NZ789515A - Horizontal transfer of fungal genes into plants (3) - Google Patents
Horizontal transfer of fungal genes into plants (3)Info
- Publication number
- NZ789515A NZ789515A NZ789515A NZ78951518A NZ789515A NZ 789515 A NZ789515 A NZ 789515A NZ 789515 A NZ789515 A NZ 789515A NZ 78951518 A NZ78951518 A NZ 78951518A NZ 789515 A NZ789515 A NZ 789515A
- Authority
- NZ
- New Zealand
- Prior art keywords
- plant
- nucleic acid
- species
- sequence
- fragment
- Prior art date
Links
- 230000002538 fungal Effects 0.000 title claims abstract description 61
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 139
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 89
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 43
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 43
- 230000031068 symbiosis, encompassing mutualism through parasitism Effects 0.000 claims abstract description 8
- 230000002103 transcriptional Effects 0.000 claims abstract description 7
- 241000196324 Embryophyta Species 0.000 claims description 227
- 241000894007 species Species 0.000 claims description 50
- 230000014509 gene expression Effects 0.000 claims description 44
- 230000002068 genetic Effects 0.000 claims description 35
- 239000002773 nucleotide Substances 0.000 claims description 21
- 125000003729 nucleotide group Chemical group 0.000 claims description 21
- 240000005979 Hordeum vulgare Species 0.000 claims description 19
- 235000007340 Hordeum vulgare Nutrition 0.000 claims description 19
- 240000008529 Triticum aestivum Species 0.000 claims description 18
- 150000001413 amino acids Chemical class 0.000 claims description 16
- 241001329985 Triticeae Species 0.000 claims description 15
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 15
- 244000075850 Avena orientalis Species 0.000 claims description 14
- 235000007319 Avena orientalis Nutrition 0.000 claims description 13
- 239000002253 acid Substances 0.000 claims description 13
- 239000003550 marker Substances 0.000 claims description 11
- 230000000692 anti-sense Effects 0.000 claims description 9
- 230000001717 pathogenic Effects 0.000 claims description 9
- 230000000295 complement Effects 0.000 claims description 7
- 241001426059 Aveneae Species 0.000 claims description 5
- 244000052769 pathogens Species 0.000 claims description 5
- 241000221752 Epichloe Species 0.000 claims description 3
- 229940035295 Ting Drugs 0.000 claims 3
- 206010034133 Pathogen resistance Diseases 0.000 abstract description 10
- 230000002708 enhancing Effects 0.000 abstract description 9
- 229920001184 polypeptide Polymers 0.000 abstract description 7
- 240000004296 Lolium perenne Species 0.000 description 61
- 238000003752 polymerase chain reaction Methods 0.000 description 57
- 241000209082 Lolium Species 0.000 description 34
- 229920003013 deoxyribonucleic acid Polymers 0.000 description 33
- 241000234642 Festuca Species 0.000 description 27
- 241001329978 Poeae Species 0.000 description 24
- 210000004027 cells Anatomy 0.000 description 24
- 230000000875 corresponding Effects 0.000 description 23
- 240000004585 Dactylis glomerata Species 0.000 description 22
- 108090000790 Enzymes Proteins 0.000 description 22
- 102000004190 Enzymes Human genes 0.000 description 22
- 238000004458 analytical method Methods 0.000 description 22
- 241000234643 Festuca arundinacea Species 0.000 description 21
- 229920001850 Nucleic acid sequence Polymers 0.000 description 20
- 210000002421 Cell Wall Anatomy 0.000 description 18
- 241001457463 Loliinae Species 0.000 description 18
- 229920002287 Amplicon Polymers 0.000 description 17
- 241000209210 Dactylis Species 0.000 description 17
- 241000233866 Fungi Species 0.000 description 17
- 241001494504 Epichloe festucae Species 0.000 description 16
- 240000007594 Oryza sativa Species 0.000 description 16
- 235000007164 Oryza sativa Nutrition 0.000 description 16
- 238000000034 method Methods 0.000 description 16
- 235000009566 rice Nutrition 0.000 description 14
- 210000001519 tissues Anatomy 0.000 description 14
- 235000021307 wheat Nutrition 0.000 description 14
- 241000218922 Magnoliophyta Species 0.000 description 13
- 238000006467 substitution reaction Methods 0.000 description 13
- 210000004436 Chromosomes, Artificial, Bacterial Anatomy 0.000 description 12
- 241000221760 Claviceps Species 0.000 description 12
- 241000824650 Dactylis marina Species 0.000 description 12
- 241000234645 Festuca pratensis Species 0.000 description 12
- 230000025458 RNA interference Effects 0.000 description 12
- 230000000593 degrading Effects 0.000 description 12
- 239000000203 mixture Substances 0.000 description 12
- 230000001105 regulatory Effects 0.000 description 12
- 240000000218 Cannabis sativa Species 0.000 description 11
- 241001456482 Dactylidinae Species 0.000 description 11
- 229920002459 Intron Polymers 0.000 description 10
- 241000745991 Phalaris Species 0.000 description 10
- 241001136123 Phalaris aquatica Species 0.000 description 10
- 241000209504 Poaceae Species 0.000 description 10
- 150000002500 ions Chemical class 0.000 description 10
- 241001522995 Deschampsia cespitosa Species 0.000 description 9
- 241000410074 Festuca ovina Species 0.000 description 9
- 241000303715 Trichoderma lixii Species 0.000 description 8
- 230000003321 amplification Effects 0.000 description 8
- 239000004459 forage Substances 0.000 description 8
- 238000003199 nucleic acid amplification method Methods 0.000 description 8
- 235000007558 Avena sp Nutrition 0.000 description 7
- 241000238631 Hexapoda Species 0.000 description 7
- 241000190478 Neotyphodium Species 0.000 description 7
- 241000957301 fungal endophyte Species 0.000 description 7
- 210000000349 Chromosomes Anatomy 0.000 description 6
- 229920001405 Coding region Polymers 0.000 description 6
- 108020004705 Codon Proteins 0.000 description 6
- 229920002676 Complementary DNA Polymers 0.000 description 6
- 241000060091 Deschampsia antarctica Species 0.000 description 6
- 241000209510 Liliopsida Species 0.000 description 6
- 240000006022 Lolium multiflorum Species 0.000 description 6
- 240000002667 Lolium temulentum Species 0.000 description 6
- 241000209048 Poa Species 0.000 description 6
- 241000223260 Trichoderma harzianum Species 0.000 description 6
- 238000004166 bioassay Methods 0.000 description 6
- 239000002299 complementary DNA Substances 0.000 description 6
- 238000003753 real-time PCR Methods 0.000 description 6
- 239000002028 Biomass Substances 0.000 description 5
- 229920002024 GDNA Polymers 0.000 description 5
- 238000002944 PCR assay Methods 0.000 description 5
- 240000008042 Zea mays Species 0.000 description 5
- 238000002856 computational phylogenetic analysis Methods 0.000 description 5
- 230000035784 germination Effects 0.000 description 5
- 238000000126 in silico method Methods 0.000 description 5
- 241001535157 Cynodon <characin> Species 0.000 description 4
- 241001265118 Epichloe festucae var. lolii Species 0.000 description 4
- 241000508723 Festuca rubra Species 0.000 description 4
- 240000003433 Miscanthus floridulus Species 0.000 description 4
- 241000209117 Panicum Species 0.000 description 4
- 241001330453 Paspalum Species 0.000 description 4
- 241000209046 Pennisetum Species 0.000 description 4
- 235000007238 Secale cereale Nutrition 0.000 description 4
- 240000002057 Secale cereale Species 0.000 description 4
- 240000006394 Sorghum bicolor Species 0.000 description 4
- 235000011684 Sorghum saccharatum Nutrition 0.000 description 4
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 4
- 235000006442 blackseeded proso millet Nutrition 0.000 description 4
- 235000006443 broomcorn panic Nutrition 0.000 description 4
- 238000001514 detection method Methods 0.000 description 4
- 201000010099 disease Diseases 0.000 description 4
- 230000000694 effects Effects 0.000 description 4
- 235000013312 flour Nutrition 0.000 description 4
- 244000053095 fungal pathogens Species 0.000 description 4
- 239000000463 material Substances 0.000 description 4
- 241001522110 Aegilops tauschii Species 0.000 description 3
- 241000894006 Bacteria Species 0.000 description 3
- 241000206602 Eukaryota Species 0.000 description 3
- 101710023886 GUSB Proteins 0.000 description 3
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 3
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 3
- 108020004999 Messenger RNA Proteins 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- 241000219000 Populus Species 0.000 description 3
- 239000011543 agarose gel Substances 0.000 description 3
- 230000001580 bacterial Effects 0.000 description 3
- 235000013339 cereals Nutrition 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- 201000009910 diseases by infectious agent Diseases 0.000 description 3
- 241001233957 eudicotyledons Species 0.000 description 3
- 238000010195 expression analysis Methods 0.000 description 3
- 239000000499 gel Substances 0.000 description 3
- 230000001965 increased Effects 0.000 description 3
- 235000021374 legumes Nutrition 0.000 description 3
- 229920002106 messenger RNA Polymers 0.000 description 3
- 239000002207 metabolite Substances 0.000 description 3
- 244000005700 microbiome Species 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000006011 modification reaction Methods 0.000 description 3
- 230000002028 premature Effects 0.000 description 3
- 108091007521 restriction endonucleases Proteins 0.000 description 3
- 238000011144 upstream manufacturing Methods 0.000 description 3
- 241000208140 Acer Species 0.000 description 2
- 102000007469 Actins Human genes 0.000 description 2
- 108010085238 Actins Proteins 0.000 description 2
- 241000589158 Agrobacterium Species 0.000 description 2
- 241001083841 Aquatica Species 0.000 description 2
- 241000219195 Arabidopsis thaliana Species 0.000 description 2
- 241000235349 Ascomycota Species 0.000 description 2
- 235000006008 Brassica napus var napus Nutrition 0.000 description 2
- 240000000385 Brassica napus var. napus Species 0.000 description 2
- 235000006618 Brassica rapa subsp oleifera Nutrition 0.000 description 2
- 235000004977 Brassica sinapistrum Nutrition 0.000 description 2
- 240000000464 Cicer arietinum Species 0.000 description 2
- 235000010523 Cicer arietinum Nutrition 0.000 description 2
- 241000221751 Claviceps purpurea Species 0.000 description 2
- 241000218631 Coniferophyta Species 0.000 description 2
- 240000001200 Eucalyptus globulus Species 0.000 description 2
- 235000004694 Eucalyptus leucoxylon Nutrition 0.000 description 2
- 235000010705 Eucalyptus maculata Nutrition 0.000 description 2
- 235000009683 Eucalyptus polybractea Nutrition 0.000 description 2
- 235000009687 Eucalyptus sargentii Nutrition 0.000 description 2
- 240000007842 Glycine max Species 0.000 description 2
- 235000010469 Glycine max Nutrition 0.000 description 2
- 241000282619 Hylobates lar Species 0.000 description 2
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 2
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 2
- MTCFGRXMJLQNBG-REOHCLBHSA-N L-serine Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 2
- 125000000510 L-tryptophano group Chemical group [H]C1=C([H])C([H])=C2N([H])C([H])=C(C([H])([H])[C@@]([H])(C(O[H])=O)N([H])[*])C2=C1[H] 0.000 description 2
- 101700015817 LAT2 Proteins 0.000 description 2
- 240000004658 Medicago sativa Species 0.000 description 2
- 240000001307 Myosotis scorpioides Species 0.000 description 2
- 238000000636 Northern blotting Methods 0.000 description 2
- 235000005205 Pinus Nutrition 0.000 description 2
- 241000218602 Pinus <genus> Species 0.000 description 2
- 241000295637 Poa poiformis Species 0.000 description 2
- 235000016976 Quercus macrolepis Nutrition 0.000 description 2
- 244000305267 Quercus macrolepis Species 0.000 description 2
- 235000007201 Saccharum officinarum Nutrition 0.000 description 2
- 240000000111 Saccharum officinarum Species 0.000 description 2
- 241000216735 Satsuma dwarf virus Species 0.000 description 2
- 235000007230 Sorghum bicolor Nutrition 0.000 description 2
- 229920001949 Transfer RNA Polymers 0.000 description 2
- 241000223259 Trichoderma Species 0.000 description 2
- 108090000848 Ubiquitin Proteins 0.000 description 2
- 102400000757 Ubiquitin Human genes 0.000 description 2
- 241000700605 Viruses Species 0.000 description 2
- 241000607479 Yersinia pestis Species 0.000 description 2
- 235000016383 Zea mays subsp huehuetenangensis Nutrition 0.000 description 2
- 230000036579 abiotic stress Effects 0.000 description 2
- 235000017585 alfalfa Nutrition 0.000 description 2
- 235000017587 alfalfa Nutrition 0.000 description 2
- 229930013930 alkaloids Natural products 0.000 description 2
- 230000033228 biological regulation Effects 0.000 description 2
- 230000004790 biotic stress Effects 0.000 description 2
- 235000008984 brauner Senf Nutrition 0.000 description 2
- 230000001488 breeding Effects 0.000 description 2
- 230000002759 chromosomal Effects 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 235000005822 corn Nutrition 0.000 description 2
- 235000005824 corn Nutrition 0.000 description 2
- 238000007405 data analysis Methods 0.000 description 2
- 230000003247 decreasing Effects 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 230000003828 downregulation Effects 0.000 description 2
- 235000001612 eucalyptus Nutrition 0.000 description 2
- 235000001617 eucalyptus Nutrition 0.000 description 2
- 235000001621 eucalyptus Nutrition 0.000 description 2
- 235000006356 eucalyptus Nutrition 0.000 description 2
- 238000001914 filtration Methods 0.000 description 2
- 238000009396 hybridization Methods 0.000 description 2
- 230000001976 improved Effects 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 235000009973 maize Nutrition 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 229920001239 microRNA Polymers 0.000 description 2
- 239000002679 microRNA Substances 0.000 description 2
- 238000009304 pastoral farming Methods 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 210000001938 protoplasts Anatomy 0.000 description 2
- 239000002096 quantum dot Substances 0.000 description 2
- 235000005227 red mallee Nutrition 0.000 description 2
- 230000001850 reproductive Effects 0.000 description 2
- 238000003757 reverse transcription PCR Methods 0.000 description 2
- 230000035945 sensitivity Effects 0.000 description 2
- 238000002864 sequence alignment Methods 0.000 description 2
- 230000001568 sexual Effects 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 230000035882 stress Effects 0.000 description 2
- 230000001131 transforming Effects 0.000 description 2
- 238000004450 types of analysis Methods 0.000 description 2
- 230000003827 upregulation Effects 0.000 description 2
- 230000003612 virological Effects 0.000 description 2
- 238000001262 western blot Methods 0.000 description 2
- GQWWGRUJOCIUKI-UHFFFAOYSA-N 2-[3-(2-methyl-1-oxopyrrolo[1,2-a]pyrazin-3-yl)propyl]guanidine Chemical compound O=C1N(C)C(CCCN=C(N)N)=CN2C=CC=C21 GQWWGRUJOCIUKI-UHFFFAOYSA-N 0.000 description 1
- 102100017808 ABCB5 Human genes 0.000 description 1
- 101700063348 ABCB5 Proteins 0.000 description 1
- 241000589155 Agrobacterium tumefaciens Species 0.000 description 1
- 241000219194 Arabidopsis Species 0.000 description 1
- 240000002922 Armillaria mellea Species 0.000 description 1
- 229920000195 Bacterial small RNA Polymers 0.000 description 1
- 241001329982 Brachypodieae Species 0.000 description 1
- 241000743774 Brachypodium Species 0.000 description 1
- 241000743776 Brachypodium distachyon Species 0.000 description 1
- 241000195940 Bryophyta Species 0.000 description 1
- 241000701489 Cauliflower mosaic virus Species 0.000 description 1
