or enadenotucirev virus particles, or
untreated control supernatants.
Figure 82 shows anti-tumour efficacy and immune activation of bispecific T-cell activator
expressing s in vivo. (a) tumour volume in mice treated with saline,
enadenotucirev or NG-611. (b) Ratio of CD8 to CD4 T cells in NG-611 treated tumours
compared to enadenotucirev treated or untreated controls.
Figure 83 shows tic representation of transgene cassettes. (a) NG-615, (b) NG-640, (c)
NG-641.
Figure 84 shows a graph ting the number of viral s detected per cell in NG-612
and NG-615 treated tumour cells
Figure 85 shows the expression of IFNα, MIP1α and Flt3 L in the ar supernatant of NG-
615 vs the supernatant of enadenotucirev and untreated control tumour cells.
Figure 86 shows the number of T cells expressing CD69 (a), CD25 (b) HLA-DR (c) , CD40L (d)
or cell surface CD107a (e) ) following co-culture with FAP expressing MRC-5 cells
and supernantants harvested from A549 cells at 24, 48 or 72hrs post-treatment with
NG-615 viurs particles compared to NG-612, enadenotucirev or untreated control
supernatants.
Figure 87 shows IFNγ expression in the atants of T cell co-cultures with MRC-5 cells
incubated with supernatants ted from A549 cells at 24, 48 or 72hrs eatment
with NG-612, NG-615 or enadenotucirev virus particles, or untreated
control supernatants.
Figure 88 shows schematic representation of the NG-618 transgene cassette
Figure 89 shows the detection of surface FAP expression on MRC-5 cells (a) or EpCam
expression on SKOV cells (b) following incubation with supernatants ted from
A549 cells at 72hrs post-treatment with NG-611, NG-612, NG-615 or enadenotucirev
virus particles.
Figure 90 shows the percentage of T cells expressing CD24 (a), CD40L (b) or cell surface
CD107a (c) following co-culture with FAP expressing MRC-5 cells and supernatants
harvested from A549 cells at 72hrs post-treatment with NG-618 virus particles
compared to enadenotucirev or untreated controls.
Figure 91 shows the percentage of T cells expressing CD24 (a), CD40L (b) or cell surface
CD107a (c) following co-culture with EpCam expressing SKOV cells and atants
harvested from A549 cells at 72hrs post-treatment with NG-618 virus particles
compared to enadenotucirev or untreated controls.
Figure 92 shows the percentage of dead MRC-5 (a) or SKOV (b) cells ing co-culture with
T cells and supernatants harvested from A549 cells at 72hrs post-treatment with NG-
618 virus paticles compared to enadenotucirev or untreated controls.
SEQUENCES
SEQ ID NO: 1 Anti-EpCAM ific T-cell tor DNA coding ce, with N-
al signal sequence and C-terminal deca-His affinity tag
SEQ ID NO: 2 Anti-EpCAM bispecific T-cell activator protein sequence, with N-terminal
signal sequence and C-terminal deca-His affinity tag
SEQ ID NO: 3 Anti-FAP bispecific T-cell tor DNA coding sequence, with N-terminal
signal sequence and C-terminal deca-His affinity tag
SEQ ID NO: 4 Anti-FAP bispecific T-cell activator amino acid sequence, with inal
signal sequence and C-terminal deca-His affinity tag
SEQ ID NO: 5: Control (Anti-FHA) bispecific T-cell activator DNA coding sequence, with N-
terminal signal sequence and C-terminal deca-His affinity tag
SEQ ID NO: 6: Control (Anti-FHA) bispecific T-cell activator amino acid sequence with N-
terminal signal sequence and C-terminal deca-His affinity tag
SEQ ID NO: 7: Anti-CD3 ScFv amino acid sequence
SEQ ID NO: 8: Anti-CD3 VH
SEQ ID NO: 9: Anti-CD3 VL
SEQ ID NO: 10: Anti-CD3 ScFv linker sequence
SEQ ID NO: 11: Anti-FAP ScFv
SEQ ID NO: 12: AP VL domain
SEQ ID NO: 13: Anti-FAP VH domain
SEQ ID NO: 14: Anti-FAP and Anti-EpCAM linker sequence
SEQ ID NO: 15: bispecific T-cell activator leader ce
SEQ ID NO: 16: Anti-EpCAM ScFv
SEQ ID NO: 17: pCAM VL
SEQ ID NO: 18: Anti-EpCAM VH
SEQ ID NO: 19: Control bispecific T-cell activator (Anti-FHA)
SEQ ID NO: 20: Control (Anti-FHA) ScFv
SEQ ID NO: 21: Control (Anti-FHA) VL
SEQ ID NO: 22: Control (Anti-FHA) VH
SEQ ID NO: 23: Control (Anti-FHA) ScFv linker sequence
SEQ ID NO: 24: Deca-His Tag sequence
SEQ ID NO: 25: FAP bispecific T-cell activator-P2A-RFP (ITALICS = leader, BOLD = furin
cleavage site, UNDERLINE = P2A sequence, lower case = RFP)
SEQ ID NO: 26: Control (Anti-FHA) bispecific T-cell tor-P2A-RFP (ITALICS = leader,
BOLD = furin cleavage site, UNDERLINE = P2A sequence, lower case = RFP)
SEQ ID NO: 27: Human EpCAM DNA coding sequence
SEQ ID NO: 28: Human EpCAM amino acid sequence
SEQ ID NO: 29: Human FAP DNA coding sequence
SEQ ID NO: 30: Human FAP amino acid sequence
SEQ ID NO: 31: CMV promoter sequence
SEQ ID NO: 32: SV40 late polyadenylation sequence
SEQ ID NO: 33: Null sequence
SEQ ID NO: 34: NG-601 CMV-EpCAMbispecific T-cell activator)
SEQ ID NO: 35: NG-602 (EnAd-SA-EpCAMbispecific T-cell activator)
SEQ ID NO: 36: NG-605 (EnAd-CMV-FAPbispecific T-cell activator)
SEQ ID NO: 37: NG-606 (EnAd-SA-FAPbispecific T-cell activator)
SEQ ID NO: 38 EnAd genome
SEQ ID NO: 39 BX DNA sequence corresponding to and including bp 28166-28366 of the
EnAd genome
SEQ ID NO: 40 BY DNA sequence corresponding to and including bp 29345-29379 of the
EnAd genome
SEQ ID NO: 41 HIS-Tag
SEQ ID NO: 42 Splice acceptor ce.
SEQ ID NO: 43 SV40 poly Adenylation sequence
SEQ ID NO: 44 EpCam bispecific T-cell tor nucleic acid sequence (OKT3)
SEQ ID NO: 45 FAP bispecific T-cell tor nucleic acid ce (OKT3)
SEQ ID NO: 46 FAP bispecific T-cell activator nucleic acid sequence (aCD3)
SEQ ID NO: 47 NG-611 Transgene cassette
SEQ ID NO: 48 NG-612 Transgene cassette
SEQ ID NO: 49 NG-613 Transgene te
SEQ ID NO: 50 Restriction site insert (BX)
SEQ ID NO: 51 Restriction site insert (BY)
SEQ ID NO: 52 CMV promoter ce
SEQ ID NO: 53 PGK promoter sequence
SEQ ID NO: 54 CBA promoter sequence
SEQ ID NO: 55 short splice acceptor (SSA) DNA sequence
SEQ ID NO: 56 splice acceptor (SA) DNA sequence
SEQ ID NO: 57 branched splice acceptor (bSA) DNA sequence
SEQ ID NO: 58 Kozak sequence (null sequence)
SEQ ID NO: 59 Example of start codon
SEQ ID NO: 60 al Ribosome Entry Sequence (IRES)
SEQ ID NO: 61 P2A e
SEQ ID NO: 62 F2A peptide
SEQ ID NO: 63 E2A peptide
SEQ ID NO: 64 T2A peptide
SEQ ID NO: 65 polyadenylation ) ce
SEQ ID NO: 66 Leader sequence
SEQ ID NO: 67 Leader ce
SEQ ID NO: 68 IFN γ amino acid sequence
SEQ ID NO: 69 IFNα amino acid sequence
SEQ ID NO: 70 TNFα amino acid sequence
SEQ ID NO: 71 DNA sequence corresponding to E2B region of the EnAd genome (bp
10355-5068)
SEQ ID NO: 72: Anti-EpCAM bispecific T-cell activator DNA coding ce, with N-
terminal signal sequence and C-terminal deca-His affinity tag
SEQ ID NO: 73: Anti-EpCAM bispecific T-cell activator protein sequence, with inal
signal sequence without C-terminal deca-His affinity tag
SEQ ID NO: 74: Anti-FAP bispecific T-cell tor DNA coding sequence, with inal
signal sequence without C-terminal deca-His affinity tag
SEQ ID NO: 75: Anti-FAP bispecific T-cell tor amino acid sequence, with inal
signal sequence without C-terminal deca-His affinity tag
SEQ ID NO: 76: Control (Anti-FHA) bispecific T-cell activator DNA coding sequence, with N-
terminal signal sequence without C-terminal deca-His affinity tag
SEQ ID NO: 77: Control (Anti-FHA) bispecific T-cell activator amino acid sequence with N-
terminal signal sequence without C-terminal deca-His affinity tag
SEQ ID NO: 78: Control bispecific T-cell activator (Anti-FHA) without C-terminal deca-His
affinity tag
SEQ ID NO: 79: NG-601 (EnAd-CMV-EpCAMbispecific T-cell activator) without deca-His
affinity tag
SEQ ID NO: 80: NG-602 (EnAd-SA-EpCAMbispecific T-cell activator) without deca-His
ty tag
SEQ ID NO: 81: NG-605 (EnAd-CMV-FAPbispecific T-cell activator) without deca-His
affinity tag
SEQ ID NO: 82: NG-606 (EnAd-SA-FAPbispecific T-cell activator) without deca-His affinity
SEQ ID NO: 83: EpCam bispecific T-cell activator nucleic acid sequence (OKT3)
SEQ ID NO: 84: Null sequence
SEQ ID NO: 85: FAP bispecific T-cell tor nucleic acid ce (OKT3)
SEQ ID NO: 86: Null sequence
SEQ ID NO: 87: FAP bispecific T-cell tor nucleic acid sequence (aCD3)
SEQ ID NO: 88: NG-611 Transgene cassette
SEQ ID NO: 89: NG-612 Transgene cassette
SEQ ID NO: 90: NG-613 Transgene cassette
SEQ ID NO: 91: NG-614 Transgene cassette
SEQ ID NO: 92: NG-617 Transgene cassette
SEQ ID NO: 93: EpCam bispecific T-cell activator amino acid sequence (OKT3)
SEQ ID NO: 94: FAP bispecific T-cell activator amino acid sequence (OKT3)
SEQ ID NO: 95: FAP bispecific T-cell activator amino acid sequence (aCD3)
SEQ ID NO: 96: NG-611 Genome
SEQ ID NO: 97: NG-612 Genome
SEQ ID NO: 98: NG-613 Genome
SEQ ID NO: 99: NG-614 Genome
SEQ ID NO: 100: NG-617 Genome
SEQ ID NO: 101: NG-615 Genome
SEQ ID NO: 102: NG-640 Genome
SEQ ID NO: 103: NG-641 Genome
SEQ ID NO: 104: Null sequence
SEQ ID NO: 105: Flt3L nucleic acid sequence
SEQ ID NO: 106: Null sequence
SEQ ID NO: 107: MIP1α c acid sequence
SEQ ID NO: 108: Flexible linker sequence
SEQ ID NO: 109: IFNα nucleic acid ce
SEQ ID NO: 110: CXCL10 nucleic acid sequence
SEQ ID NO: 111: CXCL9 nucleic acid sequence
SEQ ID NO: 112: NG-615 Transgene cassette
SEQ ID NO: 113: NG-640 Transgene cassette
SEQ ID NO: 114: NG-641 Transgene cassette
SEQ ID NO: 115: FLT3L amino acid sequence
SEQ ID NO: 116: MIP1α amino acid sequence
SEQ ID NO: 117: IFNα amino acid ce
SEQ ID NO: 118: CXCL9 amino acid sequence
SEQ ID NO: 119: CXCL10 amino acid sequence
SEQ ID NO: 120: NG-618 Genome
SEQ ID NO: 121: NG-618 EpCam bispecific T-cell activator nucleic acid sequence
SEQ ID NO: 122: NG-618 FAP bispecific T-cell activator nucleic acid sequence
SEQ ID NO: 123: NG-618 Transgene cassette
SEQ ID NO: 124 to 297 are linker sequences
SEQ ID NO: 298 NG-616 Genome
EXAMPLES
EXAMPLE 1
Recombinant bispecific T-cell activators were designed and proteins produced as described in this
example.
Bispecific T-cell activator engineering
Bispecific T-cell activators are ted by joining two single chain dy fragments (ScFv) of
different specificities with a flexible r linker. ScFv’s are d by the joining of VH and VL
domains from parental monoclonal antibodies by a linker. Each bispecific T-cell activator was
designed with an N-terminal signal ce for mammalian secretion and a C-terminal
decahistidine affinity tag for detection and purification. Bispecific T-cell activators were engineered
by standard DNA g techniques and ed into protein expression vectors (Figure 1). The
anti-EpCAM bispecific T-cell activator is that from patent WO 2005040220 (SEQ ID NO: 63 therein),
with a signal sequence and affinity tag added. The AP bispecific T-cell activator was created
de novo using the anti-FAP ScFv from patent WO2010037835A2 and the anti-CD3 ScFv from patent
WO 2005040220 (SEQ ID 63 therein), with a signal sequence and affinity tag added. A control
bispecific T-cell activator used the anti-FHA (filamentous haemagglutinin from Bordetella sis)
ScFv from Hussein et al, 2007 (Hussein AH et al (2007) “Construction and terization of singlechain
le fragment antibodies directed against the Bordetella pertussis surface adhesins
filamentous hemagglutinin and pertactin”. Infect Immunity 75, 5476-5482) and the anti-CD3 ScFv
from patent WO 2005040220 (SEQ ID NO: 63 therein), with a signal sequence and affinity tag added.
The DNA coding and amino acid sequences for these bispecific T-cell activators are SEQ ID NOs: 1-6.
Recombinant bispecific T-cell activator production
Recombinant bispecific T-cell tor proteins were produced by cloning the respective sequences
into the pSF-CMV vector using a CMV promoter (SEQ ID NO: 31) to drive n expression (Figure
1). The concentration of d DNA for plasmids, pSF-CMV-EpCAMbispecific T-cell activator, pSFCMV-FAPbispecific
T-cell activator and pSF-CMV-Controlbispecific T-cell activator (Table 2), were
measured via NanoDrop. Empty pSF-CMV vector is ed as a negative control. 54.7 μg of each
was diluted with 4 mL OptiMEM. 109.2 ug PEI (linear, MW 25000, Polysciences, USA) were diluted
in 4 mL OptiMEM medium and mixed with the 4ml of diluted DNA to generate DNA-PEI complexes
(DNA:PEI ratio of 1:2 (w/w)). After incubation at room temperature for 20 minutes, the complex
mixture was topped up to 18 mL with M and this transfection mixture was added to a T175
flask containing Ad293 cells at 90% confluency. After incubation of the cells with the transfection
mix for 4 hrs at 37⁰C, 5% CO2, 30 mL of cell media (DMEM high glucose with glutamine
supplemented, phenol red-free) was added to the cells and the flasks was incubated 37⁰C, 5% CO2
for 48 hours. Another flask of cells was transfected in el with pSF-CMV-GFP to ensure efficient
transfection efficiency. In order to harvest secreted protein, the supernatant of transfected cells was
collected and centrifuged at 350g at 4 °C for 5 s to remove cell components (Allegra X-15R,
Beckman Coulter). Supernatants were transferred to 10k MWCO Amicon Ultra-15 Centrifugal Filter
Units (Millipore). After spinning at 4750 rpm and 4 °C, the volume of the retentate was adjusted with
the flow h to obtain a d higher concentration. Aliquots of concentrated protein were
stored at -80°C.
Table 2
“p” employed as a prefix in naming constructs indicates that the construct is a plasmid.
Plasmid ID Coding Sequence [plasmid DNA] ng/ml
SEQ ID NO:
pSF-CMV-EpCAMbispecific T- SEQ ID NO: 1 3717
cell activator
pSF-CMV-FAPbispecific T-cell SEQ ID NO: 3 6700
activator
pSF-CMV-Controlbispecific T- SEQ ID NO: 5 5300
cell activator
pSF-Lenti-EpCAM SEQ ID NO: 27 2529.3
pSF-Lenti-FAP SEQ ID NO: 29 659.6
Recombinant bispecific T-cell activator detection
To detect the bispecific T-cell activator, the C-terminal decahistidine affinity tag can be probed with
an anti-His antibody using the technique of western blotting. Protein samples were adjusted with
lysis buffer to a final volume of 15 μL including 2,5 μL 6x Laemmli SDS Sample Buffer which contains
aptoethanol and SDS. s were incubated for 5 s at 95 °C to denature proteins
and loaded onto 15-well 10% precast polyacrylamide gels PROTEAN TGX Precast Gels,
BioRad, UK). Gels were run at 180 V for 45 minutes in 1 x running buffer within a Mini-PROTEAN
Tetra System (BioRad, UK). ns from the SDS gels were transferred onto nitrocellulose
membranes by wet electroblotting at 300 mA and 4 °C for 90 minutes in 1 x transfer buffer within a
Mini Trans-Blot Cell (BioRad, UK). Transfer was performed in presence of an ice pack to limit heat.
The nitrocellulose membrane was then blocked with 5% milk in PBS-T on a shaker for 1 hour at
room temperature, and probed with anti-His (C-term) antibody (mouse α-6xHis, clone 3D5,
Invitrogen, UK, #46-0693), diluted 1:5000 in PBS/5% milk. After incubation on a shaker overnight
at 4°C, the membrane was washed and probed with HRP-labelled onal secondary α-mouseimmunoglobulin-antibody
(1:10.000 in PBS/5% milk, Dako, #P0161) for 1 hour at room
ature. For visualization, SuperSignal West Dura Extended Duration Substrate (Thermo Fisher
ific, UK) was applied, following manufacturer’s instructions and exposed to X-ray film and
developed in an automatic film sor. The results demonstrated the expression and secretion of
bispecific T-cell activator protein from Ad293 cells transfected with the bispecific T-cell tor
expression plasmids, but not the parental vector.
Recombinant bispecific T-cell activator quantification
To measure the quantity of recombinant bispecific T-cell activator protein, the que of dot blot
was used to e the bispecific T-cell activator signal to a His-tagged (C-term 10His) protein
standard (10 x His-tagged human Cathepsin D, end, #556704). Two-fold serial dilutions of
bispecific T-cell activator samples and protein standard were prepared, and 1.5 uL of each directly
d to a nitrocellulose membrane and air-dried for 20 minutes. The blocking and staining
protocol described above for western blotting was then performed. The molar concentration of the
protein standard was adjusted to represent a bispecific T-cell activator concentration of 250μg/mL.
The results (Figure 2A) demonstrated the expression and secretion of bispecific T-cell tor
protein from Ad293 cells transfected with the bispecific T-cell activator expression plasmids.
FAP binding ELISA
The nding activity of the FAP bispecific T-cell activator and control (anti-FHA) bispecific T-
cell activator (SEQ ID NOs: 4 and 6) secreted from cells transfected with V-FAPbispecific T-
cell activator or pSF-CMV-Controlbispecific T-cell activator was assessed by enzyme-linked
immunosorbent assay (ELISA). Empty pSF-CMV vector supernatants were included as a negative
control. ELISA plates (Nunc Immuno MaxiSorp 96 well microplate) were prepared by g
overnight at 4⁰C with human FAP/seprase protein (100ng/well, Sino ical Inc, 10464-H07H-
) in PBS buffer. Plates were washed between all subsequent binding steps with PBS 0.05% Tween
. The plates were blocked for 1 hour at room temperature with 5% BSA in PBS 0.05% Tween 20.
Aliquots of bispecific T-cell activator protein, or protein harvested from empty pSF-CMV vectortransfected
wells, were diluted 10-fold into PBS/5% BSA/0.05% Tween 20. All samples were added
to the FAP coated plates and incubated for 2 hr at room temperature. The detection antibody, anti-
His m) antibody (mouse xHis, clone 3D5, Invitrogen, UK, 93), was diluted 1:1000
and applied for 1 hour at room temperature. HRP ated ouse-Fc (1:1000 in PBS/5%
milk, Dako) was then applied for 1 hr at room temperature before HRP detection was performed
with HRP substrate solution 3.3.5.5’-teramethylethylenediamine (TMB, Thermo-Fisher). Stop
solution was used for terminating the reaction and the developed colour was measured at 450nm
on a plate reader. Absorbance at 450nm was plotted for FAP bispecific T-cell activator, control
bispecific T-cell activator and empty vector supernatants, demonstrating specific binding of the FAP
bispecific T-cell activator to FAP protein. The results (Figure 2B) show the specific binding of the
FAP bispecific T-cell activator and not control bispecific T-cell activator to recombinant FAP protein.
EpCAM binding ELISA
The EpCAM-binding activity of the EpCAM bispecific T-cell activator and control bispecific T-cell
activator (SEQ ID NOs: 2 and 6) secreted from cells transfected with pSF-CMV-EpCAMbispecific T-
cell activator or pSF-CMV-Controlbispecific T-cell activator was assessed by enzyme-linked
sorbent assay (ELISA). Empty V vector supernatants are included as a negative
control. ELISA plates (A Nunc Immuno MaxiSorp 96 well late) were prepared by g
overnight at 4⁰C with human EpCAM/TROP-1 protein (50ng/well, Sino Biological Inc, #10694-
0) in PBS buffer. Plates were washed between all subsequent binding steps with PBS 0.05%
Tween 20. The plates were blocked for 1 hour at room temperature with 5% BSA in PBS 0.05%
Tween 20. Aliquots of bispecific T-cell activator n, or protein ted from empty pSF-CMV
vector-transfected wells, were diluted 10-fold into PBS/5% BSA/0.05% Tween 20. All s were
added to the EpCAM coated plates and incubated for 2 hr at room temperature. The detection
antibody anti-His (C-term) antibody (mouse anti-6xHis, clone 3D5, Invitrogen, UK, #46-0693) was
diluted 1:5000 and applied for 1 hour at room temperature. HRP conjugated anti-mouse-Fc (1:1000
in PBS/5% milk, Dako,) was then d for 1 hr at room temperature before HRP detection was
performed with HRP substrate solution 3.3.5.5’-teramethylethylenediamine (TMB, Thermo-Fisher).
Stop solution was used for terminating the reaction and the developed colour was measured at
450nm on a plate reader. Absorbance at 450nm was plotted for EpCAM bispecific T-cell activator,
control bispecific T-cell activator and empty vector supernatants demonstrating specific binding of
EpCAM ific T-cell activator to recombinant EpCAM. The results (Figure 2C) show the specific
binding of the EpCAM bispecific T-cell activator and not l bispecific T-cell activator to
recombinant EpCAM protein.
Example 2
The functional activities of recombinant bispecific T-cell activator proteins were assessed in a
number of different assays prior to constructing bispecific T-cell tor transgene-bearing EnAd
viruses.
Isolation of human peripheral blood mononuclear cells (PBMCs)
Human PBMCs were isolated by density gradient centrifugation either from fresh human blood
samples of y donors or from whole blood leukocyte cones, obtained from the NHS Blood and
Transplant UK in Oxford. In either case, the samples were diluted 1:2 with PBS and 25 mL of this
mixture was layered onto 13 mL Ficoll (1.079g/mL, Ficoll-Paque Plus, GE Healthcare) in a 50 mL
Falcon tube. Samples were centrifuged (Allegra X-15R, n Coulter) at 1600 rpm for 30
minutes at 22 °C with the lowest deceleration setting to preserve phase separation. After
fugation, 4 layers could be ed which included a plasma layer at the top, followed by an
interface containing PBMCs, a Ficoll layer and a layer of red blood cells and granulocytes at the
bottom. The PBMCs were collected using a Pasteur pipette and washed twice with PBS (1200 rpm
for 10 minutes at room temperature) and re-suspended in RPMI medium supplemented with 10%
Isolation of CD3-positive T-cells
sitive (CD3+) T-cells were ted from PBMCs by depletion of non-CD3 cells using a Pan T
Cell Isolation Kit (Miltenyi Biotec, #130535), according to the manufacturer’s protocol.
