NZ501214A - Using adenovirus subgroup B vectors with deprived tissue tropism for liver cells provided by virus capsid - Google Patents

Using adenovirus subgroup B vectors with deprived tissue tropism for liver cells provided by virus capsid

Info

Publication number
NZ501214A
NZ501214A NZ501214A NZ50121499A NZ501214A NZ 501214 A NZ501214 A NZ 501214A NZ 501214 A NZ501214 A NZ 501214A NZ 50121499 A NZ50121499 A NZ 50121499A NZ 501214 A NZ501214 A NZ 501214A
Authority
NZ
New Zealand
Prior art keywords
adenovirus
seq
fiber
protein
genbank
Prior art date
Application number
NZ501214A
Inventor
Ronald Vogels
Menzo Jans Emco Havenga
Abraham Bout
Original Assignee
Introgene B
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Introgene B filed Critical Introgene B
Publication of NZ501214A publication Critical patent/NZ501214A/en

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/10011Adenoviridae
    • C12N2710/10311Mastadenovirus, e.g. human or simian adenoviruses
    • C12N2710/10322New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/10011Adenoviridae
    • C12N2710/10311Mastadenovirus, e.g. human or simian adenoviruses
    • C12N2710/10341Use of virus, viral particle or viral elements as a vector
    • C12N2710/10343Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/10011Adenoviridae
    • C12N2710/10311Mastadenovirus, e.g. human or simian adenoviruses
    • C12N2710/10341Use of virus, viral particle or viral elements as a vector
    • C12N2710/10345Special targeting system for viral vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2810/00Vectors comprising a targeting moiety
    • C12N2810/50Vectors comprising as targeting moiety peptide derived from defined protein
    • C12N2810/60Vectors comprising as targeting moiety peptide derived from defined protein from viruses
    • C12N2810/6009Vectors comprising as targeting moiety peptide derived from defined protein from viruses dsDNA viruses
    • C12N2810/6018Adenoviridae

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Health & Medical Sciences (AREA)
  • General Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Molecular Biology (AREA)
  • Zoology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Wood Science & Technology (AREA)
  • Virology (AREA)
  • Medicinal Chemistry (AREA)
  • Biotechnology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Cardiology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Physics & Mathematics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Plant Pathology (AREA)
  • Microbiology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Peptides Or Proteins (AREA)

Abstract

A gene therapy method, compounds and medicines are provided for wherein the target cell types are endothelial cells and/or smooth muscle cells. The gene delivery vehicle is provided with a peptide or protein with a tissue tropism for at least smooth muscle cells. The embodiments provide for a virus capsid, wherein the capsid comprises at least one adenovirus and a fragment from another different virus, preferable a subgroup B adenovirus. The treatment is suitable for treating cardiovascular diseases.

Description

New Zealand Paient Spedficaiion for Paient Number 501 214 50121 4 NEW ZEALAND PATENTS ACT, 1953 No: Date: COMPLETE SPECIFICATION GENE DELIVERY VECTORS PROVIDED WITH A TISSUE TROPISM FOR SMOOTH MUSCLE CELLS We, INTROGENE B.V., a Dutch company of Wassenaarseweg 72, 2333 AL Leiden, the Netherlands, do hereby declare the invention for which we pray that a patent may be granted to us, and the method by which it is to be performed, to be particularly described in and by the following statement: (followed by page -la-) intellectual property office of n.z. 1 9 jul 2001 RECEIVED la 50 <%, 'J Title: Gene delivery vectors provided with a tissue tropism for smooth muscle cells.
FIELD OF THE INVENTION The invention relates to the field of molecular genetics and medicine. In particular the present invention relates to the field of gene therapy, more in particular to 5 gene therapy using adenoviruses.
BACKGROUND OF THE INVENTION In gene therapy, genetic information is usually delivered to a host cell in order to either correct 10 (supplement) a genetic deficiency in said cell, or to inhibit an undesired function in said cell, or to eliminate said host cell. Of course the genetic information can also be intended to provide the host cell with a desired function, e.g. to supply a secreted protein to treat other 15 cells of the host, etc.
Many different methods have been developed to introduce new genetic information into cells. Although many different systems may work on cell lines cultured in vitro, only the 2 0 group of viral vector mediated gene delivery methods seems to be able to meet the required efficiency of gene transfer in vivo. Thus for gene therapy purposes most of the attention is directed toward the development of suitable viral vectors. Today, most of the attention for the 25 development of suitable viral vectors is directed toward those vectors that are based on adenoviruses. These adenovirus vectors can deliver foreign genetic information very efficiently to target cells in vivo. Moreover, obtaining large amounts of adenovirus vectors is for most 30 types of adenovirus vectors not a problem. Adenovirus vectors are relatively easy to concentrate and purify. Moreover, studies m clinical trials have provided valuable information on the use of these vectors in patients. intellectual property office of n.z. 1 9 jul 2001 RECEIVED 2 There are a lot of reasons for using adenovirus vectors for the delivery of nucleic acid to target cells in gene therapy protocols. However, some characteristics of the 5 current vectors limit their use in specific applications. For instance endothelial cells and smooth muscle cells are not easily transduced by the current generation of adenovirus vectors. For many gene therapy applications, such as applications in the cardiovascular area, preferably these 10 types of cells should be genetically modified. On the other hand, in some applications, even the very good in vivo delivery capacity of adenovirus vectors is not sufficient and higher transfer efficiencies are required. This is the case, for instance, when most cells of a target tissue need 15 to be transduced.
The present invention was made in the course of the manipulation of adenovirus vectors. In the following section therefore a brief introduction to adenoviruses is given.
Adenov iruses Adenoviruses contain a linear double-stranded DNA molecule of approximately 36000 base pairs. It contains identical Inverted Terminal Repeats (ITR) of approximately 25 90-140 base pairs with the exact length depending on the serotype. The viral origins of replication are within the ITRs exactly at the genome ends. The transcription units are divided in early and late regions. Shortly after infection the E1A and E1B proteins are expressed and function in 30 transactivation of cellular and adenoviral genes. The early regions E2A and E2B encode proteins (DNA binding protein, pre-terminal protein and polymerase) required for the replication of the adenoviral genome (reviewed in van der Vliet, 1995). The early region E4 encodes several proteins 35 with pleiotropic functions e.g. transactivation of the E2 early promoter, facilitating transport and accumulation of viral mRNAs in the late phase of infection and increasing nuclear stability of major late pre-mRNAs (reviewed in Leppard, 1997). The early region 3 encodes proteins that are involved in modulation of the immune response of the host (Wold et al, 1995). The late region is transcribed from one 5 single promoter (major late promoter) and is activated at the onset of DNA replication. Complex splicing and poly-adenylation mechanisms give rise to more than 12 RNA species coding for core proteins, capsid proteins (penton, hexon, fiber and associated proteins), viral protease and proteins 10 necessary for the assembly of the capsid and shut-down of host protein translation(Imperiale, M.J., Akusjnarvi, G. and Leppard, K.N. (1995) Post-transcriptional control of adenovirus gene expression. In: The molecular repertoire of adenoviruses I. P139-171. W. Doerfler and P. Bohm (eds), 15 Springer-Verlag Berlin Heidelberg).
Interaction between virus and host cell The interaction of the virus with the host cell has mainly been investigated with the serotype C viruses Ad2 and 20 Ad5. Binding occurs via interaction of the knob region of the protruding fiber with a cellular receptor. The receptor for Ad2 and Ad5 and probably more adenoviruses is known as the "Coxsackievirus and Adenovirus Receptor' or CAR protein (Bergelson et al, 1997). Internalization is mediated through 2 5 interaction of the RGD sequence present in the penton base with cellular integrins (Wickham et al, 1993). This may not be true for all serotypes, for example serotype 4 0 and 41 do not contain a RGD sequence in their penton base sequence (Kidd et al, 1993) .
The fiber protein The initial step for successful infection is binding of adenovirus to its target cell, a process mediated through fiber protein. The fiber protein has a trimeric structure 35 (Stouten et al, 1992) with different lengths depending on the virus serotype (Signas et al, 1985; Kidd et al, 1993). Different serotypes have polypeptides with structurally similar N and C termini, but different middle stem regions. The first 3 0 amino acids at the N terminus are involved in anchoring of the fiber to the penton base (Chroboczek et al, 1995), especially the conserved FNPVYP region in the tail (Arnberg et al, 1997). The C-terminus, or knob, is responsible for initial interaction with the cellular adenovirus receptor. After this initial binding secondary binding between the capsid penton base and cell-surface integrms leads to internalization of viral particles in coated pits and endocytosis (Morgan et al, 1969; Svensson and Persson, 1984; Varga et al, 1991; Greber et al, 1993; Wickham et al, 1993). Integrins are aP-heterodimers of which at least 14 a-subunits and 8 IS-subunits have been identified (Hynes, 1992). The array of integrins expressed in cells is complex and will vary between cell types and cellular environment. Although the knob contains some conserved regions, between serotypes, knob proteins show a high degree of variability, indicating that different adenovirus receptors exist.
Adenoviral serotypes At present, six different subgroups of human adenoviruses have been proposed which in total encompass approximately 50 distinct adenovirus serotypes. Besides these human adenoviruses, many animal adenoviruses have been identified (see e.g. Ishibashi and Yasue, 1984).
A serotype is defined on the basis of its immunological distinctiveness as determined by quantitative neutralization with animal antiserum (horse, rabbit). If neutralization shows a certain degree of cross-reaction between two viruses, distinctiveness of serotype is assumed if A) the hemagglutinins are unrelated, as shown by lack of cross-reaction on hemagglutination-inhibition, or B) substantial biophysical/biochemical differences in DNA exist (Francki et al, 1991). The serotypes identified last (42-49) were isolated for the first time from HIV infected patients (Hierholzer et al, 1988; Schnurr et al, 1993). For reasons not well understood, most of such immuno-compromised patients shed adenoviruses that were never isolated from immuno-competent individuals (Hierholzer et al, 1988, 1992; Khoo et al, 1995) .
Besides differences towards the sensitivity against neutralizing antibodies of different adenovirus serotypes, adenoviruses in subgroup C such as Ad2 and Ad5 bind to different receptors as compared to adenoviruses from subgroup B such as Ad3 and Ad7 (Defer et al, 1990; Gall et al, 1996). Likewise, it was demonstrated that receptor specificity could be altered by exchanging the Ad3 knob protein with the Ad 5 knob protein, and vice versa (Krasnykh et al, 1996; Stevenson et al, 1995, 1997) . Serotypes 2, 4,5 and 7 all have a natural affiliation towards lung epithelia and other respiratory tissues. In contrast, serotypes 40 and 41 have a natural affiliation towards the gastrointestinal tract. These serotypes differ in at least capsid proteins (penton-base, hexon), proteins responsible for cell binding (fiber protein), and proteins involved in adenovirus replication. It is unknown to what extend the capsid proteins determine the differences in tropism found between the serotypes. It may very well be that post-infection mechanisms determine cell type specificity of adenoviruses. It has been shown that adenoviruses from serotypes A (Adl2 and Ad31),C (Ad2 and Ad5),D (Ad9 and Adl5),E (Ad4) and F (Ad41) all are able to bind labeled, soluble CAR (sCAR) protein when immobilized on nitrocellulose. Furthermore, binding of adenoviruses from these serotypes to Ramos cells, that express high levels of CAR but lack integrins (Roelvink et al, 1996), could be efficiently blocked by addition of sCAR to viruses prior to infection (Roelvink et al, 1998). However, the fact that (at least some) members of these subgroups are able to bind CAR does not exclude that these viruses have different infection efficiencies in various cell types. For example subgroup D serotypes have relatively short fiber shafts compared to subgroup A and C viruses. It 5 has been postulated that the tropism of subgroup D viruses is to a large extend determined by the penton base binding to integrins (Roelvink et al, 1996; Roelvink et al, 1998). Another example is provided by Zabner et al, 1998 who have tested 14 different serotypes on infection of human ciliated 10 airway epithelia (CAE) and found that serotype 17 (subgroup D) was bound and internalized more efficiently then all other viruses, including other members of subgroup D.
Similar experiments using serotypes from subgroup A-F in primary fetal rat cells showed that adenoviruses from 15 subgroup A and B were inefficient whereas viruses from subgroup D were most efficient (Law et al, 1998). Also in this case viruses within one subgroup displayed different efficiencies. The importance of fiber binding for the improved infection of Adl7 m CAE was shown by Armentano et 20 al (WO 98/22609) who made a recombinant LacZ Ad2 virus with a fiber gene from Adl7 and showed that the chimaeric virus infected CAE more efficient then LacZ Ad2 viruses with Ad2 fibers.