- LZZYPRNAOMGNLH-UHFFFAOYSA-M Cetrimonium bromide Chemical compound [Br-].CCCCCCCCCCCCCCCC[N+](C)(C)C LZZYPRNAOMGNLH-UHFFFAOYSA-M 0.000 description 1
- 241000195628 Chlorophyta Species 0.000 description 1
- 210000001106 Chromosomes, Artificial, Yeast Anatomy 0.000 description 1
- 241001480006 Clavicipitaceae Species 0.000 description 1
- 210000001072 Colon Anatomy 0.000 description 1
- 238000007400 DNA extraction Methods 0.000 description 1
- 238000000018 DNA microarray Methods 0.000 description 1
- 239000003155 DNA primer Substances 0.000 description 1
- 241000721047 Danaus plexippus Species 0.000 description 1
- 241000744363 Deschampsia Species 0.000 description 1
- 235000019749 Dry matter Nutrition 0.000 description 1
- 108010066133 EC 1.5.1.11 Proteins 0.000 description 1
- 108010067661 EC 2.1.1.68 Proteins 0.000 description 1
- 241000464742 Epichloe gansuensis Species 0.000 description 1
- 229940083253 Ergot alkaloid peripheral vasodilators Drugs 0.000 description 1
- 241000032240 Festuca filiformis Species 0.000 description 1
- OPMNROCQHKJDAQ-FKSUSPILSA-N Festucine Chemical class C1C[C@@H]2O[C@H]3[C@H](NC)[C@@H]2N1C3 OPMNROCQHKJDAQ-FKSUSPILSA-N 0.000 description 1
- 108010023832 Florigen Proteins 0.000 description 1
- 210000002683 Foot Anatomy 0.000 description 1
- 241000223221 Fusarium oxysporum Species 0.000 description 1
- 102100004985 GUSB Human genes 0.000 description 1
- 108010056771 Glucosidases Proteins 0.000 description 1
- 102000004366 Glucosidases Human genes 0.000 description 1
- 108010060309 Glucuronidase Proteins 0.000 description 1
- ZEKANFGSDXODPD-UHFFFAOYSA-N Glyphosate-isopropylammonium Chemical compound CC(C)N.OC(=O)CNCP(O)(O)=O ZEKANFGSDXODPD-UHFFFAOYSA-N 0.000 description 1
- 241000209219 Hordeum Species 0.000 description 1
- 241000221930 Hypomyces chrysospermus Species 0.000 description 1
- 108020004391 Introns Proteins 0.000 description 1
- 244000232488 Jessenia polycarpa Species 0.000 description 1
- 235000002407 Jessenia polycarpa Nutrition 0.000 description 1
- 108010025815 Kanamycin Kinase Proteins 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-N L-arginine Chemical compound OC(=O)[C@@H](N)CCCN=C(N)N ODKSFYDXXFIFQN-BYPYZUCNSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- 125000000174 L-prolyl group Chemical group [H]N1C([H])([H])C([H])([H])C([H])([H])[C@@]1([H])C(*)=O 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- 102100004646 LAT2 Human genes 0.000 description 1
- 238000007476 Maximum Likelihood Methods 0.000 description 1
- HGCNKOLVKRAVHD-RYUDHWBXSA-N Met-Phe Chemical compound CSCC[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 HGCNKOLVKRAVHD-RYUDHWBXSA-N 0.000 description 1
- 108020004388 MicroRNAs Proteins 0.000 description 1
- 229920000460 Mitochondrial DNA Polymers 0.000 description 1
- 108020005196 Mitochondrial DNA Proteins 0.000 description 1
- 240000008962 Nicotiana tabacum Species 0.000 description 1
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 1
- 210000003463 Organelles Anatomy 0.000 description 1
- 244000271379 Penicillium camembertii Species 0.000 description 1
- 235000002245 Penicillium camembertii Nutrition 0.000 description 1
- 241001006946 Periglandula ipomoeae Species 0.000 description 1
- 240000003443 Poa annua Species 0.000 description 1
- 241000384858 Poa infirma Species 0.000 description 1
- 241000855713 Poa supina Species 0.000 description 1
- 241001310793 Podium Species 0.000 description 1
- 241001330029 Pooideae Species 0.000 description 1
- 235000002912 Salvia officinalis Nutrition 0.000 description 1
- 238000002105 Southern blotting Methods 0.000 description 1
- 231100000765 Toxin Toxicity 0.000 description 1
- 241000209140 Triticum Species 0.000 description 1
- 108020004417 Untranslated RNA Proteins 0.000 description 1
- 241001459538 Ute Species 0.000 description 1
- 235000007244 Zea mays Nutrition 0.000 description 1
- 230000002378 acidificating Effects 0.000 description 1
- 108091006072 activator proteins Proteins 0.000 description 1
- 230000003044 adaptive Effects 0.000 description 1
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 1
- 150000003797 alkaloid derivatives Chemical class 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 230000000843 anti-fungal Effects 0.000 description 1
- 229940051869 antimigraine Ergot alkaloids Drugs 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 244000052616 bacterial pathogens Species 0.000 description 1
- 101710022772 bgc Proteins 0.000 description 1
- 230000000975 bioactive Effects 0.000 description 1
- 230000003115 biocidal Effects 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 101710015579 chi01 Proteins 0.000 description 1
- 101710015575 cht-1 Proteins 0.000 description 1
- 244000038559 crop plants Species 0.000 description 1
- 238000009402 cross-breeding Methods 0.000 description 1
- 235000013365 dairy product Nutrition 0.000 description 1
- 230000001419 dependent Effects 0.000 description 1
- 230000001627 detrimental Effects 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 230000002222 downregulating Effects 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 210000002257 embryonic structures Anatomy 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 230000002255 enzymatic Effects 0.000 description 1
- 229960003133 ergot alkaloids Drugs 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 230000002349 favourable Effects 0.000 description 1
- 230000001261 florigenic Effects 0.000 description 1
- 238000006062 fragmentation reaction Methods 0.000 description 1
- 230000005714 functional activity Effects 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 125000000267 glycino group Chemical group [H]N([*])C([H])([H])C(=O)O[H] 0.000 description 1
- 230000001744 histochemical Effects 0.000 description 1
- 108010002685 hygromycin-B kinase Proteins 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000002452 interceptive Effects 0.000 description 1
- 230000004301 light adaptation Effects 0.000 description 1
- 230000001404 mediated Effects 0.000 description 1
- 230000003340 mental Effects 0.000 description 1
- 108010068488 methionylphenylalanine Proteins 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 230000004660 morphological change Effects 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 229920001894 non-coding RNA Polymers 0.000 description 1
- 108010058731 nopaline synthase Proteins 0.000 description 1
- 235000016709 nutrition Nutrition 0.000 description 1
- 230000035764 nutrition Effects 0.000 description 1
- 210000000056 organs Anatomy 0.000 description 1
- 230000003071 parasitic Effects 0.000 description 1
- 108010082527 phosphinothricin N-acetyltransferase Proteins 0.000 description 1
- 230000001402 polyadenylating Effects 0.000 description 1
- 230000003362 replicative Effects 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 238000003559 rna-seq method Methods 0.000 description 1
- 235000002020 sage Nutrition 0.000 description 1
- 239000001296 salvia officinalis l. Substances 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 230000002588 toxic Effects 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 108020003112 toxins Proteins 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- 238000010200 validation analysis Methods 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
Abstract
The present invention relates to methods of creating or enhancing symbiotic relationships between plants and symbionts, in particular symbionts carrying genes encoding fungal transcriptional regulatory-like (FTR) proteins. The present invention also relates to methods for selecting plants for symbiosis with symbionts and methods of modifying pathogen resistance in plants. The present invention also relates to new organisms and symbiota developed by the methods of the invention and to related nucleic acids, polypeptides and constructs including vectors. sis with symbionts and methods of modifying pathogen resistance in plants. The present invention also relates to new organisms and symbiota developed by the methods of the invention and to related nucleic acids, polypeptides and constructs including vectors.
Description
Patent No. # - Complete Specification
No. Date:
HORIZONTAL TRANSFER OF FUNGAL GENES INTO PLANTS (3)
We, Agriculture Victoria Services Pty Ltd, of AgriBio Centre for oscience, 5 Ring
Road, Bundoora VIC 3083, Australia, hereby declare the invention, for which we pray
that a patent may be granted to us, and the method by which it is to be performed, to
be particularly described in and by the following statement
NTAL TRANSFER OF FUNGAL GENES INTO PLANTS (3)
Divisional ation status
Pursuant to Section 34 of the New Zealand Patents Act 2013, this application is intended to
be filed as a divisional of New Zealand application no 760713 filed on 27 July 2018.
Pursuant to Regulation 52 of the New Zealand Patents Regulations 2014, it is requested that
this divisional application is given the earlier filing date of 27 July 2018.
Field of the Invention
The present ion relates to methods of ing and breeding organisms, in particular
organisms which exhibit symbiotic behaviour with symbionts such as fungal endophytes or
epiphytes or bacterial microbiome in plants, methods of creating or enhancing symbiotic
relationships between plants and nts, and new organisms and ta developed
thereby.
The invention also relates to nucleic acids involved in the methods, vectors including the
nucleic acids, plant cells, plants, seeds and other plant parts transformed with the nucleic
acids and vectors, and methods of using the nucleic acids and vectors.
Background of the Invention
Important plants, including forage grasses, legumes, trees, shrubs, and vines are commonly
found in association with endophytes including fungi, bacteria, viruses and microbes. Both
beneficial and detrimental horticultural and agronomic properties result from such
associations, including improved tolerance to water and nt stress and resistance to
insect pests. For example, in grasses, insect resistance may be provided by ic
metabolites produced by the endophyte, in particular loline alkaloids and peramine. Other
metabolites produced by the endophyte, for example lolitrems and ergot alkaloids, may be
toxic to grazing animals and reduce ore feeding. Considerable variation is known to
exist in the metabolite e of endophytes. Endophyte strains that lack either or both of the
animal toxins have been introduced into commercial cultivars.
However, there remains a need for methods of using organisms which exhibit symbiotic
behaviour with endophytes. Difficulties in artificially breeding of these symbiota limit their
usefulness. For e, many of the endophytes known to be beneficial to pasture-based
agriculture exhibit low inoculation frequencies and are less stable in elite germplasm.
Moreover, in traditional ng techniques, for example in forage s such as perennial
ryegrass and tall fescue, grass varieties are bred using classic cross-breeding ques
and grass genotypes are selected for their superior characteristics, after monitoring their
performance over a period of multiple years. The selected grass genotypes that form the
experimental y are then inoculated with a single endophyte and the ing grassendophyte
associations are evaluated for any favourable characteristics such as insect
resistance. The individual experimental synthetic varieties deploying a single endophyte in
them are then evaluated for agronomic performance and resulting animal performance by
grazing animals over a period of years. This evaluation process may reveal that the single
endophyte being deployed in the different mental synthetic varieties may not show
vegetative and/or intergenerational stability in some of these ies or the desired alkaloid
profile conferred by the single yte may vary between different synthetic varieties
failing to confer appropriate levels of insect resistance or g animal toxicoses. It would
be a significant development in the art if this time-consuming process could be accelerated
or otherwise improved.
The Poeae tribe of the Poaceae family is composed of a range of cool-season turf and forage
grass species, including those of sub-tribes Loliinae and Dactylidinae. Perennial ryegrass
(Lolium perenne L.; ibe Loliinae) is one of the most important pasture crop species for
the dairy industry, and it has consequently been a primary target for improvement using
molecular biology and genetic technologies. Asexual fungal endophyte s of the genus
Epichloë (syn. Neotyphodium) are symbionts of species belonging to the Poeae tribe genera
Lolium and Festuca.
The fungal endophyte species rely on the plant host for ion, reproduction, and protection
from abiotic and biotic stress. Benefits to the host plant e enhanced itive
abilities, tolerance to pathogens, and resistance to animal and insect herbivory. Due to its
agronomic ance, the molecular basis of the symbiosis has been investigated, and
deterrence of insect herbivory is largely due to the production of bioactive alkaloids, as well
as makes caterpillars floppy-like (mcf-like) gene products.
Horizontal gene transfer (HGT) has been a source of evolutionary novelty in both yotes
and eukaryotes. In flowering plant species, organelle genomes have served as both donors
and recipients of gene transfer events. In contrast to organellar genes, transfer of r
genes to angiosperms appears to have been rare, and has been confined to date to genes
originating from yotes or other plant species such as green algae, mosses and other
angiosperms. A previous systematic in silico study, from igation of four completely
sequenced angiosperm genomes (those of Arabidopsis thaliana L., rice [Oryza sativa L.],
sorghum [Sorghum bicolor L.], and poplar us trichocarpa Torr. & A.Gray ex. Hook.]),
found no evidence for HGT from fungal species, despite two and three highly reliable events
for moss and lycophyte lineages, respectively [Richards, T. A. et al.]. It was consequently
concluded that gene transfer from fungi into angiosperms must be exceedingly infrequent.
It is accordingly an object of the t invention to me, or at least alleviate, one or
more of the ulties or deficiencies associated with the prior art.
Summary of the Invention
The applicant has found evidence for ancient horizontal er of a number of fungal genes
into angiosperm lineages. In particular the applicant has found evidence for multiple events
of horizontal gene er (HGT) from ancestral species of fungal endophytes (of the
Epichloë genus) into grass species. In perennial ryegrass (Lolium perenne L.), three fungus-
originating genes were identified. One was specific to the Poeae subtribes Loliinae, Festucae
and Dactylidinae. The gene has an enzymatic activity for ation of components
commonly found in cell walls of fungi. The gene may be previously considered to be specific
to fungi. For example, the gene may be a ß-1,6-glucanase gene. The ß-1,6-glucanase genes
may be isolated from fungal species such as oë festucae, for example s such as
Leuchtm., Schardl and M.R. Siegel (the sexual counterpart to the perennial ryegrass
endophyte), Hypocrea lixii Pat., and Trichoderma harzianum Rifai. Another gene was specific
to the Loliinae subtribe, and the other was conserved within the Triticeae and Poeae tribes,
including common wheat cum aestivum L.), barley (Hordeum vulgare L.), and oat (Avena
sativa L.). This is the first report of horizontal transfer of a nuclear gene from a taxonomically
distant eukaryote to modern flowering plants and provides evidence for a novel adaptation
mechanism in angiosperms.