Processing primary ascites samples
Primary human ascites samples were received from the gy ward of the Churchill Hospital
(Oxford University Hospitals) from patients with multiple indications, including but not limited to
ovarian, atic, breast and gastric cancer. Upon receipt, cellular and fluid fractions were
separated, with aliquots of fluid frozen at -20oC for storage and future analysis. The cellular fraction
was d with red blood cell lysis buffer (Roche, #11814389001) to remove red blood cells,
following the manufacturer’s ctions. Cell types present in each sample was determined by
staining for EpCAM, EGFR, FAP, CD45, CD11b, CD56, CD3, CD4, CD8, PD1 and CTLA4 and analysed
by flow cytometry. Cells were then used fresh for ex vivo T-cell activation and target cell lysis
experiments. In some cases, the cells were passaged in DMEM supplemented with 10% FBS for use
in later experiments.
Cell line maintenance
All cell lines were maintained in DMEM (Sigma-Aldrich, UK) or RPMI medium (Sigma-Aldrich, UK)
as ied in Table 3, mented with 10% (v/v) foetal bovine serum (FBS, GibcoTM ) and 1%
(v/v) Penicillin/Streptomycin (10 mg/mL, Sigma-Aldrich, UK), in a humidified incubator (MCO-
17AIC, Sanyo) at 37°C and 5% CO2, unless otherwise specified. Cells were split every 2 to 3 days
before reaching confluency by enzymatic dissociation with Trypsin/EDTA (0.05% n 0,02%
EDTA, Sigma-Aldrich, UK). In this s, culture medium was aspirated and cells were washed
with 15 ml of PBS and subsequently cells were treated with 2 mL of Trypsin/EDTA for 2-10 minutes
at 37 °C. Trypsin was neutralized with 10 mL of DMEM containing 10% FBS and a portion of the cells
was transferred into new flasks containing fresh medium. For routine cell culture, media was
supplemented with 10% FBS, for infections and virus plasmid transfections with 2% FBS and for
recombinant bispecific T-cell activator plasmid transfections with no FBS supplement.
Table 3
Cell line Origin of cells Culturing Media Source
Ascites-derived cell Human primary ascites DMEM NHS Blood &
lines Transplant UK
BTC100 Human primary lung cancer- DMEM University of Oxford
ated fibroblasts (CAF)
CHO-K1 Chinese hamster ovary, RPMI ATCC
adherent
CHO-K1 stable cell Chinese hamster ovary, RPMI -
lines adherent
DLD1 Human colorectal RPMI ATCC
adenocarcinoma
HEK 293A Human nic kidney, DMEM ATCC
adherent
HEK 293A stable cell Human embryonic kidney, DMEM -
lines adherent
HEK 293T Human embryonic kidney, DMEM ATCC
MCF-7 Human, mammary gland, breast, DMEM ATCC
Normal human Normal adult human primary DMEM ATCC
dermal fibroblasts dermal fibroblasts
(NHDF)
SKOV3 Human ovarian DMEM ATCC
arcinoma
Statistics
In cases where two conditions were being compared, statistical analyses were performed using a ttest.
In all other cases, statistical analyses were performed by using a One-way ANOVA.
Characterisation of human T-cell tion by recombinant FAP bispecific T-cell tor
The ability of the FAP bispecific T-cell activator to induce T-cell activation in the presence or absence
of normal human dermal fibroblast (NHDF) cells was compared. Human CD3+ T-cells (70,000 cells
per well in 96-well U-bottom plates) were co-cultured alone or with NHDF cells (10:1 T:NHDF) in
the presence of media alone or 300 ng/mL FAP or control bispecific T-cell activator. Cells were cocultured
for 24 hours at 37°C and subsequently harvested with enzyme-free cell dissociation buffer
(Thermo, #13151014). The expression levels of CD69 (Figure 3A) and CD25 (Figure 3B) on CD45+
T-cells were then ed by antibody ng and flow cytometry and ented as geometric
mean fluorescence (gMFI) values. Plate-immobilised anti-CD3 antibody (7.5 μg/mL) was used as
positive control for T cell activation. The FAP bispecific T-cell activator selectively induced the
expression of activation markers CD69 and CD25 on T-cells, indicating that it was able to activate T
cells.
In a second similar experiment, T-cells were assessed by intracellular cytokine staining 6 hr after
co-culture with NHDF cells (200,000 CD3+ cells plus 40,000 NHDF in wells of a 96-well plate) and
300ng/mL FAP or control bispecific T-cell activator. CD45 + T-cells were ellularly stained for
IFNγ expression with Brefeldin A added into the culture medium 5 hours before harvest. As a
positive control, T-cells were stimulated with soluble PMA (10ng/mL) and cin (1μg/mL). The
results shown in Figure 4A indicate that the FAP bispecific T-cell activator in the presence of NHDF
resulted in a significantly higher number of IFNγ expressing T-cells compared to the control
bispecific T-cell tor.
A r set of experiments to those in example 2 were run to characterize the recombinant EpCAM
bispecific T-cell activator n.
Characterisation of human T-cell activation by inant EpCAM bispecific T-cell activator
The ability of the EpCAM bispecific T-cell activator to induce T-cell activation in the presence or
absence of the EpCAM-positive DLD cell line was compared. Human CD3+ T-cells (70,000 cells per
well in 96-well U-bottom plates) were co-cultured alone or with DLD cells (10:1 T:DLD) in the
presence of media alone or 600 ng/mL EpCAM or control ific T-cell activator. Cells were ured
for 24 hours at 37 °C and subsequently harvested with enzyme-free cell dissociation buffer.
The expression levels of CD69 and CD25 on CD45+ T-cells were then analysed by antibody staining
and flow cytometry and data represented as geometric mean fluorescence (gMFI) values. Plateimmobilised
D3 dy (7.5μg/mL) was used as positive control for T cell activation. The
EpCAM bispecific T-cell activator selectively induced the expression of activation markers CD69 and
CD25 on T-cells, indicating that it was able to activate T cells (Figure 4B & C).
In a similar experiment, T-cells were assessed by intracellular cytokine staining 6 hr after co-culture
with DLD cells (200,000 CD3+ T-cells plus 40,000 DLD cells per well of a 96-well plate) and
300ng/mL EpCAM or control bispecific T-cell activator. CD45 + T-cells were ellularly stained
for IFNγ expression with Brefeldin A added into the culture medium 5 hours before harvest. As a
positive l, T cells were stimulated with soluble PMA (10ng/mL) and ionomycin (1μg/mL). The
results showed that the EpCAM bispecific T-cell activator in the presence of DLD resulted in a
significantly higher number of IFNγ expressing s ed to the control bispecific T-cell
activator (Figure 5A).
In another similar experiment, PBMCs from 8 different blood donors were used to evaluate donordependent
variations in bispecific T-cell activator-mediated T-cell activation. DLD (7,000 cells) were
tured with 100,000 PBMC in a U-bottom 96 well plate in the presence of media alone or
mL of control or EpCAM bispecific T-cell activator. Cells were co-cultured for 24 hours at
37°C and uently harvested. The expression levels of CD69 and CD25 on CD45+ T-cells were
then analysed by antibody staining and flow cytometry and data represented as geometric mean
fluorescence (gMFI) values. The results showed that the EpCAM bispecific T-cell activator induced
the expression of activation markers CD69 and CD25 in CD3+ T-cells from all 8 donors (Figure 5B &
Example 4
In this example, the ability of recombinant FAP bispecific T-cell activator-activated T-cells to induce
death of the last target cells was evaluated.
FAP bispecific T-cell activator induces T cell-mediated lysis of FAP-positive cell lines and
primary cells
NHDF (7,000 cells) were co-cultured with 70,000 T-cells in wells of a U-bottom 96 well plate in the
presence of media alone or 300 ng/mL of control or FAP bispecific T-cell tor. After 24 hours of
ture, supernatants were harvested and cytotoxicity determined by LDH assay following the
manufacturer’s instructions. The results are in Figure 6A show that the FAP bispecific T-cell
tor significantly increased lysis of NHDF cells.
In a similar experiment, 7,000 primary lung last cells (BTC100) were co-cultured with 70,000
CD3 + T-cells with or without 300 ng/mL of control or FAP bispecific T-cell activator. After 24 hours
of co-culture, supernatants were harvested and cytotoxicity determined by LDH assay. The results
in Figure 6B & C show that the FAP bispecific T-cell activator significantly increased lysis of primary
human cancer associated fibroblast (CAF) cells. Expression of FAP by these and other patientderived
cell lines is shown in Figure 7.
The dose-response relationship for FAP bispecific T-cell activator-mediated cell lysis was ted
by co-culturing 8,000 NHDF cells with 40,000 T-cells and bispecific T-cell tor concentrations
ranging from 2×103 to 2×10-2 ng/mL. After co-culture for 24 hours at 37°C, an LDH assay was
med on supernatants to determine target cell cytotoxicity. Dose response curves were fitted
using a four parameter non-linear fit model integrated into GraphPad Prism, generating an EC50
value for the FAP bispecific T-cell activator of 3.2ng/mL. The results (Figure 8A) show a dosedependent
relationship between FAP ific T-cell activator concentration and cytotoxicity as
measured by LDH assay (shown as Abs490 ).
Example 5
Similar s to those in example 4 were used to demonstrate the ability of recombinant EpCAM
bispecific T-cell activator-activated T-cells to induce death of target tumour cells was evaluated.
EpCAM bispecific T-cell activator s T cell-mediated lysis of EpCAM-positive cell lines
DLD tumour cells (7,000 cells) were co-cultured with 70,000 T-cells in wells of a U-bottom 96 well
plate in the presence of media alone or 300ng/mL of control or EpCAM bispecific T-cell activator.
After 24 hours of co-culture, supernatants were harvested and cytotoxicity determined by LDH
assay. The results in Figure 8B show that the EpCAM bispecific T-cell activator significantly
increased lysis of DLD cells (EpCAM expression on DLD cells is shown in Figure 8C).
In a similar ment, 4,000 SKOV cells were co-cultured with 40,000 CD3+ s with or without
300 ng/mL of control or EpCAM bispecific T-cell activator. After 24 hours of co-culture, supernatants
were harvested and cytotoxicity determined by LDH assay. The s in Figure 9A show that the
EpCAM bispecific T-cell activator significantly increased lysis of SKOV cells.
In another similar experiment, 5,000 MCF7 cells were co-cultured with 50,000 CD3+ s with or
without 300 ng/mL of control or EpCAM bispecific T-cell activator. After 24 hours of co-culture,
supernatants were harvested and cytotoxicity determined by LDH assay. The results in Figure 9B
show that the EpCAM bispecific T-cell activator also significantly increased lysis of MCF7 cells.
The dose-response relationship for EpCAM bispecific T-cell activator-mediated cell lysis was
evaluated by co-culturing 8,000 DLD with 40,000 T-cells and EpCAM or control bispecific T-cell
activator concentrations ranging from 2×103 to 2×10-2 ng/mL. After co-culture for 24 hours at 37°C,
an LDH assay was performed on supernatants to ine target cell cytotoxicity. Dose response
curves were fitted using a four parameter near fit model ated into GraphPad Prism,
ting an EC50 value for the EpCAM bispecific T-cell activator of 7.4ng/mL. The results in Figure
show a dose dependent relationship between EpCAM bispecific T-cell activator concentration
and cytotoxicity.
In sion, the results of this example demonstrate that the EpCAM bispecific T-cell activator was
able to induce T-cell ed lysis of multiple EpCAM-positive tumour cell lines.
Example 6
Stable FAP sing CHO and Ad293 cell lines were generated as a means to demonstrate the
FAP antigen specificity of the FAP bispecific T-cell tor by comparing to parental
untransfected cells.
Generation of FAP-expressing stable-transfected cell lines
The n sequence of the FAP gene was obtained from the NCBI database (SEQ ID 30), reverse
transcribed to generate a DNA coding sequence that was synthesised by Oxford Genetics Ltd (Oxford,
UK). The FAP gene was cloned into pSF-Lenti vector by standard cloning techniques producing the
pSF-Lenti-FAP vector. HEK293T cells were transfected with the lentivirus FAP expression vector
alongside pSF-CMV-HIV-Gag-Pol, pSF-CMV-VSV-G, V-HIV-Rev. Lipofectamine 2000 was used
as a transfection reagent and was added to the vector DNA at a DNA:lipofectamine ratio of 1:2, and
incubated with the cells at 37°C. Supernatant containing lentivirus was harvested 48 hours later and
mixed with polybrene (final concentration, 8μg/mL). The Lentivirus/polybrene mixture was added
to seeded Ad293 or CHO cells and incubated at 37°C. On day 4, the supernatant was ged for
media containing cin (2μg/mL for Ad293 and 7.5μg/mL for CHO). Stable variants were then
clonally selected and FAP expression of the parental cell lines or stable-transfected variant was
determined by staining with FAP or isotope control antibody and analysed by flow cytometry
(Figure 11A).
FAP bispecific T-cell activator-mediated target cell lysis is specific to FAP-expressing cells
CHO or CHO-FAP cells (7,000 cells) were co-cultured alone or with human T-cells (70,000) in the
presence of media alone or 2μg/mL l or FAP bispecific T-cell activator in wells of a U-bottom
96-well plate. After 24 hours incubation, supernatants were harvested and target cell cytotoxicity
ed by LDH cytotoxicity assay as described in example 4 (Figure 11B). T-cell tion was
also determined by analysing the expression levels of CD69 and CD25 via flow cytometry (Figure
12). Cytotoxicity was only observed when CHO-FAP cells were cultured with T-cells and FAP
bispecific T-cell activator. This indicates that FAP bispecific T-cell activator mediated T-cell
activation and target cell lysis is highly specific and limited to FAP-expressing cells, and not the FAP-
negative parental cell line.
Example 7
Stable EpCAM expressing CHO amd Ad293 cell lines were ted as a means to demonstrate the
EpCAM antigen specificity of the EpCAM bispecific T-cell activator by comparing to parental
untransfected cells.
tion of EpCAM-expressing stable-transfected cell lines
The protein sequence of the EpCAM gene was ed from NCBI database (SEQ ID 28), reverse
transcribed to generate a DNA coding sequence that was synthesised by Oxford Genetics Ltd (Oxford,
UK). The EpCAM gene was cloned into pSF-Lenti vector by standard cloning techniques producing
the pSF-Lenti-EpCAM vector. HEK293T cells were transfected with lentivirus EpCAM expression
vector alongside pSF-CMV-HIV-Gag-Pol, pSF-CMV-VSV-G, pSF-CMV-HIV-Rev. Lipofectamine 2000
was used as a ection reagent and was added to the vector DNA at a DNA:lipofectamine ratio of
1:2, and incubated with the cells at 37°C. Supernatant containing lentivirus was harvested 48 hours
later and mixed with polybrene (final concentration, 8μg/mL). The Lentivirus/polybrene e
was added to seeded Ad293 or CHO cells and incubated at 37°C. On day 4, the supernatant was
exchanged for media ning puromycin (2μg/mL for Ad293 and 7.5μg/mL for CHO). Stable
variants were then clonally selected and EpCAM expression of the parental cell lines or stabletransfected
variant was determined by staining with EpCAM or isotope control antibody and
ed by flow cytometry (Figure 13A).
EpCAM bispecific T-cell activator-mediated target cell lysis is specific to expressing cells
CHO or CHO-EpCAM cells (7,000 cells) were co-cultured alone or with human T-cells 0) in the
presence of media alone or 2μg/mL control or EpCAM bispecific T-cell activator in wells of a U-
bottom 96-well plate. After 24 hours incubation, supernatants were harvested and target cell
cytotoxicity measured by LDH cytotoxicity assay (Figure 13B). T-cell activation was also determined
by analysing the expressions levels of CD69 and CD25 via flow cytometry e 14). xicity
was only observed when CHO-EpCAM cells were cultured with T-cells and EpCAM bispecific T-cell
activator. This indicates that EpCAM bispecific T-cell activator mediated T-cell activation and target
cell lysis is highly ic and limited to EpCAM-expressing cells, and not the EpCAM-negative
parental cell line.
Example 8
In a further experiment, the ability of the recombinant FAP bispecific T-cell tor protein to
activate CD4 or CD8 s and the ability of each of these T-cell subsets to lyse NHDF cells was
assessed. CD3+ T-cells (35,000) were co-cultured with 7,000 NHDF cells in the ce of
300ng/mL control or FAP bispecific T-cell activator in wells of a U-bottom 96 well plate, and
incubated at 37°C for 24 hours. Cells were ted and stained with antibodies to CD4 or CD8 and
CD69 and CD25, and analysed by flow cytometry. The results (Figure 15A) demonstrated that the
FAP bispecific T-cell activator induced an increase in activation s CD69 and CD25 in both
CD4 + and CD8+ T-cells.
In a similar ment, the ability of each T-cell subset (CD4 and CD8) to kill target cells was
assessed. CD4+ T-cells were extracted from rified cells by positive selection using a CD4 T
Cell Isolation Kit (Miltenyi Biotec, #130101), according to the manufacturer’s protocol, with
the CD8 cells within non-isolated flow-through. In wells of a U-bottom 96-well plate, 7,000 NHDF
were co-cultured with 35,000 CD4+ or CD8+ T-cells together with 300ng/mL of control or FAP
bispecific T-cell activator and incubated at 37°C. After 24 hours, supernatants were harvested and
target cell cytotoxicity measured by LDH cytotoxicity assay. The results (Figure 15B) show that the
FAP ific T-cell activator induced both CD4+ and CD8+ T-cells to kill NHDF cells.
Example 9
The ability of the EpCAM bispecific T-cell tor to activate CD4+ or CD8+ T-cells and the ability of
each subset to lyse DLD tumour cells was assessed. CD3+ T-cells (35,000) were co-cultured with
7,000 DLD cells in the presence of mL control or EpCAM bispecific T-cell activator in wells of
a U-bottom 96 well plate, and incubated at 37°C for 24 hours. Cells were harvested and stained with
antibodies for CD4 or CD8 and CD69 and CD25, and analysed by flow cytometry. The results (Figure
16A) trated that the EpCAM bispecific T-cell tor induced an increase in activation
markers CD69 and CD25 in both CD4+ and CD8+ T-cells.
In a similar ment, the ability of each T-cell subset (CD4 and CD8) to kill target cells was
assessed. CD4+ T-cells were extracted from CD3-purified cells by positive selection using CD4 T Cell
Isolation Kit according to the manufacturer’s protocol, with the CD8 cells within non-selected flowthrough.
In wells of a U-bottom 96-well plate, 7,000 DLD were co-cultured with 35,000 CD4+ or CD8+
T-cells with 300ng/mL of control or EpCAM bispecific T-cell activator and incubated at 37°C. After
24 hours, supernatants were harvested and target cell cytotoxicity measured by LDH cytotoxicity
assay (Figure 16B). The results show that the EpCAM bispecific T-cell activator induced both CD4+
and CD8+ T-cells to kill DLD cells.
Example 10
Characterising FAP bispecific T-cell activator-mediated activation of autologous tumourassociated
lymphocytes from primary malignant s
To evaluate the activity of bispecific T-cell activator proteins using cancer patient d cells,
samples of y malignant ascetic fluids containing both CD3+ T-cells and FAP+ cells were
obtained for testing. Unpurified ascites cells fore unchanged from when received) were
seeded at 250,000 cells per well of a U-bottom 96-well plate in either 100% ascites fluid or medium
supplemented with 1% human serum in the presence of 500 ng/mL control or FAP bispecific T-cell
activator. Untreated wells served as negative controls. After incubation at 37°C for 5 days, the total
cell tion was ted and the numbers of CD3 + T-cells (Figure 17A) and expression levels
of CD25 on CD3+ T-cells were determined (Figure 17B). Total cell numbers per well were ined
using precision ng beads. The results demonstrate that the FAP bispecific T-cell activator
resulted in significant se in T-cell activation of the tumour-associated T-cells from cancer
patients.
As an ion of the experiment above, replicate wells were harvested and the number of FAP +
cells determined by flow cytometry (Figure 17C). Total cell numbers per well were determined using
precision counting beads. The results show that the FAP bispecific T-cell activator resulted in a
significant decrease in numbers of autologous FAP-expressing cells in the s sample.
Example 11
Recombinant ific T-cell activator-expressing EnAd viruses were engineered, produced and
purified using the methods described below.
tion of ific T-cell activator-expressing Enadenotucirev
EnAd is a replication ent chimeric group B adenovirus that contains frequent nonhomologous
nucleotide substitutions of Ad3 for Ad11p in the E2B region, a nearly complete E3
deletion and a r E4 deletion mapped to E4orf4 (Kuhn et al, Directed evolution generates a
novel oncolytic virus for the treatment of colon cancer, PLoS One, 2008 Jun 18; 3(6): e2409). A
schematic representation of the genome of the adenoviruses used in this study is shown in Figure
The plasmid pEnAd2.4 was used to generate the plasmids pEnAd2.4-CMV-EpCAMbispecific T-cell
activator, pEnAd2.4-SA-EpCAMbispecific T-cell activator, pEnAd2.4-CMV-FAPbispecific T-cell
activator, pEnAd2.4-SA-FAPbispecific T-cell activator, .4-CMV-Controlbispecific T-cell
activator, pEnAd2.4-SA-Controlbispecific T-cell activator (Table 4) by direct insertion of a cassette
encoding the EpCAM bispecific T-cell activator (SEQ ID NO: 1), FAP bispecific T-cell activator (SEQ
ID NO: 3) or Control bispecific T-cell activator (SEQ ID NO: 5). The transgene cassette contained a 5’
short splice acceptor sequence (SEQ ID NO: 33) or an exogenous CMV promoter (SEQ ID NO: 31), the
EpCAM, FAP or control bispecific T-cell activator cDNA sequence and a 3’ polyadenylation sequence
(SEQ ID NO: 32). Construction of the plasmid was confirmed by DNA sequencing. The exogenous
CMV promoter is constitutively active and thus leads to early expression of transgenes. The splice
acceptor sequence drives expression under the control of the viral major late promoter and leads to
later transgene expression following initiation of virus genome replication. The kinetics of this
promotor-driven expression can be observed in Figure 18B, in which GFP was used as the transgene.
Table 4
Plasmid ID [plasmid DNA] ng/ml
pEnAd2.4-CMV-EpCAMbispecific T-cell activator 205.3
pEnAd2.4-SA-EpCAMbispecific T-cell activator 325.2
.4-CMV-FAPbispecific T-cell activator 1322.8
pEnAd2.4-SA-FAPbispecific T-cell activator 3918.3
pEnAd2.4-CMV-Controlbispecific T-cell activator 189.1
pEnAd2.4-SA-Controlbispecific T-cell activator 236.2
pEnAd2.4-CMV-FAPbispecific T-cell tor-RFP 1599
pEnAd2.4-SA-FAPbispecific T-cell activator-RFP 1872
pEnAd2.4-CMV-Controlbispecific T-cell activator-RFP 1294
pEnAd2.4-SA-Controlbispecific T-cell activator-RFP 2082
Virus Production and characterisation
The plasmids EnAd2.4-CMV-EpCAMbispecific T-cell activator, pEnAd2.4-SA-EpCAMbispecific T-cell
activator, .4-CMV-FAPbispecific T-cell activator, pEnAd2.4-SA-FAPbispecific T-cell activator,
pEnAd2.4-CMV-Controlbispecific T-cell activator, pEnAd2.4-SA-Controlbispecific T-cell activator
were linearised by restriction digestion with the enzyme AscI to produce the liner virus genome.
Digested DNA was purified by isopropanol extraction and precipitated for 16hrs, -20⁰C in 300μl
>95% lar biology grade ethanol and 10μl 3M Sodium Acetate. The precipitated DNA was
pelleted by centrifuging at 14000rpm, 5 mins and was washed in 500μl 70% ethanol, before
fuging again, 14000rpm, 5mins. The clean DNA pellet was air dried and resuspended in 100μL
water. 6.25 µg DNA was mixed with 15.6μL lipofectamine transfection reagent in OptiMEM and
incubated for 20 mins, RT. The ection mixture was then added to a T-25 flask containing
Ad293 cells grown to 80% confluency. After incubation of the cells with the ection mix for
4hrs at 37⁰C, 5% CO2 4mls of cell media (DMEM high glucose with glutamine supplemented with
% FBS) was added to the cells and the flasks was incubated 37⁰C, 5% CO2. The transfected Ad293
cells were monitored every 24hrs and were mented with additional media every 48-72hrs.