Thus despite their shared ability to bind CAR, 25 differences in the length of the fiber, knob sequence and other capsid proteins e.g. penton base of the different serotypes may determine the efficiency by which an adenovirus infects a certain target cell. Of interest in this respect is the ability of Ad5 and Ad2 fibers but not of 30 Ad3 fibers to bind to fibronectin III and MHC class 1 a.2 derived peptides. This suggests that adenoviruses are able to use cellular receptors other than CAR (Hong et al, 1997). Serotypes 40 and 41 (subgroup F) are known to carry two fiber proteins differing in the length of the shaft. The 35 long shafted 41L fiber is shown to bind CAR whereas the short shafted 41S is not capable of binding CAR (Roelvink et al, 1998). The receptor for the short fiber is not known.
Adenoviral gene delivery vectors 5 Most adenoviral gene delivery vectors currently used in gene therapy are derived from the serotype C adenoviruses Ad2 or Ad5. The vectors have a deletion in the El region, where novel genetic information can be introduced. The El deletion renders the recombinant virus replication 10 defective. It has been demonstrated extensively that recombinant adenovirus, in particular serotype 5 is suitable for efficient transfer of genes in vivo to the liver, the airway epithelium and solid tumors in animal models and human xenografts in immuno-deficient mice (Bout 199S, 1997; 15 Blaese et al, 1995).
Gene transfer vectors derived from adenoviruses (adenoviral vectors) have a number of features that make them particularly useful for gene transfer: 1) the biology of the adenoviruses is well characterized, 2) the adenovirus is not associated with severe human pathology, 3) the virus is extremely efficient in introducing its DNA into the host cell, 4) the virus can infect a wide variety of cells and has a broad host-range, ) the virus can be produced at high titers in large quantities, 6) and the virus can be rendered replication defective by 30 deletion of the early-region 1 (El) of the viral genome (Brody and Crystal, 1994).
However, there is still a number of drawbacks associated with the use of adenoviral vectors: W 8 1) Adenoviruses, especially the well investigated serotypes Ad2 and Ad5 usually elicit an immune response by the host into which they are introduced, 2) it is currently not feasible to target the virus to 5 certain cells and tissues, 3) the replication and other functions of the adenovirus are not always very well suited for the cells, which are to be provided with the additional genetic material, 4) the serotypes Ad2 or Ad5, are not ideally suited for delivering additional genetic material to organs other than the liver. The liver can be particularly well transduced with vectors derived from Ad2 or Ad5. Delivery of such vectors via the bloodstream leads to a significant deliver of the vectors to the cells of the liver. In therapies were 15 other cell types then liver cells need to be transduced some means of liver exclusion must be applied to prevent uptake of the vector by these cells. Current methods rely on the physical separation of the vector from the liver cells, most of these methods rely on localizing the vector and/or the 2 0 target organ via surgery, balloon angioplasty or direct injection into an organ via for instance needles. Liver exclusion is also being practiced through delivery of the vector to compartments in the body that are essentially isolated from the bloodstream thereby preventing transport 25 of the vector to the liver. Although these methods mostly succeed in avoiding gross delivery of the vector to the liver, most of the methods are crude and still have considerable leakage and/or have poor target tissue penetration characteristics. In some cases inadvertent 30 delivery of the vector to liver cells can be toxic to the patient. For instance, delivery of a herpes simplex virus (HSV) thymidine kinase (TK) gene for the subsequent killing of dividing cancer cells through administration of gancyclovir is quite dangerous when also a significant 35 amount of liver cells are transduced by the vector.
Significant delivery and subsequent expression of the HSV-TK gene to liver cells is associated with severe toxicity. Thus 9 there is a discrete need for an inherently safe vector provided with the property of a reduced transduction efficiency of liver cells.
BRIEF DESCRIPTION OF DRAWINGS Table I: Oligonucleotides and degenerate oligonucleotides used for the amplification of DNA encoding fiber proteins derived from alternative adenovirus serotypes. (Bold 10 letters represent Ndel restriction site (A-E), Nsil restriction site (1-6, 8), or PacI restriction site, (7). Table II: Biodistribution of chimeric adenovirus upon intravenous tail vein injection. Values represent luciferase activity/ |u.g of total protein. All values below 15 200 Relative light units/ jag protein are considered background. ND = not determined Table III: Expression of CAR and integrins on the cell surface of endothelial cells and smooth muscle cells. 70%: Cells harvested for FACS analysis at a cell density of 70% 20 confluency. 100%: Cells harvested for FACS analysis at a cell density of 100% confluency. PER.C6 cells were taken as a control for antibody staining. Values represent percentages of cells that express CAR or either one of the integrins at levels above background. As background 2 5 control, HUVECs or HUVsmc were incubated only with the secondary, rat-anti-mouse IgGl-PE labeled antibody.
Table IV: Determination of transgene expression (luciferase activity) per ^g of total cellular protein after infection of A549 cells.
Figure 1: Schematic drawing of the pBr/Ad.Bam-rlTR construct. Figure 2: Schematic drawing of the strategy used to delete the fiber gene from the pBr/Ad.Bam-rlTR construct.
Figure 3: Schematic drawing of construct pBr/Ad.BamRAfib. 35 Figure 4: Sequences of the chimaeric fibers Ad5/12, Ad5/16, Ad5/28, and Ad5/40-L.
Figure 5: Schematic drawing of the construct pClipsal-Luc.
Figure 6: Schematic drawing of the method to generate chimaeric adenoviruses using three overlapping fragments. Early (E) and late regions (L) are indicated. L5 is the fiber coding sequence.
Figure 7: A) Infection of HUVEC cells using different amounts of virus particles per cell and different fiber chimeric adenoviruses. Virus concentration: 10000 vp/ cell (= white bar), 5000 vp/ cell (= grey bar), 2500 vp/ cell (= Black bar) 1000 vp/ cell (light grey bar, 250 and 50 vp/ cell no detectable luciferase activity above background.
Luciferase activity is expressed in relative light units (RLU) per microgram cellular protein. B) Infection of HUVEC cells using different concentrations of cells (22500, 45000, 90000, or 135000 cells seeded per well) and either adenovirus serotype 5 (black bar) or the fiber 16 chimeric adenovirus (white bar). Luciferase activity is expressed in relative light units (RLU) per microgram cellular protein. C) Flow cytometric analysis on Human aorta EC transduced with 500 (Black bar) or 5000 (grey bar) virus particles per cell of Ad5 or the fiber 16 chimeric virus (Fibl6). Non-infected cells were used to set the background at 1% and a median fluorescence of 5.4. The maximum shift in the median fluorescence that can be observed on a flow cytometer is 9999. This latter indicates that at 5000 vp/ cell both Ad5 and Fibl6 are outside the sensitivity scale of the flow cytometer.
Figure 8: A) Infection of HUVsmc cells using different amounts of virus particles per cell and different fiber mutant Ad5 based adenoviruses. Virus concentration: 5000 vp/ cell (= white bar), 2500 vp/ cell (= grey bar), 1250 vp/ cell (= dark grey bar), 250 vp/ cell (= black bar), or 50 vp/ cell (light grey bar). Luciferase activity is expressed as relative light units (RLU) per microgram cellular protein. B) Infection of HUVsmc cells using different concentrations of cells (10000, 20000, 40000, 60000, or 80000 cells per well) and either adenovirus 11 serotype 5 (white bars) or the fiber 16 chimeric adenovirus (black bars) . A plateau is observed after infection with chimeric fiber 16 adenovirus due to the fact that transgene expression is higher than the sensitivity range of the bioluminimeter used. C) Human umbilical vein SMC transduced with 500 VP/ cell (black bar) or 5000 VP/ cell (grey bar) using either Ad5 or the fiber 16 mutant (Fibl6). Non-transduced cells were used to set a background median fluorescence of approximately 1. Shown is the median fluorescence of GFP expression as measured by flow cytometry. D) HUVsmc were infected with 312 (light grey bar), 625 (grey bar), 1250 (black bar), 2500 (dark grey bar), 5000 (light grey bar), or 10000 (white bar) virus particles per cell of either the fiber 11, 16, 35, or 51 chimeric virus. Luciferase transgene expression expressed as relative light units (RLU) per microgram protein was measured 4 8 hours after virus exposure. E) Macroscopic photographs of LacZ staining on saphenous samples. Nuclear targeted LacZ (ntLacZ) yields a deep blue color which appears black or dark grey in non-color prints. F) Macroscopic photographs of LacZ staining on pericard samples. Nuclear targeted LacZ (ntLacZ) gives a deep blue color which appears black in non-color prints G) Macroscopic photographs of LacZ staining on right coronary artery samples. Nuclear targeted LacZ (ntLacZ) gives a deep blue color which appears black in non-color prints H) LacZ staining on Left artery descending (LAD) samples. Nuclear targeted LacZ (ntLacZ) gives a deep blue color which appears black in non-color prints Figure 9: Sequences including the gene encoding adenovirus 16 fiber protein as published in Genbank and sequences including a gene encoding a fiber from an adenovirus 16 variant as isolated in the present invention, wherein the sequences of the fiber protein are from the Ndel-site. Figure 9A nucleotide sequence comparison. Figure 9B amino-acid comparison. 12 SUMMARY OF THE INVENTION INTELLECTUAL PROPERTY OFFICE OF N.Z. 2 3 nov 2001 RECEIVED The present invention provides gene therapy methods, compounds and medicines. The present invention is particularly useful in gene therapy applications where 5 endothelial cells and /or smooth muscle cells form the target cell type. The present invention relates to gene delivery vehicles provided with a peptide or protein with a tissue tropism for at least smooth muscle cells. The present invention further relates to gene delivery vehicles having 10 been deprived of a tissue tropism for liver cells.
DETAILED DESCRIPTION OF THE INVENTION.
It is an object of the current invention to provide materials and methods to overcome the limitations of 15 adenoviral vectors mentioned above. In a broad sense, the invention provides new adenoviruses, derived in whole or in part from serotypes different from Ad5. Specific genes of serotypes with preferred characteristics may be combined in a chimaeric vector to give rise to a vector that is better 20 suited for specific applications. Preferred characteristics include, but are not limited to, improved infection of a specific target cell, reduced infection of non-target cells, improved stability of the virus, reduced uptake in antigen presenting cells (APC), or increased uptake in APC, reduced 25 toxicity to target cells, reduced neutralization in humans or animals, reduced or increased CTL response in humans or animals, better and/or prolonged transgene expression, increased penetration capacity in tissues, improved yields in packaging cell lines, etc.
One aspect of the present invention facilitates the combination of the low immunogenicity of some adenoviruses with the characteristics of other adenoviruses that allow efficient gene therapy. Such characteristics may be a high 13 specificity for certain host cells, a good replication machinery for certain cells, a high rate of infection in certain host cells, low infection efficiency in non-target cells, high or low efficiency of APC infection, etc. The invention thus may provide chimaeric adenoviruses having the useful properties of at least two adenoviruses of different serotypes.
Typically, two or more requirements from the above non-exhaustive list are required to obtain an adenovirus capable of efficiently transferring genetic material to a host cell. Therefore the present invention provides adenovirus derived vectors which can be used as cassettes to insert different adenoviral genes from different adenoviral serotypes at the required sites. This way one can obtain a vector capable of producing a chimaeric adenovirus, whereby of course also a gene of interest can be inserted (for instance at the site of El of the original adenovirus). In this manner the chimaeric adenovirus to be produced can be adapted to the requirements and needs of certain hosts in need of gene therapy for certain disorders. To enable this virus production, a packaging cell will generally be needed in order to produce sufficient amount of safe chimaeric adenoviruses.
In one of its aspects the present invention provides adenoviral vectors comprising at least a fragment of a fiber protein of an adenovirus from subgroup B. Said fiber protein may be the native fiber protein of the adenoviral vector or may be derived from a serotype different from the serotype the adenoviral vector is based on. In the latter case the adenoviral vector according to the invention is a chimaeric adenovirus displaying at least a fragment of the fiber protein derived from subgroup B adenoviruses that fragment comprising at least the receptor binding sequence. Typically such a virus will be produced using a vector (typically a plasmid, a cosmid or baculovirus vector). Such vectors are also subject of the present invention. A preferred vector is a vector that can be used to make a chimaeric recombinant virus specifically adapted to the host to be treated and the disorder to be treated.