In a first aspect, the present ion provides a substantially purified or isolated nucleic acid
or nucleic acid fragment encoding a fungal cell wall degrading enzyme, preferably a
glucanase, more preferably a β-1, 6-glucanase (BGNL), n the nucleic acid or c
acid fragment is isolated from a plant s.
In a preferred embodiment, the plant is a Loliinae or Dactylidnae species. In a more preferred
embodiment the plant is from a Lolium, Festuca or Dactylis species.
The Lolium or Festuca species may be of any le type, including Italian or annual
ss, perennial ryegrass, tall fescue, meadow fescue and red fescue. Preferably the
ryegrass or fescue species is a Lolium species such as Lolium perenne or Lolium
arundinaceum which is otherwise known as a arundinacea.
The Dactylis species may be of any suitable type. Preferably the is species is a
Dactylis marina or Dactylis glomerata.
In a second aspect, the present invention provides a substantially purified or isolated nucleic
acid or nucleic acid fragment of a domain-of-unknown-function (DUF) gene, wherein the
nucleic acid or nucleic acid fragment is isolated from a plant species.
In a preferred embodiment, the plant is a ae species. In a more preferred embodiment
the plant is from a Lolium or a species.
The Lolium or Festuca species may be of any suitable type, including Italian or annual
ryegrass, perennial ryegrass, tall fescue, meadow fescue and red fescue. Preferably the
ss or fescue species is a Lolium species such as Lolium perenne or Lolium multiflorum
which is otherwise known as Festuca perennis.
In a third aspect, the present invention provides a substantially purified or isolated nucleic
acid or nucleic acid fragment encoding a fungal transcriptional regulatory-like (FTR) protein,
wherein the nucleic acid or nucleic acid fragment is isolated from a plant species.
In a preferred embodiment, the plant is a Triticeae and Poeae species. In a more preferred
ment the plant is from a Triticeae or e species.
The Triticeae or Aveneae species may be of any suitable type, including barley, wheat and
oat. Preferably the ryegrass or fescue species is a Triticum, Hordeum or Avena species such
as Triticum aestivum, Hordeum vulgare and Avena sativa.
Thus, the present invention provides a substantially ed or isolated nucleic acid or nucleic
acid fragment:
encoding a fungal cell wall degrading enzyme;
of a DUF gene; or
encoding a FTR protein,
wherein the nucleic acid or nucleic acid fragment is isolated from a plant species.
In other words, the present invention provides a substantially purified or isolated c acid
or nucleic acid fragment from a plant species, the nucleic acid or nucleic acid fragment being
horizontally transferred from a fungal s, n the c acid or nucleic acid
fragment encodes a fungal cell wall degrading enzyme, is a DUF gene, or s a FTR
protein.
By ‘nucleic acid’ is meant a chain of nucleotides capable of carrying genetic information. The
term generally refers to genes or functionally active fragments or variants thereof and or other
sequences in the genome of the organism that influence its phenotype. The term ‘nucleic
acid’ includes DNA (such as cDNA or genomic DNA) and RNA (such as mRNA or microRNA)
that is single- or double-stranded, optionally containing synthetic, non-natural or altered
nucleotide bases, synthetic nucleic acids and combinations thereof.
The c acid or c acid fragment may be of any suitable type and includes DNA
(such as cDNA or genomic DNA) and RNA (such as mRNA) that is single- or doublestranded
, ally containing synthetic, tural or altered nucleotide bases, and
ations thereof.
By ‘substantially purified’ is meant that the nucleic acid or nucleic acid fragment is free of the
genes, which, in the naturally-occurring genome of the organism from which the nucleic acid
or nucleic acid fragment of the invention is derived, flank the nucleic acid or nucleic acid
fragment. The term therefore includes, for e, a nucleic acid or nucleic acid fragment
which is incorporated into a vector; into an autonomously replicating plasmid or virus; or into
the genomic DNA of a prokaryote or eukaryote; or which exists as a separate molecule (e.g.
a cDNA or a genomic or cDNA fragment produced by PCR or restriction endonuclease
digestion) independent of other sequences. It also includes a nucleic acid or nucleic acid
fragment which is part of a hybrid gene. Preferably, the substantially purified nucleic acid or
nucleic acid fragment is at least approximately 90% pure, more preferably at least
approximately 95% pure, even more preferably at least approximately 98% pure.
The term “isolated” means that the al is removed from its al environment (e.g. the
natural environment if it is naturally occurring). For example, a naturally ing nucleic
acid present in a living plant is not isolated, but the same nucleic acid separated from some
or all of the coexisting materials in the natural system, is isolated. Such nucleic acids could
be part of a vector and/or such nucleic acids could be part of a composition, and still be
isolated in that such a vector or composition is not part of its natural environment.
In preferred ments, the substantially purified or isolated nucleic acid or nucleic acid
fragment encoding a fungal cell wall ing enzyme includes a tide sequence
selected from the group consisting of the sequences shown in Sequence ID Nos: 1 to 4; and
functionally active fragments and variants thereof.
Also in preferred embodiments, the substantially purified or isolated nucleic acid or nucleic
acid fragment of the DUF gene includes a nucleotide sequence selected from the group
consisting of the sequence shown in Sequence ID No: 28 and sequences encoding the
polypeptide shown in Sequence ID No: 29; and functionally active fragments and variants
thereof.
Also in preferred embodiments, the substantially purified or isolated c acid or nucleic
acid fragment encoding a FTR protein includes a nucleotide sequence selected from the
group consisting of the sequence shown in ce ID No: 30 and sequences encoding
the polypeptide shown in Sequence ID No: 31; and functionally active fragments and variants
The substantially purified or ed nucleic acid or c acid of the present invention also
includes sequences complementary or antisense to a sequence encoding a fungal cell wall
degrading enzyme, to a DUF gene or to a sequence encoding a FTR protein, and preferably
ces selected from the group consisting of sequences complementary or antisense to
Sequence ID Nos: 1–4, 28 and 30; or mentary or nse to the sequences
encoding the polypeptides shown in Sequence ID Nos: 29 and 31.
In a preferred embodiment, the present invention provides a substantially purified or isolated
nucleic acid or nucleic acid fragment
ng a FTR protein or a complementary or antisense ce to a nucleic acid or
nucleic acid fragment encoding a FTR protein, said nucleic acid or nucleic acid fragment
including a nucleotide sequence selected from the group consisting of:
(a) the sequence shown in Sequence ID No: 30;
(b) complement of the sequence d in (a);
(c) sequences antisense to the sequence recited in (a); and
(d) functionally active fragments and variants of the sequences recited in (a), (b)
and (c).
By “functionally active” is meant that the fragment or variant (such as an analogue, derivative
or mutant) is capable of modifying pathogen resistance in a plant, or ng or enhancing a
symbiotic relationship between a plant and a symbiont. Such variants include naturally
occurring allelic ts and non-naturally occurring variants. Additions, deletions,
substitutions and derivatizations of one or more of the nucleotides are contemplated so long
as the modifications do not result in loss of onal activity of the fragment or t.
Preferably the functionally active fragment or t has at least approximately 80% identity
to the relevant part of the above-mentioned sequence to which the fragment or variant
corresponds, more preferably at least imately 90% identity, even more preferably at
least approximately 95% identity, most preferably at least approximately 98% identity. Such
functionally active variants and fragments include, for example, those having conservative
nucleic acid changes. By ‘conservative nucleic acid changes’ is meant nucleic acid
substitutions that result in conservation of the amino acid in the encoded protein, due to the
degeneracy of the genetic code. Such functionally active variants and fragments also
include, for example, those having nucleic acid changes which result in vative amino
acid tutions of one or more es in the corresponding amino acid sequence. By
‘conservative amino acid substitutions’ is meant the substitution of an amino acid by another
one of the same class, the classes being as follows:
Nonpolar: Ala, Val, Leu, Ile, Pro, Met Phe, Trp
ged polar: Gly, Ser, Thr, Cys, Tyr, Asn, Gln
Acidic: Asp, Glu
Basic: Lys, Arg, His
Other conservative amino acid substitutions may also be made as follows:
Aromatic: Phe, Tyr, His
Proton Donor: Asn, Gln, Lys, Arg, His, Trp
Proton Acceptor: Glu, Asp, Thr, Ser, Tyr, Asn, Gln
Preferably the fragment has a size of at least 20 nucleotides, more preferably at least 50
nucleotides, more preferably at least 100 nucleotides, more preferably at least 200
nucleotides, more preferably at least 500 nucleotides.
In a fourth aspect of the present invention there is ed a c construct or a vector
including a nucleic acid or nucleic acid fragment according to the present ion.
In other words, the present invention provides a genetic construct or a vector ing a
c acid or nucleic acid fragment according to the present invention, or sequences
complementary or antisense thereto. Preferably the nucleic acid or nucleic acid fragment
has a sequence selected from the group consisting of Sequence ID Nos: 1–4, 28, 30, and
nucleic acids encoding the polypeptides shown in Sequence ID Nos: 29 and 31.
In a preferred embodiment of this aspect of the invention, the vector may include a regulatory
element such as a er, a nucleic acid or nucleic acid fragment according to the present
invention and a terminator; said regulatory element, nucleic acid or nucleic acid fragment and
terminator being operatively linked.
By ‘genetic construct’ is meant a inant nucleic acid molecule.
By a ‘vector’ is meant a genetic construct used to er genetic material to a target cell.
By ‘operatively linked’ is meant that the nucleic acid(s) and a regulatory sequence, such as
a promoter, are linked in such a way as to permit expression of said nucleic acid under
appropriate ions, for example when appropriate molecules such as riptional
activator proteins are bound to the regulatory sequence. Preferably an operatively linked
promoter is upstream of the associated nucleic acid.
The vector may be of any suitable type and may be viral or non-viral. The vector may be an
expression vector. Such vectors include chromosomal, non-chromosomal and synthetic
nucleic acid sequences, e.g. derivatives of plant s; ial plasmids; derivatives of
the Ti d from Agrobacterium tumefaciens; derivatives of the Ri plasmid from
Agrobacterium enes; phage DNA; yeast artificial chromosomes; bacterial artificial
chromosomes; binary bacterial artificial chromosomes; vectors derived from combinations of
plasmids and phage DNA. However, any other vector may be used as long as it is replicable
or integrative or viable in the plant cell.
The regulatory element and ator may be of any le type and may be endogenous
to the target plant cell or may be exogenous, provided that they are functional in the target
plant cell.
ably the regulatory element is a promoter. A variety of promoters which may be
employed in the vectors of the present invention are well known to those skilled in the art.
Factors influencing the choice of er include the desired tissue specificity of the vector,
and whether tutive or inducible expression is desired and the nature of the plant cell to
be transformed (e.g. monocotyledon or dicotyledon). Particularly suitable promoters include
the Cauliflower Mosaic Virus 35S (CaMV 35S) promoter, the maize Ubiquitin promoter, the
rice Actin promoter, and ryegrass endogenous OMT, 4CL, CCR or CAD promoters.
A y of terminators which may be employed in the vectors of the present invention are
also well known to those skilled in the art. The terminator may be from the same gene as the
promoter sequence or a different gene. Particularly suitable terminators are polyadenylation
signals, such as the CaMV 35S polyA and other terminators from the nopaline synthase (nos)
and the octopine synthase (ocs) genes.
The vector, in addition to the regulatory element, the nucleic acid or nucleic acid fragment of
the t invention and the terminator, may include further elements necessary for
sion of the nucleic acid or nucleic acid fragment, in different combinations, for example
vector backbone, origin of ation (ori), multiple cloning sites, spacer sequences,
enhancers, introns (such as the maize Ubiquitin Ubi ), antibiotic resistance genes and
other able marker genes [such as the neomycin phosphotransferase (npt2) gene, the
hygromycin phosphotransferase (hph) gene, the phosphinothricin acetyltransferase (bar or
pat) gene], and reporter genes (such as beta-glucuronidase (GUS) gene (gusA)]. The vector
may also contain a ribosome binding site for translation initiation. The vector may also include
appropriate sequences for amplifying expression.
As an alternative to use of a selectable marker gene to e a phenotypic trait for selection
of ormed host cells, the presence of the vector in transformed cells may be determined
by other techniques well known in the art, such as PCR (polymerase chain reaction),
Southern blot hybridisation is, histochemical GUS assays, northern and Western blot
hybridisation analyses.
Those d in the art will appreciate that the various components of the vector are
operatively linked, so as to result in expression of said nucleic acid or nucleic acid fragment.
Techniques for operatively linking the ents of the vector of the present ion are
well known to those skilled in the art. Such techniques include the use of linkers, such as
synthetic linkers, for example including one or more restriction enzyme sites.
The nucleic acids and s of the present invention may be used to up-regulate or gulate
expression of ponding genes in plants.
By ‘up-regulating’ expression of said gene is meant increasing expression of said gene and,
as a result, the protein encoded by the gene, in a plant relative to a l plant.
By ‘down-regulating’ expression of said gene is meant decreasing expression of said gene
and, as a result, the protein d by the gene, in a plant relative to a control plant.
The up-regulation or down-regulation may be carried out by methods known to those skilled
in the art. For example, a gene may be up-regulated by incorporating additional copies of a
sense copy of the gene. A gene may be down-regulated, for example, by incorporating an
antisense nucleic acid, a frame-shifted or otherwise modified sense copy of the gene, or a
nucleic acid encoding interfering RNA (RNAi).
The up- or down-regulation may be carried out by introducing into said plant an effective
amount of a genetic construct including the gene or a modified form thereof, such as an
antisense nucleic acid, a frame shifted copy of the gene or a nucleic acid encoding RNAi.
The vectors of the present invention may be incorporated into a variety of , including
tyledons (such as grasses from the genera Lolium, Festuca, Dactylis, Cynodon,
Bracharia, Paspalum, Panicum, Miscanthus, Pennisetum, Phalaris, and other , turf and
bioenergy grasses, corn, oat, sugarcane, rice, wheat and barley), dicotyledons (such as
opsis, tobacco, legumes, Alfalfa, oak, Eucalyptus, maple, Populus, canola, soybean
and chickpea) and gymnosperms (such as Pinus). In a preferred embodiment, the s
are used to transform monocotyledons, preferably grass species such as Lolium, Festuca,
Dactylis, Cynodon, Bracharia, Paspalum, Panicum, Miscanthus, Pennisetum, Phalaris, and
other forage, turf and bioenergy grasses, more preferably a Lolium species such as Lolium
perenne or Lolium arundinaceum, including cultivars for forage and turf applications, or a
Dactylis species.
Techniques for incorporating the vectors of the present invention into plant cells (for example
by transduction, transfection or transformation) are well known to those skilled in the art.
Such techniques include Agrobacterium mediated introduction, electroporation to tissues,
cells and protoplasts, protoplast fusion, injection into reproductive organs, injection into
immature s and high velocity projectile uction to cells, tissues, calli, re
and mature embryos. The choice of technique will depend largely on the type of plant to be
transformed.