The production of virus was monitored by observation of a significant cytopathic effect (CPE) in the
cell monolayer. Once extensive CPE was observed the virus was harvested from Ad293 cells by three
freeze-thaw cycles. Single virus clones were selected by serial diluting harvested lysate and reinfecting
Ad293 cells, and harvesting wells containing single plaques. Serial infections of Ad293 cells
were performed once an infection had reached full CPE in order to y the virus stocks. Viable
virus production during ication was confirmed by observation of significant CPE in the cell
monolayer.
Virus Purification
Once potent virus stocks were amplified the viruses were purified by double m chloride
density gradient centrifugation ng) to produce NG-601, NG-602, NG-603, NG-604, NG-605 and
NG-606 virus stocks. These stocks were titred by micoBCA assay (Life Technologies), following
manufacturer’s instructions (Table 5).
Table 5
Virus Genome TCID50/
EnAd ID NG ID NO: vp/mL
SEQ ID mL
EnAd-CMV-EpCAMbispecific T-cell
NG-601 SEQ ID NO: 34 2.2494x1012 1.26x1011
activator
EnAd-SA-EpCAMbispecific T-cell
NG-602 SEQ ID NO: 35 6x1012 1.58x1011
activator
EnAd-CMV-Controlbispecific T-cell
NG-603 1.42607x1012 5.01x1010
activator
EnAd-SA-Controlbispecific T-cell
NG-604 3.31073x1012 2.00x1011
activator
EnAd-CMV-FAPbispecific T-cell
NG-605 SEQ ID NO: 36 1.64653x1012 1.58x1011
activator
EnAd-SA-FAPbispecific T-cell
NG-606 SEQ ID NO: 37 1.28148x1012 3.98x1010
activator
EnAd-CMV-Controlbispecific T-cell
NG-607 5.963x1012 1.26x109
activator-P2A-RFP
EnAd-SA-Controlbispecific T-cell
NG-608 1.51848x1012 6.31x109
activator-P2A-RFP
EnAd-CMV-FAPbispecific T-cell
NG-609 1.57517x1012 7.94x109
activator-P2A-RFP
A-FAPbispecific T-cell
NG-610 7.74881x1011 5.01x1010
activator-P2A-RFP
Example 12
The activities of NG-601, NG-602, , NG-604, NG-605 and NG-606 viruses were characterised
using the methods described below.
Characterisation of bispecific T-cell activator encoding EnAd activity compared to EnAd in
carcinoma cell lines
The ability , NG-602, NG-603, NG-604, NG-605, NG-606 or EnAd to ate was analysed by
infection of A549 lung carcinoma cells and ed by qPCR. A549 cells were seeded in wells of a
24-well plate at a cell y of 2x105 cells/well. Plates were ted for 18 hrs, 37⁰C, 5% CO2,
before cells were either infected with 100 virus particles per cell (ppc) or were left uninfected. Wells
were harvested 24, 48 or 72 hrs post infection and DNA purified using PureLink genomic DNA mini
kit (Invitrogen) according to the manufacturer’s protocol. Total viral genomes were quantified by
qPCR with each extracted sample or standard using an EnAd hexon gene specific primer-probe set
in the reaction mix detailed in Table 6. qPCR was performed as per the programme in Table 7.
Table 6
Reagent Volume/well (μl)
2 × qPCRBIO Probe Mix (PCRBiosystems) 10
EnAd Forward primer 0.08
EnAd Reverse primer 0.08
EnAd Probe 0.8
NFW 4.04
Sample 5
Well Volume 20
Table 7
Duration
No. Cycles Temperature (⁰C)
(secs)
1 95 120
95 5
60-65 20-30
Quantification of the number of detected virus genomes per cell demonstrated that NG-601, NG-602,
NG-603, NG-604, , NG-606 and EnAd virus replication were comparable in the A549 cell line
(Figure 19A).
Oncolytic activity of NG-601, NG-602, NG-603, NG-604, NG-605, NG-606 or EnAd was assessed by
infection of A549 (Figure 19B). A549 cells were seeded in 96-well plate at a cell density of 1.5x104
well. Plates were incubated for 18 hrs, 37⁰C, 5% CO2, before cells were infected with increasing
ppc of virus (5-fold serial dilution, 4.1x10-7 to 5000 virus ppc) or were left uninfected. A549
cytotoxicity was measured on day 5 by CellTiter 96® AQueous One Solution Cell Proliferation Assay
(MTS) (Promega, # G3582). Dose response curves were fitted using a four ter non-linear fit
model integrated into GraphPad Prism. IC50 values generated for each virus demonstrated that the
oncolytic activities of NG-601, NG-602, NG-603, NG-604, , NG-606 and EnAd was able
for each virus.
Confirmation of functional bispecific T-cell activator transgene sion from NG-601, NG-
602, NG-603, NG-604, NG-605, NG-606
To ine whether the viruses NG-601, NG-602, NG-605, NG-606 produced functional bispecific
T-cell activators, T-cell activation assays using CHO, CHO-EpCAM and CHO-FAP cell lines as target
cells were med. 10,000 target cells were co-cultured with 50,000 CD3+ T-cells in wells of a U-
bottom 96-well plate with Ad293 viral supernatants diluted 100-fold in culture medium and
incubated for 24 hrs, 37⁰C, 5% CO2. T-cells were harvested and stained with dies specific for
CD25 and CD69 and analysed by flow cytometry. The results (Figures 20A and 20B) indicated that
the viruses NG-601 and NG-602 expressed a functional bispecific T-cell activator transgene that
activated T cells when co-cultured with CHO-EpCAM cells, and NG-605 and NG-606 expressed a
functional bispecific T-cell activator ene that activated T cells when co-cultured with CHO-FAP
cells, but not when co-cultured with CHO cells.
Quantification of bispecific T-cell activator expression in a colon carcinoma cell line
The quantity of bispecific T-cell activator expression by NG-601, NG-602, NG-605, NG-606 ion
of the human colon oma cell line DLD was assessed. DLD cells were seeded in 6 well culture
plates at a density of 1.2x106 cells per well. 18 hrs post-seeding, DLD cells were infected with EnAd,
NG-601, NG-602, NG-603, NG-604, NG-605, NG-606 at 100 ppc. Cells were cultured for 72 hrs before
the supernatants were collected from the wells and centrifuged for 5 mins, 1200rpm to remove cell
debris. The clarified supernatants were then used for a killing assay, with cytotoxicity compared to
a standard curve generated with a recombinant bispecific T-cell activator of known concentration,
ng determination of quantity of ific T-cell activator in viral supernatants.
To determine the ty of FAP bispecific T-cell activator produced from NG-605 and NG-606, a
cytotoxicity assay was performed in which 8,000 NHDF were co-cultured with 40,000 CD3+ T-cells
and DLD viral supernatants diluted 1 in103, 1 in 104 and 1 in 105. A standard curve was generated
by incubating NHDF and CD3+ T-cells with FAP or control bispecific T-cell activator at 10-fold serial
dilutions from 3333 to 3.33x10-4 ng/μL. Supernatants were ted 24 hour post-treatment and
cytotoxicity measured by LDH assay. Quantity of bispecific T-cell activator expressed was
ined by ing xicity of viral supernatants to that of the inant bispecific T-
cell activator standard curve. The results (Figure 21) indicated that the viruses NG-605 and NG-606
produced 9.8 and 49.2 μg FAP bispecific T-cell activator per million DLD cells, respectively.
To determine the quantity of EpCAM bispecific T-cell activator produced from NG-601 and NG-602,
a cytotoxicity assay was performed in which 8,000 DLD cells were co-cultured with 40,000 CD3+ T-
cells and DLD viral supernatants diluted 1 in103, 1 in 104 and 1 in 105. A standard curve was
generated by incubating DLD and CD3+ T-cells with EpCAM or control bispecific T-cell tor at
-fold serial dilutions from 3333 to 0-4 ng/μL. Supernatants were harvested 24 hour posttreatment
and cytotoxicity ed by LDH assay (Figure 22). Quantity of bispecific T-cell activator
expressed was determined by comparing cytotoxicity of viral supernatants to that of the
recombinant bispecific T-cell activator standard curve. The results indicated that the viruses NG-
601 and NG-602 produced 165 and 50.3 μg EpCAM bispecific T-cell activator per million DLD cells,
respectively.
Example 13
In addition to encoding a FAP or Control bispecific T-cell activator, the , NG-608, NG-609, NG-
610 viruses also carry a red fluorescent protein (RFP) transgene for visualization of infected cells
using fluorescent microscopy methods (SEQ ID NOS: 25 & 26, Table 4). The functional activities of
these viruses were terised using the methods described below.
Confirmation of ene expression from NG-607, NG-608, NG-609, NG-610
The ability of s NG-607, NG-608, NG-609 and NG-610 to produce their bispecific T-cell
activator transgene was assessed by infection of Ad293 cells. Ad293 cells were plated in a 6-well
plate at 1x106 cells/well. Plates were incubated for 24 hrs, 37⁰C, 5% CO2, before cells were infected
with viruses at 100 ppc or were left uninfected. At 48 hours post-infection, plaques were irradiated
with a fluorescent mercury lamp and raphed e 23). The results suggested that the
viruses NG-607, NG-608, NG-609 and NG-610 express the RFP transgene.
Example 14
In the next series of experiments, the ability of EnAd and FAP or control bispecific T-cell activator
viruses NG-603, NG-604, NG-605, NG-606, NG-607, NG-608, NG-609, NG-610 to kill target cells,
including tumour cells and fibroblasts, was evaluated.
In the first study, the ability of EnAd to kill DLD cells was assessed using xCELLigence technology.
DLD cells were plated in a 48-well E-plate at 1.2x10 4 cells/well and incubated for 18 hrs, 37⁰C, 5%
CO 2, before cells were either ed with 100 EnAd ppc or were left uninfected. gence was
used to measure target cell cytotoxicity every 15 minutes over an 8 day tion . The
results e 24A) suggest that EnAd was able to kill DLD cells effectively over the time period.
In a similar ment, the ability of EnAd to kill SKOV cells was assessed using xCELLigence
technology. SKOV cells were plated in a 48-well E-plate at 1x104 cells/well and incubated for 18 hrs,
37⁰C, 5% CO2, before cells were either ed with 100 EnAd ppc or were left uninfected.
xCELLigence was used to measure target cell cytotoxicity every 15 s for a period of 8 days.
The results (Figure 24B) suggest that SKOV cells are resistant to EnAd-mediated cytotoxicity over
this time frame.
In a similar experiment, the ability of EnAd to kill NHDF cells was also ed using xCELLigence
technology. NHDF cells were plated in a 48-well E-plate at 4x103 cells/well and incubated for 18 hrs,
37⁰C, 5% CO2, before cells were either infected with 100 EnAd ppc or were left uninfected.
xCELLigence was used to measure target cell cytotoxicity every 15 minutes over the same time
period as for A549 and SKOV cells. The results (Figure 24C) suggest that EnAd is unable to kill NHDF
cells in the period of time observed.
In a similar experiment, the ability of NG-603, NG-604, NG-605, NG-606 and EnAd to kill NHDF cells
was assessed in co-culture with SKOV tumour cells and CD3+ T-cells using xCELLigence. NHDF cells
and SKOV cells were seeded in a 48-well E-plate at 4x10 3 and 1x103 cells/well, respectively. Plates
were incubated for 18 hrs, 37⁰C, 5% CO2, before cells were either infected with 100 ppc of EnAd, of
NG-603, NG-604, NG-605 or NG-606 or were left uninfected. After 2 hour incubation, 37,500 CD3+
T-cells were added to each well. xCELLigence was used to measure target cell cytotoxicity every 15
minutes. The results (Figure 25A) demonstrate that the FAP bispecific T-cell activator-expressing
viruses NG-605 and NG606, but not EnAd or control bispecific T-cell activator-expressing viruses
NG-603 and NG-604, were able to induce lysis of NHDF cells, with cs dependent on the
promoter used for ific T-cell activator expression (faster with CMV promoter).
In a similar experiment, the ability of NG-603, NG-604, NG-605, NG-606 and EnAd to kill NHDF cells,
was assessed in co-culture with SKOV and CD3+ s using LDH cytotoxicity assay. NHDF cells and
SKOV cells were seeded in a 96-well U-bottom plate at 8x103 and 2x103 cells/well, respectively, and
either infected with 100 ppc of EnAd, of , NG-604, NG-605 or NG-606 or were left cted.
After 2 hour incubation, 75,000 CD3+ T-cells were added to each well and plates were ted at
37⁰C, 5% CO2. Supernatants were harvested at 0, 24, 48 and 96 hours post-treatment and
cytotoxicity measured by LDH cytotoxicity assay. The results (Figure 25B) demonstrate that the FAP
bispecific T-cell activator-expressing viruses NG-605 and NG606, but not EnAd or l bispecific
T-cell activator-expressing viruses NG-603 and NG-604, were able to induce lysis of NHDF cells, with
kinetics dependent on the promoter used for bispecific T-cell activator expression.
As an extension of the LDH experiment above, the cells were also harvested at 0, 24, 48 and 96 hours
post-treatment, stained with antibodies for CD45, CD69 and CD25 and analysed by flow cytometry.
The results (Figure 26) demonstrate that the FAP bispecific T-cell activator-expressing viruses NG-
605 and NG-606, but not EnAd or control bispecific T-cell activator-expressing viruses NG-603 and
NG-604, were able to induce T-cell activation, with kinetics dependent on the promoter used for
bispecific T-cell activator sion.
In a r experiment, the dependence on FAP to induce FAP bispecific T-cell activator-mediated
T-cell activation was evaluated. In a 96-well U-bottom plate, SKOV cells were seeded at 2x103
cells/well alone or in combination with NHDF cells at 8x103 cells/well. Viral particles were added to
each well at 100 ppc, and plates incubated at 37⁰C, 5% CO2. After two hours, 75,000 CD3+ T-cells
were added and plates incubated r. At 96-hours post-infection, cells were ted and
stained for CD45 and CD25 and analysed by flow cytometry (Figure 27A). The results demonstrate
that the FAP bispecific T-cell activator-expressing viruses NG-605 and NG-606, only induced T-cell
tion in the presence of FAP-positive NHDF cells.
In a similar experiment, the icity of promoter (CMV or virus MLP/SA)-driven ific T-cell
activator expression in NG-605 and NG-606 was investigated further. In a 96-well U-bottom plate,
NHDF cells were seeded at 4x103 well. 100 viral particles per cell were added to each well, and
plates incubated at 37⁰C, 5% CO2. After two hours, 40,000 CD3 cells were added and plates incubated
r. At 72-hours post-infection, supernatants were harvested and xicity measured by LDH
cytotoxicity assay. The results (Figure 27B) demonstrate that the CMV-driven virus NG-605, but not
SA-driven NG-606, was able to mediate killing of NHDF cells upon infection of NHDF cells alone.
The s indicate that NG-605 and NG-606 were both able to induce T cell activation and target
cell lysis, although the kinetic e was slightly different depending on the promoter used.
Timelapse videos were obtained to observe viral or T cell-mediated lysis of target cells by
recombinant FAP bispecific T-cell tor, EnAd, NG-603 or . NHDF cells were stained with
CellTracker Orange CMTMR Dye (Life Tech, #C2927) and CD3+ T-cells were stained with CellTrace
Violet Cell eration Kit (Life Tech, 7) following manufacturer’s protocols. Dyed NHDF
were plated in a 24-well plate at 7.5x103 cells/well in co-culture with 1.35x104DLD or SKOV tumour
cells. Plates were incubated for 18 hrs, 37⁰C, 5% CO 2. Cells were then treated with 300 ng/mL FAP
ific T-cell activator or infected with 100 ppc of EnAd, NG-603, and NG-605 or left untreated.
After two hours incubation, 100,000 dyed CD3+ T-cells were added to necessary wells, in addition to
1.5 μM CellEvent Caspase 3-7 reagent (Life Tech, #C10423). Videos were obtained on a Nikon TE
2000-E Eclipse inverted microscope, with images captured every 15 minutes for 96 hours. Frames
from the videos are shown in Figure 28. The results show that the recombinant FAP bispecific T-cell
activator and NG-605, but not EnAd or , were able to induce rapid lysis of NHDF cells.
In a similar experiment, NHDF cells were stained with CellTracker Green CMFDA Dye (Life Tech,
#C2925) and CD3+ T-cells were stained with CellTrace Violet Cell Proliferation Kit (Life Tech,
#C34557) following manufacturer’s protocols. Dyed NHDF were plated in a 24-well plate at 7.5x103
cells/well in co-culture with 1.35x104 DLD or SKOV tumour cells. Plates were incubated for 18 hrs,
37⁰C, 5% CO2. Cells were then infected with 100 ppc of NG-607, NG-608, NG-609 or NG-610 or left
uninfected. After two hours incubation, 100,000 dyed CD3+ T-cells were added to necessary wells.
Videos were obtained on a Nikon TE 2000-E Eclipse inverted microscope, with images captured
every 15 minutes for 96 hours. Frames from the videos are shown in Figure 29. The results show
that all s lead to tumour cell infection (RFP, red fluorescence, positive), but only NG-609 and
NG-610 were able to induce rapid lysis of the co-cultured NHDF cells.
Example 15
In this series of experiments, the ability of EnAd and EpCAM or control bispecific T-cell activator
viruses NG-601, NG-602, NG-603 and NG-604 to kill target cells, including tumour cells and
fibroblasts, was evaluated.
Characterisation of human T-cell activation and EpCAM-positive target cell lysis by EnAd, NG-
601, NG-602, NG-603 and NG-604
The ability of EnAd and , NG-602, NG-603 and NG-604 to kill DLD tumour cells in the
presence or absence of CD3+ T-cells was ed using xCELLigence logy. DLD cells were
plated in 48-well E-plate at 1.2x104cells/well. Plates were incubated for 18 hrs, 37⁰C, 5% CO2, before
cells were either infected with EnAd at 100 ppc or were left uninfected. Two hours after infection,
75,000 CD3+ T-cells were added to the necessary wells. XCELLigence was used to measure target cell
xicity every 15 minutes. The results (Figure 30) demonstrate that NG-601 and NG-602 lead
to significantly more rapid DLD cytotoxicity in a T cell-dependent manner.
In a similar experiment, the ability of EnAd and NG-601, NG-602, NG-603 and NG-604 to kill DLD
tumour cells in the presence or absence of CD3+ T-cells was assessed using LDH cytotoxicity assay.
DLD cells were plated in a 96-well U-bottom plate at 2x104 well and either infected with 100
ppc EnAd or were left uninfected. Two hours after infection, 150,000 CD3+ T-cells were added to the
necessary wells. Plates were ted at 37⁰C, 5% CO 2 and supernatant harvested and analysed by
LDH cytotoxicity assay at 0, 24, 48 and 72 hours post-infection. The results (Figure 31) demonstrate
that NG-601 and NG-602 lead to more rapid DLD cytotoxicity in a T cell-dependent manner.
As an extension of the LDH experiment above, the cells were also harvested at 0, 24, 48 and 96 hours
post-treatment, stained with antibodies for CD45, CD69 and CD25 and analysed by flow cytometry
to determine activation status of the CD3+ T-cells. The s (Figure 32) demonstrate that the
EpCAM bispecific T-cell activator-expressing viruses NG-601 and , but not EnAd or control
bispecific T-cell activator-expressing viruses NG-603 and NG-604, were able to induce T-cell
tion, with kinetics dependent on the er used for bispecific T-cell activator expression.
In another experiment, the y of NG-601 to kill DLD tumour cells at varying multiplicity of
infection (MOI) in the presence or absence of CD3+ T-cells was assessed using xCELLigence
technology. DLD cells were plated in 48-well E-plate at 2x104 cells/well. Plates were incubated for
18 hrs, 37⁰C, 5% CO2, before cells were either infected with NG-601 at MOI (ppc) varying from 0.001
to 10 or left uninfected. Two hours after infection, 150,000 CD3+ T-cells were added to the necessary
wells. xCELLigence was used to measure target cell cytotoxicity every 15 s. The results
(Figure 33) demonstrate that NG-601 lead to more rapid DLD cytotoxicity in a T cell-dependent
manner at MOI’s as low as 0.001.
In a similar experiment, the ability of EnAd and NG-601, NG-602, NG-603 and NG-604 to kill SKOV
tumour cells in the ce or absence of CD3+ T-cells was assessed using xCELLigence technology.
SKOV cells were plated in 48-well E-plate at 1x104 cells/well. Plates were incubated for 18 hrs, 37⁰C,
% CO2, before cells were either infected with EnAd (100 ppc) or were left uninfected. Two hours
after infection, 50,000 CD3+ T-cells were added to the necessary wells. xCELLigence was used to
measure target cell cytotoxicity every 15 s. The results (Figure 34) suggest that SKOV cells
are resistant to ediated cytotoxicity over the timeframe of this study, however NG-601 and
NG-602 were able to induce rapid lysis of SKOV cells in the presence of CD3+ T-cells.
In a r experiment, the ability of EnAd and NG-601, NG-602, NG-603 and NG-604 to kill SKOV
cells in the presence or absence of CD3+ T-cells was assessed using LDH cytotoxicity assay. SKOV
cells were plated in 96-well U-bottom plates at 2x10 4 cells/well and either infected with EnAd (100
ppc) or were left uninfected. Two hours after infection, 150,000 CD3+ T-cells were added to the
necessary wells. Plates were incubated at 37⁰C, 5% CO 2 and supernatant harvested and analysed by
LDH cytotoxicity assay at 0, 24, 48 and 72 hours post-infection. The results (Figure 35) are
consistent with previous data and suggest that SKOV cells are resistant to EnAd-mediated
cytotoxicity over this time frame, r NG-601 and NG-602 are able to induce rapid lysis of SKOV
cells in the presence of CD3+ T-cells.
As an extension of the LDH experiment above, the cells were also harvested at 0, 24, 48 and 96 hours
post-treatment, stained with dies for CD45, CD69 and CD25 and analysed by flow cytometry
to determine activation status of CD3+ T-cells (Figure 36). The results demonstrate that the EpCAM
bispecific T-cell activator-expressing viruses NG-601 and NG-602, but not EnAd or control bispecific
T-cell activator-expressing viruses NG-603 and , were able to induce T-cell activation, with
cs dependent on the promoter used for bispecific T-cell activator expression.
In a similar experiment, the ability of EnAd and NG-601, NG-602, NG-603 and NG-604 to te
cancer patient-derived CD3+ T-cells from a CD3+ negative primary ascites sample was
ed. EpCAM-positive DLD cells were plated at 1x10 4 cells per well in a 96-well U-bottom plate
and co-cultured with 100,000 ascites cells (unchanged from when received). Cells were infected
with viral particles at 100 ppc or were left uninfected. After incubation at 37oC for 48 hours, the total
cell population was harvested and the expression level of CD25 on CD3+ T-cells ined by flow
cytometry. The results (Figure 37) demonstrate that the EpCAM bispecific T-cell activatorexpressing
viruses NG-601 and NG-602, but not EnAd or control ific T-cell activatorexpressing
viruses NG-603 and NG-604, were able to induce T-cell activation of patient-derived CD3+
T-cells.
The results te that both EpCAM bispecific T-cell activator viruses NG-601 and NG-602 were
able to induce T cell activation and target cell lysis, although the kinetic profile was slightly different
depending on the promoter used.