The present invention also provides a chimaeric adenovirus based on adenovirus type 5 but having at least a fragment of 5 the fiber sequence from adenovirus type 16, whereby the fragment of the fiber of Adl6 comprises the fragment of the fiber protein that is involved in binding a host cell. The present invention also provides chimaeric adenoviral vectors that show improved infection as compared to 10 adenoviruses from other subgroups in specific host cells for example, but not limited to, endothelial cells and smooth muscle cells of human or animal origin. An important feature of the present invention is the means to produce the chimaeric virus. Typically, one does not want an adenovirus 15 batch to be administered to the host cell, which contains replication competent adenovirus. In general therefore it is desired to omit a number of genes (but at least one) from the adenoviral genome on the vector encoding the chimaeric virus and to supply these genes in the genome of the cell in 2 0 which the vector is brought to produce chimaeric adenovirus.
Such a cell is usually called a packaging cell. The invention thus also provides a packaging cell for producing a chimaeric adenovirus according to the invention, comprising in trans all elements necessary for adenovirus 25 production not present on the adenoviral vector according to the invention. Typically vector and packaging cell have to be adapted to one another in that they have all the necessary elements, but that they do not have overlapping elements which lead to replication competent virus by 3 0 recombination. Thus the invention also provides a kit of parts comprising a packaging cell according to the invention and a recombinant vector according the invention whereby there is essentially no sequence overlap leading to recombination resulting in the production of replication 35 competent adenovirus between said cell and said vector. For certain applications for example when the therapy is aimed at eradication of tumor cells, the adenoviral vector according to the invention may be replication competent or capable of replicating under certain conditions for example in specific cell types like tumor cells or tumor endothelial cells.
It is within the scope of the invention to insert more genes, or a functional part of these genes from the same or other serotypes into the adenoviral vector replacing the corresponding native sequences. Thus for example replacement of (a functional part of the) fiber sequences with 10 corresponding sequences of other serotypes may be combined with for example replacements of (a functional part of) other capsid genes like penton base or hexon with corresponding sequences of said serotype or of other distinct serotypes. Persons skilled in the art understand 15 that other combinations not limited to the said genes are possible and are within the scope of the invention. The chimaeric adenoviral vector according to the invention may originate from at least two different serotypes. This may provide the vector with preferred characteristics such as 20 improved infection of target cells and/or less infection of non-target cells, improved stability of the virus, reduced immunogenicity in humans or animals (e.g. reduced uptake in APC, reduced neutralization in the host and/or reduced cytotoxic T-lymphocyte (CTL) response), increased 25 penetration of tissue, better longevity of transgene expression, etc. In this aspect it is preferred to use capsid genes e.g. penton and/or hexon genes from less immunogenic serotypes as defined by the absence or the presence of low amounts of neutralizing antibodies in the 3 0 vast majority of hosts. It is also preferred to use fiber and/or penton sequences from serotypes that show improved binding and internalization in the target cells. Furthermore it is preferred to delete from the viral vector those genes which lead to expression of adenoviral genes in the target 35 cells. In this aspect a vector deleted of all adenoviral genes is also preferred. Furthermore it is preferred that 16 the promoter driving the gene of interest to be expressed in the target cells is a cell type specific promoter.
In order to be able to precisely adapt the viral vector and provide the chimaeric virus with the desired properties at will, it is preferred that a library of adenoviral genes is provided whereby the genes to be exchanged are located on plasmid- or cosmid-based adenoviral constructs whereby the genes or the sequences to be exchanged are flanked by restriction sites. The preferred genes or sequences can be selected from the library and inserted in the adenoviral constructs that are used to generate the viruses. Typically such a method comprises a number of restriction and ligation steps and transfection of a packaging cell. The adenoviral vector can be transfected in one piece, or as two or more overlapping fragments, whereby viruses are generated by homologous recombination. For example the adenoviral vector may be built up from two or more overlapping sequences for insertion or replacements of a gene of interest in for example the El region, for insertion or replacements in penton and/or hexon sequences, and for insertions or replacements into fiber sequences. Thus the invention provides a method for producing chimaeric adenoviruses having one or more desired properties like a desired host range and diminished antigenicity, comprising providing one or more vectors according to the invention having the desired insertion sites, inserting into said vectors at least a functional part of a fiber protein derived from an adenovirus serotype having the desired host range and/or inserting a functional part of a capsid protein derived from an adenovirus serotype having relatively low antigenicity and transfecting said vectors in a packaging cell according to the invention and allowing for production of chimaeric viral particles. Of course other combinations of other viral genes originating from different serotypes can also be inserted as disclosed herein before. Chimaeric viruses having only one non-native sequence in addition to an insertion or replacement of a gene of interest in the El region, are also within the scope of the invention. An immunogenic response to adenovirus that typically occurs is the production of neutralizing antibodies by the host.
This is typically a reason for selecting a capsid protein like penton, hexon and/or fiber of a less immunogenic serotype.
Of course it may not be necessary to make chimaeric adenoviruses which have complete proteins from different serotypes. It is well within the skill of the art to produce chimaeric proteins, for instance in the case of fiber proteins it is very well possible to have the base of one serotype and the shaft and the knob from another serotype. In this manner it becomes possible to have the parts of the protein responsible for assembly of viral particles originate from one serotype, thereby enhancing the production of intact viral particles. Thus the invention also provides a chimaeric adenovirus according to the invention, wherein the hexon, penton, fiber and/or other 2 0 capsid proteins are chimaeric proteins originating from different adenovirus serotypes. Besides generating chimaeric adenoviruses by swapping entire wild type capsid (protein) genes etc. or parts thereof, it is also within the scope of the present invention to insert capsid (protein) genes etc. carrying non-adenoviral sequences or mutations such as point mutations, deletions, insertions, etc. which can be easily screened for preferred characteristics such as temperature stability, assembly, anchoring, redirected infection, altered immune response etc. Again other chimaeric 3 0 combinations can also be produced and are within the scope of the present invention.
It has been demonstrated in mice and rats that upon in vivo systemic delivery of recombinant adenovirus of common used 3 5 serotypes for gene therapy purposes more than 90% of the virus is trapped in the liver (Herz et al, 1993; Kass-Eisler et al, 1994; Huard et al, 1995) . It is also known that human hepatocytes are efficiently transduced by adenovirus serotype 5 vectors (Castell, J.V., Hernandez, D. Gomez-Foix, A.M., Guillen, I, Donato, T. and Gomez-Lechon, M.J. (1997). Adenovirus-mediated gene transfer into human hepatocytes: analysis of the biochemical functionality of transduced cells. Gene Ther. 4(5), p455-464). Thus in vivo gene therapy by systemic delivery of Ad2 or Ad5 based vectors is seriously hampered by the efficient uptake of the viruses in the liver leading to unwanted toxicity and less virus being available for transduction of the target cells. Therefore, alteration of the adenovirus serotype 5 host cell range to be able to target other organs in vivo is a major interest of the invention.
To obtain re-directed infection of recombinant adenovirus serotype 5, several approaches have been or still are under investigation. Wickham et al have altered the RGD (Arg, Gly, Asp) motif in the penton base which is believed to be responsible for the avP3 and avPs integrin binding to the penton base. They have replaced this RGD motif by another peptide motif which is specific for the (X4P1 receptor. In this way targeting the adenovirus to a specific target cell could be accomplished (Wickham et al, 1995). Krasnykh et al (1998) have made use of the HI loop available in the knob. This loop is, based on X-ray crystallography, located on the outside of the knob trimeric structure and therefore is thought not to contribute to the intramolecular interactions in the knob. Insertion of a FLAG coding sequence into the HI loop resulted in fiber proteins that were able to trimerise and it was further shown that viruses containing the FLAG sequence in the knob region could be made. Although interactions of the FLAG-containing knob with CAR are not changed, insertion of ligands in the HI loop may lead to retargeting of infection. Although successful introduction 19 of changes in the adenovirus serotype 5 fiber and penton-base have been reported, the complex structure of knob and the limited knowledge of the precise amino acids interacting with CAR render such targeting approaches laborious and 5 difficult. The use of antibodies binding to CAR and to a specific cellular receptor has also been described (Wickham et al, 1996; Rogers et al, 1997). This approach is however limited by the availability of a specific antibody and by the complexity of the gene therapy product.
To overcome the limitations described above we used preexisting adenovirus fibers, penton base proteins, hexon proteins or other capsid proteins derived from other adenovirus serotypes. By generating chimaeric adenovirus serotype 5 libraries containing structural proteins of 15 alternative adenovirus serotypes, we have developed a technology, which enables rapid screening for a recombinant adenoviral vector with preferred characteristics.
The present invention provides methods for the generation of chimaeric capsids which can be targeted to specific cell types in vitro as well as in vivo, and thus have an altered tropism for certain cell types. It is a further object of the present invention to provide methods and means by which an adenovirus or an adenovirus capsid can 25 be used as a protein or nucleic acid delivery vehicle to a specific cell type or tissue.
The generation of chimaeric adenoviruses based on adenovirus serotype 5 with modified late genes is described. For this purpose, three plasmids, which together contain the complete 3 0 adenovirus serotype 5 genome, were constructed. From one of these plasmids part of the DNA encoding the adenovirus serotype 5 fiber protein was removed and replaced by linker DNA sequences that facilitate easy cloning. This plasmid subsequently served as template for the insertion of DNA 35 encoding fiber protein derived from different adenovirus serotypes. The DNA sequences derived from the different INTELLECTUAL PROPERTY OFFICE OF N.Z. 1 9 jul 2001 RECEIVED serotypes were obtained using the polymerase chain reaction technique in combination with (degenerate) oligonucleotides. At the former El location in the genome of adenovirus serotype 5, any gene of interest can be cloned. A single 5 transfection procedure of the three plasmids together results in the formation of a recombinant chimaeric adenovirus. Alternatively, cloning of the sequences obtained from the library of genes can be such that the chimaeric adenoviral vector is build up from one or two fragments. For 10 example one construct contains at least the left ITR and sequences necessary for packaging of the virus, an expression cassette for the gene of interest and sequences overlapping with the second construct comprising all sequences necessary for replication and virus formation not 15 present in the packaging cell as well as the non-native sequences providing the preferred characteristics. This new technology of libraries consisting of chimaeric adenoviruses thus allows for a rapid screening for improved recombinant adenoviral vectors for in vitro and in vivo gene therapy 2 0 purposes.
The use of adenovirus type 5 for in vivo gene therapy is limited by the apparent inability to infect certain cell types e.g. human endothelial cells and smooth muscle cells 2 5 and the preference of infection of certain organs e.g. liver and spleen. Specifically this has consequences for treatment of cardiovascular diseases like restenosis and pulmonary hypertension. Adenovirus-mediated delivery of human ceNOS (constitutive endothelial nitric oxide synthase) has been 3 0 proposed as treatment for restenosis after percutaneous transluminal coronary angioplasty (PTCA). Restenosis is characterized by progressive arterial remodeling, extracellular matrix formation and intimal hyperplasia at the site of angioplasty (Schwartz et al, 1993; Carter et al, 35 1994; Shi et al,1996). NO is one of the vasoactive factors shown to be lost after PTCA-induced injury to the endothelial barrier (Lloyd Jones and Bloch, 1996). Thus restoration of NO levels after balloon-induced injury by means of adenoviral delivery of ceNOS may prevent restenosis (Varenne et al, 1998). Other applications for gene therapy whereby the viruses or chimaeric viruses according to the invention are superior to Ad2 or Ad5 based viruses, given as non-limiting examples, are production of proteins by endothelial cells that are secreted into the blood, treatment of hypertension, preventive treatment of stenosis during vein grafting, angiogenesis, heart failure, renal hypertension and others.
In one embodiment this invention describes adenoviral vectors that are, amongst others, especially suited for gene delivery to endothelial cells and smooth muscle cells important for treatment of cardiovascular disorders. The adenoviral vectors preferably are derived from subgroup B adenoviruses or contain at least a functional part of the fiber protein from an adenovirus from subgroup B comprising at least the cell-binding moiety of the fiber protein. In a further preferred embodiment the adenoviral vectors are chimaeric vectors based on adenovirus type 5 and contain at least a functional part of the fiber protein from adenovirus type 16.
In another embodiment this invention provides adenoviral vectors or chimaeric adenoviral vectors that escape the liver following systemic administration. Preferably these adenoviral vectors are derived from subgroup A, B, D, or F in particular serotypes 12, 16, 28 and 40 or contain at least the cell-binding moiety of the fiber protein derived from said adenoviruses.