Cells incorporating the vector of the present invention may be selected, as described above,
and then cultured in an appropriate medium to regenerate transformed plants, using
techniques well known in the art. The culture conditions, such as ature, pH and the
like, will be apparent to the person skilled in the art. The resulting plants may be uced,
either sexually or asexually, using methods well known in the art, to produce successive
generations of transformed plants.
In a fifth aspect of the present invention there is provided a transformed plant cell, plant, plant
seed or other plant part, or plant biomass, including digestible biomass such as hay,
ing, e.g. transformed with, a nucleic acid, genetic uct or vector of the present
invention. Preferably the enic plant cell, plant, plant seed or other plant part is
produced by a method according to the t invention.
The present invention also provides a transgenic plant, plant seed or other plant part, or plant
biomass, derived from a plant cell of the present invention and including a nucleic acid,
genetic construct or vector of the present ion.
The present ion also provides a enic plant, plant seed or other plant, part or plant
biomass, derived from a plant of the present invention and including a nucleic acid, c
construct or vector of the present invention.
The nucleic acid, genetic construct or vector of the present invention may be stably integrated
into the genome of the plant, plant seed, other plant part or plant biomass.
The plant cell, plant, plant seed or other plant part may be from any suitable species, including
monocotyledons (such as grasses from the genera Lolium, Festuca, is, Cynodon,
Bracharia, Paspalum, Panicum, Miscanthus, Pennisetum, Phalaris, and other forage, turf and
bioenergy grasses, corn, oat, sugarcane, rice, wheat and ), dicotyledons (such as
Arabidopsis, o, legumes, Alfalfa, oak, Eucalyptus, maple, Populus, canola, soybean
and chickpea) and gymnosperms (such as Pinus). In a preferred embodiment the plant cell,
plant, plant seed or other plant part may be from a monocotyledon, preferably a grass
species, such as Lolium, Festuca, Dactylis, Cynodon, Bracharia, Paspalum, Panicum,
Miscanthus, Pennisetum, Phalaris, and other forage, turf and rgy grasses, more
preferably a Lolium species such as Lolium perenne or Lolium arundinaceum or a Dactylis
species.
In a sixth aspect of the present invention there is provided a method of ing pathogen
resistance in a plant, said method including introducing into said plant an effective amount of
a nucleic acid or nucleic acid fragment, genetic construct and/or a vector according to the
present invention.
By “modifying pathogen resistance” is meant modifying a plant’s ability to protect itself from,
or reduce the extent of, pathogen growth on or in the plant. Such pathogen resistance may
subsequently protect the plant from, or reduce the extent of, fungal es generated by
such fungal pathogens. Fungal es may include leaf spot, stalk rot, root rot, dying-off,
choke disease and seedling wilt. ing pathogen resistance includes creating resistance
to a pathogen in a plant, or sing or decreasing ng levels of resistance in a plant.
In a seventh aspect of the present invention there is provided use of a nucleic acid or nucleic
acid fragment according to the present invention, and/or nucleotide sequence information
thereof, and/or single nucleotide polymorphisms thereof, as a molecular c marker.
More particularly, nucleic acids or nucleic acid fragments according to the present invention,
and/or nucleotide sequence information thereof, and/or single nucleotide polymorphisms
thereof, may be used as a lar genetic marker for qualitative trait loci (QTL) tagging,
mapping, DNA printing and in marker assisted selection, and may be used as candidate
genes or perfect markers, particularly in ryegrasses and s. Even more particularly,
nucleic acids or nucleic acid fragments according to the present invention, and/or nucleotide
sequence information thereof, may be used as molecular genetic markers in forage and turf
grass improvement, e.g. tagging QTLs for dry matter ibility, herbage quality,
ical stress tolerance, disease resistance, insect pest resistance, plant stature and
leaf and stem colour.
In an eighth aspect of the present invention there is provided a method of creating or
enhancing a symbiotic relationship between a plant and a symbiont carrying:
a fungal cell wall degrading enzyme
a DUF gene; or
a FTR protein,
said method ing introducing into said plant an effective amount of a nucleic acid or
nucleic acid fragment encoding the fungal cell wall ing enzyme, of the DUF gene or
encoding the FTR protein, or a functionally active fragment or t thereof, wherein the
c acid or c acid fragment is isolated from a plant species.
In a preferred embodiment, the present invention provides a method of creating or enhancing
a symbiotic relationship between a plant and a symbiont carrying a fungal transcriptional
regulatory-like (FTR) protein, said method including introducing into said plant an effective
amount of a nucleic acid or c acid fragment encoding the FTR protein, wherein the
nucleic acid or nucleic acid fragment is isolated from a plant species.
In a ninth aspect of the present invention there is provided a method of creating or enhancing
a symbiotic relationship between a plant and a symbiont carrying:
a fungal cell wall degrading enzyme;
a DUF gene; or
a FTR protein,
said method including introducing into said plant an effective amount of a nucleic acid or
nucleic acid fragment, genetic construct and/or a vector according to the present invention
and introducing said symbiont into said plant.
The present invention also es a plant endophyte symbiota produced by a method of
the present invention.
ably, the fungal cell wall ing enzyme is a glucanase, more preferably a BGNL
as hereinbefore described.
By “symbiont” is meant one or more organisms that live within the body or cells of another
organism, such as fungal endophytes or epiphytes or a bacterial microbiome in plants.
By “creating or enhancing a symbiotic relationship” is meant enabling a plant which otherwise
would not form a symbiotic onship with a selected symbiont to form said symbiotic
relationship or increasing the stability of the symbiotic relationship. For example, the nucleic
acid or nucleic acid nt, genetic construct and/or a vector according to the t
invention may be introduced into plants such as rice, wheat and barley, which do not naturally
n an ortholog of the gene of the present invention, to ate establishment of symbiotic
relationships between these plants and symbionts.
By “an effective amount” is meant an amount sufficient to result in an identifiable phenotypic
change in said plant cells or a plant, plant seed or other plant part derived therefrom. Such
amounts can be readily determined by an appropriately skilled person, taking into account
the type of plant cell, the route of administration and other relevant factors. Such a person
will readily be able to determine a suitable amount and method of administration. See, for
example, Maniatis et al, lar Cloning: A Laboratory Manual, Cold Spring Harbor
Laboratory, Cold Spring Harbor, the entire disclosure of which is incorporated herein by
reference.
In a tenth aspect, the present invention es a method for selecting a plant for symbiosis
with a symbiont carrying a fungal cell wall degrading gene, a DUF gene or a FTR gene, said
method comprising
a) ining the presence of a fungal cell wall degrading gene, a DUF gene or a
FTR gene in said plant,
b) measuring the level of expression of the gene identified in a), and
c) using the expression level measured in b) to determine if the plant will form a
tic relationship with said symbiont.
Preferably, the fungal cell wall degrading enzyme is a glucanase, more preferably a BGNL
as hereinbefore described.
In a preferred embodiment, the present invention provides a method for selecting a plant for
symbiosis with a symbiont carrying a FTR gene,
said method comprising
a) ining the presence of a FTR gene in said plant,
b) measuring the level of expression of the gene identified in a), and
c) using the expression level measured in b) to determine if the plant will form a
symbiotic relationship with said symbiont.
Techniques for detecting the ce of a ic gene in a plant are well known to those
skilled in the art. Such techniques may involve one or more of rase chain reaction
(PCR), sequencing of PCR products, sequencing of c and/or mitochondrial DNA, and
performing sequence analysis and comparisons to assess genetic variation.
Techniques for measuring the level of gene expression in plant s are well known to
those skilled in the art. Such techniques may involve one or more of reverse transcription
polymerase chain reaction (RT-PCR), quantitative polymerase chain reaction (qPCR),
northern blotting, DNA microarray, Western blotting, 2D-Gel Electrophoresis, and
Immunoassays.
In an eleventh aspect of the present invention there is provided a substantially purified or
ed fungal cell wall degrading enzyme, DUF or FTR protein, wherein said fungal cell wall
ing enzyme, DUF or FTR protein is isolated from a plant species.
In a preferred embodiment the fungal cell wall degrading enzyme is a glucanase, more
preferably a BGNL, and the plant is a Loliinae or Dactylidnae species. In a more preferred
ment the plant is from the , Festuca or Dactylis species.
The Lolium or Festuca species may be of any le type, including Italian or annual
ryegrass, perennial ryegrass, tall fescue, meadow fescue and red fescue. Preferably the
ryegrass or fescue species is a Lolium species such as Lolium perenne or Lolium
arundinaceum which is otherwise known as a arundinacea.
The Dactylis species may be of any suitable type. Preferably the Dactylis species is a
Dactylis marina or Dactylis glomerata.
In a preferred embodiment, the plant from which the DUF protein is isolated is a Loliinae
species. In a more preferred embodiment the plant is from a Lolium or a s.
The Lolium or Festuca species may be of any suitable type, including Italian or annual
ryegrass, perennial ryegrass, tall fescue, meadow fescue and red fescue. Preferably the
ryegrass or fescue species is a Lolium s such as Lolium perenne or Lolium multiflorum
which is ise known as Festuca perennis.
In a preferred embodiment, the present ion provides a substantially purified or isolated
FTR protein, wherein said FTR protein is isolated from a plant species.
In a preferred embodiment, the plant from which the FTR protein is isolated is a Triticeae, or
Aveneae species, preferably Triticum aestivum, Hordeum vulgare or Avena sativa.
In a preferred embodiment, the substantially purified or isolated fungal cell wall ing
enzyme includes an amino acid ce shown in Sequence ID No: 7; or a functionally
active fragment or variant thereof.
In a preferred embodiment, the substantially ed or isolated DUF protein includes an
amino acid sequence shown in Sequence ID No: 29; or a functionally active fragment or
variant thereof.
In a preferred embodiment, the substantially purified or isolated FTR protein includes an
amino acid sequence shown in Sequence ID No: 31; or a functionally active nt or
variant thereof.
\Thus in a preferred ment, the present invention provides a substantially purified or
isolated FTR n, said protein including an amino acid sequence selected from the group
consisting of:
(a) the sequence shown in ce ID No: 31; and
(b) functionally active fragments and variants of the sequences recited in (a).
By "functionally active" in this context is meant that the fragment or t is capable of
modifying pathogen resistance in a plant, or creating or enhancing a symbiotic relationship
between a plant and a symbiont. Preferably, the fragment or variant has one or more of the
biological ties of the fungal cell wall degrading enzyme, DUF or FTR protein. Additions,
ons, substitutions and derivatizations of one or more of the amino acids are
contemplated so long as the modifications do not result in loss of functional activity of the
nt or variant. Preferably the fragment or variant has at least approximately 60%
identity to the relevant part of the above-mentioned sequence, more preferably at least
approximately 80% identity, most preferably at least approximately 90% identity. Such
functionally active variants and fragments include, for example, those having vative
amino acid substitutions of one or more residues in the corresponding amino acid sequence.
Preferably the nt has a size of at least 10 amino acids, more preferably at least 15
amino acids, most preferably at least 20 amino acids.
In a further embodiment of this aspect of the invention, there is ed a ptide
recombinantly produced from a nucleic acid or nucleic acid nt according to the present
invention. Techniques for recombinantly producing polypeptides are well known to those
skilled in the art.
The t invention will now be more fully described with reference to the accompanying
Examples and drawings. It should be tood, however, that the description ing is
illustrative only and should not be taken in any way as a restriction on the generality of the
invention described above.
Brief Description of the Drawings/Figures
Figure 1: Amino acid sequence alignment of LpBGNL (ß-1,6-glucanase gene; Sequence ID
No 7) and fungus ß-1,6-glucanase gene products [Neotyphodium sp. (Sequence ID No 5),
Epichloë festucae (Sequence ID No 6), derma harzianum (Sequence ID No 8),
Hypocrea lixii (Sequence ID No 9)]. The aryl-phospho-beta-D-glucosidase domain is shown
in boxes (Sequence ID Nos 10-14). Dash (-) in the amino acid sequences shows a gap.
Following the CLUSTAL W , asterisk (*), colon (:) and dot (.) under the alignment
denote ‘conserved amino acid residues’, ‘including conserved substitution(s)’ and ‘including
semi-conserved substitution(s)’. NCBI UI is shown at the end of each sequence.
Figure 2: Genome ure of the LpBGNL and E. festucae ß-1,6-glucanase genes and
genetic linkage analysis for LpBGNL. (a) Alignment of genome sequences from ial
ryegrass and Epichloë species. The filled and striped boxes in the upper part of Fig 2 (a)
show the location of LpBGNL and the plant genome-related sequence, respectively. The
black-filled box represents the BAC vector. The filled and empty boxes in the lower part of
Fig 2 (a) show the location of the ß-1,6-glucanase gene and flanking gene, respectively. The
transcription direction of the genes is indicated with the arrow. Corresponding gene
sequences are connected with black dashed lines. (b) Alignment of coding regions of the
LpBGNL and Epichloë ß-1,6-glucanase genes. The solid lines represent non-gene coding
region of perennial ryegrass (upper part of Fig 2 (b)) and Epichloë (lower part of Fig 2 (b))
species. The location of the intron and aryl-phospho-beta-D-glucosidase domain (breaking
line) are shown. (c) Genetic linkage map of perennial ryegrass LG5 with the LpBGNL-related
locus. The LpBGNL-related marker locus is indicated with the arrow. Genetic distance (cM)
is shown on the right side of the genetic markers.
Figure 3: The expression levels of LpBGNL and the E. festucae var. lolii ß-1,6-glucanase
gene. (a) The expression level of LpBGNL in each tissue of perennial ryegrass. The y-axis
shows normalised read count number (CPM). (b and c) The expression levels of the genes
in E- and E+ perennial ryegrass genotypes. The x-axis shows time since the germination
treatment, and y-axis shows CPM for LpBGNL (b) and the E. festucae var. lolii ß-1,6-
ase gene (c).
Figure 4. Phylogenetic tree of LpBGNL orthologues and fungal ß-1,6-glucanase genes. The
phylogram was generated based on amino acid sequence of the aryl-phospho-beta-D-
glucosidase domain. S equences from angiosperm s are indicated in a dashed box;
the der are fungal species. Asterisk (*) denotes species from which gene ts
have been med to have the ß-1,6-glucanase activity. For cocksfoot, three s
(haplotypes 1-3) were generated, and amino acid sequences from those contigs were used.
For Dactylis marina, the contig without a putative premature stop codon was used. Strain
and ce contig (scaffold) identifiers of the Genome Project at the University of Kentucky
e are shown in brackets. For the other fungal sequences, NCBI UI is shown in
brackets. The clade including the sequences from Trichoderma and Hypocreaas species
were selected as an outer group to obtain a root of the enic tree.