Timelapse videos were obtained to observe viral or T cell-mediated lysis of target cells by
recombinant EpCAM bispecific T-cell activator, EnAd, NG-601 or NG-603. NHDF cells were stained
with acker Orange CMTMR Dye (Life Tech, #C2927) and CD3+ T-cells were stained with
CellTrace Violet Cell eration Kit (Life Tech, #C34557) ing manufacturer’s protocols. Dyed
NHDF were plated in a 24-well plate at 7.5x103 cells/well in co-culture with 1.35x104 DLD or SKOV
tumour cells. Plates were incubated for 18 hrs, 37⁰C, 5% CO2. Cells were then treated with 300ng/mL
EpCAM bispecific T-cell activator or infected with EnAd, NG-601 or NG-603 at 100 ppc or left
untreated. After two hours incubation, 100,000 dyed CD3+ T-cells were added to necessary wells, in
addition to 1.5μM CellEvent Caspase 3-7 reagent (Life Tech, #C10423). Videos were obtained on
Nikon TE 2000-E Eclipse inverted, with images captured every 15 minutes for 96 hours. Frames
from the videos are shown in Figure 38. The results show that the recombinant EpCAM bispecific T-
cell activator and NG-605 lead to rapid lysis of both DLD and SKOV target cells, but NHDF ed
unaffected.
Example 16
In this example, the tion of autologous tumour-associated lymphocytes from FAP+ primary
malignant ascites from cancer patients by EnAd, NG-603, , NG-605 and NG-606 was
evaluated. Patient samples considered suitable for further analysis were those containing CD3+ T-
cells and FAP+ cells.
In the first experiment, unpurified (therefore unchanged from when ed) ascites cells from a
patient were seeded at 250,000 cells per well of a om 96-well plate in 100% ascites fluid. Cells
were infected with viruses at 100 ppc, with untreated wells serving as negative controls. EnAd-CMVGFP
and EnAd-SA-GFP were also included in the ment as a reporter to determine infection
and late stage viral gene sion, respectively, with micrographs shown in Figure 39. After
incubation at 37oC for 5 days, the total cell tion was harvested and the expression level of
CD25 on CD3+ T-cells (Figure 40A) was determined. Total cell numbers per well were determined
using precision counting beads. The results demonstrate that the FAP bispecific T-cell activator
viruses NG-605 and NG-606 resulted in significant increases in T-cell activation of tumourassociated
lymphocytes.
As an extension of the experiment above, replicate wells were harvested and the number of
endogenous FAP+ cells determined by flow cytometry. Total cell numbers per well were ined
using precision counting beads. The results (Figure 40B) show that NG-605 and NG-606 resulted in
a significant se in numbers of autologous FAP-expressing cells in the ascites samples,
suggesting some FAP+ cells had been killed by the activated T-cells.
In a second experiment, unpurified (therefore unchanged from when received) ascites cells from a
cancer patient were seeded at 250,000 cells per well of a U-bottom 96-well plate in either 100%
ascites fluid or medium supplemented with 1% human serum. Cells were infected with viruses at
100 ppc, with untreated wells serving as negative ls. EnAd-CMV-GFP and EnAd-SA-GFP were
also included as a reporter to determine ion and late stage viral gene expression, respectively,
with micrographs shown in Figure 41. After incubation at 37oC for 5 days, the total cell population
was harvested and the number of CD3+ T-cells e 42) and expression level of CD25 on CD3+ T-
cells (Figure 43) was ined. Total cell s per well were determined using precision
counting beads. The results demonstrate that for this patient recombinant FAP bispecific T-cell
activator and NG-605, but not , ed in icant increase in T-cell activation of tumourassociated
lymphocytes in media. Neither virus led to activation in ascites fluid.
As an extension of the experiment above, replicate wells were harvested and the number of FAP +
cells was determined by flow cytometry (Figure 44). Total cell numbers per well were determined
using precision counting beads. The results demonstrate that recombinant FAP bispecific T-cell
activator and NG-605, but not NG-606, resulted in a significant decrease in numbers of autologous
FAP-expressing cells in media. Neither virus led to a reduction in FAP+ cells in ascites fluid.
Example 17 - Materials and Methods
Cell lines
HEK293A, DLD, SKOV3, MCF7, A431, A549 and PC3 cells (ATCC) were cultured in Dulbecco’s
Modified Eagle’s Medium (DMEM, Aldrich, UK) and CHO cells (ATCC) in Roswell Park
Memorial ute (RPMI-1640, Sigma-Aldrich, UK). Growth media was supplemented with 10%
(v/v) fetal bovine serum (FBS, Gibco, UK) and 1% (v/v) penicillin/streptomycin (10 mg/mL, Sigma-
Aldrich) and cells maintained in humidified atmosphere at 37°C and 5% CO2. For virus infections
and virus plasmid transfections cells were maintained in DMEM supplemented with 2% FBS. For
recombinant bispecific T-cell activator plasmid transfections cells were maintained in DMEM
without FBS. EpCAM expression of target cell lines was ined by flow cytometry.
Generation of EpCAM-expressing stable cell lines
The n sequence of the EpCAM gene (ID: 4072) was obtained from NCBI database and DNA
synthesised by Oxford Genetics Ltd (Oxford, UK). The EpCAM gene was cloned into pSF-Lenti vector
by standard cloning techniques producing the pSF-Lenti-EpCAM vector. HEK293T cells were
transfected using Lipofectamine 2000 with lentivirus EpCAM expression vector alongside pSFCMVHIV-Gag-Pol
, pSF-CMV-VSV-G, pSF-CMV-HIV-Rev (Oxford cs Ltd). Supernatants
containing lentivirus were harvested 48 h later and mixed with ene (8 μg/mL).
Lentivirus/polybrene mixtures were added to CHO cells and incubated at 37°C. On day 4, the
supernatant was exchanged for media containing 7.5 μg/mL puromycin. Stable variants were then
clonally selected and EpCAM expression of the parental cell lines or stable-transfected t was
determined by antibody staining with EpCAM or isotope control antibody and analysed by flow
cytometry. ve clones were expanded and used in further ments.
Preparation of eral blood clear cells (PBMC) and T cell isolation
PBMCs were isolated by density gradient centrifugation (Boyum, 1968) from whole blood leukocyte
cones obtained from the NHS Blood and Transplant UK (Oxford, UK). Blood was diluted 1:2 with PBS
and layered onto Ficoll (1,079g/mL, Ficoll-Paque Plus, GE Healthcare) before centrifugation at 400
g for 30 min at 22°C with low deceleration. After centrifugation, PBMCs were collected and washed
twice with PBS (300 g for 10 min at room temperature) and resuspended in RPMI-1640 medium
supplemented with 10% FBS. For extraction of CD3-positive T-cells from PBMCs, 3 cells were
depleted using Pan T Cell Isolation Kit (Miltenyi Biotec, #130535), according to the
manufacturer’s protocol. For further isolation of CD4- and CD8-positive T-cells, CD3 T-cells
underwent another round of purification using CD4+ Microbeads nyi , #130101).
Processing primary ascites and pleural effusions
Primary human malignant s and pleural effusion samples were received from the Churchill
Hospital, Oxford University Hospitals (Oxford, UK) following informed consent from patients with
multiple tions of advanced carcinoma, including but not limited to ovarian, pancreatic, breast
and lung. This work was approved by the research ethics committee of the Oxford Centre for
athology Research. Upon receipt, cellular and fluid fractions were separated and fluid used
immediately or aliquots stored at -20°C for future analysis. The cellular fraction was treated with
red blood cell lysis buffer (Roche, UK) following manufacturer’s ctions. Cell number and
viability was determined by trypan blue stain. Cell types present in each sample were determined
by antibody staining for EpCAM, EGFR, FAP, CD45, CD11b, CD56, CD3, CD4, CD8, PD1 and CTLA4 and
analysed by flow try. For ex vivo T-cell tion and target cell lysis experiments fresh cells
and fluid were used. In some cases, the adherent cells were passaged in DMEM supplemented with
% FBS and expanded for later use.
Bispecific T-cell activator engineering and production
Bispecific T-cell activators were generated by g two scFvs of ent specificities with a
flexible GS linker. Each scFv is d by the joining of VH and VL domains from parental
monoclonal antibodies by a linker. Each bispecific T-cell activator possessed an immunoglobulin
light chain (Ig) inal signal sequence for mammalian secretion and a C-terminal decahistidine
affinity tag for detection and purification. bispecific T-cell activators were engineered by standard
DNA cloning techniques and inserted into a protein expression vector (pSFCMV- Amp) for
cytomegalovirus (CMV) promoter-driven constitutive protein expression and secretion. VEpCAMbispecific
T-cell tor or pSF-CMV-Controlbispecific T-cell activator plasmid DNA were
transfected into HEK293A cells using polyethylenimine (PEI, linear, MW 25000, Polysciences, USA )
under the ing ions, 55 μg of plasmid DNA:110 μg PEI EI ratio of 1:2 (w/w)) was
added to cells, incubated at 37°C for 4 h, then replaced with fresh serum-free DMEM and further
incubated at 37°C, 5% CO2 for 48 h. Cells were ected in parallel with pSF-CMV-GFP to ensure
transfection efficiency. To harvest secreted protein, the supernatant of transfected cells was
collected and centrifuged at 350 g, 4°C for 5 min to remove cell components. Supernatants were
transferred to 10,000 MWCO Amicon Ultra-15 Centrifugal Filter Units (Millipore). After
centrifugation at 4750 g and 4°C, the volume of the retentate was ed with the flow through to
obtain a 50-fold higher tration. Aliquots of concentrated protein were stored at -80 °C.
Generation of ific T-cell activator-expressing EnAdenotucirev
The plasmids pEnAd2.4-CMV-EpCAMbispecific T-cell activator, pEnAd2.4-SA-EpCAMbispecific T-
cell activator, pEnAd2.4-CMV-Controlbispecific T-cell activator, .4-SA-Controlbispecific T-
cell tor were generated by direct insertion of the transgene cassette encoding the EpCAM
bispecific T-cell activator or control bispecific T-cell activator into the basic EnAd plasmid pEnAd2.4
using Gibson assembly technology. The transgene cassette contained a 5’ short splice acceptor
sequence or an exogenous CMV promoter, followed downstream by the EpCAM or control bispecific
T-cell activator cDNA sequence and a 3’ polyadenylation sequence. A schematic of the inserted
transgene cassette is shown in Figure 18. t construction of the plasmid was confirmed by DNA
sequencing. The plasmids EnAd2.4-CMV-EpCAMbispecific T-cell activator, pEnAd2.4-SAEpCAMbispecific
T-cell activator, pEnAd2.4-CMV-Controlbispecific T-cell activator and pEnAd2.4-
SA-Controlbispecific T-cell activator were linearised by restriction digest with the enzyme AscI prior
to transfection in HEK293A cells. The production of virus was monitored by observation of
thic effect (CPE) in the cell monolayer. Once extensive CPE was observed the virus was
harvested from HEK293A cells by three freeze-thaw cycles. Single virus clones were selected by
serially diluting harvested lysate and re-infecting HEK293A cells, and harvesting wells containing
single plaques. Serial infections of HEK293A cells were performed once an infection had reached full
CPE in order to y the virus stocks. Once potent virus stocks were amplified the viruses were
purified by double caesium chloride banding to produce MVEpCAMbispecific T-cell activator,
EnAd-SA-EpCAMbispecific T-cell activator, EnAd-CMV-Controlbispecific T-cell tor, EnAd-SAControlbispecific
T-cell activator virus stocks. These stocks were titred by TCID50 and picogreen
assay (Life Technologies), ing manufacturer’s instructions.
Preparation of supernatants
To te bispecific T-cell activator-mediated cytokine release, DLD cells (20,000) were plated
with 100,000 CD3+ s in 96-well flat bottom plate alone or with 2 ng/μL EpCAM or control
bispecific T-cell activator. After 48 h incubation at 37°C and 5% CO2, supernatants were collected,
cell components d by centrifugation and aliquots stored at -20°C. To assess bispecific T-cell
activator transgene expression from recombinant viruses, HEK293A (1e6) or DLD cells (1.2e6) were
ed with EnAd-CMV-EpCAMbispecific T-cell activator, EnAd-SA-EpCAMbispecific T-cell
activator, EnAd-CMVControlbispecific T-cell activator, A-Controlbispecific T-cell activator or
EnAd at 100 vp/cell. Cells were cultured for 72 h at which point the cytopathic effect (CPE) was
advanced. Supernatants were collected and centrifuged for 5 min, 300 g to remove cell debris and
stored at -20°C for future analysis.
Immunoblotting
Dot blot was used to measure the tration of recombinant bispecific T-cell activator produced
from plasmid transfections. Two-fold serial ons of each bispecific T-cell activator and of a
protein rd (10 x His-tagged (Cterminus) human Cathepsin D, Biolegend, #556704) were
prepared. The molar concentration of the n standard was adjusted to represent a bispecific T-
cell activator concentration of 100 μg/mL. Two μL of each sample and protein standard was directly
applied onto a nitrocellulose membrane. The membrane was airdried, blocked and probed with α-
6xHis (C-terminus) dy (1:5000, clone 3D5, Invitrogen, UK, #46- 0693) for detection of C-
terminally His-tagged proteins, followed by washing and incubation with antimouse ary
antibody (1:10000, Dako, #P0161) and ed by application of SuperSignal West Dura Extended
Duration Substrate (Thermo Fisher, #34075) according to manufacturer’s instructions.
Supernatants of virus-infected HEK293A cells were analysed by Western blotting for bispecific T-
cell activator sion. Supernatants were fractionated by SDS-PAGE and transferred to a
nitrocellulose membrane according to manufacturer’s protocols ad). Membranes were
further treated identically to that of dot blot protocol above.
Enzyme-linked immuno-sorbent assay (ELISA)
To assess EpCAM binding, ELISA plates were prepared by coating overnight at 4°C with human
EpCAM/TROP-1 protein (50 ng/well, Sino Biological Inc, #10694-H02H-50). Plates were blocked for
1 h at ambient temperature with 5% BSA, followed by incubation with diluted EpCAM ific T-
cell activator-, Control bispecific T-cell activator- and empty pSF-CMV vector-transfected HEK293A
supernatants (2 h, room temperature). Plates were washed three times with PBS-T and
subsequently after every future binding step. Plates were incubated with anti-His (C-term) antibody
(1:5000, clone 3D5, #46-0693, Invitrogen, UK) for 1 h, room temperature, followed by HRP
conjugated anti-mouse-Fc (1:1000 in PBS/5% milk, Dako) for 1 h at room temperature. HRP
detection was performed using 3.3.5.5’-teramethylethylenediamine (TMB, Thermo-Fisher) and stop
solution was used for terminating the reaction. Absorbance at 450 nm was measured on a Wallac
1420 plate reader (Perkin Elmer).
Flow Cytometry
Flow cytometry analysis was performed on a FACSCalibur flow cytometer (BD Biosciences) and data
processed with FlowJo v10.0.7r2 re (TreeStar Inc., USA). For classification of different ar
populations, dies ic for CD45 (HI30, Biolegend), CD11b (ICRF44, Biolegend), EpCAM
(9C4, Biolegend) and FAP (427819, R&D Systems) were used. For analysis of T-cell populations, the
following antibody clones coupled to ent fluorophores were used: CD69 (FN50, Biolegend),
CD25 (BC96, Biolegend), IFNγ (4S.B3, Biolegend), a antibody (H4A3, Biolegend), CD3
(HIT3a, Biolegend), CD4 (OKT4, Biolegend), CD8a (HIT8a, end), PD1 (H4A3, Biolegend). In
each case, the appropriate isotype control antibody was used.
Characterisation of human T-cell tion
CD69 and CD25 expression levels
The ability of the inant EpCAM bispecific T-cell activator or EpCAM bispecific T-cell activator
viruses to induce T-cell tion was assessed by surface expression of CD69 and CD25. Human
CD3 cells (75,000 cells/well in 96-well flatbottom plates) from PBMC or ascites samples were
ed alone or with DLD, SKOV, CHO, AM or s target cells (15,000) in the presence
of media alone, EpCAM or control bispecific T-cell activator protein (2 ng/μL) or recombinant virus
(100 vp/cell). In some cases, anti-PD1 (Invivogen, #hpd1ni-mab7) antibody was added at a final
concentration of 2.5 μg/mL. CD3 cells were incubated with CD3/CD28 Dynabeads (Thermo Fisher,
#11131D) as positive control for T cell activation. Cells were cultured medium for 24 h at 37°C
unless stated otherwise and subsequently harvested with enzyme free cell dissociation buffer
(Gibco, #13151014). Total cells were stained with antibodies for surface expression of CD69, CD25,
CD3, CD4 or CD8 and analysed by flow cytometry. The effect of ascites fluid on T-cell activation
(CD69, CD25) was investigated by polyclonally activating CD3-purified PBMC (100,000) by
incubating with plate-immobilised CD3 antibody (7.5 μg/mL, HIT3a, Biolegend, #300313) in RPMI-
1640 or fluids isolated from the malignant ascites samples.
IFNγ expression
The ability of the EpCAM bispecific T-cell activator to induce T-cell activity was assessed by IFNγ
expression, by co-culture of T-cells for 6 h with DLD cells (200,000 CD3 well, 40,000 DLD
cells/well in a flat-bottom 96 well plate) and 2 ng/μL recombinant EpCAM or control bispecific T-
cell activator. As a positive control, T cells were stimulated with soluble PMA/ionomycin cell
activation cocktail (Biolegend, #423301). Brefeldin A (GolgiPlug, BD Biosciences) was added into
the culture medium 5 h before harvest, at which point CD3+ T-cells were harvested and
intracellularly stained for IFNγ sion and analysed by flow cytometry.
T cell proliferation
To study T cell proliferation, 100,000 CFSE-labelled (CellTrace CFSE kit, Invitrogen, #C34554) CD3+
T cells were ted with 20,000 DLD cells in 96 well plate format, with 2 ng/μL EpCAM or control
bispecific T-cell activator. Five days after co-culture, cells were stained for CD3, CD4 or CD8 and CFSE
fluorescence of viable CD3+ T-cells were measured by flow try, with total cell number
normalised using precision ng beads well, end, #424902). Fluorescence data
was ed and modelled using the proliferation function of FlowJo v7.6.5 re. Data is
presented as the percentage of original cells that entered a proliferation cycle (%divided) or the
average number of cell divisions that a cell in the al population has one (Division
Index).
CD107a degranulation
DLD cells (15,000 cells/well) were tured with 75,000 CD3+ T-cells in a flat-bottom 96 well
plate in the presence of media alone or 2 ng/μL of control or EpCAM bispecific T-cell activator.
αCD107a or isotype control antibodies were added directly to the culture medium. Monensin
(GolgiStop, BD Biosciences) was added after 1 h of incubation at 37°C and 5% CO2, followed by 5 h
of further incubation. Cells were subsequently harvested, stained for CD3, CD4 or CD8 and analysed
by flow cytometry.
Cytokine release
Cytokines within supernatants harvested from cultures of DLD/PBMC or pleural effusion cells were
quantified using the LEGENDplex Human T Helper Cytokine panel (Biolegend, #740001) and flow
cytometry following the manufacturer’s instructions. Cytokines included in the is are IL-2, IL-
4, IL-5, IL-6, IL-9, IL-10, IL-13, IL-17A, IL-17F, IL-21, IL-22, IFNγ and TNFα.
In vitro target cell cytotoxicity assay
Target cell cytotoxicity mediated by recombinant ific T-cell activator or viruses was assessed
by LDH release or MTS assay. Target cells (DLD, SKOV, HT-29, A431, A549, PC3, CHO, CHO-EpCAM)
were co-cultured with CD3, CD4 or CD8 T-cells (E:T 5:1) in a flat-bottom 96 well plate in the presence
of media alone, d supernatants or virus (100 vp/cell). After 24 h of co-culture (unless stated
otherwise), atants and cells were harvested and cytotoxicity determined by LDH assay
ox 96 Non-Radioactive Cytotoxicity Assay, Promega, #G1780) or MTS viability assay
(CellTiter 96 Cell Proliferation Assay, Promega, #G3580) as per manufacturer’s instructions.
Quantity of bispecific T-cell activator produced from virus-infected DLD cells was determined by
comparing cytotoxicity induced by diluted viral supernatants to that of a standard curve ted
using recombinant bispecific T-cell activator.
To evaluate oncolytic activity of the viruses, DLD cells were seeded in 96-well plate (25,000
cells/well) for 18 h at 37°C and 5% CO2, before infection with increasing vp/cell (5-fold serial
dilution, 100 to 5.12e-5 vp/cell) or left uninfected. DLD cytotoxicity was measured on day 5 by MTS
ity assay. Dose response curves were fitted and IC50 determined using a four parameter nonlinear
fit model integrated into Prism 7 software (GraphPad Software). Cell viability was monitored
in real-time using xCELLigence RTCA DP logy (Acea Biosciences). DLD, SKOV3 or MCF7 cells
were plated in 48-well E-plate at 12,000 cells/well. Plates were incubated for 18 h, 37°C, 5% CO2,
before cells were either treated with bispecific T-cell activator (2 ng/μL) or infected with virus (100
vp/cell) or left untreated. Two hours after infection, 75,000 CD3+ cells were added to the necessary
wells. Cell impedance was ed every 15 min for a duration of up to 160 h. For ex vivo
cytotoxicity assays, unpurified cells from ascites or pleural effusion samples were resuspended in
s fluid and plated (1.5e5/well) in flat bottom l plates. After tion for the stated
duration at 37°C, 5% CO2, supernatants were analysed by LDH assay or total cells were harvested
by cell-dissociation buffer, stained for CD3, CD25 and EpCAM, and ed by flow cytometry. For
PD1 blocking experiments, anti-PD1 antibody (2.5 μg/mL, gen, #hpd1ni-mab7) antibody was
included.
Viral genome replication and qPCR
The ability of EnAd-CMV-EpCAMbispecific T-cell activator, EnAd-SA-EpCAMbispecific T-cell
activator, EnAd-CMV-Controlbispecific T-cell activator, EnAd-SAControlbispecific T-cell activator or
EnAd to replicate their genomes was analysed by seeding DLD cells in l plate (150,000
cells/well) for 18 h, 37°C, 5% CO2, before infection with 100 vp/cell. Wells were harvested 24 and
72 h post infection, and DNA purified using PureLink genomic DNA mini kit (Invitrogen, #K182001)
according to the manufacturer’s protocol. Total viral s were quantified by qPCR against EnAd
hexon using specific primer-probe set rs: TACATGCACATCGCCGGA/CGGGCGAACTGCACCA,
probe: CCGGACTCAGGTACTCCGAAGCATCCT).
Microscopy
field and fluorescence images were captured on a Zeiss Axiovert 25 microscope. Time lapse
videos were obtained to observe viral or T cell-mediated lysis of target cells by EnAd or EnAd-
CMVEpCAMbispecific T-cell activator. Uninfected cells were used as a negative control. NHDF cells
were stained with CellTracker Orange CMTMR Dye (Life Technologies, #C2927) and CD3+ cells were
stained with CellTrace Violet Cell Proliferation Kit (Life Technologies, #C34557) following
manufacturer’s protocols. Dyed NHDF were plated in a 24-well plate at 7,500 cells/well in co-culture
SKOV3 at 13,500 cell/well. Plates were incubated for 18 h, 37°C, 5% CO2. Cells were then treated
with 300 ng/mL EpCAM bispecific T-cell activator or infected with 100 vp/cell of EnAd or EnAd2.4-
CMV-EpCAMbispecific T-cell activator or left untreated. After 2 h tion, 100,000 dyed CD3+
were added to necessary wells, in addition to 1.5 uM CellEvent Caspase 3-7 reagent (Life
Technologies, #C10423). Images were captured on a Nikon TE 2000-E Eclipse inverted microscope
(10× optical objective) at intervals of 15 min covering a period of 96 h. Time-lapse videos (12
frames/second) were ted using ImageJ software.
In all cases of more than two experimental conditions being compared, statistical analysis was
performed using a One-way ANOVA test with Tukey’s Post Hoc is. All data is presented as
mean ± SD. The significant levels used were P = 0.01 - 0.05 (*), 0.001 – 0.01 (**), 0.0001-0.001 (***).
All in vitro experiments were performed in triplicate, unless stated otherwise.