It is to be understood that in all embodiments the adenoviral vectors may be derived from the serotype having the desired properties or that the adenoviral vector is based on an adenovirus from one serotype and contains the sequences comprising the desired functions of another 22 serotype, these sequences replacing the native sequences in the said serotype.
In another aspect this invention describes chimaeric 5 adenoviruses and methods to generate these viruses that have an altered tropism different from that of adenovirus serotype 5. For example, viruses based on adenovirus serotype 5 but displaying any adenovirus fiber existing in nature. This chimaeric adenovirus 10 serotype 5 is able to infect certain cell types more efficiently, or less efficiently in vitro and in vivo than the adenovirus serotype 5. Such cells include but are not limited to endothelial cells, smooth muscle cells, dendritic cells, neuronal cells, glial cells, 15 synovical cells, lung epithelial cells, hemopoietic stem cells, monocytic/macrophage cells, tumor cells, skeletal muscle cells, mesothelial cells, synoviocytes, etc. 2 0 In another aspect the invention describes the construction and use of libraries consisting of distinct parts of adenovirus serotype 5 in which one or more genes or sequences have been replaced with DNA derived from alternative human or animal serotypes. This set of 25 constructs, in total encompassing the complete adenovirus genome, allows for the construction of unique chimaeric adenoviruses customized for a certain disease, group of patients or even a single individual.
In all aspects of the invention the chimaeric adenoviruses 3 0 may, or may not, contain deletions in the El region and insertions of heterologous genes linked either or not to a promoter. Furthermore, chimaeric adenoviruses may, or may not, contain deletions in the E3 region and insertions of heterologous genes linked to a promoter. Furthermore, 3 5 chimaeric adenoviruses may, or may not, contain deletions in the E2 and/or E4 region and insertions of heterologous genes 23 linked to a promoter. In the latter case E2 and/or E4 complementing cell lines are required to generate recombinant adenoviruses. In fact any gene in the genome of the viral vector can be taken out and supplied in trans. Thus, in the extreme situation, chimaeric viruses do not contain any adenoviral genes in their genome and are by definition minimal adenoviral vectors. In this case all adenoviral functions are supplied in trans using stable cell lines and/or transient expression of these genes. A method for producing minimal adenoviral vectors is described m W097/00326 and is taken as reference herein. In another case Ad/AAV chimaeric molecules are packaged into the adenovirus capsids of the invention. A method for producing Ad/AAV chimaeric vectors is described in EP 1 042 494 and is taken as reference herein. In principle any nucleic acid may be provided with the adenovirus capsids of the invention.
The invention provides a gene delivery vehicle having been provided with at least a tissue tropism for smooth muscle cells.
Preferably, said gene delivery vehicle is provided with a tissue tropism for at least smooth muscle cells and deprived of a tissue tropism for at least liver cells. In a preferred embodiment of the invention said gene delivery vehicle is provided with a tissue tropism for at least smooth muscle cells and deprived of a tissue tropism for at least liver cells using a fiber protein derived from a subgroup B adenovirus, preferably of adenovirus 16. In a preferred aspect of the invention said gene delivery vehicle comprises a virus capsid. Preferably said virus capsid comprises a virus capsid derived in whole or in part from an adenovirus of subgroup B, preferably from adenovirus 16, or it comprises proteins, or parts thereof, from an adenovirus of subgroup B, preferably of adenovirus 16. In preferred embodiment of the invention INTELLECTUAL PROPERTY OFFICE OF N.Z. 1 9 jul 2001 said virus capsid comprises proteins, or fragments thereof, from at least two different viruses, preferably adenoviruses. In a preferred embodiment of this aspect of the invention at least one of said virus is an adenovirus of subgroup B, 5 preferably adenovirus 16.
In a preferred embodiment of the invention said gene delivery vehicle comprises an adenovirus fiber protein or fragments thereof. Said fiber protein is preferably derived from an adenovirus of subgroup B, preferably of adenovirus 16. Said 10 gene delivery vehicle may further comprise other fiber proteins, or fragments thereof, from other adenoviruses. Said gene delivery vehicle may or may not comprise other adenovirus proteins. Nucleic acid may be linked directly to fiber proteins, or fragments thereof, but may also be linked 15 indirectly. Examples of indirect linkages include but are not limited to, packaging of nucleic acid into adenovirus capsids or packaging of nucleic acid into liposomes, wherein a fiber protein, or a fragment thereof, is incorporated into an adenovirus capsid or linked to a liposome. Direct linkage of 20 nucleic acid to a fiber protein, or a fragment thereof, may be performed when said fiber protein, or a fragment thereof, is not part of a complex or when said fiber protein, or a fragment thereof, is part of complex such as an adenovirus capsid.
In one embodiment of the invention is provided a gene delivery vehicle comprising an adenovirus fiber protein wherein said fiber protein comprises a tissue determining fragment of an adenovirus of subgroup B adenovirus preferably of adenovirus 16. Adenovirus fiber protein comprises three 3 0 functional domains. One domain, the base, is responsible for anchoring the fiber to a penton base of the adenovirus capsid. Another domain, the knob, is responsible for receptor recognition whereas the shaft domain functions as a spacer separating the base from the knob. The different domains may 3 5 also have other function. For instance, the shaft is presumably also involved in target cell specificity. Each of the domains mentioned above may be used to define a fragment of a fiber. However, fragments may also be identified in another way. For instance the knob domain comprises of a receptor binding fragment and a shaft binding fragment. The base domain comprises of a penton base binding fragment and a 5 shaft binding fragment. Moreover, the shaft comprises of repeated stretches of amino acids. Each of these repeated stretches may be a fragment.
A tissue tropism determining fragment of a fiber protein may be a single fragment of a fiber protein or a combination of 10 fragments of at least one fiber protein, wherein said tissue tropism determining fragment, either alone or in combination with a virus capsid, determines the efficiency with which a gene delivery vehicle can transduce a given cell or cell type, preferably but not necessarily in a positive way. With 15 a tissue tropism for liver cells is meant a tissue tropism for cells residing in the liver, preferably liver parenchyma cells.
A tissue tropism for a certain tissue may be provided by increasing the efficiency with which cells of said tissue are 20 transduced, alternatively, a tissue tropism for a certain tissue may be provided by decreasing the efficiency with which other cells than the cells of said tissue are transduced.
Fiber proteins possess tissue tropism determining properties. The most well described fragment of the fiber protein involved in tissue tropism is the knob domain. However, the shaft domain of the fiber protein also possesses tissue 30 tropism determining properties. However, not all of the tissue tropism determining properties of an adenovirus capsid are incorporated into a fiber protein.
In a preferred embodiment of the invention, a fiber protein derived from a subgroup B adenovirus, preferably adenovirus 35 16, is combined with the non-fiber capsid proteins from an adenovirus of subgroup C, preferably of adenovirus 5.
In one aspect of the invention is provided a gene delivery-vehicle comprising a nucleic acid derived from an adenovirus. In a preferred embodiment of the invention said adenovirus nucleic acid comprises at least one nucleic acid sequence 5 encoding a fiber protein comprising at least a tissue tropism determining fragment of a subgroup B adenovirus fiber protein, preferably of adenovirus 16. In a preferred aspect said adenovirus comprises nucleic acid from at least two different adenoviruses. In a preferred aspect said adenovirus 10 comprises nucleic acid from at least two different adenoviruses wherein at least one nucleic acid sequence encoding a fiber protein comprising at least a tissue tropism determining fragment of a subgroup B adenovirus fiber protein, preferably of adenovirus 16.
In a preferred embodiment of the invention said adenovirus nucleic acid is modified such that the capacity of said adenovirus nucleic acid to replicate in a target cell has been reduced or disabled. This may be achieved through inactivating or deleting genes encoding early region 1 20 proteins.
In another preferred embodiment said adenovirus nucleic acid is modified such that the capacity of a host immune system to mount an immune response against adenovirus proteins encoded by said adenovirus nucleic acid has been reduced or disabled. 25 This may be achieved through deletion of genes encoding proteins of early region 2 and/or early region 4. Alternatively, genes encoding early region 3 proteins, may be deleted, or on the contrary, considering the anti-immune system function of some of the proteins encoded by the genes 3 0 in early region 3, the expression of early region 3 proteins may be enhanced for some purposes. Also, the adenovirus nucleic acid may be altered by a combination of two or more of the specific alterations of the adenovirus nucleic acid mentioned above. It is clear that when essential genes are 3 5 deleted from the adenovirus nucleic acid, the genes must be complemented in the cell that is going to produce the adenovirus nucleic acid, the adenovirus vector, the vehicle or the chimaeric capsid. The adenovirus nucleic acid may also be modified such that the capacity of a host immune system to mount an immune response against adenovirus proteins encoded by said adenovirus nucleic acid has been reduced or disabled, 5 in other ways then mentioned above, for instance through exchanging capsid proteins, or fragments thereof, by capsid proteins, or fragments thereof, from other serotypes for which humans do not have, or have low levels of, neutralizing antibodies. Another example of this is the exchange of genes 10 encoding capsid proteins with the genes encoding for capsid proteins from other serotypes. Also capsid proteins, or fragments thereof, may be exchanged for other capsid proteins, or fragments thereof, for which individuals are not capable of, or have a low capacity of, raising an immune 15 response against.
An adenovirus nucleic acid may be altered further or instead of one or more of the alterations mentioned above, by inactivating or deleting genes encoding adenovirus late 20 proteins such as but not-limited to, hexon, penton, fiber and/or protein IX.
In a preferred embodiment of the invention all genes encoding adenovirus proteins are deleted from said adenovirus nucleic acid, turning said nucleic acid into a minimal adenovirus 25 vector.
In another preferred embodiment of the invention said adenovirus nucleic acid is an Ad/AAV chimaeric vector, wherein at least the integration means of an adeno-associated virus (AAV) are incorporated into said adenovirus nucleic 30 acid.
In a preferred embodiment of the invention, a vector or a nucleic acid, which may be one and the same or not, according to the invention further comprises at least one non-adenovirus gene. Preferably, at least one of said non-35 adenovirus gene is selected from the group of genes encoding: an apolipoprotein, a ceNOS, a herpes simplex virus thymidine kinase, an interleukin-3, an interleukin-la, an 28 (anti)angiogenesis protein such as angiostatin, an anti-proliferation protein, a vascular endothelial growth factor (VGAF), a basic fibroblast growth factor (bFGF),a hypoxia inducible factor la (HIF-la), a PAI-1 or a smooth muscle cell anti-migration protein.
In another aspect, the invention provides a cell for the production of a gene delivery vehicle provided with at least a tissue tropism for smooth muscle cells and in embodiments of the invention provides a cell for . the production of a gene delivery vehicle deprived of at least a tissue tropism for liver cells. In another aspect, the invention provides a cell for the production of a gene delivery vehicle provided with at least a tissue tropism for smooth muscle cells and deprived of at least a tissue tropism for liver cells. In a preferred embodiment of the invention said cell is an adenovirus packaging cell, wherein an adenovirus nucleic acid is packaged into an adenovirus capsid. In one aspect of an adenovirus packaging cell of the invention all proteins required for the replication and packaging of an adenovirus nucleic acid, except for the proteins encoded by early region 1, are provided by genes incorporated in said adenovirus nucleic acid. The early region 1 encoded proteins in this aspect of the invention may be encoded by genes incorporated into the cells genomic DNA. In a preferred embodiment of the invention said cell is PER.C6 (ECACC deposit number 96022940). In general, when gene products required for the replication and packaging of adenovirus nucleic acid into adenovirus capsid are not provided by a adenovirus nucleic acid, they are provided by the packaging cell, either by transient transfection, or through stable transformation of said packaging cell. However, a gene product provided by the packaging cell may also be provided by a gene present on said adenovirus nucleic acid. For instance fiber protein may be provided by the packaging cell, for instance through transient transfection, and may be encoded by the adenovirus nucleic acid. This feature can among others be used to intellectual property office of nz. 1 9 jul 2001 received 29 generate adenovirus capsids comprising of fiber proteins from two different viruses.
The gene delivery vehicles of the invention are useful for the treatment cardiovascular disease or disease treatable by 5 nucleic acid delivery to smooth muscle cells. A non-limiting example of the latter is for instance cancer, where the nucleic acid transferred comprises a gene encoding an anti-angiogenesis protein.
The gene delivery vehicles of the invention may be used as a 10 pharmaceutical for the treatment of said diseases.
Alternatively, gene delivery vehicles of the invention may be used for the preparation of a medicament for the treatment of said diseases.