Figure 5. PCR screening for the LpBGNL sequence, and taxonomic classification of plant
species described in the current study (a) PCR amplicons from perennial ryegrass genotype
Impact04, cooksfoot, Dactylis marina, coast tussock-grass and harding grass, and a strain of
E. festucae are visualised on the 2200 TapeStation instrument nt Technologies, CA,
USA). The target fragments are indicated with the large arrows. Two genotypes of coast
tussock-grass were subjected to the screening. The uppermost and lowermost bands show
the position of upper and lower markers, respectively, of the D1000 Kit nt). NTC
denotes no-template control for the PCR assay. The small arrows indicate the positions of
400 and 500-bp fragments of the ladder. (b) Species classified into angiosperms, the tribe
Poeae, and sub-tribes Loliinae and Dactylidinae are indicated by the boxes on the right side
of the phylogenetic tree. The species which were positive and negative in the PCR screening
step are indicated by the plus (+) and minus (-) signs, tively. The divergent points of
plant species from other species (>1,000 MYA) and the clade monocotyledon from other plant
species (ca. 150 MYA) are indicated with dashed arrows. The divergent points of sub-tribes
Loliinae and Dactylidinae from the remaining Poeae s, especially from genus Poa,
which is a closely related taxon (ca. 13 MYA), and fine-leaved fescue (Sheep fescue) from
broad-leaved fescues (tall fescue and meadow fescue) (ca. 9 MYA) are indicated with black
arrows. The triangle ents the ve period of HGT in the evolutionary lineage.
Figure 6. DNA sequence alignment of the two ypes from the C3 pe (Sequence
ID Nos 15 and 16). Dash (-) in the DNA sequence shows a gap, and asterisk (*) under the
alignment denotes ‘conserved nucleotide’. DNA sequence corresponding to the PCR primers
for the indel-based genotyping assay is underlined.
Figure 7. Result of the indel-based genotyping assay. The PCR amplicons were visualised
on an e gel including the SYBR™ Safe DNA Gel stain (Thermo Fisher Scientific,
Waltham, Massachusetts, USA). EasyLadder I (BIOLINE) was used as a size rd, and
the 250 and 500 bp fragments are ted with arrows. The genotype UI of the genetic
mapping population is indicated in each lane. C3 and NTC stand for ‘the C3 genotype’ and
mplate control’.
Figure 8. PCR screening for the LpBGNL sequence using the LpBGNL locus-specific primers
(LpBGNL_short). (a) PCR amplicons from perennial ryegrass genotypes Impact04 and C3,
and perennial ss-associated endophyte were visualised on the 2200 TapeStation
instrument using the High Sensitivity D1000 Kit (Aglient). The uppermost and lowermost
bands show the position of upper and lower markers, respectively, of the High Sensitivity
D1000 Kit. (b) PCR amplicons from Lolium and Festuca species (sub-tribe Loliinae) were
visualised on an agarose gel containing the SYBR™ Safe stain. Tall fescue genotypes from
two cultivars (Demeter and Quantum) were subjected to the screening. NTC denotes ‘notemplate
control’ for the PCR assay. (c) PCR amplicons from cocksfoot, Dactylis marina,
coast tussock-grass and harding grass were visualised on the 2200 TapeStation instrument
using the D1000 Kit. The uppermost and lowermost bands show the position of upper and
lower markers, respectively, of the D1000 Kit. Two pes of coast tussock-grass were
subjected, and the Impact04 genotype was used as a positive control.
Figure 9. DNA sequences of the conserved ca. 750-bp region from plant species (Sequence
ID Nos 17-27). Putative ure stop codons were found in is marina haplotypes 2
and 3.
Figure 10. PCR assay for confirmation of a cross-species amplification ty. PCR
amplicons from cooksfoot, Dactylis , coast tussock-grass and harding grass were
visualised on the 2200 TapeStation ment using the D1000 Kit. The uppermost and
lowermost bands show the position of upper and lower markers, respectively, of the D1000
Kit. The position of the target amplicons is indicated with a solid arrow. Size markers are
indicated with ed arrows. The 04 genotype was used as a positive control, and
NTC denotes ‘no-template control’ for the PCR assay.
Figure 11. Genomic sequence of LpBGNL gene (Sequence ID No 1). The coding sequence
is underlined (Sequence ID No 2), and the region in bold is a single intron (Sequence ID No
Figure 12. LpBGNL cDNA sequence (Sequence ID No 4).
Figure 13. Taxonomic relationships of plant and fungal species and phylogenetic tree of
Epichloë-Triticeae/Poeae HGT candidates and ponding fungal genes. (a) Taxonomic
relationships of plant and fungal species and the presence/absence status of the LpFTRL
and 632-like ces. The ent point of plant species from other species
(fungi and animals) is indicated with the filled hexagon (>1,000 MYA), and the filled circle
indicate the divergent point of species belonging to the Triticeae and Poeae tribes from other
Poaceae species. The triangles represent species ing to the Loliinae subtribe, or
Epichloë or Claviceps genera. The presence/absence status of putative homologous
(orthologous) sequence for each gene is shown on the right side of species (subtribe/genius)
name, in which ‘In silico’ and ‘PCR’ denote the database and PCR-based screening results,
respectively. The plus (+) and minus (-) te presence and absence, respectively, and
‘N/A’ stands for ‘not analyzed’. The ancient Epichloë-Poeae/Triticeae HGT events are shown
with curved arrows. The phylograms for LpFTRL(b) and LpDUF3632(c) generated based on
predicted amino acid ces. Sequences from plant species are Barley, Tausch’s
goatgrass and perennial ryegrass. For LpFTRL, the sequence from Trichoderma was
selected as an outer group to obtain a root of the phylogenic tree (b). The DUF3632-like
sequence was specific to Epichloë and Claviceps species, and no corresponding sequence
was found in other related species of the Clavicipitaceae family, except for Periglandula
ipomoeae, which is shown with an asterisk. No sequence was, therefore, selected as an
outer group in the phylogram for LpDUF3632 (c). For fungus sequences, strain and
sequence fiers of the Genome Project at the University of Kentucky are shown in
ts. For plant sequences, NCBI UI is shown in ts.
Figure 14. The expression levels of HGT candidates and corresponding fungal endophyte
genes in perennial ryegrass. (a) The expression levels of LpFTRL and LpDUF3632 in each
tissues of the perennial ryegrass Impact04 genotype. (b) The expression levels of the HGT
candidates and corresponding fungal genes in E+ and E- perennial ryegrass genotypes. (c)
A time course gene expression analysis for the HGT candidates and corresponding fungal
genes in perennial ryegrass seeds and young ngs. The x-axis shows tissue types (c
and d) or period after a germination treatment (e and f), and normalised read count numbers
[counts per million (CPM)] are indicated on the y-axis. The bars or lines show the expression
levels of the HGT candidates in E- and E+ plants, respectively, and the expression levels of
corresponding fungal genes in E+ plants. Note that the scales of the y-axes are not
Figure 15. PCR-based detection of the Epichloë-Poeae/Triticeae HGT candidate from retail
products. PCR assay results using the primers designed for LpFTRL. The PCR products
were visualised on an agarose gel, using the SYBR™ Safe DNA Gel Stain (Thermo Fisher
Scientific). The size (bp) of PCR amplicons is indicated on the right side of each image. As
a control experiment, PCR primers for the florigen candidate gene (Hd3a in rice, and FT in
wheat and barley) were used. For demonstration of absence of Epichloë and Claviceps
species in the retail products, PCR primers ic to the fungal species were used. The
gDNA samples from the perennial ryegrass genotype 04 and E. festuca were used, as
ve controls for amplification with the plant and fungus-specific primers, respectively.
With the PCR s specific to Claviceps species, ication from E. festucae gDNA
template was observed, presumably due to sequence similarity between Epichloë and
Claviceps species. ‘NTC’ stands for ‘no DNA template control’.
Figure 16. Nucleotide ce of Lolium perenne DUF3632-like protein gene.
Figure 17. Amino acid ce of Lolium perenne DUF3632-like protein gene.
Figure 18. Nucleotide sequence of Lolium perenne fungal transcriptional regulatory (FTR)
gene.
Figure 19. Amino acid sequence of Lolium perenne fungal transcriptional regulatory (FTR)
gene.
Detailed Description of the Embodiments
Example 1: Identification of a putative plant ß-1,6-glucanase gene
A single genotype of perennial ryegrass (Impact04) was subjected to whole-genome shotgun
and transcriptome sequencing using the Illumina HiSeq platform (NCBI BioProject
Accession: PRJNA379202) . De novo ly of sequencing reads generated a 7.2 kb
c DNA ce contig [NCBI GenBank unique identifier (UI): KY771173], which
contained a ve ß-1,6-glucanase gene. The gene-like sequence was designated
LpBGNL (Lolium perenne ß-1,6-Glucanase-Like). LpBGNL showed 74-90% and 72-82%
identity at the DNA and amino acid ce levels, respectively, to ß-1,6-glucanase genes
of fungal taxa, such as E. festucae, H. lixii, and T. harzianum (Fig. 1, Table 1). The full
genomic sequence of LpBGNL is shown in Figure 11. No matching sequence, however, was
identified in the full genome ces of plants such as A. thaliana, rice, Brachypodium
distachyon (L.) P. Beauv., barley (Hordeum vulgare L.) or wheat (Triticum aestivum L.), based
on database searches.
T. harzianum (1103 bp) - 74% 73% (1112 bp) 73% (1288 bp) 96% (1320 bp) ce identity (length of homologus sequence) H. lixii 75% (1101 bp) 74% (1101 bp) 74% (1283 bp) - - Neotyphodium 89% (1140 bp) 98% (1164 bp) - - - E. festucae 90% (1140 bp) - - - - NCB UI Lp BGNL) KY771173 ( EF015481.1 AF535131.1 EU747838 X79197.1
Species Perennial ss Table 1
Epichloe festucae Neotyphodium sp. Hypocrea lixii Trichoderma harzianum 5
Example 2: Genomic and genetic terisation of LpBGNL
Methods
Plant materials and DNA extraction
s of plant genotypes are ised in Table 2. Genomic DNA was extracted from
young leaves of plants and fungal endophyte mycelium using the DNeasy plant mini kit
(QIAGEN, Hilden, Germany).
PCR amplification
Locus-specific primers were designed using the Sequencher software ODE, MI,
USA) and the PCR primers are listed in Table 4. PCR amplification was performed with MyFi
polymerase kit (BIOLINE, London, UK). PCR amplicons were visualised on the 2200
ation instrument.
Short-read sequencing of BAC clones and amplicons
The BAC-based genomic library was screened through use of PCR. For the phylogenomic
analysis, PCR primers were ed to obtain genomic fragments from Loliinae and
Dactylidinae species (Table 4). Sequencing libraries for the MiSeq platform (Illumina, San
Diego, California, USA) were prepared from the BAC clones and PCR amplicons, following
the previously described MspJI-based method [Shinozuka et al]. The library was
characterised with the TapeStation and Qubit instruments (Thermo Fisher Scientific). The
outcome reads were assembled with the Sequencher and SOAPdenovo programs.
Genetic linkage analysis
PCR primers were designed to detect the indel polymorphism within the LpBGNL sequence
(Table 3). Genetic linkage analysis was performed through use of the p150/112 reference
genetic mapping tion of perennial ryegrass using the JoinMAP 3.0 application.
PCR amplification
Locus-specific primers were ed using the Sequencher software (GENECODE, MI,
USA) and the PCR primers are listed in Table 4 PCR amplification was performed with MyFi
rase kit (BIOLINE, , UK). PCR amplicons were visualised on the 2200
TapeStation instrument.
Short-read sequencing of BAC clones and amplicons
The BAC-based genomic library was screened through use of PCR. For the phylogenomic
is, PCR primers were designed to obtain genomic fragments from Loliinae and
Dactylidinae s (Table 4). Sequencing ies for the MiSeq platform (Illumina, San
Diego, rnia, USA) were prepared from the BAC clones and PCR amplicons, ing
the previously described MspJI-based method. The library was characterised with the
TapeStation and Qubit instruments (Thermo Fisher Scientific). The outcome reads were
assembled with the Sequencher and SOAPdenovo programs.
Genetic linkage analysis
PCR primers were designed to detect the indel polymorphism within the LpBGNL sequence
(Table 3). Genetic linkage analysis was performed through use of the p150/112 nce
genetic mapping population of perennial ryegrass using the JoinMAP 3.0 application.
., Reference Shinozuka et al 2010 2010 2010 2010 2017 Hand et al., Hand et al., Hand et al., Hand et al., UI IBERS: BA13157 IBERS: BF1199 IBERS: BL2643 SARDI: 778 SARDI: 38013 SARDI: 41525
Genotype or ar 04 Genotype from Aberystwyth (Great Britain) Genotype from Tadham Moor (Great Britain) Demeter Quantum Genotype from wyd (Great Britain) Currie Wild genotype from Algeria Wild genotype from Australia Landmaster
Huds. Schreb. Festuca arundinacea Schreb. Festuca ovina Dactylis glomerata L. Dactylis marina Borrill Scientific name Lolium perenne L. Lolium ntum L. Festuca pratensis Festuca arundinacea Poa poiformis (Labill.) Druce Phalaris aquatica L. )
Table 2 Species Common name Perennial ryegrass Darnel Meadow fescue Tall fescue Tall fescue Sheep fescue Cocksfoot (Orchard grass) lis marina Coast tussock- grass Harding grass (Phalaris)
itted by UTE Auburn University Teagasc Auburn University Auburn University Subm Sichuan Agricultural University KOREA POLAR RESEARCH 31G G 9.3G 10.2G 8.9G bases bases M spots, 25.9 bases bases bases bases Data size 1 run, 162.8M spots, 32.6G 1 run, 153.38M spots, 1 run, 129.3 1 run, 46.3M spots, 1 run, 50.4M spots, 1 run, 44.4M spots, Instrument Illumina HiSeq 2000 Illumina HiSeq 2000 Illumina HiSeq Illumina HiSeq 2000 Illumina HiSeq 2000 2000 Illumina HiSeq 2000
UI SRX738187 SRX465632 SRX745831 SRX745855 858 SRX669405
Dactylis ata L. (orchardgrass) Deschampsia antarctica Poa annua Poa supina Poa infirma Species Phalaris aquatica
Table 3
, , , Phalaris Phalaris iated DNA template perennial ryegrass, darnel, meadow fescue, tall fescue, sheep fescue, cocksfoot, is marina Phalaris aquatica, perennial darnel sheep fescue aquatica endophyte coast tussock- grass, ryegrass- associated endophyte, perennial ryegrass genomic library p150/112 genetic mapping population perennial ss, tall , meadow fescue perennial ryegrass, cocksfoot, is marina coast tussock- grass, cocksfoot, Dactylis marina ial ryegrass, cocksfoot, Dactylis marina coast tussock- grass, aquatica, perennial ryegrass Amplicon size* 178 bp 253/306 bp 1452 bp 1590 bp 1067 bp 248 bp 235 bp 1147 bp 415 bp 126 bp**
Reverse ACTGCACATGGAGCTTGTTG CGTCGCTCATCATCCATGGC CAGATATCTTGATACACATTCC CAGATATCTTGATACACATTCC GTTCACGGTGCGAT TTTGTCGTCCGGGCTCACGC TGGATGCGCYTCGTCATCC ATCCTCCTGGCAAGCTGAATG ATGATGGTGTTGGCCGCGTT TCGTCGCCGATGATGGTGTT
GCCCGTCTGACGGGGCACAG CATCAACAAGATCAGGGGCG CACGACTTGGCTGCTTTCAA CTGCCTCCGAGTTCGACTG 3’) Sequence (5’ Forward GTCGGCATGATTGAGGTTCT AGGGCATCAACAAGATCAGG CGCGCCTAATCCTCTCCTCT TGCTTGCCCTTCAGGAGGCT ATCAGGAAGGAGAGCCTCCA TAACGCTCAACGGGGACG LpHistone** LpABCG5 LpABCG6 Table 4 Primer name LpBGNL_short LpBGNL_indel LpBGNL_long1 LpBGNL_long2 LpBGNL_long3 LpBGNL_long4 LpBGNL_cons * Length of DNA fragment based on the ial ryegrass genome sequence
-Reductase Genes from Perennial Ryegrass -CoA . 2010 Functional Analyses of Caffeic Acid O- Methyltransferase and oyl (doi:10.1105/tpc.109.072827) –3373. ** Reference: Tu, Y. et al
). The Plant Cell 22, 3357
(Lolium perenne
Results
An se bacterial artificial chromosome (BAC)-based genomic library of perennial
ryegrass had previously been constructed from endophyte-devoid (E-) individuals of the
cultivar Grasslands Nui. PCR-based screening of the library fied two positive clones,
ated 4-B20 and LpBAC125-N24. De novo sequence analysis and assembly
identified the presence of LpBGNL in both clones. The gene was located within 39 kb- and
24 kb-contigs (NCBI UI: KY771171 and KY771172) of LpBAC94-B20 and LpBAC125-N24,
respectively, along with a sequence (ca. 2 kb in ) showing similarity at a DNA sequence
identity of 82% to a Zea mays oson-related gene (NCBI UI: AF434192.1) (Fig. 2a). A
11 kb-contig of E. festucae genome sequence (NCBI UI: EF015481), which includes the
corresponding ß-1,6-glucanase gene, was obtained from the NCBI database and was shown
to contain three other genes located within a 5 kb distance from the glucanase gene.