Example 18 - Generation and production of a ific T-cell activator targeting EpCAM
A ific T-cell tor targeting EpCAM was engineered by joining two scFv specific for CD3ε
and EpCAM with a flexible glycine-serine (GS) linker. A control bispecific T-cell activator, recognising
CD3ε and an irrelevant antigen (the filamentous haemagglutinin adhesin (FHA) of Bordetella
pertussis) was also produced. Both bispecific T-cell activators were engineered to n an N-
terminal signal sequence for mammalian secretion and a C- terminal decahistidine affinity tag for
detection and purification (Figure 45A). To characterise the functionality of the recombinant
bispecific T-cell activators, they were cloned into expression s under transcriptional control
of the CMV immediate early promoter MV-EpCAMbispecific T-cell activator and pSF-CMVControlbispecific
T-cell activator, tively).
nt HEK293 cells (HEK293A) were transfected with the expression vectors and supernatants
harvested and concentrated 50-fold for further analysis. To estimate the amount of bispecific T-cell
activator produced, samples were ly diluted and evaluated, using is, in a dot blot using
decahistidine-tagged cathepsin D as a standard. In this way it was possible to estimate the level of
bispecific T-cell activators produced into the supernatant to be approximately 20 μg/mL at 48 h post
transfection (of 1.8e7 HEK293A cells)
(Figure 46A). Specific binding of the EpCAM bispecific T-cell activator and not the control ific
T-cell activator to recombinant EpCAM protein was demonstrated by ELISA (Figure 46B).
Example 19 - Characterisation of human T-cell activation by recombinant EpCAM bispecific
T-cell activator
The ability of recombinant EpCAM bispecific T-cell activator protein to activate PBMC-derived T
cells was evaluated by adding unstimulated human primary CD3+ cells to a culture of human DLD
colorectal carcinoma cells, which are known to express EpCAM on their surface (Karlsson et al,
2008). Addition of 2.5 ng/ml EpCAM bispecific T-cell activator (as supernatant from transduced
HEK293A cells) led to a significant se in T cell activation markers CD69 and CD25 (Figure 45B
& C), whereas the control bispecific T-cell activator had no effect.
re of CD3 cells to the EpCAM bispecific T-cell tor in the absence of tumour cells gave a
very modest increase in CD69 and CD25, and this indicates that antibody-mediated clustering of CD3
is essential for full activation by this anti-CD3 binding. T cells stimulated by the EpCAM bispecific T-
cell activator in the presence of tumour cells also showed a significant increase in the production of
gamma interferon (Figure 45D) and cell proliferation (Figure 45E) whereas the control Bispecific T-
cell activator had no effect. The aim of T cell activation is to cause degranulation-mediated
cytotoxicity, and expression of surface /LAMP1 (indicating degranulation, Aktas et al.) was
ly upregulated by the EpCAM bispecific T-cell activator but not by control (Figure 45F).
The release of cytokines following EpCAM bispecific T-cell tor-mediated activation of PBMC-
derived T cells in the presence of DLD cells was terised by flow cytometry using a cytokine
bead array. As before the control bispecific T-cell activator showed little activity, although the
EpCAM ific T-cell activator triggered release of several cytokines, including high levels of IL-
2, IL-6, IL-10, IL-13, gamma interferon and TNF (Figure 45G). Production of IL-2, gamma interferon
and TNF are generally associated with a Th1 response, s IL-6 and IL-10 are more often linked
to a Th2 response (Mosmann & Sad, 1996).
Example 20 - Specificity of recombinant EpCAM bispecific T-cell tor
Most human epithelial cells s EpCAM, so to assess whether the effect of the EpCAM bispecific
T-cell activator was
antigen-specific, Chinese r Ovary cells (CHO cells) were engineered using a lentiviral vector
to express human EpCAM on their surface. In the presence of EpCAM bispecific T-cell activator and
CHO-EpCAM cells, exogenously added PBMC-derived T cells showed strong activation (assessed by
CD25 expression see Figure 47A) and associated cytotoxicity e 47B) that was not seen with
parental CHO control cells or control ific T-cell activators. This indicates that the cytotoxicity
of the EpCAM bispecific T-cell activator is antigen-specific.
We then assessed whether the EpCAM bispecific T-cell activator would kill a range of tumour cells,
and whether the level of EpCAM bispecific T-cell activator-mediated xicity observed was
dependent on the density of EpCAM expression. Cytotoxicity of T cells in the presence of the EpCAM
bispecific T-cell activator was measured in six different carcinoma cell lines, with greatest
cytotoxicity observed in DLD and A431, and least in A549 and PC3 (Figure 47C). This showed a loose
ation with the surface levels of EpCAM (determined by flow cytometry), where A549 and PC3
cells showed the lowest levels and DLD the highest e 47D). This suggests that the presence
and level of EpCAM expression do nce the degree of cytotoxicity, although other factors
(perhaps the intrinsic resistance of cells to granzyme-mediated apoptosis) also play a role in
ining the overall level of cell killing.
Example 21 - Bispecific T-cell activator mediated activation of CD4+ and CD8+ T cell s
To determine which T cell types are activated by the EpCAM bispecific T-cell activator, PBMC-
derived T cells were incubated with DLD cells and activated using the bispecific T-cell activator prior
to flow analysis. Both CD4+ and CD8+ cells showed high levels of expression of CD69 and CD25
(Figure 49A), although the percentage of activated CD4 cells was generally slightly greater. EpCAM
bispecific T-cell activator-mediated T cell proliferation was ed using CFSE stain (Figure 49B),
and degranulation by expression of CD197a/LAMP1 (Figure 49C) and again r levels of
activation were seen for both CD4+ and CD8+ cells. Finally, levels of tumour cell xicity
ed were compared using EpCAM bispecific T-cell activator to activate purified CD4+ and CD8+
subsets. All T cell preparations showed similar cytotoxicity (Figure 49D), indicating that both CD4+
and CD8+ cells can bute to the bispecific T-cell activator-mediated cytotoxicity observed.
Example 22 - Expression of the EpCAM ific T-cell activator from oncolytic adenovirus,
EnAdenotucirev
EnAdenotucirev (EnAd) is an oncolytic adenovirus, a chimera of group B type 11 and type 3
irus with a mosaic E2B region, a nearly complete E3 deletion and a smaller E4 on
mapped to E4orf4 (Kuhn 2008). Currently undergoing l early phase clinical trials for
treatment of cancer, the virus combines good systemic pharmacokinetics and promising clinical
activity with the possibility to encode and express transgenes (Calvo 2014, Boni 2014). The EpCAM
bispecific T-cell activator was encoded within EnAd immediately downstream of the fibre gene,
using a shuttle vector inserted into the virus backbone by Gibson assembly (Figure 18). The
bispecific T-cell activator was placed either under transcriptional control of a CMV immediate early
promoter (EnAd-CMV-EpCAM bispecific T-cell tor), or was placed downstream of a splice
acceptor site for the adenovirus major late promoter (MLP; EnAd-SA-EpCAM bispecific T-cell
activator). In the former configuration the bispecific T-cell activator should be expressed whenever
the virus successfully infects a cell, whereas expression from the MLP splice acceptor site will only
occur when the MLP is activated in cells that are sive to virus replication. A control bispecific
T-cell activator (recognising CD3 and FHA) was also introduced to create two corresponding l
viruses.
The viruses were cloned, rescued in HEK293A cells, and a large batch of each was prepared in a
hyperflask and purified twice by caesium chloride banding. Infection of DLD with parental EnAd and
the recombinant bispecific T-cell activator viruses yielded similar amounts of viral genomes
(measured by qPCR) at all timepoints tested, indicating the bispecific T-cell activator transgene does
not interfere with the viral replication kinetics (Figure 51A). Next we investigated the replication
and oncolytic properties of the viruses in the e of human T-cells. DLD cells were infected with
virus batches at sing virus particles (vp)/cell, and the cytotoxicity ed by MTS assay on
day 5. All of the recombinant viruses, including those with EpCAM and control ific T-cell
activators, regulated by the CMV promoter or splice acceptor, showed cytotoxic activity
indistinguishable from the al virus, showing that the genetic modification had not changed
the sic oncolytic activity of the virus e 51B).
To assess bispecific T-cell activator expression and secretion, the bispecific T-cell activatorexpressing
EnAd viruses were used to infect HEK293A cells, and 72 h supernatants were examined
by western blotting using an anti-His dy. As shown in Figure 51C, all four viruses (two
expressing the control bispecific T-cell activator and two expressing the EpCAM bispecific T-cell
activator) showed similar levels of bispecific T-cell activator secreted into the supernatant.
Example 23 - Selective killing of EpCAM positive cells by virally produced EpCAM bispecific
T-cell tor
The supernatants from EnAd-EpCAM ific T-cell activator-infected HEK293A cells were added
to cultures of CHO and CHO-EpCAM cells, either with or without PBMC-derived T cells; T cell
activation and cytotoxicity to the CHO/CHO-EpCAM cells was measured after 24 h. In the case of CHO
cells, there was no increase in T cell expression of CD25 (Figure 51D) nor any cytotoxicity observed
with any treatment (Figure 51E). However, T cells I ted with the CHO-EpCAM cells showed
substantial increases in CD25 expression using supernatants from HEK293A cells that had been
infected with either EnAd-CMV-EpCAM bispecific T-cell activator or EnAd-SA-EpCAM bispecific T-
cell tor viruses (Figure 51D). As expected this translated into selective cytotoxicity to CHOEpCAM
cells only when T cells were added in the presence of supernatant from 293A cells that had
been infected with either EnAd-CMV-EpCAM bispecific T-cell activator or EnAd-SA-EpCAM bispecific
T-cell activator viruses (Figure 51E). Crucially there was no cytotoxicity in the absence of T cells, or
when using supernatants from HEK293A that cells had been infected with EnAd expressing the
control bispecific T-cell activator.
Example 24 - Superior cytotoxicity of EnAd expressing EpCAM bispecific T-cell activator
EnAd kills most carcinoma cells quickly by direct oncolysis (Kuhn 2008), although some cells –
notably SKOV3 ovarian carcinoma cells – are lly resistant and killed more slowly. We therefore
reasoned that the consequences of arming End to e EpCAM bispecific T-cell tor, leading
to xic activation of T cells might be particularly evident in SKOV3 cells. Cells were therefore
exposed to virus (100 l) 24 h after seeding and cell death monitored by xCELLigence system.
erived T cells were added (or not) to the SKOV3 cell e 2 h later. In the absence of T
cells, the tumour cells grew for approximately 72 h (manifest by the increasing Cell Index signal in
Figure 53A) but cell growth then reached a plateau and remained stable, independent of virus
infection, up until at least 160 h). All tested viruses, including parental EnAd, induced no observable
target cell cytotoxicity during the time measured. However, when co-cultured with PBMC-derived T
cells, both the CMV- and SA- EpCAM bispecific T-cell activator-armed viruses induced rapid SKOV3
lysis, with CMV-driven induced lysis within 16 h, and SA within 44 h following on of T cells
(Figure 53B). Importantly, parental EnAd or the non-specific bispecific T-cell activator control
viruses demonstrated no target cell lysis in this time frame even with the addition of Tcells. This
result was confirmed by LDH assay, in which co-cultures identical to above were set up, with
cytotoxicity measured at 24, 48 and 96 h post-infection (Figure 48). These results are further
supported by r findings in DLD cells in which EpCAM bispecific T-cell activator expressing
viruses induced cytotoxicity at a significantly r rate than the control bispecific T-cell activator
viruses (Figure 50A+B).
To confirm that target cell cytotoxicity is mediated via T cell activation, CD3 cells were harvested at
each timepoint and tion status determined by CD69 and CD25 expression, trating
similar kinetics of expression as observed for cytotoxicity (Figure 53C & D, Figure 50C & D). The
approximate ty of EpCAM bispecific T-cell tor produced from infected DLD cells was
determined by comparing xicity (Abs490) induced by infected DLD supernatants to the
cytotoxicity induced by known quantities of recombinant bispecific T-cell activator (i.e. creation of
a standard curve (Abs490)). DLD in co-culture with CD3-purified PBMC (1:5) were incubated with
recombinant bispecific T-cell activator (Figure 50E) or ed DLD supernatant (Figure 50F) and
LDH e was measured at 24 h, This d us to determine that EpCAM bispecific T-cell
activator was produced at 165 μg and 50 μg per million DLD for EnAd-CMV-EpCAMbispecific T-cell
activator and EnAd-SAEpCAMbispecific T-cell activator, respectively. The EC50 for the EpCAM
bispecific T-cell activator is 7.4 ng/ml e 50E & F), and therefore EpCAM bispecific T-cell
tor is produced by the recombinant virus at levels that are likely to reach therapeutic doses.
Cytotoxicity of EpCAM bispecific T-cell activator-expressing EnAd was visualised by time lapse video
microscopy. SKOV3 tumour cells (unlabelled) were co-incubated with normal human fibroblasts
-negative, labelled red, serving as non-target control cells) and PBMC-derived T cells
(labelled blue) in the presence of a caspase stain (CellEvent Caspase 3-7 reagent produces a green
stain when caspases are activated). Again the combination of EpCAM bispecific T-cell activatorexpressing
EnAd, combined with exogenous T cells, gave dramatic cytotoxicity to the SKOV3 tumour
cells, which showed strong induction of apoptosis when infected with EnAd-CMV-EpCAMbispecific
T-cell activator, but not parental EnAd. Importantly, the EpCAM-negative NHDF in co-culture
remained viable throughout. entative fluorescent images at different time points from the
SKOV3 videos are shown in Figure 53E. Equivalent time lapse videos showing DLD cells (which are
intrinsically more sensitive to the virus) cocultured with NHDF are also shown.
Example 25 - EpCAM bispecific T-cell activator can overcome immune suppression, activate
endogenous T cells and kill endogenous tumour cells within malignant peritoneal ascites
Three clinical samples of ant peritoneal ascites samples ning positive tumour
cells and primary fibroblasts (as control, non EpCAM-expressing cells) were expanded ex vivo and
the mixed y cell populations were incubated with PBMC-derived T-cells and treated with free
bispecific T-cell activator or 100 vp/cell EnAd-EpCAMbispecific T-cell activator in culture medium.
After 72 h, the level of EpCAM-positive target cells (Figure 55A) or non-target fibroblast activation
protein (FAP)-positive lasts (Figure 55B) were measured by flow cytometry. Activation of T
cells was analysed by measuring CD25 sion (Figure 55C). The free EpCAM bispecific T-cell
activator and the EpCAM bispecific T-cell activator-expressing viruses induced T-cell activation,
g to a depletion of EpCAM-positive tumour cells, with primary FAP-positive (EpCAM-negative)
fibroblasts showing no change in numbers. This was ed in all the patients’ samples, and none
of the other treatments showed any significant effects. This demonstrates that the EpCAM bispecific
T-cell activator (or oncolytic virus encoding it) can mediate activation and selective cytotoxicity by
PBMC-derived T cells to human n ascites tumour cells.
Malignant exudates likely represent an environment of potential immune nce with suppressed
immune responses commonly observed in patients with late-stage metastatic cancer. To test this
hypothesis we polyclonally stimulated PBMC-derived T cells with D3 dies in culture
media or the presence of 100% ascites fluid from five patients with peritoneal malignancies.
Whereas in RPMI medium the anti-CD3 antibody gave approximately 50% of T cells positive for both
CD25 and CD69, the presence of ascites fluid appeared to ate the activation of T-cells as
determined by decreased antibody-mediated elevation of CD69/CD25 expression, and this was
particularly noticeable for patient fluid #2 (Figure 56A). This supports our notion that components
of ascites fluid may exert an immune suppressive or tolerising effect. r, this attenuation in
the increase of activation s did not correlate with a ssion of T-cell degranulation, with
CD107a externalisation in ascites fluid similar to that in culture medium (Figure 56B). It follows that
ific T-cell tors may be able to bypass tumour microenvironment-associated mechanisms
of T-cell immunosuppression (Nakamura & Smyth, 2016).
We therefore investigated the ability of PBMC-derived T cells and EpCAM bispecific T-cell activator
to mediate target cell cytotoxicity in the presence of immunosuppressive ascites fluid. T-cells
incubated with ascites fluid 1 and 2 induced similar lysis of the human breast adenocarcinoma MCF7
cell line as when in RPMI culture medium (measured using xCELLigence), although the cytotoxicity
showed a delay of about 8 h in the presence of patient ascites fluid #2 (Figure 56C). In addition to
the immune suppressive fluid and tumour cells present, ascites contain tumour-associated
lymphocytes and supporting cells of the tumour stroma, ing a unique tumour-like model
system to test bispecific T-cell activator-mediated activation of nous patient-derived T-cells.
ing a 24 h incubation of total endogenous cells and the ascites fluid with the free recombinant
bispecific T-cell activator, activation of patient T cells was assessed (Figure 56D). In this highly
clinically-relevant setting the EpCAM bispecific T-cell activator (but not the control counterpart)
induced CD69 and CD25 expression, albeit CD25 at lower levels when the experiment was
performed in 100% ascites fluid than in simple medium. These data suggest that the EpCAM
bispecific T-cell tor can overcome at least some of the immune suppressive effects of
peritoneal ascites fluid to activate endogenous T cells. Cytotoxicity was assessed by measuring
release of LDH, and the bispecific T-cell tor caused a significant rise both when the experiment
was med in medium and also in 100% ascites fluid. This indicates that some of the ascites cells
had been killed by bispecific T-cell activator-mediated cytotoxicity, gh given the multiple cell
types present in primary ascites it is not possible to define what proportion of tumour cells are killed.
e 26 - EnAd expressing EpCAM bispecific T-cell activator can activate endogenous T
cells to kill endogenous tumour cells within malignant pleural exudates
To study the effects of the EpCAM bispecific T-cell activator-expressing viruses in another clinically
relevant setting, we obtained several samples of pleural exudates from patients with a range of
malignancies. At initial screening (an e is shown in Figure 52), samples considered suitable
for further analysis were those containing CD3 and EpCAM-positive cells. We also assessed the
expression of PD1 by endogenous T cells following their initial isolation, and whereas only 10% of
PBMC-derived T cells expresses PD1, all the malignant effusion samples T cells were at least 40%
positive for PD1 and reached sometimes as high as 100% (Figure 54). Unpurified total cells (isolated
by fugation and resuspended) were incubated at fixed concentrations in 100% pleural effusion
fluid in the ce of 500 ng/mL free EpCAM bispecific T-cell activator or 100 l virus
ng bispecific T-cell activator. After 5 days, the total cell population was harvested, and the
total number of CD3+ cells (Figure 57A) was measured.
Compared to untreated controls, only s receiving the free EpCAM bispecific T-cell activator
or EnAd encoding EpCAM bispecific T-cell activator showed T cell proliferation. This confirms that
the EpCAM bispecific T-cell activator was binding to the EpCAM target and crosslinking CD3 to
stimulate endogenous T cells. The expression level of CD25 on CD3 cells was also determined (Figure
57B). The free EpCAM bispecific T-cell activator induced significant T-cell activation of
tumourassociated lymphocytes (assessed by CD25 expression) in all patients’ samples, even within
the likely -tolerising environment of the pleural effusion fluid. The addition of an anti-PD1
blocking antibody had no effect on EpCAM bispecific T-cell activator mediated activation of T cells
in this setting (Figure 54B & C). There was noticeable ion between ts (although little
between samples from the same patient), with activation ranging from 50% to 90% dependent on
the donor. Similarly, s treated with EnAd sing the EpCAM bispecific T-cell activator
showed high activation in some patients (ranging from 10-20% up to 80%, for both MVEpCAM
ific T-cell activator and EnAd-SA-EpCAM bispecific T-cell activator).
Interestingly, the patient showing the lowest bispecific T-cell activator-mediated activation also
showed the lowest level of background T cell activation. Parental EnAd, or EnAd expressing control
bispecific T-cell activators, or free control bispecific T-cell activators caused no ation above
background.
We ed the ability of the bispecific T-cell activator-expressing viruses to mediate EpCAM-
targeted cytotoxicity by ing residual levels of EpCAM positive cells by flow cytometry at the
end of the five day incubation (Figure 57C). The free EpCAM bispecific T-cell activator, and the two
viruses encoding EpCAM bispecific T-cell activator, caused a marked depletion of autologous
EpCAM-expressing cells in every case, whereas the other treatments had little or no effect on the
level of EpCAM-positive cells. In the case of Sample #1 there is a slightly decreased viability with all
EnAd based viruses compared to the untreated control, and this is likely to represent the effects of
direct viral oncolysis. In conjunction with the lack of influence of the PD1 blocking antibody on T cell
activation, it had no effect on EpCAM bispecific T-cell activator mediated killing of target cells, with
near complete cytotoxity of EpCAM+ cells (patients 2, 3 & 4) in the absence of the PD1 blocker
(Figure 54D).
The different effects of parental EnAd and EnAd-CMV-EpCAM bispecific T-cell activator are shown
by microscopy in Figure 57D, where expression of the bispecific T-cell activator decreases the
presence of tumour cells and expands the T cell tion. The associated flow cytometry plots
confirm the substantial ion and activation of T cells following treatment with the EpCAM
bispecific T-cell activator-expressing virus.
Finally the effects of the various treatments were characterised by measuring the levels of key
cytokines ed using a LEGENDplex protein array (Figure 57E). By far the greatest fold
ses were in gamma interferon, which rose nearly 1000-fold following treatment with the free
EpCAM bispecific T-cell activator or EnAd encoding EpCAM bispecific T-cell activator. These two
treatments also caused approximately 10-fold ses in expression of IL-5, IL-13, tumour
necrosis factor (TNF), IL17A and IL17F, characteristic of activated T cells. EnAd alone (or expressing
the control bispecific T-cell activator) also caused a 10-fold rise in gamma interferon, but otherwise
no treatments caused any appreciable changes in cytokine expression.
Example 27 - Discussion
Oncolytic viruses offer an intriguing new gy to combine several therapeutic modalities within
a single ed, self-amplifying, agent r & Bell, 2016; Seymour & Fisher, 2016). As they
replicate ively within cancer cells and spread from cell to cell, some oncolytic viruses are
thought to mediate cell death by non-apoptotic death pathways (Ingemarsdotter et al, 2010; Li et al,
2013), as part of the s allowing virus particles to escape from dying cells. EnAd, in ular,
kills cells by a pro-inflammatory process known as oncosis or ischemic cell death (Dyer, 2017). This
optotic death mechanism causes e of several pro-inflammatory cellular components,
such as ATP, HMGB1 and exposure of calreticulin (known as damage-associated molecular patterns,
(Weerasinghe & Buja, 2012), and is likely pivotal to the y of the virus to promote an
effective anticancer immune response. In addition to the consequences of direct lysis, however,
viruses offer the potential to encode and s other anticancer biologics, obviating delivery
challenges and ensuring the biologic achieves its highest concentration within the tumour
microenvironment. Imlygic encodes GM-CSF, however the potential for arming viruses is virtually
limitless and provides many exciting opportunities to design multimodal therapeutic strategies with
additive or istic anticancer effects (de Gruijl et al, 2015; Hermiston & Kuhn, 2002).
Encoding bispecific T-cell activators within oncolytic viruses provides a powerful means to activate
tumour infiltrating lymphocytes to become cytotoxic and lyse antigen-positive target cells, providing
a completely separate eutic modality from the effects of direct viral lysis. In this study we have
shown that bispecific T-cell activator-targeted cytotoxicity is fully antigen-specific, can be mediated
by both CD4 and CD8 T cells (Brischwein et al, 2006) and can be incorporated into an oncolytic
adenovirus and expressed only in cells that allow virus replication. In addition the current study
shows, for the first time, that endogenous T cells within liquid cancer biopsies can be activated by
bispecific T-cell activators and virus-encoded bispecific T-cell activators and can kill endogenous
tumour cells without any additional stimulation or al of immune suppression. Importantly,
this can happen even in the primary fluids that comprise the microenvironment of peritoneal ascites
or pleural effusions, as surrogates for the immune suppressive microenvironment of solid tumours.
Arming oncolytic viruses to express bispecific T-cell activators combines two quite distinct
therapeutic mechanisms, with the former providing lytic death of tumour cells that are permissive
for virus infection, and the latter targeting T cell cytotoxicity via a specific, chosen, antigen. This
provides erable flexibility in the design of a therapeutic approach, perhaps using the bispecific
T-cell activators to deliver cytotoxicity to tumour-associated cells that are relatively resistant to kill
by the virus directly. For example, while we have exemplified the technology here using a bispecific
T-cell activator that recognises a carcinoma-associated n (EpCAM), it is also possible to use
the bispecific T-cell activator approach to target cytotoxicity to tumour-associated fibroblasts or
other stromal cells. Indeed, even when the targets for bispecific T-cell activator-recognition are not
restricted to expression in the tumour microenvironment, by linking bispecific T-cell activator
production to virus replication allows expression of the bispecific T-cell activator to be spatially
restricted to the tumour, minimising systemic toxicities. This is important, as bispecific T-cell
activators administered intravenously show relatively short circulation kinetics (Klinger et al, 2012)
and are often associated with considerable on-target off-tumour ties (Teachey et al, 2013).