In one aspect the invention provides an adenovirus capsid 15 with or provided with a tissue tropism for smooth muscle cells and wherein said capsid preferably comprises proteins from at least two different adenoviruses and wherein at least a tissue tropism determining fragment of a fiber protein is derived from a subgroup B adenovirus, 20 preferably of adenovirus 16. In another aspect the invention provides an adenovirus capsid deprived of a tissue tropism for liver cells wherein said capsid preferably comprises proteins from at least two different adenoviruses and wherein at least a tissue tropism determining fragment of a fiber 25 protein is derived from a subgroup B adenovirus, preferably of adenovirus 16.
In one embodiment the invention comprises the use of an adenovirus capsid, for the delivery of nucleic acid to smooth muscle cells. In another embodiment 3 0 the invention comprises the use of an adenovirus capsid, for preventing the delivery of nucleic acid to liver cells. The adenovirus capsids of the invention may be used for the treatment cardiovascular disease or disease treatable by nucleic acid delivery to endothelial cells or smooth muscle 35 cells. Example of the latter is for instance cancer where the nucleic acid transferred comprises a gene encoding an anti-angiogenesis protein.
INTELLECTUAL PROPERTY OFFICE OF N.Z. 1 9 jul 2001 received « The adenovirus capsids of the invention may be used as a pharmaceutical for the treatment of said diseases. Alternatively, adenovirus capsids of the invention may be used for the preparation of a medicament for the treatment of said diseases.
In another aspect of the invention is provided construct pBr/Ad.BamRAFib, comprising adenovirus 5 sequences 21562-31094 and 32794-35938.
In another aspect of the invention is provided construct pBr/AdBamRfibl6, comprising adenovirus 5 sequences 21562-31094 and 32794-35938, further comprising an adenovirus 16 gene encoding fiber protein.
In yet another aspect of the invention is provided construct pBr/AdBamR.pac/fibl6, comprising adenovirus 5 sequences 21562-31094 and 32794-35938, further comprising an adenovirus 16 gene encoding fiber protein, and further comprising a unique PacI-site in the proximity of the adenovirus 5 right terminal repeat, in the non-adenovirus sequence backbone of said construct.
In another aspect of the invention is provided construct pWE/Ad.AfHlrITRfibl6 comprising Ad5 sequence 3534-31094 and 32794-35938, further comprising an adenovirus 16 gene encoding fiber protein.
In another aspect of the invention is provided construct pWE/Ad.AfHlrITRDE2Afibl6 comprising Ad5 sequences 3534-22443 and 24033-31094 and 32794-35938, further comprising an adenovirus 16 gene encoding fiber protein.
In the numbering of the sequences mentioned above, the number is depicted until and not until plus.
In a preferred embodiment of the invention said constructs are used for the generation of a gene delivery vehicle or an adenovirus capsid with a tissue tropism for smooth muscle cells.
In another aspect the invention provides a library of adenovirus vectors, or gene delivery vehicles which may be one and the same or not, comprising a large selection of non- intellectual property office of n.z. 1 9 jul 2001 adenovirus nucleic acids. In another aspect of the invention, adenovirus genes encoding capsid proteins are used to generate a library of adenovirus capsids comprising of proteins derived from at least two different adenoviruses, 5 said adenoviruses preferably being derived from two different serotypes, wherein preferably one serotype is an adenovirus of subgroup B. In a particularly preferred embodiment of the invention a library of adenovirus capsids is generated comprising proteins from at least two different adenoviruses 10 and wherein at least a tissue tropism determining fragment of fiber protein is derived from an adenovirus of subgroup B, preferably of adenovirus 16.
A fiber protein of adenovirus 16 preferably comprises of the 15 sequence given in figure 9. However within the scope of the present invention analogous sequences may be obtained through using codon degeneracy. Alternatively, amino-acid substitutions or insertions or deletions may be performed as long as the tissue tropism determining property is not 20 significantly altered. Such amino-acid substitutions may be within the same polarity group or without.
In the following the invention is illustrated by a number of non-limiting examples.
EXAMPLES 32 Example 1: Generation of adenovirus serotype 5 based viruses with chimaeric fiber proteins Generation of adenovirus template clones lacking DNA encoding for fiber The fiber coding sequence of adenovirus serotype 5 is located between nucleotides 31042 and 32787. To remove the adenovirus serotype 5 DNA encoding fiber we started with construct 10 pBr/Ad.Bam-rlTR (Figure 1; ECACC deposit P97082122). From this construct first a Ndel site was removed. For this purpose, pBr322 plasmid DNA was digested with Ndel after which protruding ends were filled using Klenow enzyme. This pBr322 plasmid was then re-ligated, digested with Ndel and 15 transformed into E. coli DH5a. The obtained pBr/ANdel plasmid was digested with Seal and Sail and the resulting 3198 bp vector fragment was ligated to the 15349 bp Seal-Sail fragment derived from pBr/Ad.BamrlTR, resulting in plasmid pBr/Ad.Bam-rITRANdel which hence contained a unique Ndel 20 site. Next a PCR was performed with oligonucleotides "NY-up" and "NY-down" (Figure 2). During amplification, both a Ndel and a Nsil restriction site were introduced to facilitate cloning of the amplified fiber DNAs. Amplification consisted of 25 cycles of each 45 sec. at 94°C, 1 min. at 60°C, and 45 25 sec. at 72°C. The PCR reaction contained 25 pmol of oligonucleotides NY-up or NY-down, 2mM dNTP, PCR buffer with 1.5 mM MgCl2, and 1 unit of Elongase heat stable polymerase (Gibco, The Netherlands). One-tenth of the PCR product was run on an agarose gel which demonstrated that the expected 30 DNA fragment of + 2200 bp was amplified. This PCR fragment was subsequently purified using Geneclean kit system. (BiolOl Inc.) Then, both the construct pBr/Ad.Bam-rITRANdel as well as the PCR product were digested with restriction enzymes Ndel and SbfI. The PCR fragment was subsequently cloned using 33 T4 ligase enzyme into the Ndel and Sbfl sites thus generating pBr/Ad.BamRAFib (Figure 3).
Amplification of fiber sequences from adenovirus serotypes 5 To enable amplification of the DNAs encoding fiber protein derived from alternative serotypes degenerate oligonucleotides were synthesized. For this purpose, first known DNA sequences encoding for fiber protein of alternative serotypes were aligned to identify conserved regions in both 10 the tail region as well as the knob region of the fiber protein. From the alignment, which contained the nucleotide sequence of 19 different serotypes representing all 6 subgroups, (degenerate) oligonucleotides were synthesized (see Table I). Also shown in table 3 is the combination of 15 oligonucleotides used to amplify the DNA encoding fiber protein of a specific serotype. The amplification reaction (50 fj.1) contained 2 mM dNTPs, 25 pmol of each oligonucleotide, standard lx PCR buffer, 1,5 mM MgCl2, and 1 Unit Pwo heat stable polymerase (Boehringer Mannheim) per 2 0 reaction. The cycler program contained 2 0 cycles, each consisting of 30 sec. 94°C, 60 sec. 60-64°C, and 120 sec. 72°C. One-tenth of the PCR product was run on an agarose gel to demonstrate that a DNA fragment was amplified. Of each different template, two independent PCR reactions were 25 performed.
Generation of chimaeric adenoviral DNA constructs All amplified fiber DNAs as well as the vector (pBr/Ad.BamRAFib) were digested with Ndel and Nsil. The 3 0 digested DNAs were subsequently run on a agarose gel after which the fragments were isolated from the gel and purified using the Geneclean kit (BiolOl Inc). The PCR fragments were then cloned into the Ndel and Nsil sites of pBr/AdBamRAFib, thus generating pBr/AdBamRFibXX (where XX stands for the 34 serotype number of which the fiber DNA was isolated). The inserts generated by PCR were sequenced to confirm correct amplification. The obtained sequences of the different fiber genes are shown in Figure 4.
Generation of recombinant adenovirus chimaeric for fiber protein To enable efficient generation of chimaeric viruses an Avrll fragment from the pBr/AdBamRFibl6, pBr/AdBamRFib2 8, pBr/AdBamRFib4 0-L constructs was subcloned into the vector pBr/Ad.Bam-rITR.pac#8 (ECACC deposit #P97082121) replacing the corresponding sequences in this vector. pBr/Ad.Bam-rITR.pac#8 has the same adenoviral insert as pBr/Ad.Bam-rITR but has a PacI site near the rITR that enables the ITR to be separated from the vector sequences. The construct pWE/Ad.AfIII-Eco was generated as follows. PWE.pac was digested with Clal and the 5 prime protruding ends were filled in with Klenow enzyme. The DNA was then digested with PacI and isolate from agarose gel. PWE/AfUlrlTR was digested with EcoRI and after treatment with Klenow enzyme digested with PacI. The large 24 kb. fragment containing the adenoviral sequences was isolated from agarose gel and ligated to the Clal digested and blunted pWE.Pac vector. Use was made of the ligation express kit from Clontech. After transformation of XLlO-gold cells from Stratagene, clones were identified that contained the expected construct. PWE/Ad.AlfII-Eco contains Ad5 sequences from basepairs 3534-27336. Three constructs, pClipsal-Luc (Figure 5) digested with Sail, pWE/Ad.AfIII-Eco digested with PacI and EcoRI and pBr/AdBamR.pac/fibXX digested with BamHI and PacI were transfected into adenovirus producer cells (PER.C6, Fallaux et al, 1998). Figure 6 schematically depicts the method and fragments used to generate the chimaeric viruses. Only pBr/Ad.BamRfibl2 was used without subcloning in the PacI containing vector and therefor was not liberated from vector sequences using PacI but was digested with Clal which leaves approximately 160 bp of vector sequences attached to the right ITR. Furthermore, the pBr/Ad.BamRfibl2 and pBr/Ad.BamRfib28 contain an internal BamHI site in the fiber sequences and were therefor digested with Sail which cuts in the vector sequences flanking the BamHI site. For transfection, 2 (jg of pCLIPsal-Luc, and 4 |jg of both pWE/Ad.AfIII-Eco and pBr/AdBamR.pac/fibXX were diluted in serum free DMEM to 100 (^1 total volume. To this DNA suspension 100 fJ.1 2 . 5x diluted lipofectamine (Gibco) in serum-free medium was added. After 3 0 minutes at room temperature the DNA-lipofectamine complex solution was added to 2.5 ml of serum-free DMEM which was subsequently added to a T25 cm2 tissue culture flask. This flask contained PER.C6 cells that were seeded 24-hours prior to transfection at a density of 1x10s cells/flask. Two hours later, the DNA-lipof ectamine complex containing medium was diluted once by the addition of 2.5 ml DMEM supplemented with 20% fetal calf serum. Again 24 hours later the medium was replaced by fresh DMEM supplemented with 10% fetal calf serum. Cells were cultured for 6-8 days, subsequently harvested, and freeze/thawed 3 times. Cellular debris was removed by centrifugation for 5 minutes at 3000 rpm room temperature. Of the supernatant (12.5 ml) 3-5 ml was used to infect again PER.C6 cells (T80 cm2 tissue culture flasks). This reinfection results in full cytopathogenic effect (CPE) after 5-6 days after which the adenovirus is harvested as described above.