In the BAC clone-derived contigs, however, no ces similar to these flanking genes
were identified. Putative coding regions for the E. ae ß-1,6-glucanase and LpBGNL
genes were identified (Fig. 2b). A single intron was found in both sequences, and comparison
of the exonic and intronic regions identified 4 insertion-deletion (indel) variations between
them. Although the position of the intron was conserved, it seemed that almost all intron
sequence was replaced in perennial ryegrass, due to insertion and deletion events. Although
the coding regions were relatively highly conserved, no ce similarity was found in the
flanking sequence of the coding regions. A BLAST search of 1.5-kb upstream and
downstream sequences of LpBGNL identified partial sequence similarity to the s of
wheat and rice, while the corresponding upstream and downstream sequences of the E.
festucae ß-1,6-glucanase gene ed partial sequences of the flanking genes (Fig. 2b).
Sequencing of PCR products generated using LpBGNL-specific primers identified a 51-bp
intron-located polymorphism between haplotypes of the heterozygous parent (C3 genotype)
of the perennial ryegrass p150/112 genetic linkage mapping population (Figure 6), which
facilitated development of an indel-based DNA marker. From the p150/112 population, 48
individuals were ped (Figure 7), and the LpBGNL-related marker locus was ed
to a distal region of perennial ss linkage group (LG) 5 (Fig. 2c).
Example 3: LpBGNL gene sion analysis
Methods
Gene expression analysis
The transcriptome sequencing reads from Impact04 tissues were mapped against Impact04
genome contigs (>999 bp) for filtering. The number of reads which ned LpBGNL
sequence (no sequence mismatch for 60 bp or longer) were counted as LpBGNL-derived
reads. For gene expression in seedlings, E+ and E- seeds of perennial ss cultivar Alto
were subjected to germination treatment by placement on wet filter paper in the dark for 2
days followed by seedling growth under full-light conditions [44]. RNA was extracted with a
CTAB extraction method, and sequencing libraries were prepared using the SureSelect
strand-specific RNA library ation kit (Agilent). Sequencing is was performed on
the na HiSeq 3000 platform. The full LpBGNL cDNA sequence is shown in Figure 12.
Results
Expression of LpBGNL was determined using data from the transcriptome sequence of the
Impact04 genotype (NCBI BioProject Accession: PRJNA379202) . Sequencing reads
corresponding to LpBGNL were identified from leaf, root and flower samples, and higher
expression levels [based on counts per million reads (CPM)] were detected in root and flower
than in leaf (Fig. 3a, Table 6). Specificity of gene sion was examined using yteinfected
(E+) and E- perennial ss seeds and seedlings. Due to sequence divergence,
sequencing reads corresponding to the plant and fungal gene could be reliably discriminated
(Table 7). Read counts were very low for both E+ and E- seeds immediately after the
germination treatment (Fig. 3b). Although no large-scale morphological change was
observed during the ing two days, the read counts substantially increased in both
samples. The counts remained at relatively high levels in young seedlings at 5 and 10 days
after treatment. As similar trends were observed for both E+ and E- genotypes, presence of
endophyte did not significantly affect LpBGNL expression pattern. Expression of the
endogenous E. festucae var. lolii ß-1,6-glucanase gene was observed in E+ seedlings, but
the read count approach ed relatively low levels throughout the 10 days, in contrast to
LpBGNL (Fig. 3c, Table 7).
glucanase gene CPM 0.14 0.17 0.44 0.43 0.16 0.41 - β 1,6 - Epichloe Counts 5 7 28 25 9 22 CPM 0.11 2.59 12.47 49.38 32.26 72.58 CPM 32.7 55.0 3.7 2.5 3.7 12.1 5.9 9.2 66.5 Lp BGNL Counts 4 109 802 2838 1847 3901
Counts 479 798 87 49 54 272 113 154 767 E+ individual 36,389,285 42,014,889 64,295,493 57,472,563 57,259,134 53,748,829
Total reads 14,656,730 14,515,287 23,613,687 19,292,712 ,797 22,525,848 13,271,284 ,932 11,536,030 Total reads glucanase gene CPM 0.00 0.02 0.04 0.01 0.02 0.00
Library Root tip Root (middle) Leaf middle 1 Leaf middle 2 Leaf middle 3 Leaf tip 1 Leaf tip 2 Leaf tip 3 1,6
Flower Epichloe - β Counts 0 1 3 1 1 0 BGNL CPM 0.35 0.48 36.77 87.56 57.32 64.31 Lp Counts 19 30 2751 6285 3391 6565 - individual E Total reads 54,109,844 62,109,304 74,819,980 71,779,944 59,159,973 102,085,102 0 h 4 h 1 day Table 6 Table 7 2 days 5 days 10 days
[Link]
http://www.megasoftware.net/
Example 4: Phylogenetic analysis of plant and fungal ß-1,6-glucanase(-like) genes
Method
In silico analysis
The DNA sequences of fungal ß-1,6-glucanase genes were obtained from the NCBI
(http://www.ncbi.nlm.nih.gov/) database and the Genome Project at the University of
Kentucky website. ve orthologous sequences were sought in the NCBI, podium
distachyon (http://www.brachypodium.org/) and Ensembl
(http://plants.ensembl.org/index.html) databases. Non-synonymous and synonymous
nucleotide tution rates (Ka and Ks, respectively) were calculated using the
Synonymous Non-synonymous Analysis Program (SNAP; http://www.hiv.lanl.gov/).
Alignment of DNA sequences was performed with the CLUSTALW program
(http://www.genome.jp/tools/clustalw/) with the default parameters. Phylogeny was
generated with the MEGA7 program (http://www.megasoftware.net/).
The presence of LpBGNL orthologues in other Poeae species was determined by PCR-based
ing. LpBGNL-specific primers were designed and short DNA nts (178 bp in
length) were ied from genomic DNA templates of darnel (Lolium temulentum L.),
meadow fescue ca pratensis Huds.), tall fescue (Festuca nacea Schreb.), sheep
fescue (Festuca ovina) (Table 2, Figure 8). Products were also obtained from those of
cocksfoot/orchard grass (Dactylis glomerata L.) and Dactylis marina Borrill, but not from those
of coast k-grass [Poa poiformis (Labill.) Druce] or g grass/phalaris (Phalaris
aquatica L.). DNA fragments were not amplified from genomic DNA templates of E. festucae
var. lolii., ming the specificity of the oligonucleotide primers that were used . Alignment
of LpBGNL and the fungal genes identified a conserved region ca. 750 bp in length,
corresponding to the aryl-phospho-beta-D-glucosidase domain. For a phylogenetic analysis,
DNA fragments, including the aryl-phospho-beta-D-glucosidase domain, were amplified from
the selected Loliinae and Dactylidinae species. De novo on sequence analysis and
assembly obtained a single ce contig of the 750 bp region for each Lolium and
Festuca species (Figure 9). For each Dactylis species, three contigs (haplotypes) were
generated. A putative ure stop codon was found in two haplotypes of Dactylis marina,
and the haplotypes with the premature stop codon were excluded from the further analysis.
Fungal glucanase gene-like sequences were obtained from the NCBI database and
the Genome Project at the University of Kentucky website. Phylogenetic analysis with the
maximum likelihood method was performed, and the plant species-derived sequences were
found to be clustered in the phylogram with those from Epichloë (Neotyphodium) species (Fig
4). The sequences from other fungi were more distantly related to the plant ces.
Synonymous and non-synonymous nucleotide substitution (Ks/Ka) ratios were calculated
using the 750 bp sequences. Both Ks and Ka values between the Epichloë and plant species
were substantially lower than those between the Epichloë s and other fungi (H. lixii and
T. harzianum) (Table 2). The Ks/Ka ratios for candidate LpBGNL orthologues were between
0.027-0.221, lower or equivalent to values from the fungal ß-1,6-glucanase genes (0.057-
0.275).
In order to verify presence/absence boundaries, a set of PCR s was designed to
amplify 415 bp fragments within a region highly conserved between plant and fungal ß-1,6-
glucanase(-like) genes. This assay confirmed the absence of the gene in the Poa and
is species samples (Fig. 5). As a control experiment for capacity to y cross-
species, PCR was performed with primers specific to perennial ryegrass histone H3 and
candidate plant architecture genes, such as the ATP -binding cassette protein sub-family G 5
and 6 genes (LpABCG5 and LpABCG6, respectively). Although all primers were designed
based on ial ryegrass sequence, PCR amplification from coast k-grass and
harding grass/phalaris was observed, except for the combination of ABCG 5 primers and one
of the Poa genotypes (Figure 10). Database searches were performed using published shortread
sequencing data on the NCBI Sequence Read Archive (SRA;
https://www.ncbi.nlm.nih.gov/sra). Sequences icantly matching the LpBGNL and E.
festucae ß-1,6-glucanase genes were found from Dactylis species, but not from Poa or
Phalaris species (Table 9, Figure 9). No significantly matching sequence was obtained from
Antarctic hair grass (Deschampsia antarctica É. Desv.), which is believed to be mically
closer than Poa species to s of the sub-tribes Loliinae and Dactylidinae (Fig 5b). As
a l analysis, sequences similar to the LpABCG 5 and 6 genes were sought, leading to
identification of matching sequences from all tested Poeae species, including those
belonging to both Poa and Phalaris.
um ) ia n 2 7 T. r z 5 h a 0.6396, 0.1469 (0.2297) (0.2304) 0.1186, 0.0068 . 0 ( 0 , 0.1453 (0.2276) 0.6563, 0.1432 (0.2182) , 0.1449 (0.2231) 0.6805, 0.1407 0.6424, 0.1492 (0.2323) 0.6670, 0.1537 (0.2068) H. lixii 0.6116, 0.1507 (0.2341) - (0.2464) 0.6041, 0.1491 8) 0.6285, 0.1470 (0.2339) 0.6093, 0.1487 (0.2441) , 0.1442 0.6363, 0.1488 (0.2339) 0.6546, 0.1533 (0.2186) Neotyphodium sp. 0.2539, 0.0629 (0.2477) - 0.2533, 0.0646 (0.2550) 0.2369, 0.0655 (0.2766) 0.2305, 0.0638 0) 0.2969, 0.051 0.0896, 0.0247 (0.2751) - (0.1717) -glucanase gene ß- 1,6 E. festucae 0.1961, 0.0501 (0.2553) - , 0.0518 (0.2647) 0.1887, 0.0535 (0.2838) 0.1823, 0.0519 (0.2845) 0.2207, - - 0.0433 (0.1961) Sheep fescue 0.3333, 0.0416 (0.1247) 0.3575, 0.0433 (0.1211) 0.3313, 0.0467 (0.1411) 0.3247, 0.045 (0.1387) - - - -
BGNL Meadow Fescue 0.0991, 0.0102 (0.1029) 0.1359, 0.0085 (0.0625) 0.0308, 0.0068 (0.2213) - - - - -
Candidate orthologue of Lp Tall fescue , 0.0102 (0.0783) 0.1670, 0.0085 (0.0509) - - - - - -
ryegrass Darnel 0.0622, 0.0017 (0.0273) - - - - - - - Perennial ss Darnel ryegrass Tall fescue Meadow Fescue Sheep Fescue Epichloe festucae Neotyphodium sp. Hypocrea lixii Table 8 Ks, Ka (Ka/Ks)
Results
The high level of DNA sequence similarity to the fungal genes, and absence of LpBGNL-like
sequences from other representative angiosperm species suggested that LpBGNL was
ed from a fungal species through HGT. Genomic and genetic characterisation was
uently performed in order to demonstrate that LpBGNL is d on a perennial
ryegrass chromosome. Furthermore, LpBGNL orthologues were found to be present in other
Loliinae and Dactylidinae species. It is hence unlikely that LpBGNL was an assembly or
annotation ct, even though LpBGNL shows unusually high DNA sequence rity
(ca. 90%) to the ß-1,6-glucanase genes of contemporary species descended from the
putative donor, when compared to other horizontally transferred genes in otes.
The PCR-based screening and database searches ted that the ß-1,6-glucanase-like
gene is present in only a limited number of Poeae species including the genera Lolium,
Festuca and Dactylis, which are confined to the sub-tribes Loliinae and Dactylidinae. The
enetic analysis suggested a common origin of the Epichloë-derived glucanase
genes and LpBGNL orthologues, and the close relationship between the LpBGNL
orthologues of contemporary Loliinae and Dactylidinae grasses suggests that the gene may
have been introduced into the genome of a common ancestor of the ibes by a single
transfer event. The HGT event may consequently have occurred between ca. 9 to 13 million
years ago (MYA), based on the predicted time of divergence of the two sub-tribes from other
Poeae lineages (Fig. 5b).
The Ks/Ka ratios between plant ß-1,6-glucanase-like genes (0.027-0.221) were not
substantially different from those of the fungal ß-1,6-glucanase genes, and those of
LpABCG5 and LpABCG6 (0.166 and . This suggests that LpBGNL may have been
subjected to selection pressures. Although similar Ks/Ka ratios were obtained from the
angiosperm and fungus groups, DNA mutation rates between those two groups may not be
equivalent. From cocksfoot/orchard grass and Dactylis marina, three haplotypes of the aryl-
phospho-beta-D-glucosidase domain were identified, and two haplotypes obtained from
Dactylis marina contained a putative premature stop codon. As these Dactylis species have
autopolyploid genomes, the ß-1,6-glucanase-like genes in these species may have been
ted to unique selection pressures due to c redundancy, when compared with
genes in the other plant species.