The possibility to encode bispecific T-cell activators within oncolytic viruses has been previously
explored using an oncolytic vaccinia virus with an Ephrin A2-targeting ific T-cell tor.
This agent showed that the Ephrin bispecific T-cell activator could mediate activation of PBMCs and
antigen-targeted killing of tumour cells both in vitro and in vivo. Intriguingly, gh the bispecific
T-cell activator could activate T cells it did not lead to T cell proliferation without the addition of
exogenous IL-2, whereas the bispecific T-cell activator used in the current study led to ive
proliferation both of PBMC in vitro and of -associated lymphocytes using the clinical biopsy
samples ex vivo.
We believe that the differences observed may reflect the different bispecific T-cell activator design,
the different oncolytic virus used or perhaps depend on the antigen density giving sufficient
crosslinking of CD3 on the T cells.
One l aim of oncolytic virus y is to create an anticancer T cell response that ises
patient specific neoantigens as well as “public” tumour ated antigens. Lytic viruses may do this
by stimulating improved n presentation by lysing tumour cells in the t of DAMPs
alongside virus-related pathogen-associated molecular patterns (PAMPs). Immunohistochemical
staining of ed colon tumours, following intravenous delivery of EnAd, suggest the virus
es a strong influx of CD8+ T cells into tumour tissue (Garcia-Carbonero, 2017). r,
while this is potentially a very powerful ch, adaptive T cell responses are ultimately
dependent on the expression of MHC class I antigens by tumour cells, to allow ed killing. Loss
of MHC expression is a well documented immune evasion strategy for tumours (Garrido et al, 2016).
It is noteworthy that both cytotoxic strategies that are ately d by bispecific T-cell
activator-armed tic viruses operate independently of MHC class I by the tumour cells, and
therefore can be employed to kill cancer cells even when tumour cells have lost MHC expression.
The present study thus demonstrates that encoding bispecific T-cell activators within EnAd provides
a particularly promising strategy to achieve targeted expression in disseminated tumours, exploiting
the known blood-stability and systemic bioavailability of the virus, which has now been studied in
several early phase clinical trials. Notably, in a study where the virus is given intravenously a few
days prior to resection of primary colon cancer, subsequent immunohistological assessment of
tumour sections showed that the virus had reached to regions through the tumours and gave strong
intranuclear hexon signals, indicating successful infection and virus replication selectively in tumour
cells. This confirms nical data (Di et al, 2014; Illingworth, 2017) indicating that this virus is
stable in 100% human blood and should be capable of tumourtargeted infection of disseminated and
metastatic malignancies in human patients.
bispecific T-cell tors could be encoded by EnAd without any loss of oncolytic virulence (Figure
51B), reflecting the considerable transgene packaging capacity of the virus. The presence of the
transgene will not affect the physicochemical properties of the virus particles, hence the modified
viruses should t exactly the same al pharmacokinetics as the parental agent, and should
be capable of expressing the encoded bispecific T-cell activator selectively within tumours
throughout the body. This provides an exciting and potentially very effective new approach to
ically targeted cancer immunotherapy that should now be prioritised for clinical assessment.
Example 28
Immunosuppression of human T-cell activation and target cell cytotoxicity by t
malignant exudate fluids
Malignant exudates represent an environment of potential immune tolerance with suppressed
immune responses ly observed in patients with late-stage metastatic cancer. The quantity
of IL-10, considered to be an anti-inflammatory cytokine, was ed in normal serum or patient
malignant exudate fluids (A, neal ascites; P, pleural effusion) using Human IL-10 ELISA MAX
kit gend, 430604). IL-10 levels in the exudates (88.1 – 633.4 pg/mL) were far in excess of those
measured in normal serum (7.2 – 10 pg/mL). See Figure 58.
The ability of CD3/CD28 beads , 11161D) to activate PBMC T-cells in the presence of normal
serum, ascites or pleural fluid was investigated. Human PBMC T-cells (100,000 cells per well in 96
well plate) were treated with CD3/CD28 beads (following manufacturers instructions) in normal
serum or patient exudate fluid (50%). T-cells were left untreated in each fluid as negative control.
After 24 hours of culture, cells were harvested and the expression levels of CD69 and CD25 on CD3+
T-cells were then analysed by antibody staining and flow try represented as percentage of
dual positive (CD69+CD25+ cells) (Figure 59). In normal serum the anti-CD3/CD28 beads gave
approximately 60% of T cells dual positive for both CD25 and CD69, whereas the presence of ascites
fluid ated T cell tion in 6/12 fluids.
In a similar experiment, 100,000 T-cells were treated with CD3/CD28 beads in the presence of
normal serum, ascites or pleural fluid (50%). Anti-CD107a or isotype control antibody were added
directly to culture medium. After 1 hour, in was added (BD Golgistop, BD Biosciences)
according to manufacturers instructions. After 5 further hours, cells were harvested and analysed
by flow cytometry to determine ulation (Figure 60). In normal serum the anti-CD3/CD28
beads gave imately 22.5% of T cells degranulated, whereas the presence of ascites fluid
attenuated T cell activation in 10/12 fluids. The level of degranulation was icantly ative
(Pearson co-efficient, r = -0.7645; p = 0.0038) with quantity of IL-10 in each fluid (Figure 61).
In a similar experiment, 75,000 T-cells were co-cultured with 15,000 SKOV3 and EpCAM in the
presence of normal serum, ascites or pleural fluid (50%). T-cells were treated with control bispecific
T-cell activator in each fluid as negative control. After 24 hours of culture, cells were harvested and
the expression levels of CD69 and CD25 on CD3+ T-cells were then analysed by antibody staining
and flow try represented as percentage of dual positive (CD69+CD25+ cells) (Figure 62). In
normal serum the EpCAM bispecific T-cell activator gave approximately 67.6% of T cells dual
positive for both CD25 and CD69, whereas the presence of s fluid attenuated T cell activation
in 0/12 fluids, and slightly induced activation in 4/10 fluids.
In a similar experiment, 75,000 T-cells were co-cultured with 15,000 SKOV3 and EpCAM in the
presence of normal serum, ascites or pleural fluid (50%). T-cells were d with control bispecific
T-cell activator in each fluid as negative control. Anti-CD107a or isotype l dy were
added directly to culture medium. After 1 hour, monensin was added (BD Golgistop, BD ences)
according to manufacturers instructions. After 5 further hours, cells were ted and analysed
by flow cytometry to determine degranulation (Figure 63). In normal serum the EpCAM bispecific
T-cell activator beads gave approximately 41.4% of T cells degranulated, whereas the presence of
ascites fluid attenuated T cell activation in 2/12 fluids.
The ability of EnAd-SA-EpCAMbispecific T-cell activator and EnAd-SA-Controlbispecific T-cell
activator to induce T cell-mediated target cell lysis in malignant exudate fluids was ed using
xCELLigence technology. SKOV cells were plated in 48-well E-plate at 1e4 cells/well respectively.
Plates were incubated for 18 hrs, 37⁰C, 5% CO2, before cells were either infected with 100 virus
particles per cell (ppc) or were left uninfected. After two hours, PBMC s (5:1) in normal serum
or patient e fluid (final, 50%) were added. gence was used to measure target cell
cytotoxicity every 10 minutes (Figure 64). The results suggest that bispecific T-cell activatormediated
SKOV3 lysis by T-cells is independent of fluid used.
Unpurified ascites cells (therefore unchanged from when received) are seeded at 100,000 cells per
well of a ottom 96-well plate in RPMI media or ascites fluid. Cells were d with EpCAM or
control bispecific T-cell activator, with untreated wells serving as a negative control. After
incubation at 37C for 24 hours, cells were harvested, and the expression level of CD25 and CD69 on
CD3 cells determined (Figure 65). The results demonstrate that EpCAM bispecific T-cell activator
resulted in significant increase in T-cell activation (CD69/CD25 dual positive) of tumour-associated
lymphocytes, slightly sed by ascites fluid.
In a similar experiment, fied ascites cells (therefore unchanged from when ed) are
seeded at 100,000 cells per well of a flat-bottom 96-well plate in RPMI media or ascites fluid. Cells
were treated with EpCAM, control bispecific T-cell activator or recombinant bispecific T-cell
activator viruses (100 vp/cell), with untreated wells serving as a negative control (Figure 66). After
incubation at 37C for 5 days, the total cell population was harvested, and the number of CD3+ cells
(Figure 66A) and expression level of CD25 on CD3 cells determined (Figure 66B) and the number of
endogenous EpCaM + cells determined by flow cytometry (Figure 66C). Total cell numbers per well
were determined using precision counting beads. The results demonstrate that EpCAM bispecific T-
cell activator and EnAd expressing EpCAM bispecific T-cell activator resulted in significant increase
in T-cell activation (CD3 number, CD25) of tumour-associated lymphocytes and cytotoxicity of
EpCAM+ cells in both RPMI media and s fluid.
As an extension of the experiment above, six more patient exudate samples (for a total of 7) were
d identically in ascites fluid (Figure 67) and number of CD3+ e 67A), CD25 expression
of s (Figure 67B) and number of EpCAM+ cells (Figure 67C) determined by flow cytometry.
The results show that EpCAM bispecific T-cell activator and EnAd expressing EpCAM bispecific T-
cell activator resulted in significant increase in T-cell activation (CD3 number, CD25) of tumourassociated
lymphocytes and cytotoxicity of EpCAM+ cells reproducibly in a range of exudate biopsy
samples.
Example 29
FAP bispecific T-cell activator mediate activation of T-cells and killing of FAP+ cells by diferent
donor T-cells
In other experiments, s described in Example 2 were used to further evaluate the T-cell
activating properties of recombinant FAP bispecific T-cell activator protein tested in co-cultures of
NHDF and T-cells, comparing to control bispecific T-cell activator and polyclonal T-cell activation
using anti-CD3/CD28 Dynabeads.
Supernatants taken after 24 hours of culture were tested by ELISA for IFNγ (Figure 68A) and by
cytokine bead array (LEGENDplex human T helper cytokine panel, BioLegend #74001) for a panel
of cytokines (Figure 68B). The control bispecific T-cell activator induced no significant change in
any cytokine, however the FAP-bispecific T-cell activator led to strong increases in gamma
interferon, IL-2, TNFα, IL-17 and IL-10, consistent with different subsets of s being ated,
and production of IFNγ was far greater than that triggered by anti-CD3/CD28.
Stimulation with the FAP bispecific T-cell activator, but not l bispecific T-cell activator, in the
presence of NHDF cells also induced rapid degranulation n 6 hr) of T-cells, both CD4+ and
CD8+ subsets, as determined by the alisation of CD107a/LAMP1 on the T-cell surface (as
assessed by flow cytometry), which is strongly correlative with their ability to kill target cells (Figure
69A&B). This induction of degranulation by the FAP ific T-cell activator translated to potent
fibroblast lysis (Figure 69C), as measured by LDH e after 24 h ture with PBMC T-cells
(EC 50 of ~2.5 ng/mL) with induced T-cell activation and cytotoxicity observed using 6/6 donor T-
cells (Figure 69D). No cytotoxicity was induced by the control bispecific T-cell activator, consistent
with T-cells remaining in an inactivated state.
Example 30
Effect of FAP bispecific T-cell activator and EnAd-FAP bispecific T-cell activator viruses on cells
in y malignant ascites s from different ancer patients
As a follow-on to studies bed in Example 16, fresh primary malignant peritoneal ascites from
further cancer patients were obtained for study of EnAd FAP bispecific T-cell activator virus
activities. Three patient samples containing both EpCAM+ tumour cells and FAP+ fibroblasts were
expanded ex vivo, and the mixed (adherent) cell populations were cultured with PBMC-derived T-
cells and unmodified or bispecific T-cell activator expressing EnAd viruses. After 72 h, total cells
were harvested and the number of FAP+ (Figure 70A) and EpCAM+ cells (Figure 70B) determined by
flow cytometry. Additionally, the activation status of T-cells (by CD25 expression) was measured
(Figure 70C). Infection with both EnAd-CMV-FAPbispecific T-cell activator and EnAd-SAFAPbispecific
T-cell activator d T-cell activation and FAP+ cell depletion in all patient samples,
with no significant change in levels of EpCAM+ tumour cells. Parental EnAd or the control viruses
induced no observable T cell activation, with FAP+ cell numbers remaining similar to the uninfected
control.
Importantly, this depletion in FAP+ fibroblasts consistenly led to a strong reduction in levels of the
immunosuppressive cytokine TGFβ detected in supernatants (Figure 70D).
In a second series of experiments, total (and unpurified) cells from five patient biopsy samples were
evaluated to assess the activity of endogenous tumour-associated T-cells in the samples. Cells were
plated in 50% ascites fluid and treated with recombinant control or FAP bispecific T-cell activator
ns, or 100 vp/cell of EnAd or EnAd-bispecific T-cell activator viruses. After 5 days incubation,
T-cell activation (by CD25 expression) and residual number of FAP+ cells was measured by flow
cytometry e 71A&B). In all 3 t samples, recombinant FAP-bispecific T-cell activator and
EnAd-CMV-FAP bispecific T-cell activator induced strong T-cell activation, with up to ~80% of
patient-derived T-cells activated, which caused a marked depletion FAP+ lasts. Interestingly,
EnAd-SA-FAP-bispecific T-cell activator induced CD25 expression in 2/3 samples, with no
able activation or FAP+ cell ion in patient 1. This is probably due to insufficient tumour
cells being present for infection by the virus and production of bispecific T-cell activator protein (no
EpCAM+ tumour cells were detected in this sample by flow cytometry), consistent with the
requirement for tumour cells for MLP (SA)-driven transgene sion (this likely also ns the
lack of T-cell activation and FAP+ cell depletion by A-FAP-bispecific T-cell activator virus
with the patient ascites sample rated in Figs 42-44). Collectively, the data shows that EnAd
sing FAP-bispecific T-cell activator can, following infection of tumor cells, reproducibly lead
to activation of tumour-associated T-cells to kill endogenous fibroblasts.
Another experiment investigated whether FAP-bispecific T-cell activator activity could be improved
by blocking the PD-1 checkpoint, using a patient biopsy sample in which s were 73.6% PD-1
positive and FAP+ cells were 62.9% PDL1-positive (Figure 72A). Co-cultures r to those
described above were set up in the ce or absence of a purified blocking mouse IgG2b antibody
to human PDL1 (BioLegend, clone 29E.2A3) at a final concentration of 2.5 µg/mL. After 2 days of
e, total cells were harvested and residual FAP+ cells and T-cell activation was measured. The
inclusion of the blocking DL1 antibody led to a modest increase in CD25 induction (Figure
72B) and a two-fold higher IFNγ production (Figure 72C), without altering the depletion of FAP+
cells (Figure 72D) with near complete lysis by day 2 in either setting.
Tumour-associated lymphocytes (TALs) isolated from ovarian cancer patient ascites are reported to
have enriched expression of PD-1 and impaired effector functions – including cytotoxicity and IFNg
production. Consistent with this, PD-1 expression was 2-fold higher on CD3+ cells from six cancer
patient ascites biopsies than on those in peripheral blood mononuclear cells (PBMCs) from three
healthy donors (Figure 73A). To evaluate the functionality of the T-cells within these cancer biopsy
s, NHDF cells and unpurified PBMC or ascites cells (the % CD3+ cells for each of the samples
is shown in Figure 73B) were tured with control or FAP bispecific T-cell activator-containing
supernatants, and supernatants were harvested 5 days later and tested for IFNγ by ELISA (Figure
73C). No IFNγ was induced by the control bispecific T-cell activator. Three of the ascites cell samples
produced IFNγ at a similar level to that of the PBMC samples, while the other three had an attenuated
response to the FAP bispecific T-cell tor. We next investigate the ability of these T-cells to
induce bispecific T-cell activator-mediated lysis of the NHDF cells. NHDF were plated, and PBMC or
ascites cells added along with ific T-cell activator-containing supernatants and the viability of
cells in the culture monitored in real-time using the xCELLigence cytotoxicity assay system. Despite
the variability in IFNγ tion, all ascites samples induced full cytotoxicity of NHDF cells when
added with the FAP ific T-cell activator, with an l similar rate of bispecific T-cell
activator-mediated NHDF lysis to that seen with when effected by PBMCs e 73D).
To investigate whether the FAP bispecific T-cell activator can mediate T-cell activation in the
presence patient malignant exudate samples (all at 50%), PBMC T-cells were ted with control
or FAP bispecific T-cell activators in the presence of NHDF cells, or activated with anti-CD3/CD28
Dynabeads, either in 50% normal human serum (NS) or different (cell-free) malignant exudate
samples. s in normal serum 74% of T-cells were activated (dual-positive for both CD25 and
CD69) at 24 h following stimulation with the anti-CD3/CD28 beads, 3/5 tested ascites fluid
significantly ated T-cell activation compared to the response in NS (Figure 74A). However,
when PBMCs were cultured with NHDF and stimulated with the FAP bispecific T-cell tor, there
was no observable suppression of T-cell activation in the ce of any of the exudate fluids
(Figure 74B), demonstrating that the FAP bispecific T-cell activator can overcome
immunosuppressive mechanisms to activate T-cells.
Example 31
EnAd-FAPbispecific T-cell activator-mediated oncolysis and T cell stimulation polarise CD11b+
TAMs in patient ascites to a more activated phenotype
To investigate whether the production of Th1 cytokines, including IFNγ, TNFα and IL-2, by FAP
bispecific T-cell activator-mediated activation of T-cells, and the subsequent elimination of FAP+
lasts (and associated reduction in TGFβ1 was associated other shifts in the tumour
nvironment from immunosuppressive and pro-oncogenic towards umour ty, the
effect on tumour-associated macrophages (TAMs) in an unseparated ascites cell sample was
evaluated. Total unpurified patient ascites cells were plated in 50% ascites fluid and treated with
free control or FAP bispecific T-cell activator or infected with EnAd-SA-control bispecific T-cell
activator or EnAd-SA-FAPbispecific T-cell activator virus (at 100 vp/cell). In parallel, some cells
were treated in with IFNγ to induce an activated CD11b myeloid cell phenotype. After 3 days
incubation, the activation status of T-cells was first measured; CD25+ cells measured by flow
cytometry and IFNγ secretion by ELISA.
Treatment with FAP bispecific T-cell activator and EnAd-SA-FAPbispecific T-cell activator led to
approximately 60% of CD3+ s becoming CD25+ (Figure 75A) and large quantities of IFNγ in
culture supernatants (Figure 75B). No increase above background by the control bispecific T-cell
activator or control virus was observed for CD25 expression or IFNγ. To te TAM polarisation,
the expression levels of CD64 and CD86 (M1 or ‘activated’ macrophage markers) and CD206 and
CD163 (M2 or TAM markers) were measured on CD11b+ cells by flow cytometry (Figure 75C).
Treatment with free FAP bispecific T-cell activator or EnAd expressing FAP bispecific T-cell activator
induce a more activated phenotype, manifested by icant increases in CD64 expression, and
strong decreases CD206 and CD163 – similar to that observed when IFNγ was spiked into the
cultures.
While treatment with free FAP bispecific T-cell activator or control virus induced no clear change in
CD86 above background in this experiment, the EnAd expressing FAP bispecific T-cell activator
induced a large increase in CD86 expression, indicating that EnAd virus infection and FAP bispecific
T-cell activator activity may synergize to activate primary d cells within a suppressive tumour
microenvironment such as the malignant ascetic fluid samples tested here. In this study, IFNγ
treatment d a modest decrease in CD86, indicating that the strong increase in CD86 observed
by EnAd-SA-FAPbispecific T-cell activator may be via an IFNγ-independent mechanism.
Example 32
EnAd-FAPbispecific T-cell activator activates tumour-infiltrating lymphocytes and s
xicity in solid te tumour biopsies ex vivo
Tissue slice cultures e one of the most realistic preclinical models of diverse tissues, organs
and tumours. To te the activity of the FAP bispecific T-cell tor expressing viruses in this
highly clinically-relevant setting, several paired punch biopsies of malignant and benign prostate
tissue from resected human prostates were studies. At initial screening, prostate tissue was
reproducibly shown to have circular rings of EpCAM+ tumour cells (Figure 76A) interspersed
between large regions of stroma containing scattered CD8 T-cells e 76B). FAP staining was
found on fibroblasts adjacent to tumour regions (Figure 76C).
Cores were sliced by a vibratome to 300µm thickness and slice cultures established in the presence
of virus (1.5e9 vp/slice), or left uninfected. After 7 days, slices were fixed, paraffin-embedded,
sectioned and T-cell activation status was assessed by immunohistochemistry (IHC) by ng for
CD25 expression (Figure 76D). Only samples receiving EnAd-CMV-FAPbispecific T-cell activator or
A-FAPbispecific T-cell tor showed activation of tumour-infiltrating T-cells, manifest by
strong CD25 ng. Neither untreated or control virus-treated had detectable CD25-positive cells.
Supernatants from these slice cultures taken at 4 and 7 days post-infection were tested for IFNγ and
IL-2 by ELISA, with increases in IFNγ detected from malignant, but not benign, prostate slice cultures
infected with either FAP bispecific T-cell activator virus (Figure 76E) and IL-2 detected in cultures
with A-FAPbispecific T-cell activator virus e 76F). The EnAd-SA-FAPbispecific T-cell
activator induced higher quantities of IFNγ, which were detectable earlier, than the CMV-driven
FAPbispecific T-cell activator virus.
Example 33 - EnAd viurses expressing EpCAM or FAP bispecific T-cell activators
Five viruses 1, NG-612, NG-613, NG-614, NG-617) were generated that encode a single
bispecific T-cell activator (Table 8).
Table 8
Virus ID Transgene Cassette
NG-611 (SEQ ID NO: 96) SSA1-EpCambispecific T-cell activator2-His3-PA4
NG-612 (SEQ ID NO: 97) SSA1-FAPbispecific T-cell activator5-His3-PA4
NG-613 (SEQ ID NO: 98) SA6-FAPbispecific T-cell activator5-His3-PA4
NG-614 (SEQ ID NO: 99) SA6-FAPbispecific T-cell tor7-His3-PA4
NG-617 (SEQ ID NO: 100) SSA1-FAPbispecific T-cell activator5-PA4
1SEQ ID NO. 55; 2SEQ ID NO. 83; 3SEQ ID NO. 84; 4SEQ ID NO. 65; 5SEQ ID NO. 85; 6SEQ ID NO. 86; 7SEQ ID NO.
In each transgene cassette, the cDNA encoding the bispecific T-cell activator was flanked at the 5’
end with either a short splice or sequence (SSA, SEQUENCE ID NO: 55) or a longer splice
acceptor sequence (SA, SEQUENCE ID NO: 86). At the 3’ end of the bispecific T-cell activator, a SV40
late poly(A) sequence (PA, CE ID NO: 65) was encoded preceded by either a Histidine tag
(HIS, SEQ ID NO. 41) or no tag. In s NG-611, NG-612, NG-613 and NG-617 the anti-CD3 portion
of the bispecific T-cell activator molecule used a single chain t of the mouse anti-human CD3ɛ
monoclonal antibody OKT3.
Virus Production
The plasmid pEnAd2.4 was used to gerneate the plasmids pNG-611, 2, pNG-613, pNG-614
and pNG-617 by direct insertion of sised transgene cassettes (SEQ ID NOs: 88-92,
respectively). The pNG-611 transgene cassette encodes for an EpCam ing ific T-cell
activator (SEQ ID NO. 93), the 2, pNG-613 and 7 transgene cassettes encode a FAP
targeting bispecific T-cell activator of SEQ ID NO. 94 and the pNG-614 transgene cassette encodes a
FAP targeting bispecific T-cell activator of SEQ ID NO. 95. Schematics of the transgene tes are
shown in Figure 77A to C. Construction of plasmid DNA was confirmed by restriction analysis and
DNA sequencing.