Production of fiber chimeric adenovirus ml of the above described crude lysate was used to inoculate a 1 liter fermentor which contained 1 - 1.5 x 106 PER.C6 cells/ml growing in suspension. Three days after inoculation, the cells were harvested and pelleted by centrifuging for 10 min at 1750 rpm at room temperature. The chimeric adenovirus present in the pelleted cells was subsequently extracted and purified using the following downstream processing protocol. The pellet was dissolved in 50 ml 10 mM NaP04~ and frozen at -20°C. After thawing at 37°C, 5.6 ml deoxycholate (5% w/v) was added after which the solution was homogenated. The solution was subsequently incubated for 15 minutes at 3 7°C to completely crack the cells. After homogenizing the solution, 1875 (J.1 (1M) MgCl2" was added and 5 ml 100% glycerol. After the addition of 375 (il DNase (10 mg/ ml) the solution was incubated for 30 minutes at 37°C. Cell debris was removed by centrifugation at 18 8 0xg for 3 0 minutes at room temperature without the brake on. The supernatant was subsequently purified from proteins by loading on 10 ml of freon. Upon centrifugation for 15 minutes at 2 000 rpm without brake at room temperature three bands are visible of which the upper band represents the adenovirus. This band was isolated by pipetting after which it was loaded on a Tris/HCl (1M) buffered caesiumchloride blockgradient (range: 1.2 to 1.4 gr./ml). Upon centrifugation at 21000 rpm for 2.5 hours at 10°C the virus was purified from remaining protein and cell debris since the virus, in contrast to the other components, does not migrate into the 1.4 gr./ ml caesiumchloride solution. The virus band is isolated after which a second purification using a Tris/ HCl (1M) buffered continues gradient of 1.33 gr. /ml of caesiumchloride is performed. After virus loading on top of this gradient the virus is centrifuged for 17 hours at 55000 rpm at 10°C. Subsequently the virus band is isolated and after the addition of 30 (J.1 of sucrose (50 w/v) excess caesiumchloride is removed by three rounds of dialysis, each round comprising of 1 hour. For dialysis the virus is transferred to dialysis slides (Slide-a-lizer, cut off 10000 kDa, Pierce, USA). The buffers used for dialysis are PBS which are supplemented with an increasing concentration of sucrose (round 1 to 3: 30 ml, 60 ml, and 150 ml sucrose (50% w/v)/ 1.5 liter PBS, all supplemented with 7.5 ml 2% (w/v) CaMgCl2) . After dialysis, the virus is removed from the slide-a-lizer after which it is aliquoted in portions of 25 and 100 p.1 upon which the virus is stored at -85°C. To determine the number of virusparticles per ml, 50 (al of the virus batch is run on an high pressure liquid chromatograph (HPLC) as described by Shamram et al (1997). The virus titers 5 were found to be in the same range as the Ad5.Luc virus batch (Ad5 . Luc : 2.2 x 1011 vp/ ml; Ad5 . LucFibl2 : 1.3 x 1011 vp/ ml; Ad5 . LucFibl6 : 3.1 x 1012 vp/ ml; Ad5 . LucFib2 8 : 5.4 x 1010 vp/ ml; Ad5 .LucFib4 0-L: 1.6 x 1012 vp/ ml).
Example 2: biodistribution of chimeric viruses after intravenous tail vein injection of rats.
To investigate the biodistribution of the chimeric adenoviruses carrying fiber 12, 16, 28, or 40-2, IxlO10 15 particles of each of the generated virusbatches was diluted in 1 ml PBS after which the virus was injected in the tail vein of adult male Wag/Rij rats (3 rats/ virus). As a control, Ad5 carrying the luciferase transgene was used. Forty-eight hours after the administration of the virus, the 20 rats were sacrificed after which the liver, spleen, lung, kidney, heart, and brain were dissected. These organs were subsequently mixed with 1 ml of lysis buffer (1% Triton X-100/ PBS) and minced for 30 seconds to obtain a protein lysate. The protein lysate was subsequently tested for the 25 presence of transgene expression (luciferase activity) and the protein concentration was determined to express the luciferase activity per [J.g of protein. The results, Shown in Table II, demonstrate that in contrast to the Adenovirus serotype 5 control, none of the fiber chimeras are targeted 30 specifically to the liver or to the spleen. This experiment shows that it is possible to circumvent the uptake of adenoviruses by the liver by making use of fibers of other serotypes. It also shows that the uptake by the liver is not correlated with the length of the fiber shaft, or determined 35 solely by the ability of fiber knob to bind to CAR. The fibers used have different shaft lengths and, except for 38 fiber 16, are derived from subgroups known to have a fiber that can bind CAR (Roelvink et al 1998) .
Example 3: Chimeric viruses display differences in 5 endothelial and smooth muscle cell transduction A) Infection of Human endothelial cells Human endothelial cells (HUVEC) were isolated, cultured and 10 characterized as described previously (Jaffe et al 1973; Wijnberg et al 1997). Briefly, cells were cultured on gelatin-coated dishes in M199 supplemented with 20 mM HEPES, pH 7.3 (Flow Labs., Irvine, Scotland), 10% (v/v) human serum (local blood bank), 10% (v/v) heat-inactivated newborn calf 15 serum (NBCS) (GIBCO BRL, Gaithersburg, MD) , 150 jag/ ml crude endothelial cell growth factor, 5 U/ ml heparin (Leo Pharmaceutics Products, Weesp, The Netherlands), penicillin (100 IU/ ml)/streptomycin (100 (j.g/ ml) (Boehringer Mannheim, Mannheim, FRG) at 37°C under 5% (v/v) C02/ 95% (v/v) air 20 atmosphere. Cells used for experiments were between passage 1-3. In a first set of experiments 40000 HUVEC cells (a pool from 4 different individuals) were seeded in each well of 24-wells plates in a total volume of 200 (J.1. Twenty-four hours after seeding, the cells were washed with PBS after which 200 25 [J.1 of DMEM supplemented with 2% FCS was added to the cells. This medium contained various amounts of virus (MOI = 50, 250, 1000, 2500, 5000, and 10000). The viruses used were besides the control Ad5, the fiber chimeras 12, 16, 28, and 40-L (each infection in triplicate). Two hours after addition 3 0 of the virus the medium was replaced by normal medium. Again forty-eight hours later cells were washed and lysed by the addition of 100 (J.1 lysisbuffer. In figure 7a, results are shown on the transgene expression per microgram total protein after infection of HUVEC cells. These results show that fiber 35 chimeras 12 and 28 are unable to infect HUVEC cells, that 40-L infects HUVECs with similar efficiency as the control Ad5 w 39 virus, and that fiber chimera 16 infects HUVECs significantly better. In a next set of experiments (n = 8) the fiber 16 chimera was compared with the Ad5.Luc vector on HUVEC for luciferase activity after transduction with 2500 virus 5 particles per cell of each virus. These experiments demonstrated that fiber 16 yields, on average, 8.1 fold increased luciferase activity (SD ±4.6) as compared with Ad5. In a next experiment, an equal number of virus particles was added to wells of 24-well plates that contained different 10 HUVEC cell concentrations. This experiment was performed since it is known that HUVECs are less efficiently infected with adenovirus serotype 5 when these cells reach confluency. For this purpose, HUVECs were seeded at 22500, 45000, 90000, and 135000 cells per well of 24-well plates (in triplicate). 15 Twenty-four hours later these cells were infected as described above with medium containing 4.5 x 108 virusparticles. The viruses used were, besides the control adenovirus serotype 5, the chimera fiber 16. The result of the transgene expression (RLU) per microgram protein 20 determined 48 hours after infection (see figure 7b) shows that the fiber 16 chimeric adenovirus is also better suited to infect HUVEC cells even when these cells are 100% confluent which better mimics an in vivo situation. Since the Luciferase markergene does not provide information concerning 25 the number of cells infected another experiment was performed with adenovirus serotype 5 and the fiber 16 chimera, both carrying a green fluorescent protein (GFP) as a marker gene. This protein expression can be detected using a flow cytometer which renders information about the percentage of 30 cells transduced as well as fluorescence per cell. In this experiment cells were seeded at a concentration of 40000 cells per well and were exposed to virus for 2 hours. The virus used was Ad5.GFP (8.4 x 1011 vp/ ml) and Ad5. Fibl6. GFP (5.1 x 1011 vp/ ml) . Cells were exposed to a virus 35 concentration of 500 virus particles per cell. Flow cytometric analysis, 48 hours after virus exposure demonstrated that the fiber 16 virus gives higher transgene expression levels per cell since the median fluorescence, a parameter identifying the amount of GFP expression per cell, is higher with fiber 16 as compared to Ad5 (Figure 7c). These 5 results are thus consistent and demonstrate that the fiber 16 chimeric virus is better suited to infect human primary endothelial cells as compared to Ad5.
B) Infection of human smooth muscle cells Smooth muscle cells were isolated after isolation of EC (Weinberg et al 1997) . The veins were incubated with medium (DMEM) supplemented with penicillin/ streptomycin) containing 0.075% (w/v) collagenase (Worthington Biochemical Corp., 15 Freehold, NJ, USA). After 45 minutes the incubation medium containing detached cells was flushed from the veins. Cells were washed and cultured on gelatin coated dishes in culture medium supplemented with 10% fetal calf serum and 10% human serum at 37°C under 5% (v/v) C02/ 95% (v/v) air atmosphere. 20 Cells used for experiments were between passage 3-6. We first tested the panel of chimeric fiber viruses versus the control adenovirus serotype 5 for the infection of human smooth muscle cells. For this purpose, 40000 human umbilical vein smooth muscle cells (HUVsmc) were seeded in wells of 24-well 25 plates in a total volume of 200 [il. Twenty-four hours after seeding, the cells were washed with PBS after which 200 (0.1 of DMEM supplemented with 2% FCS was added to the cells. This medium contained various amounts of virus (MOI = 50, 250, 1250, 2500, and 5000). The viruses used were besides the 30 control Ad5 the fiber chimeras 12, 16, 28, and 40-L (each infection in triplicate). Two hours after addition of the virus the medium was replaced by normal medium. Again forty-eight hours later cells were washed and lysed by the addition of 100 (al lysisbuffer. In figure 8a, results are shown of the 35 transgene expression per microgram total protein after infection of HUVsmc cells. These results show that fiber chimeras 12 and 2 8 are unable to infect HUVsmc cells, that 40-L infects HUVsmc with similar efficiency as the control Ad5 virus, and that fiber chimera 16 infects HUVsmc significantly better. In a next set of experiments, smooth muscle cells derived from saphenous vene, arteria Iliaca, left interior mammory artery (LIMA) and aorta were tested for infection with the fiber 16 chimera and Ad5 (both carrying luciferase as a marker gene). These experiments (n = 11) demonstrated that, on average, the fiber 16 chimera yielded 61.4 fold increased levels in luciferase activity (SD ± 54.8) as compared to Ad5. The high standard deviation (SD) is obtained due to the finding that the adenoviruses used vary in their efficiency of infection of SMC derived from different human vessels. In a next experiment, an equal number of virus particles was added to wells of 24-well plates that contained different HUVsmc cell concentrations confluency. For this purpose, HUVsmc were seeded at 10000, 20000, 40000, 60000, and 80000 cells per well of 24-well plates (in triplicate). Twenty-four hours later these cells were infected as described above with medium containing 2 x 108 virusparticles. The viruses used were, besides the control adenovirus serotype 5, the chimera fiber 16. The result of the transgene expression (RLU) per microgram protein determined 48 hours after infection (see figure 8b) shows that the fiber 16 chimeric adenovirus is better suited to infect smooth muscle cells even when these cells are 100% confluent which better mimics an in vivo situation. To identify the number of SMCs transduced with the fiber 16 chimera and Ad5, we performed transduction experiments with Ad5.GFP and Ad5Fibl6.GFP (identical batches as used for EC infections). Human umbilical vein SMC were seeded at a concentration of 60000 cells per well in 24-well plates and exposed for 2 hours to 500 or 5000 virus particles per cell of Ad5.GFP or Ad5Fibl6.GFP. Forty-eight hours after exposure cells were harvested and analyzed using a flow cytometer. The results obtained show that the fiber 16 mutant yields approximately 10 fold higher transduction of SMC since the GFP expression measured after transduction with 5000 virus particles of Ad5.GFP is equal to GFP expression after transduction with 500 virus particles per cell of the fiber 5 16 chimera (Figure 8c) .
C) Subgroup B fiber mutants other than fiber 16 The shaft and knob of fiber 16 are derived from adenovirus 10 serotype 16 which, as described earlier, belongs to subgroup B. Based on hemagglutination assays, DNA restriction patterns, and neutralization assays the subgroup B viruses have been further subdivided into subgroup B1 and B2 (Wadell et al 1984). Subgroup B1 members include serotypes 3, 7, 16, 15 21, and 51. Subgroup B2 members include 11, 14, 34, and 35. To test whether the increased infection of smooth muscle cells is a trade of all fibers derived from subgroup B or specific for one or more subgroup B fiber molecules, we compared fiber 16 and fiber 51 (both subgroup Bl) with fiber 2 0 11 and fiber 3 5 (both subgroup B2). For this purpose HUVsmc were infected with increasing amounts of virus particles per cell (156, 312, 625, 1250, 2500, 5000) . The fiber mutant all carry the Luciferase marker gene (Ad5Fibll. Luc: 1.1 x 1012 vp/ml; Ad5Fib3 5Luc: 1.4 x 101Z vp/ml ; Ad5Fib51Luc: 1.0 x 1012 2 5 vp/ml). Based on the Luciferase activity measured and shown in Figure 8d, efficient infection of SMC is not a general trade of all subgroup B fiber molecules. Clearly fiber 16 an fiber 11 are better suited for infection of SMC than fiber 35 and fiber 51. Nevertheless, all subgroup B fiber mutants 3 0 tested infect SMC better as compared to Ad5.