As asexual symbiotic Epichloë species grow as hyphae between cells of vegetative aerial
s in Poeae species, it is likely that the close physical proximity of both partners in the
symbiosis may have facilitated an HGT event, r to the physical contacts between
parasitic and host plants. The conservation of the intron position n the LpBGNL and
Epichloë ß-1,6-glucanase genes suggests that a part of the endophyte genome including the
ß-1,6-glucanase gene, rather than a reverse-transcription product of endophyte gene mRNA,
was incorporated into the recipient genome. In prokaryotes, transformation is a prevalent
mechanism of gene exchange, in which HGT occurs through uptake of exogenous doublestranded
DNA by the recipient cell.
4) G6 -38) -26) C e- 3 (4 pA B % L 94% (5e- 32) 97% (1e 95% (1e- 33) 90% (6e- 27) 92% (2e 4 9 LpABCG5 99% (3e- 41) 99% (7e- 42) 100% (5e- 43) 99% (8e- 42) 100% (2e- 43) 97% (5e- 39) -glucanase gene E. festucae ß -1,6 99% (6e- 41) N.S. N.S. N.S. N.S. N.S. LpBGNL 95% (8e- 35) N.S. N.S. N.S. N.S. N.S. Data size 32.6G bases 31G bases 25.9G bases 8.9G bases 9.3G bases 10.2G bases Source Transcriptome Genome Transcriptome Transcriptome Transcriptome Transcriptome
UI 187 SRX465632 SRX745831 SRX745855 SRX745858 SRX669405
Table 9 Species Dactylis glomerata (orchardgrass) Deschampsia tica Poa annua Poa supina Poa infirma Phalaris aquatica
e 5: Loss of function of LpBGNL
Given the role of plant-encoded glucanase enzyme in the establishment of a stable
symbiotic relationship with an endophyte, a loss of function analysis is carried out. A
LpBGNL-like gene is removed from the genome of a ryegrass plant which ly forms a
stable relationship with an Epichloë endophyte. The stability of the plant-endophyte
association is then evaluated in such plants compared with unmodified control plants.
e 6: Gain of function of LpBGNL
Given the role of plant-encoded ß-1,6-glucanase enzyme in the establishment of a stable
symbiotic relationship with an endophyte, a gain of function analysis is carried out. A
LpBGNL-like gene is uced into plants such as rice and wheat that do not normally form
stable symbiotic relationship with Epichloë endophytes. The stability of the plant-endophyte
association is then evaluated in such plants ed with unmodified control plants.
Example 7: LpBGNL as a promoter of natural stable associations with asexual
Epichloë
Fungal ß-1,6-glucanases have been ed to be specifically ed into plant apoplasts
during endophyte ion, and may play a role in provision of nutrition to the infecting
endophyte, control of branching of the yte hyphae, and protection of plant tissues
from infection of other fungal pathogens. The plant-encoded enzyme may participate in one
or more of these processes, and so contribute to establishment of a stable tic
relationship.
Although Epichloë ytes do not colonise root tissues, a relatively high level of
expression of LpBGNL was observed in root tissues. Hence, the plant-encoded enzyme may
function to protect against infection by soil-borne fungal pathogens. Similarly, active
expression in flowers may suggest the capacity to protect against fungal pathogens such as
Epichloë typhina, which causes choke disease. However, some Festuca and Dactylis
species are relatively susceptible to infection by E. a, even though those species
presumably also possess the ß-1,6-glucanase-like gene. As natural stable associations with
asexual Epichloë endophytes are confined to the Poeae lineages that possess LpBGNL-like
genes, the ancestral HGT event (which might have occurred from a sexual pathogenic
oë-like species) may have provided pre-adaptive conditions for the contemporary
symbiosis. The evidence for selective pressure on the gene is suggestive.
As major symbionts, the l Epichloë species provide abiotic and biotic stress nce
to grass species of the Poeae tribe. Tolerance to invertebrate ory is a wellcharacterised
benefit to the host, partially attributable to the effects of a makes caterpillers
floppy-like ike) gene. The mcf-like gene was horizontally erred into the endophyte
genome from a bacterial species 7.2-58.8 MYA. Hence, multiple horizontal transfer events,
ing transfer of the LpBGNL-like gene as described in the present study, may have been
involved in the establishment of the t stable symbiotic relationship.
Given the role of plant-encoded LpBGNL enzyme in the establishment of a stable symbiotic
relationship with an endophyte, a stable symbiotic relationship with a plant and an endophyte
may be created, which otherwise may not occur. The introduction of BGNL into plants which
do not contain BGNL and are thus not able to form a stable symbiotic relationship with
endophytes, may enable the establishment of such a relationship.
Example 8: A role for LpBGNL in pathogenic resistance
The potential role of a ß-1,6-glucanase-like gene in protection against other, pathogenic,
fungal species is of particular st. Species such as T. harzianum are mycoparasites of
fungal phytopathogens, and this property is related to glucanase activity. Fungal-derived
genes for anti-fungal enzymes such as endochitinases and glucanases have also been used
for generation of transgenic plants with ed pathogen resistance.
To generate transgenic plants with enhanced pathogen resistance using the LpBGNL-like
gene the LpBGNL-like gene is transferred into the genomes of crop plants such as rice and
wheat and then the resistance of the transformed plants to a range of fungal diseases is
Example 9: ß-1,6-glucanase as an indicator of stable associations with asexual
Epichloë
Given the role of the plant-encoded ß-1,6-glucanase enzyme in the establishment of a stable
symbiotic relationship with the endophyte, the presence and level of expression of a plant-
encoded ß-1,6-glucanase may be used to predict the likelihood of the plant forming a stable
association with an endophyte carrying the glucanase, such as Epichloë.
The method involves selecting a plant for ing for symbiosis with a symbiont such as
an Epichloë endophyte. The first step es determining r the plant to be screened
contains the BGNL gene, through genetic analysis. If the plant selected for screening
contains the BGNL gene, the second step is to determine the level and location of expression
of the gene. The expression level of BGNL ed is then used to determine if the said
plant screened would form a symbiotic relationship with the Epichloë endophyte.
High levels of expression in the root tissues and in the flowers of the plant are indicative of
the plant screened being able to form a stable association with the endophyte.
Example 10: Identification of putative plant FTRL and DUF genes
Using non-polyadenylated RNA from an endophyte-absent (E-) ial ryegrass individual,
a sequencing library was ed. A single Illumina MiSeq run generated a total of
8,216,014 reads from the library. A dataset of unique RNA reads, including 274
ces, was generated. A BLAST search of the perennial ryegrass (E-) transcriptome
shotgun assembly (TSA) and unique RNA read datasets against the oë festucae
transcriptome data identified 88 and 123 sequence similarity hits, respectively. Sequences
putatively derived from microbiome, highly conserved genes between fungi and plants, such
as actin and ubiquitin genes, and low confident matches were excluded through a manual
examination, and 2 novel HGT candidates were identified.
From the TSA data, a sequence [unique identifier (UI): ID_150936_C1449060_17.0] showing
a relatively high similarity (85%) to an E. festucae unknown n gene (UI:
EfM3.066060.partial-2.mRNA-1) was identified. Due to a similarity of predicted amino acid
sequence to a fungal transcriptional regulatory (FTR) n (Genbank UI: CRL18938;
identity: 48%, e-value: 2e-150) of Penicillium camemberti (Ascomycota, comaceae),
one identified gene was designed LpFTRL (FTR-like).
The other candidate, designated 632, showing a higher similarity (96%) to the E.
festucae DUF3632 (domain of unknown function 3632)-like gene (UI: EfM3.028800. mRNA-
1) was identified from the unique reads (Sequence UI: 734684-1).
Genome sequence contigs containing LpFTRL and LpDUF3632 from an in-house shotgun
sequencing assembly data of the ial ryegrass Impact04 genotype (E-) were subject to
a BLASTN search against nucleotide sequences catalogued in the NCBI GenBank database.
Relatively high ce similarity matches against LpFTRL were identified from Tausch's
goatgrass (Aegilops tauschii L., UI: XM_020322891.1) and barley (UI: AK375773.1), ed
by ascomycota species, while only fungal genes showed significant sequence similarity to
LpDUF3632. Putative orthologues of LpFTRL were identified in barley chromosomes 1H and
7H (Ensembl UI: HORVU1Hr1G009870 and HORVU7Hr1G108080, respectively), while the
corresponding sequences were only found from chromosome 7 of each sub-genome of
hexaploid wheat bl UI: TRIAE_CS42_7AL_TGACv1_557369_AA1780460,
_AA1881100, and _AA1997520), and from cereal rye (Secale cereal L.) chromosome 7
(NCBI short read archive (SRA) UI: ERX140518), suggesting that the fungal gene was
transferred into the chromosome 7 of a common or of Triticeae and Poeae species.
No significant match was obtained from the genome ces of Brachypodium [B.
hyon (L.) v.], rice (Oryza sativa L.), sorghum [Sorghum bicolor (L.) Conrad
Moench], Zea Mays (L.) and Arabidopsis thaliana (L.).
The LpDUF3632 sequence was subjected to a BLASTN search against NCBI SRA data from
cool-season grass species, to find significant hits from Italian ryegrass (L. multiflorum L.) and
tall fescue ca arundinacea L.), but not from orchard grass (Dactylis glomerata L.) or
Antarctic hairgrass (Deschampsia Antarctica É.Desv.). The gene presence/absence status
of the DUF3632-like sequence in Poeae species was confirmed with a PCR-based assay
(Fig. 13a).
The ce of LpFTRL-like sequence in all tested Poeae species was confirmed. A
phylogenetic analysis revealed close relationships of LpFTRL and LpDUF3632 n
corresponding Epichloë sequences (Fig. 13b and c), suggesting that the two genes were
transferred from the fungus lineage into plant species, but not vice versa, after ification
[59 million years ago (MYA)] of ancestral Epichloë species from the Claviceps lineage. Based
on the divergence ages of the Brachypodieae tribe from other Pooideae species, the FTRL
gene was predicted to have been transferred into plants after 32-39 MYA. An LpDUF3632-
derived sed marker was assigned into perennial ss linkage group (LG) 3, which
corresponds to the chromosome 3 of eae species. The DUF3632-like sequence is likely
to have been transferred independently of the β-glucanase(-like) gene, of which DNA-based
marker has been assigned into perennial ryegrass LG 5, indicating a ility of at least
three independent HGT events since 32-39 MYA. Comparison of genomic sequences
including DUF3632-like genes ted transformation-like ancestral HGT events, due to
conservation of the position of the putative intron between plant and Epichloë s, r
to LpBGNL. No intron was predicted for LpFTRL and corresponding sequences in Epichloë
species.
From the E- perennial ryegrass transcriptome data, a leaf tip-specific expression pattern of
LpFTRL was proposed (Fig. 14a). Although the counts per million reads (CPM) values were
vely low, LpDUF3632 was ubiquitously expressed (Fig. 14b). An analysis of the SRA
data from Massay University, which did not include a leaf tip sample, indicated that the
expression levels of LpFTRL and the ponding Epichloë gene (EfM3.066060) were
below the limit of detection in most tested tissues, regardless of the endophyte-infected (E+)
/E- plants (Fig. 14c). Expression ns of LpDUF3632 were similar between E+ and E-
plants, and the Epichloë DUF3632 gene (EfM3.028800) was expressed in all tested s
of the E+ plant (Fig. 14d). From the E+ and E- seeds/young seedlings, an increment of
LpDUF3632 expression level was observed in E+ seeds after a germination-treatment,
although the expression levels of LpFTRL, EfM3.066060, and EfM3.028800 stayed low
throughout the tested 10 days (Fig. 14e and f). Although the LpDUF3632 sequence was
identified from the non-polyadenylated RNA sequencing library, it is likely that the gene is
also expressed as polyadenylated RNA, due to identification of corresponding reads from the
SRA data.
Identification of LpFTRL provided a unique opportunity to compare nucleotide tution
rates between fungus and plant lineages, using the sequences ed only less than 40
MYA. The synonymous (Ks) substitution rate of the plant FTRL sequences was not
substantially different from those from fungus sequences. Although some variation was
observed in the non-synonymous (Ka) substitution rates, the Ka/MYA rate from the plant
sequences was n those from Claviceps-Epichloë and E. gansuensis-other Epichloë
combinations (Table 1).
Ka/Ks 0.2174 0.1657 0.3760 9 1 6 . 3 of the 0 Rate (Ka/MYA) Claviceps and Claviceps were 0.0040 0.0024 0.0050 0.0072 combinations are shown as SDV 0.0064 0.0073 0.0008 0.0055 Epichloë Epichloë and Non- synonymous Ka (average) 0.2307 0.1412 0.1041 0.0519 Rate (Ks/MYA) and the rest of Epichloë, respectively. As lineage (from 58.8 MYA to the HGT event), while the 0.0183 0.0147 0.0132 0.0199 Claviceps genes. The ratios calculated from the Epichloë and E. gansuensis mous SDV 0.2560 0.1745 0.0231 0.0112 E. nsis- other Ks (AVE) 1.0612 0.8517 0.2767 0.1435 Poeae (plants), and Poeae, and Diverged and
age (MYA) 58 58 21 orthologues and corresponding Epichloë Triticeae-
7.2 Triticeae
oë FTRL s, Claviceps and Plants, , eps Poeae combination merely represent diversification between plant species. and Plants combination include the diversification period in the
Table 10. Claviceps- plants Claviceps- Epichloë Triticeae- Poeae E. gansuensis- other Ka and Ks rates for Lp Epichloë, Claviceps- Epichloë diverged around 58.8 MYA followed by horizontal transfer of the FTRL sequence into plant species after 39 MYA, the comparison Claviceps Triticeae and 5
The Ka/Ks ratio for the plant FTRL and corresponding E. gansuensis-other Epichloë
sequences (0.376 and 0.3619, respectively) were relatively close, suggesting that the plant
genes have been subjected to selection pressures since HGT. A comparison with E. festucae
DUF3632 suggested a similar level (Ka/Ks = 0.31) of selection pressures for LpDUF3632.
These results proposed that plant FTRL and DUF3632 genes retain functionalities at the
protein level, and have contributed to natural tion of the plant species. Similar to
LpBGNL, the intron sequences of LpDUF3632 were less conserved than the exon
ces, likely due to lower levels of the pressure, which implies that the selective
pressures have been an important factor for retaining of sequence similarity to the
corresponding Epichloë sequences. The close physical contacts between the host plants
and symbiotic and/or pathogenic fungi could have facilitated the relatively frequent transfer
events. As both Epichloë and eps species infect to plant reproductive tissues, the
presence close to germ cells might have been an important factor of the multiple HGT .
Comparison of codon usage of LpFTRL orthologues from diploid plant species and
corresponding Epichloë ces revealed a similar usage ratio for each amino acid, except
for the termination codons. Only ‘TGA’ was used in the plant genes as termination codon,
the ratio of ‘TGA’ was only 38.5% in the Epichloë sequences.