The plasmids, pNG-611, pNG-612, pNG-613, pNG-614 and pNG-617, were linearised by restriction
digest with the enzyme AscI to produce the virus genomes. The viruses were amplified and purified
according to methods given below.
Digested DNA was purified by phenol/chloroform extraction and itated for 16hrs, -20⁰C in
300μl >95% molecular biology grade ethanol and 10μl 3M Sodium Acetate. The precipitated DNA
was pelleted by centrifuging at 14000rpm, 5 mins and was washed in 500μl 70% ethanol, before
centrifuging again, 14000rpm, 5mins. The clean DNA pellet was air dried, resuspended in 500μl
M containing 15μl lipofectamine transfection reagent and incubated for 30 mins, RT. The
transfection mixture was then added drop wise to a T-25 flask containing 293 cells grown to 70%
confluency. After incubation of the cells with the transfection mix for 2hrs at 37⁰C, 5% CO2 4mls of
cell media (DMEM high glucose with glutamine mented with 2% FBS) was added to the cells
and the flasks was incubated 37⁰C, 5% CO2.
The transfected 293 cells were monitored every 24hrs and were mented with additional
media every rs. The production of virus was monitored by observation of a significant
cytopathic effect (CPE) in the cell monolayer. Once extensive CPE was observed the virus was
harvested from 293 cells by three freeze-thaw cycles. The harvested viruses were used to re-infect
293 cells in order to amplify the virus stocks. Viable virus production during amplification was
confirmed by observation of significant CPE in the cell monolayer. Once CPE was observed the virus
was harvested from 293 cells by three -thaw cycles. The amplified stocks of viruses were used
for further amplification before the s were purified by double m chloride banding to
produce purified virus stocks.
Virus activity assessed by qPCR
A549 cells, either infected for 72 hrs with 1ppc NG-611, NG-612, NG-617, enadenotucirev or left
uninfected, were used for quantification of viral DNA by qPCR. Cell supernatants were collected and
ied by centrifuging for 5 mins, 1200rpm. DNA was extracted from 45µL of supernatant using
the Qiagen DNeasy kit, according to the manufacturer’s protocol. A standard curve using
enadenotucirev virus particles (2.5e10-2.5e5vp) was also prepared and extracted using the DNeasy
kit. Each extracted sample or standard was ed by qPCR using a virus gene ic primerprobe
set to the early gene E3.
Quantification of the number of detected virus genomes per cell demonstrated that NG-611, NG-612,
and NG-617 showed significant genome replication in A549 cell lines (Figure 77D). This was similar
for all viruses tested including the al virus otucirev, indicating that inclusion of the
bispecific T-cell activator transgene does not impact virus ative activity. No virus genomes
could be detected in uninfected cells (data not shown).
T cell activation and degranulation mediated by bispecific T-cell activator expressing viruses.
Carcinoma cell infection
A549 cells were seeded into 24 well plates at a density of 2.5e5 cells/well. Plates were incubated
for 4 hrs, 37⁰C, 5% CO2, before cells were either infected with 1ppc of NG-611, NG-612,
enadenotucirev or were left uninfected. At 24, 48 or 72hrs post-infection supernatants were
harvested from the cells, ied by centrifuging for 5 mins, 1200rpm and snap frozen.
T cell Assay
FAP expressing lung fibroblast cell lines MRC-5, or EpCam expressing ovarian oma cells,
SKOV3 were seeded into 48 well plates at densities of 5.7e4 cells/well and 1.2e5 cells/well,
respectively. Plates were incubated for 4 hrs, 37⁰C, 5% CO2, before media was replaced with
150µL/well of thawed supernatant harvested from the A549 plates. Purified CD3 T cells isolated
form human PBMC donors were then also added to the plates to give a ratio of T cells to MRC-5 or
SKOV3 of 2 to 1. The co-cultures were incubated for 16hrs, 37⁰C, 5% CO2 before cellular
supernatants were collected for ELISA analysis and T cells harvested for flow cytometry analysis.
Culture media ning non-adherent cells was removed from co-culture wells and fuged
(300xg). The supernatant was carefully removed, diluted 1 in 2 with PBS 5% BSA and stored for
ELISA analysis. The adherent cell monolayers were washed once with PBS and then detached using
trypsin. The trypsin was inactivated using 10% FBS RPMI media and the cells were added to the cell
pellets that had been collected from the culture supernatants. The cells were centrifuged (300xg),
the supernatant discarded and the cell pellet washed in 200μL of PBS. The cells were centrifuged
again then resuspended in 50μL of PBS containing Live/Dead Aqua (Life tech) for 15 minutes at RT.
The cells were washed once in FACs buffer before staining with panels of directly conjugated
antibodies: D3 conjugated to AF700; anti-CD25 conjugated to BV421; anti-HLA-DR conjugated
to PE/CY5; anti-CD40L conjugated to BV605; anti-CD69 conjugated to PE and anti-CD107a
conjugated to FITC. A sample of cells from each co-culture condition was also stained with relevant
isotype control antibodies. All ng was carried out in FACs buffer in a total volume of 50μL/well
for 15 minutes, 4°C. Cells were then washed twice with FACs buffer (200μL) before resuspension in
200μL of FACs buffer and analysis by Flow cytometry (Attune).
Upregulation of T cell activation markers
Flow cytometry analysis of T cell activation was assessed by expression of the T cell tion
markers CD25, CD69, HLA-DR and CD40L or the T cell degranulation , CD107a on live, single
cells. These data showed that when co-cultured with EpCam+ SKOV3 cells the number of T cells
expressing CD25, CD69, HLA-DR, CD40L or cell surface CD107a was significantly sed when
NG-611 supernantants were added to the cells compared to , enadenotucirev or untreated
control supernatants (Figure 78). For all these markers little T cell activation was stimulated by
supernatants from A549 cells infected for 24hrs however, by 48 hrs post-infection, supernatants
stimulated significant T cell activation across all markers. This was also the case at 72hrs postinfection.
When co-cultured with FAP+ MRC-5 cells the number of T cells expressing CD25, CD69, HLA-DR,
CD40L or cell surface CD107a was icantly increased when NG-612 supernantants were added
to the cells compared to NG-611, enadenotucirev or untreated control atants (Figure 79).
Some T cell activation could also be observed with the NG-611 virus, which was likely due to low but
detectable expression of EpCam (~5%) on the MRC-5 cell lines engaging the EpCam bispecific T-cell
activator expressed by the NG-611 virus e 80). For all these markers, little T cell activation
was stimulated by supernatants from A549 cells infected for 24hrs however, by 48 hrs postinfection
, supernatants stimulated significant T cell activation across all s. CD25 and CD69
markers were also upregulated following incubation with supernatants harvested 72hrs postinfection
, however, activation markers, HLA-DR, CD40L and CD107a were detected at lower levels
with supernatants harvested 72hrs nfection than 48hrs post-infection. This could be due to
high levels of ific T-cell activator present at this later stage of infection leading to rapid and
potent T cell activation that means the or functions need to measured at timepoints r
than 16 hrs post-incbuation with the supernatants.
For detection of IFNγ expression, co-culture supernatants were d into 5% BSA/PBS assay
buffer (in a range of 1:10 to 1:1000) and ELISA was carried out using the Human IFN gamma
Quantikine ELISA kit (R&D systems) according to the cturer’s ol. The concentration
of secreted IFNγ was determined by interpolating from the standard curve. Expression of IFNγ could
only be detected in the supernatants of co-cultures using NG-611 on SKOV3 cells Figure 81A) or NG-
611, NG-612 on MRC-5 cells (Figure 81B).
Example 34: Immune tion and anti-tumour efficacy of ific T-cell activator
expressing viruses in vivo
NSG mice humanised CD34+ haematopoietic stem cells (from Jackson Labs) were implanted with
HCT116 tumour cells subcutaneously on both flanks at 18 weeks post engraftment. Once tumours
reached 80-400mm3 mice were grouped such that each treatment arm had an equivalent
distribution of tumour volumes, 7 mice per group. Mice were injected umourally with either
saline, enadenotucirev or NG-611 at 5x109 les per injection, 2 injections per tumour. Tumours
on both flanks were treated. Tumour volume was measured 3-4 times per week and demonstrated
that NG-611 treatment resulted in a significant umour response out to 20 days post-dosing
compared to enadenotucirev or untreated controls e 82a). After the 20 days post-dosing one
tumour from 4 mice in each group was processed for flow cytometry while remaining tumours were
frozen on dry ice.
Flow cytometry
Tumour samples were mechanically disaggregated immediately following resection in a small
volume of RPMI media. Disaggregated tumours were then passed through a 70µm cell strainer and
centrifuged at 300g for10 minutes. Cell pellets were resuspended in 100μL of PBS containing
ead Aqua (Life tech) for 15 minutes on ice. The cells were washed once in FACs buffer (5%
BSA PBS) before staining with a panel of directly conjugated antibodies: anti-CD8 (RPA-T8, AF700);
anti-CD4 (RPA-T4, PE); anti-CD45 (2D1, APC-Fire 750); anti-CD3 (OKT3, PerCP-Cy5.5); anti-CD25
1, PE-Dazzle 594); anti-CD69 (FN50, APC); anti-HLA-DR (L243, BV605); anti-CD107a (H4A3,
FITC). A pool of tumour cell suspensions was also stained with relevant isotype control
antibodies. All staining was carried out in FACs buffer in a total volume of 50μL/well for 20 minutes
at 4°C. Cells were washed three times with FACs buffer (200μL) before ension in 200μL of
FACs buffer and analysis by Flow cytometry (Attune). FACs analysis demonstrated that the ratio of
CD8 to CD4 T cells in the tumour was significantly increased in NG-611 treated tumours compared
to enadenotucirev treated or untreated controls (Figure 82b).
Example 35 – EnAd s co-expressing FAP bispecific T-cell activators and immunemodulatory
cytokines and chemokines
Three s (NG-615, NG-640 and NG-641) were generated that encoded a FAP bispecific T-cell
activator and immunomodulatory proteins (Table 9).
Table 9
Virus ID Transgene Cassette
NG-615 (SEQ ID NO: 101) SSA1-FAPbispecific T-cell activator2-E2A3-Flt3L4-P2A5-MIP1α6-
T2A7-IFNα8-PA9
NG-640 (SEQ ID NO: 102) SSA1-FAPbispecific T-cell activator2-P2A5-CXCL1010-T2A7-
CXCL911-PA6
NG-641 (SEQ ID NO: 103) SSA1-FAPbispecific T-cell activator5-P2A5-CXCL1010-T2A7-
1-E2A3-IFNα8-PA6
NG-615 (SEQ ID NO: 298) SA12-FAPbispecific T-cell activator2-E2A3-Flt3L4-P2A5-MIP1α6-
T2A7-IFNα8-PA9
1SEQ ID NO. 55; 2SEQ ID NO. 87; 3SEQ ID NO. 63; 4SEQ ID NO. 105; 5SEQ ID NO. 61; 6SEQ ID NO. 107;
7SEQ ID NO. 64; 8SEQ ID NO. 109; 9SEQ ID NO. 65; 10SEQ ID NO. 110; 11SEQ ID NO. 111; 12SEQ ID NO.
Virus Production
The plasmid pEnAd2.4 was used to gerneate the plasmids pNG-615, pNG-616, pNG-640 and pNG-
641 by direct insertion of synthesised transgene cassettes (SEQ ID NOs: 112-114, tively). NG-
615 and NG-616 contain four transgenes encoding for a FAP-targeting bispecific T-cell activator
(SEQ ID NO: 94), Flt3L (SEQ ID NO. 115), MIP1α SEQ ID NO. 116) and IFNα (SEQ ID NO. 117). NG-
640 and NG-641 encode for a FAP targeting bispecific T-cell activator (SEQ ID NO. 94), CXCL9 (SEQ
ID NO. 118) and CXCL10 (SEQ ID NO. 119), NG-641 also ns a fourth transgene encoding IFNα
(SEQ ID NO. 117) Schematics of the transgene cassettes are shown in Figure 83A to C. Construction
of plasmid DNA was confirmed by restriction is and DNA sequencing.
The plasmids, pNG-615, pNG-616, pNG-640 and pNG-641, were ised by ction digest with
the enzyme AscI to e the virus genomes. The viruses were amplified and purified according
to methods detailed in Example 33.
Virus activity assessed by qPCR and transgene ELISA
Carcinoma cell infection
A549 cells either infected for 72 hrs with 1ppc NG-615, enadenotucirev or left uninfected were used
for quantification of viral DNA by qPCR and analysis of transgene expression by ELISA. Cell
supernatants were collected and clarified by centrifuging for 5 mins, 1200rpm. 45µL of atant
was used for DNA analysis and the remaining supernatant was used for ELISA.
DNA was ted from the supernatant sample using the Qiagen DNeasy kit, according to the
manufacturer’s protocol. A standard curve using enadenotucirev virus particles 0-2.5e5vp)
was also prepared and extracted using the DNeasy kit. Each extracted sample or standard was
analysed by qPCR using a virus gene specific primer-probe set to the early gene E3. Quantification
of the number of detected virus genomes per cell demonstrated that NG-615 showed significant
genome replication in A549 cell lines at a level similar to that of the parental virus enadenotucirev
(Figure 84). These data indicated that ion of the bispecific T-cell activator and three
immunomodulatory transgenes does not significantly impact virus replicative activity. No virus
genomes could be detected in uninfected cells.
ELISA
IFNα ELISA was d out using the Verikine Human IFN alpha Kit (Pbl assay science), MIP1α
ELISA was carried out using the Human CCL3 Quantikine ELISA kit (R & D systems) and Flt3L ELISA
was carried out using the Flt3L human ELISA kit (Abcam). All assays were carried out ing to
the manufacturers’ protocol.
The concentrations of secreted IFNα, MIPα or FLt3L were determined by interpolating from the
standard curves. IFNα, MIP1α and Flt3 L expression could be detected in the cellular supernatant of
NG-615 but not enadenotucirev or untreated control cells (Figure 85).
T cell activation and degranulation mediated by bispecific T-cell activator expressing viruses.
oma cell infection
A549 cells were seeded into 24 well plates at a density of 2.5e5 cells/well. Plates were incubated
for 4 hrs, 37⁰C, 5% CO2, before cells were either ed with 1ppc of NG-612, ,
enadenotucirev or were left uninfected. At 24, 48 or 72hrs post-infection supernatants were
harvested from the cells, clarified by centrifuging for 5 mins, 1200rpm and snap .
T cell Assay
FAP expressing lung fibroblast cell lines MRC-5 were seeded into 48 well plates at a density of 5.7e4
cells/well. Plates were ted for 4 hrs, 37⁰C, 5% CO2, before media was replaced with
150µL/well of thawed supernatant harvested from the A549 plates. Purified CD3 T cells isolated
form human PBMC donors were then also added to the plates to give a ratio of T cells to MRC-5 of 2
to 1. The co-cultures were incubated for 16hrs, 37⁰C, 5% CO2 before cellular supernatants were
collected for ELISA is and T cells harvested for flow cytometry analysis according to the
s detailed in Example 29.
Upregulation of T cell activation markers
Flow cytometry analysis of T cell activation was assessed by expression of the T cell activation
markers CD25, CD69, HLA-DR and CD40L or the T cell degranulation marker, CD107a on live, CD3+,
single cells. These data showed that when co-cultured with FAP+ MRC-5 cells the number of T cells
expressing CD25, CD69, HLA-DR, CD40L or CD107a was significantly increased when NG-615 or 612
supernantants were added to the cells compared to enadenotucirev or untreated control
supernatants (Figure 86).
Secretion of the stimulatory cytokine IFNγ
For detection of IFNγ expression, co-culture atants were d into 5% BSA/PBS assay
buffer (in a range of 1:10 to 1:1000) and ELISA was carried out using the Human IFN gamma
Quantikine kit (RandD Systems) according to the manufacturer’s protocol. The concentration of
secreted IFNγ was determined by interpolating from the standard curve. sion of IFNγ could
only be detected in the supernatants of co-cultures using NG-612 or NG-615 infected A549
supernatants (Figure 87).
Example 36 – EnAd virus co-expressing a bispecific T-cell activator targeting FAP and a
bispecific T-cell activator targeting EpCam
The virus NG-618 was generated that encoded two bispecific T-cell activator molecules, one
targeting EpCam (EpCam bispecific T-cell activator) and one targeting FAP (FAP bispecific T-cell
activator) (Table 10).
Table 10
Virus ID Transgene Cassette
NG-618 (SEQ ID NO: 120) SSA1-EpCAMbispecific T-cell activator2-P2A3-
pecific T-cell activator4-PA5
1SEQ ID NO. 55; 2SEQ ID NO. 121; 3SEQ ID NO. 106; 4SEQ ID NO. 122; 5SEQ ID NO. 65;
Virus Production
The plasmid .4 was used to gerneate the plasmid pNG-618 by direct insertion of a
synthesised transgene cassettes (SEQ ID NO. 123). The NG-618 virus contains two transgenes
encoding an EpCam targeting bispecific T-cell activator (SEQ ID NO. 93) and a FAP targeting
bispecific T-cell activator (SEQ ID NO. 95). A schematic of the transgene cassette is shown in Figure
88. Construction of plasmid DNA was med by restriction analysis and DNA sequencing.
The d pNG-618, was linearised by restriction digest with the enzyme AscI to produce the virus
genomes. The s were amplified and purified according to methods detailed in Example 33
T cell activation and degranulation ed by bispecific T-cell activator expressing viruses.
Carcinoma cell infection
A549 cells were seeded into 6 well plates at a y of 1.2e6 cells/well. Plates were incubated for
4 hrs, 37⁰C, 5% CO2, before cells were either infected with NG-611, NG-612, NG-618, enadenotucirev
or were left uninfected. At 72hrs post-infection supernatants were harvested from the cells and
ied by centrifuging for 5 mins, 1200rpm.
T cell Assay
FAP expressing lung fibroblast cell lines MRC-5 and EpCam expressing A549 cells, were seeded into
24 well plates at a density of 1.5e5 cells/well. MRC-5 and A549 cells were also mixed at a 1 to 1 ratio
and seeded in to 24 plates at a total cell density of 1.5e5 cells/well. Plates were ted for 4 hrs,
37⁰C, 5% CO2, before media was replaced with 300µL/well of thawed supernatant harvested from
the A549 plates. Purified CD3 T cells isolated form human PBMC donors were then also added to the
plates to give a ratio of T cells to MRC-5 or SKOV3 cells of 2 to 1. The co-cultures were ted for
16hrs, 37⁰C, 5% CO2 before cellular supernatants were collected for ELISA analysis and T, MRC-5
and A549 cells harvested for flow try analysis.
Detection of FAP and EpCam on MRC-5 or SKOV cells
Flow cytometry is of detectable FAP or EpCam on the surface of MRC-5 or SKOV cells,
respectively was assessed by washing the cells once in FACs buffer before staining with panels of
directly conjugated antibodies: anti-FAP ated to AF647; anti-EpCam conjugated to PE.
Analysis showed that FAP expression was no longer detectable on the MRC-5 cells that had been
ted with supernatant from cells infected with specific T-cell activator expressing virus,
NG-618 but was detected on >80% of cells incubated with supernatants from cells treated with
EnAd, or the untreated cells (Figure 89A). These data indicate that FAP-bispecific T-cell activator
produced by the NG-618 viruses binds to its FAP target on the MRC-5 cells occluding binding of the
anti-FAP antibody. Live, large, single cells SKOV cells were assessed for detectable expression of
EpCam. EpCam expression was only detectable at low levels on the SKOV cells that had been
incubated with supernatants from cells infected with EpCam-bispecific T-cell activator expressing
virus, NG-618 (17% of cells), but was detected on >40% of cells incubated with supernatants from
cells d with EnAd or the untreated cells (Figure 89B). Collectively these data te that NG-
618 produces ific T-cell tor molecules that bind to EpCam and FAP target proteins.
lation of T cell activation markers
Flow cytometry analysis of T cell activation was assessed by expression of the T cell activation
markers CD25, CD69, HLA-DR and CD40L or the T cell degranulation marker, CD107a on live, CD3+,
single cells. These data showed that when co-cultured with FAP+ MRC-5 cells the number of T cells
sing CD25, CD40L or CD107a was significantly increased when NG-618 supernantants were
added to the cells compared enadenotucirev or ted l supernatants (Figure 90). The
number of T cells expressing CD25, CD40L or CD107a was also significantly increased when NG-618
supernantants were added to the EpCam+ SKOV3 cells compared to enadenotucirev or untreated
control supernatants (Figure 91). These data demonstrate that both bispecific T-cell activator
molecules expressed by the NG-618 virus are functional in terms of inducing T cell activation.
Analysis of T cell mediated target (MRC-5 and SKOV) cell killing
Flow cytometry analysis of MRC-5 and SKOV cell viability was assessed by staining the cells in 50μL
of PBS containing Live/Dead Aqua (Life tech) for 15 minutes at RT. The cells were washed once in
FACs buffer before staining with panels of directly conjugated antibodies: anti-FAP conjugated to
AF647; anti-EpCam conjugated to PE. MRC-5 and SKOV cell viability was significantly reduced
following incubation with NG-618 supernatant samples, whereas no significant cell death was
detectable in the enadenotucirev or untreated control supernatants Figure 92. These data
demonstrate the functional ability of NG-618 coexpressed FAP and EpCam targeting bispecific T-cell
activators to induce T cell mediated cell killing of target cells.
SEQUENCES
SEQ ID NO: 25: FAP bispecific T-cell activator-P2A-RFP (ITALICS = , BOLD = furin
ge site, UNDERLINE = P2A sequence, lower case = RFP)
MGWSCIILFLVATATGVHS DIVMTQSPDSLAVSLGERATINCKSSQSLLYSRNQKNYLAWYQQKPGQPPKLL
IFWASTRESGVPDRFSGSGFGTDFTLTISSLQAEDVAVYYCQQYFSYPLTFGQGTKVEIKGGGGSGGGGSGGG
GSQVQLVQSGAEVKKPGASVKVSCKTSRYTFTEYTIHWVRQAPGQRLEWIGGINPNNGIPNYNQKFKGRV
TITVDTSASTAYMELSSLRSEDTAVYYCARRRIAYGYDEGHAMDYWGQGTLVTVSSGGGGSDVQLVQSGAE
VKKPGASVKVSCKASGYTFTRYTMHWVRQAPGQGLEWIGYINPSRGYTNYADSVKGRFTITTDKSTSTAY
MELSSLRSEDTATYYCARYYDDHYCLDYWGQGTTVTVSSGEGTSTGSGGSGGSGGADDIVLTQSPATLSLSP
GERATLSCRASQSVSYMNWYQQKPGKAPKRWIYDTSKVASGVPARFSGSGSGTDYSLTINSLEAEDAATYY
CQQWSSNPLTFGGGTKVEIKHHHHHHHHHH G ATNFSLLKQAGDVEENPGPmselikenmhmkly
megtvnnhhfkctsegegkpyegtqtmkikvveggplpfafdilatsfmygskafinhtqgipdffkqsfpegftwerittyedggvltat
qdtsfqngciiynvkingvnfpsngpvmqkktrgweantemlypadgglrghsqmalklvgggylhcsfkttyrskkpaknlkmpgf
hfvdhrlerikeadketyveqhemavakycdlpsklghr
SEQ ID NO: 26: Control (Anti-FHA) bispecific T-cell activator-P2A-RFP (ITALICS = leader,
BOLD = furin cleavage site, INE = P2A ce, lower case = RFP)
MGWSCIILFLVATATGVHS ELDIVMTQAPASLAVSLGQRATISCRASKSVSSSGYNYLHWYQQKPGQPPKLLI
YLASNLESGVPARFSGSGSGTDFTLNIHPVEEEDAATYYCQHSREFPLTFGAGTKLEIKSSGGGGSGGGGGGS
SRSSLEVQLQQSGPELVKPGASVKISCKTSGYTFTGYTMHWVRQSHGKSLEWIGGINPKNGGIIYNQKFQGK
ATLTVDKSSSTASMELRSLTSDDSAVYYCARRVYDDYPYYYAMDYWGQGTSVTVSSAKTTPPSVTSGGGGS
DVQLVQSGAEVKKPGASVKVSCKASGYTFTRYTMHWVRQAPGQGLEWIGYINPSRGYTNYADSVKGRFTI
TTDKSTSTAYMELSSLRSEDTATYYCARYYDDHYCLDYWGQGTTVTVSSGEGTSTGSGGSGGSGGADDIVL
LSLSPGERATLSCRASQSVSYMNWYQQKPGKAPKRWIYDTSKVASGVPARFSGSGSGTDYSLTIN
SLEAEDAATYYCQQWSSNPLTFGGGTKVEIKHHHHHHHHHH RRKRGSG LKQAGDVEENPGPm
selikenmhmklymegtvnnhhfkctsegegkpyegtqtmkikvveggplpfafdilatsfmygskafinhtqgipdffkqsfpegftw
erittyedggvltatqdtsfqngciiynvkingvnfpsngpvmqkktrgweantemlypadgglrghsqmalklvgggylhcsfkttyrs
kkpaknlkmpgfhfvdhrlerikeadketyveqhemavakycdlpsklghr
SEQ ID NO: 33: Splice acceptor sequence
CAGG
SEQ ID NO: 55 short splice acceptor (SSA) DNA sequence (null sequence)
SEQ ID NO: 58 Kozak sequence (null sequence)
CCACC
Particular features of the present disclosure are set out in the following numbered paragraphs:
1. An adenovirus comprising a sequence of formula (I) :
’ITR-B1-BA-B2-BX-BB-BY-B3-3’ITR (I)
wherein:
B1 is bond or comprises: E1A, E1B or E1A-E1B;
BA comprises-E2B-L1-L2-L3-E2A-L4;
B2 is a bond or comprises: E3;
BX is a bond or a DNA sequence comprising: a restriction site, one or more enes or
both;
BB comprises L5;
BY is a bond or a DNA sequence comprising: a restriction site, one or more transgenes or
40 both;
B3 is a bond or comprises: E4;
n the adenovirus encodes a Bispecific T cell Activator sing at least two binding
domains wherein at least one of the said domains is specific to a surface antigen on an immune
cells of interest, such as a T cell of interest; and
45 wherein the adenovirus is EnAd or Ad11.