D) Organ culture experiments We next identified whether the observed difference in 3 5 transduction of EC and SMC using the fiber 16 chimera or the Ad5 can also be demonstrated in organ culture experiments. Hereto, We focused on the following tissues: 1) Human Saphenous vein: the vein used in approximately 80% of all clinical vein grafting procedures 2) Human pericard/ epicard: for delivery of recombinant adenoviruses to the pericardial fluid which after infection of the percardial or epicardial cells produce the protein of interest from the transgene carried by the adenovirus. 3) Human coronary arteries: for percutaneous transluminal coronary angioplasty (PTCA) to prevent restenosis. Of the coronary arteries we focused on the Left artery descending (LAD) en right coronary artery (RCA).
Parts of a human saphenous vein left over after vein graft surgery were sliced into pieces of approximately 0.5 cm.
These pieces (n=3) were subsequently cultured for 2 hours in 200 ml of 5 xlO10 virus particles per ml. After two hours 15 virus exposure the pieces were washed with PBS and cultured for another 48 hours at 37°C in a 10% C02 incubator. The pieces were then washed fixated and stained for LacZ transgene expression. The viruses were AdS.LacZ (2.2 x 1012 vp/ ml), the fiber 16 chimera Ad5Fibl6. LacZ (5.2 x 1011 vp/ 20 ml), and A fiber 51 chimera: Ad5Fib51.LacZ (2.1 x 1012 vp/ ml). The pieces of saphenous vein were macroscopically photographed using a digital camera. Based on LacZ transgene expression obtained after 2 hours of virus exposure on saphenous vein slices, both the fiber 16 and the fiber 51 25 chimeric viruses give higher infection since much more blue staining is observed using these viruses as compared to Ad5.LacZ (Figure 8e). Identical experiments as described on saphenous vein were performed with human pericard and the human coronary arteries: RCA and LAD. Results of these 30 experiments (Figures 8f-8g-8h respectively) together with the experiments performed on primary cells confirmed the superiority of the fiber 16 and 51 mutants as compared to Ad5 in infecting human cardiovascular tissues. 3 5 E) CAR and integrin expression on human EC and SMC 44 From the above described results it is clear that the chimeric adenovirus with the shaft and knob from fiber 16 is well suited to infect endothelial cells and smooth muscle cells. Thus, by changing the fiber protein on Ad5 viruses we 5 are able to increase infection of cells that are poorly infected by Ad5. The difference between Ad5 and Ad5Fibl6, although significant on both cell types, is less striking on endothelial cells as compared to smooth muscle cells. This may reflect differences in receptor expression. For example, 10 HUVsmc significantly more avp5 integrins than HUVEC (see below). Alternatively, this difference may be due to differences in expression of the receptor of fiber 16. Ad5.LucFibl6 infects umbilical vein smooth muscle cells approximately 8 fold better than umbilical vein endothelial 15 cells whereas in case of Ad5.Luc viruses endothelial cells are better infected than smooth muscle cells. To test whether Ad5 infection correlated with receptor expression of these cells the presence of CAR and av-integrins was assayed on a flow cytometer. For this purpose lxlO5 HUVEC cells or HUVsmc 20 were washed once with PBS/ 0.5% BSA after which the cells were pelleted by centrifugation for 5 minutes at 1750 rpm at room temperature. Subsequently, 10 (0,1 of a 100 times diluted avP3 antibody (Mab 1961, Brunswick chemie, Amsterdam, The Netherlands), a 100 times diluted antibody avP5 (antibody 25 (Mab 1976, Brunswick chemie, Amsterdam, The Netherlands), or 2000 times diluted CAR antibody was a kind gift of Dr. Bergelson, Harvard Medical School, Boston, USA (Hsu et al) was added to the cell pellet after which the cells were incubated for 3 0 minutes at 4°C in a dark environment. After 30 this incubation, cells were washed twice with PBS/0.5% BSA and again pelleted by centrifugation for 5 minutes at 1750 rpm room temperature. To label the cells, 10 ml of rat anti mouse IgGl labeled with phycoerythrine (PE) was added to the cell pellet upon which the cells were again incubated for 3 0 35 minutes at 4°C in a dark environment. Finally the cells were washed twice with PBS/0.5% BSA and analyzed on a flow cytometer. The results of these experiments are shown in table III. From the results it can be concluded that HUVsmc do not express detectable levels of CAR confirming that these cells are difficult to transduce with an adenovirus which 5 enters the cells via the CAR receptor.
F) Infection of human A549 cells As a control for the experiments performed on endothelial cells and smooth muscle cells, A549 cells were infected to establish whether an equal amount of virus particles of the different chimeric adenoviruses show significant differences in transgene expression on cell lines that are easily 15 infected by adenovirus. This is to investigate whether the observed differences in infection efficiency on endothelial and smooth muscle cells are cell type specific. For this purpose, 10s A549 cells were seeded in 24-well plates m a volume of 200 j_il. Two hours after seeding the medium was 2 0 replaced by medium containing different amounts of particles of either fiber chimera 5, 12, 16, or 40-L (MOI = 0, 5, 10, 25, 100, 500). Twenty-four hours after the addition of virus, the cells were washed once with PBS after which the cells were lysed by the addition of 100 jj.1 lysisbuffer to each well 25 (1% Triton X-100 in PBS) after which transgene expression (Luciferase activity) and the protein concentration was determined. Subsequently, the luciferase activity per jj.g protein was calculated. The data, shown in table IV, demonstrate that Ad5.Luc viruses infect A549 cells most 30 efficient while the infection efficiency of Ad5LucFibl6 or Ad5LucFib40-L is a few times lower. This means that the efficient infection of endothelial cells and especially smooth muscle cells is due to differences in binding of the virus to these cells and not to the amount of virus or the 35 quality of the viruses used. 46 Table I Serotype Tail oligonucleotide 4 A 8 B 9 B 12 E 16 C 19p B 28 B 32 B 36 B 37 B 40-1 D 40-2 D 41-s D 41-1 D 49 B 50 B 51 C Knob oligonucleotide 1 2 2 3 4 2 2 2 2 2 6 5 7 2 2 8 A - CCC GTG TAT CCA TAT GAT GCA GAC AAC GAC CGA B '- CCC GTC TAC CCA TAT GGC TAC GCG CGG - 3' C '- CCK GTS TAC CCA TAT GAA GAT GAA AGC 3' D '- CCC GTC TAC CCA TAT GAC ACC TYC TCA ACT C- 3 E '- ccc GTT TAC CCA TAT GAC CCA TTT GAC ACA TCA 1 '- CCG ATG CAT TTA TTG TTG GGC TAT ATA GGA - 3' 2 '- CCG ATG CAT TYA TTC TTG GGC RAT ATA GGA - 3' 3 '- CCG ATG CAT TTA TTC TTG GGR AAT GTA WGA AAA 4 ' - CCG ATG CAT TCA GTC ATC TTC TCT GAT ATA - 3' ' - CCG ATG CAT TTA TTG TTC AGT TAT GTA GCA - 3' 6 '- GCC ATG CAT TTA TTG TTC TGT TAC ATA AGA - 3' 7 ' - CCG TTA ATT AAG CCC TTA TTG TTC TGT TAC ATA 8 '- CCG ATG CAT TCA GTC ATC YTC TWT AAT ATA - 3' A - 3 47 Table II Organ Control Aclb Fib 12 Fib 16 Fib 28 F±J3 40-L Liver 740045 458 8844 419 2033 Spleen 105432 931 3442 592 16107 Lung 428 315 334 316 424 Kidney 254 142 190 209 224 Heart 474 473 276 304 302 Brain 291 318 294 323 257 Table III 48 Cell line avP3 avP5 CAR HUVEC 70% 98.3% 18.9% 18.1% HUVEC 100% 97.2% . 5% 7.2% HUVsmc 70% 95.5% 76.6% 0 . 3% HUVsmc 100% 92 .2% 66.5% 0.3% PER.C6 7.8% 16.8% 99.6% 49 Table IV MOI (VP/Cell) Control Ad5 Fiber 12 Fiber 16 Fiber 40-L 0 0 0 0 0 1025 46 661 443 1982 183 1704 843 4840 200 3274 2614 100 21875 1216 13432 11907 500 203834 3296 93163 71433 50 REFERENCES Arnberg N., Mei Y. and Wadell G., 1997. Fiber genes of adenoviruses with tropism for the eye and the genital tract. Virology 227: 239-244.
Bergelson, J.M., Cunningham, J.A., Droguett, G., Kurt-Jones, E.A., Krithivas, A., Hong, J.S., Horwitz, M.S., Crowell, R.L. and Finberg, R.W. (1997) Isolation of a common receptor for coxsackie B virus and adenoviruses 2 and 5. Science 275: 1320-1323.
Bout A. (1997) Gene therapy, p. 167-182. In: D.J.A. Crommelin and R.D. Sindelar (ed.), Pharmaceutical,Biotechnology , Harwood Academic Publishers.
Bout, A. (1996) Prospects for human gene therapy. Eur. J.
Drug Met. and Pharma. 2, 175-179.
Blaese, M., Blankenstein, T., Brenner, M., Cohen-Hagenauer, O., Gansbacher, B., Russel, S., Sorrentino, B. and Velu, T. 20 (1995) Cancer Gene Ther. 2: 291-297.
Brody, S.L. and Crystal, R.G. (1994) Adenovirus mediated in vivo gene transfer. Ann. N. Y. Acad. Sci. 716:90-101.
Carter, A.J., Laird, J.R., Farb, A., Kufs, W., Wortham, D.C. and Virmani, R. (1994) Morphologic characteristics of lesion formation and time course of smooth muscle cell proliferation in a porcine proliferative restenosis model. J. Am. Coll. Cardiol. 24: 1398-1405.
Chroboczek J., Ruigrok R.W.H., and Cusack S., 1995.
Adenovirus fiber, p. 163-200. In: W. Doerfler and P. Bohm (ed.), The molecular repertoire of adenoviruses, I. Springer-Verlag, Berlin. 51 Defer C., Belin M., Caillet-Boudin M. and Boulanger P., 1990. Human adenovirus-host cell interactions; comparative study with members of subgroup B and C. Journal of Virology 64 (8): 5 3661-3673.
Fallaux, F.J, Bout, A, van der Velde, I et al. New helper cells and matched El-deleted adenovirus vectors prevent generation of replication competent adenoviruses. Human Gene 10 Therapy, 9 (1998), pl909-1917.
Francki, R.I.B., Fauquet, C.M., Knudson, D.L. and Brown, F. (1991) Classification and nomenclature of viruses. Fifth report of the international Committee on taxonomy of viruses. 15 Arch. Virol. Suppl. 2: 14 0-144.
Gall J., Kass-Eisler A., Leinwand L. and Falck-Pedersen E. (1996) Adenovirus type 5 and 7 capsid chimera: fiber replacement alters receptor tropism without affecting primary 20 immune neutralization epitopes. Journal of Virology 70 (4) : 2116-2123.
Greber, U.F., Willets, M., Webster, P., and Helenius, A. (1993). Stepwise dismanteling of adenovirus 2 during entry 25 into cells. Cell 75: 477-486.
Hynes, R.O. (1992) Integrins: versatility, modulation and signalling in cell adhesion. Cell 69: 11-25.
Herz, J. and Gerard, R.D. (1993) Adenovirus-mediated transfer of low density lipoprotein receptor gene acutely accelerates cholesterol clearence in normal mice. Proc. Natl. Acad. Sci. U.S.A. 96: 2812-2816.
Hierholzer, J.C. (1992) Adenovirus in the immunocompromised host. Clin. Microbiol Rev. 5, 262-274. 52 Hierholzer, J.C., Wigand, R., Anderson, L.J., Adrian, T., and Gold, J.W.M. (1988) Adenoviruses from patients with AIDS: a plethora of serotypes and a description of five new serotypes 5 of subgenus D (types 43-47). J. Infect. Dis. 158, 804-813.
Hong, S.S., Karayan, L., Tournier, J., Curiel, D.T. and Boulanger, P.A. (1997) Adenovirus type 5 fiber knob binds to MHC class I a2 domain at the surface of human epithelial and 10 B lymphoblastoid cells. EMBO J. 16: 2294-2306.
Hsu, K.H., Lonberg-Holm, K., Alstein, B. and Crowell, R.L. (1988) A monoclonal antibody specific for the cellular receptor for 15 the group B coxsackieviruses. J. Virol 62(5): 1647-1652.