Pearl barley, wheat plain flour, rolled oat, and rice flour products were obtained from retail
shops, and DNA was extracted from the retail products. PCR primers for the LpFTRL
sequence within a conserved region between plant and Epichloë species were designed.
h PCR, the sequences corresponding to LpFTRL were amplified from barley, wheat,
oat, and E. festuca gDNA templates, but not from rice, confirming the presence of the ‘natural’
transgene in Triticeae and Poeae cereal species (Fig. 15). A control experiment with fungus-
specific primers confirmed absence of gDNA of Epichloë and Claviceps species, especially
the rye ergot , C. purpurea, in the retail products.
Materials and Methods
sRNA cing
Fresh young leaves of an individual of perennial ss cultivar Trojan were harvested.
Total RNA ing small molecules was ted using the RNeasy Plant mini kit
N) following the modified protocol of related products ication of miRNA from
animal cells using the RNeasy® Plus Mini Kit and RNeasy MinElute® Cleanup Kit). A
sequencing library was prepared using the Small RNA cing library preparation kit
(NEB), and a fraction containing non-coding RNA molecules (bp in ) was purified using
the BluePippin platform (Sage Science). The products were characterised on the 2200
TapeStation instrument using the D1000 kit (Agilent). The library was loaded on the MiSeq
platform (Illumina), following the cture’s instruction, and a sequencing analysis was
performed with the MiSeq Reagent Kit v3 ycle) kit (Illumina). The outcome data was
sed with the FastX-tool-kit package, to remove adapter ce and generate a
unique read dataset.
BLAST-based screening
The transcriptome dataset of E. festucae (file name: M3 ript sequences) was obtained
from the website of Kentucky university (http://www.endophyte.uky.edu). The TSA
(GFSR01000001-GFSR01044773) and sRNA unique read datasets of perennial ryegrass
were prepared for a DNA sequence homology search. The homology search was performed
with the megablast function of the BLAST+ package, and the old E value was set at
1e-10. The resulting data was ed into the Microsoft Excel software for a manual
examination. The manual examination was performed using the NCBI BLAST tools.
The gues sequence in representative flowering plant species were performed on the
Ensembl Plants website (http://plants.ensembl.org/index.html). The LpFTRL sequence was
subjected to BLAST-based search against cereal rye SRA dataset (SRA UI: DRP000390).
The LpDUF3632 sequence were subjected to the search against the following SRA datasets;
Italian ryegrass (SRX1604870 and SRX1604871), tall fescue 56957), orchard grass
42528), and Antarctic hairgrass (SRX465632), from which significant homology hits
against the perennial ryegrass architecture candidate genes, LpABCG5 and 6 (GenBank UIs:
54.1 and JN051255.1) were obtained, but no significantly similar sequence to an
Epichloë-specific gene, makes caterpillars floppy (mcf)-like gene (GenBank UI: KJ502561.1),
was identified. This screening method was validated through a BLAST search of the LpFTRL,
LpDUF3632, and Epichloë mcf sequences t E+ and E- perennial ryegrass SRA
datasets (SRA UIs: SRX1167577-SRX1167590).
DNA sample preparation
Plant seeds were obtained from the Genetic Resources Unit of ute for Biological
Environmental and Rural Studies (IBERS; Aberystwyth, Wales, UK) and the South Australian
Research and Development Institute (SARDI). The plants were germinated on a filter paper
in a petri dish. Total DNA was extracted from fresh leaf of each plant genotype using the
DNeasy Plant mini kit N) following the manufacture’s instruction. Total DNA was also
extracted from barley (pearled grains), wheat (plain flour), oat (rolled grains) and rice (flour)
using the DNeasy Plant mini kit.
PCR-based screening
PCR primers were designed using the Oligo Calc tools. For cross-species amplification,
primers were designed to generate short DNA fragments (< 251 bp in length) within highly
conserved regions of the target sequences. The PCR was performed on the CFX Real-Time
PCR Detection Systems (Bio-Rad), with the Luna® Universal qPCR Master Mix (NEB), and
data analysis was med using the CFX Manager™ Software (Bio-Rad). Visualisation of
PCR products was performed on the 2200 TapeStation instrument or on an agarose gel
(2.0% w/v) stained with SYBR Green o Fisher) through electrophoresis.
Validation of the PCR-based screening method
PCR primers were designed based on perennial ryegrass sequences to amplify larger
fragments (> 900 bp), for use as DNA tes of a rd curve assay (SCA). The PCR
amplicons were amplified from the 04 genotype, using the MyTaq™ DNA rase
kit, and the amplicons were d using the Monarch® PCR & DNA Cleanup Kit (NEB).
DNA concentration was adjusted to 1 pg/μl, and a dilution series was prepared. For fungus-
specific primers, a dilution series of E. festucas gDNA was prepared. The SCA was
med on the CFX Real-Time PCR Detection s, with the Luna® Universal qPCR
Master Mix, followed by data analysis with the CFX Manager™ Software.
In silico analysis
Amino acid and DNA sequences were prepared for in silico analysis. Gene structure
prediction was performed using the FGENESH program of the Softberry e using the
‘Monocot plants’ parameter. Alignments of amino acid sequences were ted with the
CLUSTALW program with the default parameters. Sequence homology search was
performed with the NCBI and PredictProtein websites. Phylogenetic analysis was performed
with the MEGA7 m. Non-synonymous and synonymous nucleotide substitution rate
(Ka and Ks, respectively) was calculated using the Synonymous Non-synonymous Analysis
Program (SNAP). For gene expression analysis, an in-house riptome read dataset
was prepared through filtering of the riptome sequencing reads from Impact04 tissues
using Impact04 genome contigs (>999 bp). The number of reads which contained LpFTRL or
LpDUF3632 sequences (no sequence mismatch for 60 bp or longer) were counted.
Finally, it is to be understood that various alterations, modifications and/or additions may be
made without departing from the spirit of the present invention as outlined herein.
References
Hand, M. L., Cogan, N. O., Stewart, A. V. & Forster, J. W. Evolutionary history of tall fescue
morphotypes inferred from molecular phylogenetics of the Lolium-Festuca s complex.
BMC Evolutionary y 10, 303 (2010).
Richards, T. A. et al. Phylogenomic analysis demonstrates a pattern of rare and ancient
ntal gene transfer between plants and fungi. The Plant Cell 21, 1897–1911 (2009).
Shinozuka, H. et al. A simple method for semi-random DNA on fragmentation using
the methylation-dependent restriction enzyme MspJI. BMC Biotechnology 15, 25 (2015).
Claims (24)
- THE CLAIMS DEFINING THE INVENTION ARE AS FOLLOWS: 1. A method of creating or ing a symbiotic relationship between a plant and a symbiont carrying a fungal transcriptional regulatory-like (FTR) protein, said method including 5 introducing into said plant an effective amount of a nucleic acid or nucleic acid fragment encoding the FTR protein, wherein the nucleic acid or nucleic acid fragment is isolated from a plant species.
- 2. A method according to claim 1, wherein said plant is from a Triticeae,or Aveneae 10 species.
- 3. A method according to claim 2, wherein said plant s is ed from the group ting of Triticum aestivum, Hordeum vulgare and Avena sativa. 15
- 4. A plant endophyte symbiota produced by a method according to any one of claims 1 to 3.
- 5. A method for selecting a plant for symbiosis with a symbiont carrying a FTR gene, said method comprising 20 a) determining the presence of a FTR gene in said plant, b) measuring the level of expression of the gene identified in a), and c) using the expression level measured in b) to determine if the plant will form a symbiotic relationship with said symbiont. 25
- 6. A method according to claim 5, wherein the symbiont is an endophyte from an Epichloe species.
- 7. A substantially purified or ed nucleic acid or nucleic acid nt encoding a FTR protein; n the nucleic acid or c acid fragment is isolated from a plant species.
- 8. A nucleic acid or nucleic acid nt according to claim 7, wherein said plant is from a from a Triticeae or Aveneae species.
- 9. A nucleic acid or nucleic acid fragment ing to claim 8, wherein said plant s is selected from the group consisting of um aestivum, Hordeum vulgare and 11. Avena sativa. 5
- 10. A substantially purified or isolated nucleic acid or nucleic acid fragment encoding a FTR protein or a complementary or antisense sequence to a nucleic acid or c acid fragment encoding a FTR protein, said nucleic acid or nucleic acid fragment including a tide sequence selected from the group ting of: (a) the sequence shown in ce ID No: 30; 10 (b) complement of the sequence recited in (a); (c) sequences antisense to the sequence recited in (a); and (d) functionally active fragments and variants of the sequences recited in (a), (b) and (c). 15
- 11. A nucleic acid or nucleic acid fragment according to claim 10, wherein one of the following applies: i) said onally active fragment or variant has a size of at least 20 nucleotides and has at least imately 90% identity to the relevant part of the ce recited in (a), (b) or (c), upon which the fragment or variant is based; or 20 ii) said functionally active fragment or variant has a size of at least 100 nucleotides and has at least approximately 95% identity to the relevant part of the sequence recited in (a), (b) or (c), upon which the fragment or variant is based.
- 12. A vector including a nucleic acid or nucleic acid fragment according to any one of 25 claims 7 to 11.
- 13. A vector according to claim 12 further including a promoter and a terminator, said promoter, nucleic acid or nucleic acid fragment and terminator being operatively linked. 30
- 14. A plant cell, plant, plant seed or other plant part, including vector according to claim 12 or 13.
- 15. A method of modifying pathogen ance in a plant, said method including introducing into said plant an effective amount of a nucleic acid or nucleic acid fragment 35 according to any one of claims 7 to 11, or a vector according to claim 12 or 13.
- 16. Use of a nucleic acid or nucleic acid fragment according to any one of claims 7 to 11 for modifying pathogen ance in a plant. 5
- 17. Use of a nucleic acid or nucleic acid fragment according to any one of claims 7 to 11, or nucleotide ce ation thereof, or single nucleotide polymorphisms thereof, as a molecular genetic marker.
- 18. A method of creating or ing a symbiotic relationship between a plant and a 10 symbiont carrying a FTR protein, said method including introducing into said plant an effective amount of a nucleic acid or nucleic acid fragment according to any one of claims 7 to 11, or a vector according to claim 12 or 13.
- 19. A plant endophyte symbiota produced by a method according to claim 18.
- 20. A substantially purified or isolated FTR protein, wherein said FTR protein is isolated from a plant species.
- 21. A FTR protein according to claim 20, wherein said plant from which the FTR protein 20 is isolated is a Triticeae or Aveneae species.
- 22. A FTR protein according to claim 21, wherein said plant species is selected from the group ting of um aestivum, Hordeum vulgare and Avena sativa. 25
- 23. A substantially ed or isolated FTR protein, said protein including an amino acid sequence selected from the group consisting of: (b) the sequence shown in Sequence ID No: 31; and (c) functionally active fragments and ts of the sequences recited in (a). 30
- 24. A protein according to claim 23, wherein one of the following applies: i) the functionally active fragment or variant has a size of at least 20 amino acids and has at least approximately 90% identity to the nt part of the sequence recited in (a) upon which the fragment or variant is based; or ii) the functionally active fragment or variant has a size of at least 100 amino acids and has at least approximately 95% ty to the relevant part of the sequence recited in (a) upon which the fragment or variant is based. EPWMMSDEWNNVMGCNGAPSEFDCMQNIYGGSKR NFGGWLICEPWMMSDEWNNVRGCNGAASEFDCMRNNYGGSKR KGINKIRGVNFGGWLICEPWMMSDEWNNVMGCNGAASEFDCMLNNYMGSNR EPWMMSNEWNNNMGCNNAASEFDCMRNNYMGSKR ALNVPSNKKLHVQFMSSKWDSGDPR SPGMDGWIYWTWKTELNDPR .*:.************.******:**** ***.*.****** * * **:* PGALKAVRDAEASLGVADGKKLHVQFMSQKWDSGNPR ADFFKKFFTAQQQLYEAPGMSGWVYWTWKTQLNDPR *********** ***.**:******:***** D DKDFFKKFFTAQQQLYEAPGMSGWVYWTWKTQLNDPR KFFTAQQQLYEEPGMSGWIYWTWKTQLNDPR DGNFFTKFFTAQQQLYESPGMDGWIYWTWKTELNDPR
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AU2017902978 | 2017-07-28 |
Publications (1)
Publication Number | Publication Date |
---|---|
NZ789515A true NZ789515A (en) | 2022-07-01 |
Family
ID=
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Su et al. | A deletion mutation in TaHRC confers Fhb1 resistance to Fusarium head blight in wheat | |
Nguyen et al. | GmKIX8‐1 regulates organ size in soybean and is the causative gene for the major seed weight QTL qSw17‐1 | |
Qu et al. | The broad-spectrum blast resistance gene Pi9 encodes a nucleotide-binding site–leucine-rich repeat protein and is a member of a multigene family in rice | |
DK3011037T3 (en) | Resistance gene against rhizomania. | |
Zhang et al. | Fine mapping of fw3. 2 controlling fruit weight in tomato | |
WO2021143587A1 (en) | Methods of identifying, selecting, and producing disease resistant crops | |
CN103906839A (en) | Spl16 compositions and methods to increase agronomic performance of plants | |
CN112375130B (en) | Corn ear length gene and molecular marker and application thereof | |
CN111247244A (en) | Genes conferring resistance to fungal pathogens | |
BR122019002801B1 (en) | method for selecting a maize plant and method for identifying a transformed maize plant | |
Perry et al. | A comparison of the molecular organization of genomic regions associated with resistance to common bacterial blight in two Phaseolus vulgaris genotypes | |
WO2017013409A2 (en) | Modified plants | |
Cao et al. | Molecular characterization of a transcriptionally active Ty1/copia-like retrotransposon in Gossypium | |
Von Korff et al. | Asymmetric allele‐specific expression in relation to developmental variation and drought stress in barley hybrids | |
CN108642065B (en) | Rice endosperm aleurone related gene OsSecY2 and encoding protein and application thereof | |
Zhang et al. | Identification of the Q gene playing a role in spike morphology variation in wheat mutants and its regulatory network | |
Berg et al. | The amino acid permease (AAP) genes CsAAP2A and SlAAP5A/B are required for oomycete susceptibility in cucumber and tomato | |
Fang et al. | Analysis of allelic variants of RhMLO genes in rose and functional studies on susceptibility to powdery mildew related to clade V homologs | |
Wang et al. | Functional analysis and marker development of TaCRT-D gene in common wheat (Triticum aestivum L.) | |
Song et al. | Genome-wide analysis of nucleotide-binding site disease resistance genes in Medicago truncatula | |
Xie et al. | Overexpression of ARAhPR10, a member of the PR10 family, decreases levels of Aspergillus flavus infection in peanut seeds | |
EP1641921B1 (en) | Nod-factor perception | |
WO2021092173A1 (en) | Methods of identifying, selecting, and producing southern corn rust resistant crops | |
AU2018305727A1 (en) | Horizontal transfer of fungal genes into plants | |
Chen et al. | Production of the 14 kDa trypsin inhibitor protein is important for maize resistance against Aspergillus flavus infection/aflatoxin accumulation |