2. An adenovirus according to aph 1, wherein the adenovirus is EnAd.
3. An adenovirus according to paragraphs 1 or 2, wherein the surface antigen is a component of
the T-cell or complex (TCR), such as selected from CD3, TCR-α and TCR-β.
4. An adenovirus according to paragraph 3, wherein the surface antigen is CD3 such as CD3ε,
CD3 γ and CD3δ, in particular CD3ε.
5. An adenovirus according to paragraph 1 or 2, wherein one of the binding domains in the
bispecific T-cell activator is specific to a non-TCR activating protein such as CD31, CD2 and
CD277.
6. An adenovirus according to any one of paragraphs 1 to 5, n one of the binding
domains is specific to a tumour antigen, such as CEA, MUC-1, EpCAM, HER receptors HER1,
HER2, HER3, HER4, PEM, A33, G250, carbohydrate antigens Ley, Lex, Leb, PSMA, TAG-72,
STEAP1, CD166, CD24, CD44, E-cadherin, SPARC, ErbB2 and ErbB3.
7. An adenovirus according to paragraph 6, wherein one of the binding domains is specific to
EpCAM.
8. An adenovirus ing to any one of paragraphs 1 to 7 wherein one of the binding domains
is specific to a tumour stromal antigen, for example fibroblast activation protein (FAP),
TREM1, IGFBP7, FSP-1, platelet-derived growth factor-α receptor (PDGFR-α), platelet-derived
growth factor-β receptor (PDGFR-β) and vimentin.
9. An adenovirus according to paragraph 8, wherein one of the binding domains is specific to
10. A adenovirus ing to paragraph 8 or 9, wherein the stromal antigen is an antigen is
selected from a myeloid derived suppressor cell antigen, a tumor associated macrophage, and
combinations thereof.
11. An adenovirus according to paragraph 10, wherein the antigen is selected from CD163, CD206,
CD68, CD11c, CD11b, CD14, CSF1 Receptor, CD15, CD33, CD66b and a combination of two or
more of the same.
12. An adenovirus according to any one of paragraphs 1 to 11, n at least one of BX or BY is
not a bond.
13. An adenovirus according to any one of paragraphs 1 to 12, wherein the irus is chimeric.
14. An adenovirus according to any one of aphs 1 to 13, wherein the irus is oncolytic.
15. An adenovirus ing to any one of paragraphs 1 to 14, wherein the adenovirus ation
16. An adenovirus according to paragraph 15, wherein the adenovirus is replication competent.
17. An adenovirus according to any one of paragraphs 1 to 14, wherein the adenovirus is
replication ent.
18. An adenovirus according to any one of aphs 1 to 17, wherein BX comprises one or more
transgenes or a ene cassette.
19. An adenovirus according to any one of paragraphs 1 to 18, wherein BY comprises one or more
transgenes or a transgene cassette.
. An adenovirus according to any one of paragraphs 1 to 19, wherein the one or more
40 transgenes or transgene cassettes is/are under the control of an nous or ous
promoter, such as an endogenous promotor.
21. An adenovirus according to paragraph 20, wherein the transgene or transgene cassette is/are
under the control of an endogenous er ed from the group consisting of E4
promoter and major late promoter, in particular the major late promoter.
22. An adenovirus according to paragraph 20 or 21, wherein a transgene or transgene cassette is
under the control of an exogenous promoter, such as CMV.
23. An adenovirus according to any one of paragraphs 1 to 22, wherein the bispecific T-cell
activator has a short half-life, for example 48 hours or less.
24. An adenovirus according to any one of paragraphs 1 to 23, wherein the bispecific T-cell
activator is encoded in a region ed from E1, E3, BX, BY and combinations thereof.
25. An adenovirus according to aph 24, wherein a bispecific T-cell activator is encoded at
least in position BX, for e under the control of an exogenous promoter.
26. An adenovirus according to paragraph 24 or 25, wherein a bispecific T-cell activator is
encoded at least in position BY, for example under the l of the major late promoter.
27. An adenovirus according to any one of paragraphs 1 to 26, wherein the adenovirus further
encodes a second bispecific T-cell activator, for example wherein both bispecific T-cell
activators are encoded in position BY.
28. An adenovirus according to paragraph 27 n the first ific T-cell activator molecule
is specific to a tumour antigen, for example a tumor antigen, and the second bispecific T-cell
activator molecule is specific to a tumour stromal n, for example a stromal antigen on a
fibroblast or tumour associated macrophage or a myeloid d suppressor cells
29. An adenovirus according to any one of the paragraphs 1 to 28, wherein the encoded bispecific
T-cell activator comprises a VH domain comprising an amino acid sequence as set forth in SEQ
ID NOs: 8, or an amino acid ce that is at least 95% identical thereto and a VL comprising
an amino acid sequence as set forth in SEQ ID NO: 9 or a sequence at least 95% indentical
thereto
. An adenovirus according to paragraph 29, wherein the encoded bispecific T-cell activator
comprises and scFv comprising an amino acid sequence as set forth in SEQ ID NO: 7 or a
sequence at least 95% indentical thereto.
31. An adenovirus according to any one of the paragraphs 1 to 30, wherein the encoded ific
T-cell activator ses a VH domain sing an amino acid sequence as set forth in SEQ
ID NOs: 8, or an amino acid sequence that is at least 95% cal thereto and a VL comprising
an amino acid sequence as set forth in SEQ ID NO: 9 or a sequence at least 95% indentical
thereto.
32. An adenovirus according to paragraph 31, wherein the encoded bispecific T-cell activator
comprises and scFv comprising an amino acid sequence as set forth in SEQ ID NO: 7 or a
sequence at least 95% indentical thereto
33. An adenovirus according to any one of the aphs 1 to 32, wherein the encoded bispecific
T-cell activator comprises a VH domain comprising an amino acid sequence as set forth in SEQ
ID NOs: 13, or an amino acid sequence that is at least 95% identical thereto and a VL
40 comprising an amino acid sequence as set forth in SEQ ID NO: 12 or a sequence at least 95%
ical thereto.
34. An adenovirus according to paragraph 33, wherein the encoded bispecific T-cell activator
comprises and scFv comprising an amino acid sequence as set forth in SEQ ID NO: 11, 74, 75
or a sequence at least 95% indentical to any one of the same.
. An adenovirus ing to any one of the paragraphs 1 to 34, wherein the encoded bispecific
T-cell activator comprises a VH domain comprising an amino acid sequence as set forth in SEQ
ID NOs: 18, or an amino acid ce that is at least 95% cal thereto and a VL
comprising an amino acid sequence as set forth in SEQ ID NO: 17 or a sequence at least 95%
indentical thereto.
36. An adenovirus ing to paragraph 35, wherein the encoded bispecific T-cell activator
comprises and scFv comprising an amino acid sequence as set forth in SEQ ID NO: 16, 72, 73
or a sequence at least 95% indentical to any one of the same.
37. An adenovirus according to paragraph 1, 33 or 24 wherein the adenovirus comprises a
sequence shown in SEQ ID NO: 36, 37, 81, 82, 97, 98, 99 or 100
38. An adenovirus ing to paragraph 1, 35 or 36 wherein the adenovirus comprises a
sequence shown in SEQ ID NO: 34, 35, 79, 80 or 96.
39. An adenovirus according to any one of paragraphs 1 to 38, wherein the adenovirus encodes at
least one further transgene, for example 1, 2, 3 or 4 further transgenes.
40. An irus according to paragraph 39, wherein the further transgene(s) encodes a
cytokine, chemokine and/or an immunomodulator, for example encoded in on BY.
41. An adenovirus according to aph 39 or 40, n at least one further transgene
encodes a cytokine, for example selected from MIP1α, IL-1α, IL-1β, IL-6, IL-9, IL-12, IL-13, IL-
17, IL-18, IL-22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-33, IL-35, IL-2, IL-4, IL-5, IL-7, IL-10, IL-15,
IL-21, IL-25, IL-1RA, IFNα, IFNβ, IFNγ, TNFα, lymphotoxin α (LTA), Flt3L, GM-CSF and IL-8.
42. An adenovirus according to any one of paragraphs 39 to 41, wherein at least one further
transgene encodes a chemokine, for example selected from CCL2, CCL3, CCL5, CCL17, CCL20,
CCL22, CXCL9, CXCL10, CXCL11, CXCL13, CXCL12, CCL2, CCL19 and CCL21.
43. An adenovirus according to any one of paragraphs 40 to 42, wherein the adenovirus comprises
a sequence shown in SEQ ID NO: 101, 102, 103 or 298.
44. A composition comprising an adenovirus according to any one of aphs 1 to 43 and a
diluent or carrier.
45. A ition according to paragraph 44, n the formulation ses a second
oncolytic virus, for example Ad11 or a derivative thereof, such as EnAd, in particular wherein
the additional virus is according to the present disclosure.
46. A method of treating a patient comprising administering a therapeutically effective amount of
an adenovirus of any one of paragraphs 1 to 43 or a composition of paragraph according to
paragraph 44 or 45.
47. A method according to paragraph 46, for the treatment of cancer, in particular a solid .
48. An oncolytic adenovirus comprising a sequence of formula (I) :
40 5’ITR-B1-BA-B2-BX-BB-BY-B3-3’ITR (I)
wherein:
B1 is bond or comprises: E1A, E1B or E1A-E1B;
BA comprises-E2B-L1-L2-L3-E2A-L4;
B2 is a bond or comprises: E3;
BX is a bond or a DNA sequence comprising: a restriction site, one or more enes or
both;
BB comprises L5;
BY is a DNA sequence comprising: a restriction site, one or more transgenes or both;
B3 is a bond or comprises: E4;
wherein the adenovirus encodes a Bispecific T cell Activator in on BY comprising at
least two binding domains wherein :
one of the said s is specific to a component of the T-cell receptor x
(TCR); and
one the binding domains of the bispecific T-cell activator is specific to a tumour
stromal n, and
the irus is Enadenotucirev (EnAd) or pe 11 adenovirus (Ad11).
49. An oncolytic adenovirus according to aph 48, wherein the adenovirus is EnAd.
50. An oncolytic adenovirus according to paragraphs 48 or 49, wherein the ent of the TCR
is CD3.
51. An oncolytic adenovirus according to aph 50, wherein the surface antigen is CD3 such
as CD3ε, CD3γ and CD3δ, in particular CD3ε.
52. An oncolytic adenovirus according to any one of paragraphs 48 to 51, wherein, the tumour
stomal antigen is selected from: fibroblast activation protein (FAP), TREM1, IGFBP7, FSP-1,
platelet-derived growth factor-α receptor (PDGFR-α), platelet-derived growth -β
receptor (PDGFR-β) and in.
53. An oncolytic adenovirus according to paragraph 52, wherein the tumour stromal antigen is
FAP.
54. An oncolytic adenovirus according to any one of paragraphs 48 to 53, wherein the adenovirus
is chimeric.
55. An oncolytic adenovirus according to any one of paragraphs 48 to 54, wherein the adenovirus
replication capable.
56. An oncolytic adenovirus according to paragraph 55, wherein the adenovirus is replication
competent.
57. An oncolytic adenovirus according to any one of paragraphs 48 to 54, wherein the adenovirus
is replication deficient.
58. An oncolytic adenovirus according to any one of paragraphs 48 to 57, wherein BX ses
one or more transgenes or a transgene cassette.
59. An oncolytic adenovirus according to any one of paragraphs 48 to 58, wherein the bispecific
T-cell activator is encoded in position BY isunder the control of the major late promoter.
60. An tic adenovirus according to any one of paragraphs 48 to 59, wherein the adenovirus
further encodes a second bispecific T-cell activator.
40 61. An oncolytic adenovirus according to paragraph 60, wherein both bispecific T-cell activators
are encoded in position BY.
62. An oncolytic irus according to paragraph 60, wherein a bispecific T-cell activator is
encoded in position BX,
63. An oncolytic adenovirus according to paragraph 60, n the encoded bispecific T-cell
activator under the control of an exogenous promoter.
64. An oncolytic adenovirus according to any one of paragraphs 60 to 63, wherein the first
bispecific T-cell activator molecule is specific to a tumour antigen, for example a tumor
antigen, and the second bispecific T-cell activator molecule is specific to a tumour stromal
antigen, for example a stromal antigen on a last or tumour associated macrophage or a
myeloid derived suppressor cells.
65. An oncolytic adenovirus according to any one of the paragraphs 48 to 64, wherein the encoded
bispecific T-cell tor comprises a VH domain comprising an amino acid sequence as set
forth in SEQ ID NOs: 8, or an amino acid sequence that is at least 95% identical o and a
VL comprising an amino acid ce as set forth in SEQ ID NO: 9 or a sequence at least 95%
indentical thereto.
66. An oncolytic adenovirus according to paragraph 65, wherein the encoded bispecific T-cell
activator comprises and scFv comprising an amino acid sequence as set forth in SEQ ID NO: 7
or a sequence at least 95% indentical thereto.
67. An tic adenovirus according to any one of paragraphs 48 to 66, wherein the encoded
bispecific T-cell activator comprises a VH domain comprising an amino acid sequence as set
forth in SEQ ID NOs: 13, or an amino acid sequence that is at least 95% identical thereto and a
VL comprising an amino acid sequence as set forth in SEQ ID NO: 12 or a sequence at least 95%
indentical thereto.
68. An oncolytic adenovirus according to paragraph 67, wherein the encoded bispecific T-cell
tor comprises a scFv comprising an amino acid sequence as set forth in SEQ ID NO: 11 or
75 or a sequence at least 95% ical to any one of the same.
69. An oncolytic adenovirus according to any one of paragraphs 60 to 68, wherein the encoded
bispecific T-cell activator comprises a VH domain comprising an amino acid ce as set
forth in SEQ ID NOs: 18, or an amino acid sequence that is at least 95% identical thereto and a
VL comprising an amino acid sequence as set forth in SEQ ID NO: 17 or a sequence at least 95%
ical thereto.
70. An oncolytic adenovirus according to paragraph 69, wherein the encoded bispecific T-cell
activator comprises and scFv comprising an amino acid sequence as set forth in SEQ ID NO: 16
or 73 or a sequence at least 95% indentical to any one of the same.
71. An oncolytic adenovirus according to paragraph 48 or 60, wherein the adenovirus comprises
a sequence shown in SEQ ID NO: 36, 37, 81, 82, 97, 98, 99 or 100
72. An oncolytic adenovirus according to paragraph 60 or 64 wherein the adenovirus comprises a
sequence shown in SEQ ID NO: 34, 35, 79, 80 or 96.
73. An ytic denovirus according to any one of aphs 48 to 72, wherein the adenovirus
s 2, 3 or 4 further enes.
40 74. An oncolytic virus ing to paragraph 73, wherein a different cleavage peptide is encoded
between each of the transgenes.
75. An oncolytic adenovirus according to aph 73 or 74, wherein the further transgene(s)
encodes a cytokine, chemokine and/or an immunomodulator.
76. An oncolytic adenovirus ing to any one of paragraphs 73 to 75, wherein all the further
transgene is in position BY.
77. An oncolytic irus according to any one of paragraphs 73 to 76, wherein at least one
further transgene encodes a cytokine, for example selected from MIP1α, IL-1α, IL-1β, IL-6, IL-
9, IL-12, IL-13, IL-17, IL-18, IL-22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-33, IL-35, IL-2, IL-4, IL-5,
IL-7, IL-10, IL-15, IL-21, IL-25, IL-1RA, IFNα, IFNβ, IFNγ, TNFα, lymphotoxin α (LTA), Flt3L,
GM-CSF and IL-8.
78. An oncolytic adenovirus according to any one of paragraphs 73 to 77, wherein at least one
further transgene encodes a chemokine, for example selected from CCL2, CCL3, CCL5, CCL17,
CCL20, CCL22, CXCL9, CXCL10, CXCL11, CXCL13, CXCL12, CCL2, CCL19 and CCL21.
79. A composition comprising an adenovirus according to any one of aphs 48 to 78 and a
t or carrier.
80. A composition according to paragraph 79, n the formulation comprises a second
oncolytic virus, for e Ad11 or a derivative thereof, such as EnAd.
81. A method of treating a patient comprising administering a therapeutically effective amount of
an oncolytic adenovirus of any one of paragraphs 48 to 79 or a composition of paragraph 80.
82. A method according to paragraph 81, for the ent of cancer, in particular a solid tumour.
Claims (20)
1. An oncolytic adenovirus comprising a ce of formula (I) : 5’ITR-B1-BA-B2-BX-BB-BY-B3-3’ITR (I) 5 wherein: B1 is bond or comprises: E1A, E1B or E1A-E1B; BA comprises-E2B-L1-L2-L3-E2A-L4; B2 is a bond or comprises: E3; BX is a bond or a DNA sequence sing: a restriction site, one or more transgenes or 10 both; BB comprises L5; BY is a DNA sequence comprising: a ction site, one or more transgenes or both; B3 is a bond or comprises: E4; wherein the irus encodes a Bispecific T cell Activator in position BY under the control 15 of the major late promoter said Bispecific T cell Activator comprising at least two binding domains n: one of the said domains is specific to a component of the T-cell receptor complex (TCR); and one of the binding domains is specific to a tumour antigen selected from the group 20 comprising CEA, MUC-1, EpCAM, HER receptors HER1, HER2, HER3, HER4, PEM, A33, G250, carbohydrate antigens Ley, Lex, Leb, PSMA, TAG-72, STEAP1, CD166, CD24, CD44, E-cadherin, SPARC, ErbB2, and ErbB3. the adenovirus is Enadenotucirev (EnAd) or serotype 11 adenovirus (Ad11).
2. An oncolytic adenovirus according to claim 1, wherein the irus is EnAd. 25
3. An oncolytic adenovirus according to claims 1 or 2, wherein the component of the TCR is CD3β.
4. An adenovirus according to claim 3, wherein the surface antigen is CD3ε, CD3γ or CD3δ.
5. An oncolytic adenovirus according to any one of claims 1 to 4, wherein the tumour antigen is selected from the group comprising CEA, MUC-1, EpCAM, HER receptors HER2, HER3, HER4, PEM, A33, G250, carbohydrate antigens Ley, Lex, Leb, PSMA, TAG-72, STEAP1, CD166, CD24, 30 CD44, E-cadherin, SPARC, ErbB2, and ErbB3.
6. An oncolytic adenovirus according to claim 5, wherein the tumour antigen is EpCAM.
7. An adenovirus according to any one of claims 1 or 2, wherein the adenovirus is replication competent.
8. An oncolytic adenovirus according to claims 1 or 2, wherein the adenovirus further encodes a 35 second Bispecific T cell Activator.
9. An oncolytic adenovirus ing to claim 8, wherein both Bispecific T cell Activators are d in position BY.
10. An oncolytic irus ing to claim 1 or 2, wherein the encoded Bispecific T cell tor comprises a VH domain comprising an amino acid ce as set forth in SEQ ID 40 NO: 8, or an amino acid ce that is at least 95% identical thereto and a VL comprising an amino acid sequence as set forth in SEQ ID NO: 9 or a sequence at least 95% indentical thereto.
11. An oncolytic adenovirus according to claim 1 or 2, wherein the encoded Bispecific T cell Activator comprises a VH domain comprising an amino acid sequence as set forth in SEQ ID NO: 18, or an amino acid sequence that is at least 95% identical thereto and a VL comprising an amino acid sequence as set forth in SEQ ID NO: 17 or a sequence at least 95% indentical 5 thereto.
12. An oncolytic adenovirus according to claim 1, wherein the adenovirus comprises a sequence shown in SEQ ID NOs: 34, 35, 79, 80 or 96.
13. An aoncolytic denovirus according to claim 1 or 2, wherein the irus encodes 2, 3 or 4 further transgenes. 10
14. An oncolytic adenovirus according to claim 13, wherein the further transgene(s) encodes one or more of a ne, chemokine and an immunomodulator.
15. An oncolytic adenovirus according to claim 13, wherein all the further transgenes are in position BY.
16. An adenovirus according to claim 14, n the cytokine or ine is selected from 15 MIP1α, IL-1α, IL-1β, IL-6, IL-9, IL-12, IL-13, IL-17, IL-18, IL-22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-33, IL-35, IL-2, IL-4, IL-5, IL-7, IL-10, IL-15, IL-21, IL-25, IL-1RA, IFNα, IFNβ, IFNγ, TNFα, lymphotoxin α (LTA), Flt3L, GM-CSF, IL-8, CCL2, CCL3, CCL5, CCL17, CCL20, CCL22, CXCL9, CXCL10, , CXCL13, CXCL12, CCL2, CCL19 and CCL21.
17. A composition comprising an adenovirus ing to claims 1 or 2 and a diluent or carrier. 20
18. A composition ing to claim 17 for the ent of cancer.
19. An oncolytic adenovirus of claims 1 or 2 for use in treatment.
20. An oncolytic adenovirus according to claim 19, for the treatment of cancer.
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
GB1614607.8 | 2016-08-29 | ||
GB1700663.6 | 2017-01-13 | ||
GB1706219.1 | 2017-04-19 | ||
GB1713765.4 | 2017-08-28 |
Publications (1)
Publication Number | Publication Date |
---|---|
NZ791667A true NZ791667A (en) | 2022-09-30 |
Family
ID=
Similar Documents
Publication | Publication Date | Title |
---|---|---|
EP3503918B1 (en) | Adenovirus armed with bispecific t cell engager (bite) | |
US11938159B2 (en) | Oncolytic adenoviruses armed with heterologous genes | |
US11155622B2 (en) | Virus encoding an anti-TCR-complex antibody or fragment | |
AU2016256582B2 (en) | Oncolytic adenovirus encoding a B7 protein | |
US11840702B2 (en) | Adenovirus armed with bispecific T cell activator | |
WO2018083259A1 (en) | Oncolytic adenovirus encoding transgenes | |
WO2018083258A1 (en) | Oncolytic adenovirus encoding at least three transgenes | |
WO2018083257A1 (en) | Oncolytic adenovirus encoding transgenes | |
NZ791667A (en) | Adenovirus armed with bispecific T-cell activator | |
US11970536B2 (en) | Group B adenovirus encoding an anti-TCR-complex antibody or fragment | |
EA043895B1 (en) | ADENOVIRUS ARMED WITH A BISPECIFIC T-CELL ACTIVator |