Huard, J., Lochmuller, H., Acsadi, G., Jani, A., Massie, B. and Karpati, G. (1995) The route of administration is a major determinant of the transduction efficiency of rat tissues by 20 adenoviral recombinants. Gene Ther. 2: 107-115.
Ishibashi, M. and Yasue, H. (1984) The adenoviruses, H.S. Ginsberg, ed., Plenum Press, Londen, New York. Chapter 12, 497-561.
Jaffe, E.A., Nachman, R.L., Becker, C.G., Minick, C.R. (1973) Culture of endothelial cells derived from umbilical veins. Identification by morphologic and immunologic criteria. J. Clin. Invest. 52, 2745-2756.
Kass-Eisler, A., Falck-Pederson, E., Elfenbein, D.H., Alvira, M., Buttrick, P.M. and Leinwand, L.A. (1994) The impact of developmental stage, route of administration and the immune system on adenovirus-mediated gene transfer. Gene Ther. 1: 35 395-402.
Khoo, S.H., Bailey, A.S., De Jong, J.C., and Mandal, B.K. (1995). Adenovirus infections in human immunodeficiency virus-positive patients: Clinical features and molecular epidemiology. J. Infect. Dis 172, 629-637 Kidd, A.H., Chroboczek, J., Cusack, S., and Ruigrok, R.W. (1993) Adenovirus type 40 virions contain two distinct fibers. Virology 192, 73-84.
Krasnykh V.N., Mikheeva G.V., Douglas J.T. and Curiel D.T. (1996) Generation of recombinant adenovirus vectors with modified fibers for altering viral tropism. J. Virol. 70(10): 6839-6846.
Krasnykh V.N., Dmitriev I., Mikheeva G., Miller C.R., Belousova N. and Curiel D.T. (1998) Characterization of an adenovirus vector containing a heterologous peptide epitope in the HI loop of the fiber knob. J. Virol. 72 (3) : 1844-1852.
Law, L., Chillon, M., Bosch, A., Armentano, D., Welsh, M.J. and Davidson, B.L. (1998) Infection of primary CNS cells by different adenoviral serotypes: Searching for a more efficient vector. Abstract 1st Annual Meeting American Society of Gene Therapy, Seattle, Washington.
Leppard, K.N. (1997) E4 gene function in adenovirus, adenovirus vector and adeno-associated virus infections. J. Gen. Virol. 78: 2131-2138. 3 0 Lloyd Jones, D.M. and Bloch, K.D. (1996) The vascular biology of nitric oxide and its role in atherogenesis. Annu. Rev. Med. 47: 365-375.
Morgan, C., Rozenkrantz, H.S., and Mednis, B. (1969) 3 5 Structure and development of viruses as observed in the electron microscope.X. Entry and uncoating of adenovirus. J. Virol 4, 777-796. 54 Roelvink, P.W., Kovesdi, I. and Wickham, T.J. (1996) Comparative analysis of adenovirus fiber-cell interaction: Adenovirus type 2 (Ad2) and Ad9 utilize the same cellular 5 fiber receptor but use different binding stratagies for attachemnt. J. Virol. 70: 7614-7621.
Roelvink, P.W., Lizonova, A., Lee, J.G.M., Li, Y., Bergelson, J.M., Finberg, R.W., Brough, D.E., Kovesdi, I. and Wickham, T.J. (1998) The coxsackie-adenovirus receptor protein can function as a cellular attachment protein for adenovirus serotypes from subgroups A, C, D, E, and F. J. Virol. 72: 7909-7915.
Rogers, B.E., Douglas J.T., Ahlem, C., Buchsbaum, D.J., Frincke, J. and Curiel, D.T. (1997) Use of a novel cross-linking method to modify adenovirus tropism. Gene Ther.4: 1387-1392.
Schulick, A.H., Vassalli, G., Dunn, P.F., Dong, G., Rade, J.J., Zamarron, C. and Dichek, D.A. (1997). Established immunity precludes adenovirus-mediated gene transfer in rat carotid arteries.
Schnurr, D and Dondero, M.E. (1993) Two new candidate adenovirus serotypes. Intervirol. 36, 79-83.
Schwartz, R.S., Edwards, W.D., Huber, K.C., Antoniudes, L.C. Bailey, K.R., Camrud, A.R., Jorgenson, M.A. and Holmes, D.R.
Jr. (1993) Coronary restenosis: Prospects for solution and new perspectives from a porcine model. Mayo Clin. Proc. 68: 54-62.
Shi, Y., Pieniek, M., Fard, A., O'Brien, J., Mannion, J.D. and Zalewski, A. (1996) Adventitial remodelling after coronary arterial injury. Circulation 93: 340-348. 55 Shabram, P.W., Giroux, D.D., Goudreau, A.M., Gregory, R.J., Horn, M.T., Huyghe, B.G., Liu, X., Nunnally, M.H., Sugarman, B.J. and Sutjipto, S. (1997) Analytical anion-exchange HPLC 5 of recombinant type-5 adenoviral particles. Hum. Gene Ther. 8 (4) : 453-465.
Signas, G., Akusjarvi, G., and Petterson, U. (1985). Adenovirus 3 fiberpolypeptide gene: Complications for the 10 structure of the fiber protein. J. Virol. 53, 672-678.
Stevenson S.C., Rollence M., White B., Weaver L. and McClelland A., (1995) Human adenovirus serotypes 3 and 5 bind to two different cellular receptors via the fiber head 15 domain. J. Virol 69(5): 2850-2857.
Stevenson S.C., Rollence M., Marshall-Neff J. and McClelland A. (1997) Selective targeting of human cells by a chimaeric adenovirus vector containing a modified fiber protein. J. 20 Virology 71(6): 4782-4790.
Stouten, P.W.F., Sander, C., Ruigrok, R.W.H., and Cusack, S. (1992) New triple helical model for the shaft of the adenovirus fiber. J. Mol. Biol. 226, 1073-1084.
Svensson, V. and Persson, R. (1984). Entry of adenovirus 2 into Hela cells. J. Virol. 51, 687-694.
Van der Vliet, P.C. (1995) Adenovirus DNA replication In: 30 W. Doerfler and P. Bohm (eds.), The molecular repertoire of adenoviruses II. Springer-Verlag, Berlin.
Varga, M.J., Weibull, C., and Everitt, E. (1991). Infectious entry pathway of adenovirus type 2. J. Virol 65, 6061-6070.
Varenne, O., Pislaru, S., Gillijns, H., Van Pelt, N., Gerard, R.D., Zoldhelyi, P., Van de Werf, F., Collen, D. and Janssens, S.P. (1998) Local adenovirus-mediated transfer of human endothelial nitric oxide synthetase reduces luminal narrowing after coronary angioplasty in pigs. Circulation 98: 919-926.
Wadell G (1984) Molecular Epidemiology of human adenoviruses Curr. Top. Microbiol.Immunol. 110, 191-220.
Wickham T.J., Carrion M.E. and Kovesdi I., 1995. Targeting of 10 adenovirus penton base to new receptors through replacement of its RGD motif with other receptor-specific peptide motifs. Gene Therapy 2: 750-756.
Wickham T.J., Segal, D.M., Roelvink, P.W., Carrion M.E., 15 Lizonova, A., Lee, G-M., and Kovesdi, I. (1996) Targeted adenovirus gene transfer to endothelial and smooth muscle cells by using bispecific antibodies. J. Virol. 70 (10), 6831-6838.
Wickham, T.J., Mathias, P., Cherish, D.A., and Nemerow, G.R. (1993) Integrins avb3 and avb5 promote adenovirus internalization but not virus attachment. Cell 73, 309-319.
Wijnberg, M.J., Quax, P.H.A., Nieuwenbroek, N.M.E., 25 Verheijen, J.H. (1997). The migration of human smooth muscle cells in vitro is mediated by plasminogen activation and can be inhibited by al- pha(2)- macro globulin receptor associated protein. Thromb. and Haemostas. 78, 880-886 .
Wold, W.S., Tollefson, A.E. and Hermiston, T.W. (1995) E3 transcription unit of adenovirus. In: W. Doerfler and P. Bohm (eds.), The molecular repertoire of adenoviruses I. Springer-Verlag, Berlin.

Claims (1)

  1. 57 Zabner, J., Armentano, D., Chillon, M., Wadsworth, S.C. and Welsh, M.J. (1998) Type 17 fiber enhances gene transfer Abstract 1st Annual Meeting American Society of Gene Therapy, Seattle, Washington. 4 y i is -58- Claims intellectual property office of n.z. 2 3 nov 2001 received 1 A gene delivery vehicle having been provided with a peptide or protein with at least a tissue tropism for smooth muscle cells, said gene delivery vehicle comprising a decreased tissue tropism for at least liver cells 2 A gene delivery vehicle according to claim 1 wherein said tissue tropism is being provided by a virus capsid. 3 A gene delivery vehicle according to claim 2, wherein said capsid comprises protein fragments from at least two different viruses. 4 A gene delivery vehicle according to claim 3, wherein at least one of said different viruses is an adenovirus. 5 A gene delivery vehicle according tQ claim 3 or claim 4, wherein at least one of said different viruses is 1 a subgroup B adenovirus 6 A gene dehvery vehicle according to any one of the claims 3-5, wherein at least one of said protein fragments comprises a tissue tropism determining fragment of a fiber protein derived from a subgroup B adenovirus 7 A gene dehvery vehicle according to claim 5 or claim 6, wherein said subgroup B adenovirus is adenovirus 16 8 A gene dehvery vehicle according to claim 5-7, wherein protein fragments not derived fiom a subgroup B adenovirus are derived from a subgroup C adenovirus, preferably of adenovirus 5. 9 A gene dehvery vehicle according to any one of the claims 1-8 comprising a nucleic acid derived from an adenovirus 10 , A gene dehvery vehicle according to any one of the claims 1-9 comprising a nucleic acid derived from at least two different adenoviruses. 11 A gene dehvery vehicle according to claim 9 or claim 10, wherein said nucleic acid comprises at least one sequence encoding a fiber protein comprising at Km 1 2 -59- intellectual property office of n.z. 2 3 nov 2001 received least a tissue tropism determining fragment of a subgroup B adenovirus fiber protein, preferably of adenovirus 16. ^ ' A gene delivery vehicle according to any one of claims 8-11 wherein said _ nucleic acid is modified such that the capacity of said r nucleic acid to replicate in a target cell has been reduced or disabled. A gene delivery vehicle according to any one of the claims 9-12 wherein said nucleic acid is modified such that the capacity of a host immune system to mount an immune response against adenovirus proteins encoded by said nucleic acid has been reduced or disabled. 14. A gene delivery vehicle according to any one of the claims 1-13, said gene delivery vehicle is _ a minimal adenovirus vector or an Ad/AAV chimaeric vector. 15 A gene delivery vehicle according to any one of the claims 1-14, further1 comprising at least one non-adenovirus nucleic acid. 16 A gene delivery vehicle according to claim 15 wherein at least one of said non-adenovirus nucleic acids is a gene selected from the group of genes encoding: an apolipoprotein, a nitric oxide synthase, a herpes simplex virus thymidine kinase, an interleukin-3, an interleukin-la, an (anti)angiogenesis protein such as angiostatin, an anti-proliferation protein, a smooth muscle cell anti-migration protein, a vascular endothelial growth factor (VEGF), a basic fibroblast growth factor, a hypoxia inducible factor la (HIF-la) or a PAI-1. 17. A cell for the production of a gene dehvery vehicle according to any one 0f the claims 1-16, comprising means for the assembly of said gene delivery vehicle wherein said means include a means for the production of an adenovirus fiber protein, wherein said adenovirus fiber protein comprises at least a tissue tropism determining fragment of a subgroup B adenovirus fiber protein. 18. A cell according to claim 17, wherein said cell is or is derived from a PER.C6 cell (ECACC deposit number 96022940). 19. i The use of a gene dehvery vehicle according to any one of the claims 1-17 for the preparation of a medicament for the treatment of cardiovascular disease. / 4- -60- intellectual property office of n.z. 2 3 nov 2001 received 20. The use of claim _ 19, . wherein said cardiovascular disease is treatable by transfer of a therapeutic nucleic acid to smooth muscle cells. 21 , An adenovirus capsid with or provided with a tissue tropism for smooth muscle cells wherein said capsid preferably comprises proteins from at least two different adenoviruses and wherein at least a tissue tropism determining fragment of a fiber protein is derived from a subgroup B adenovirus, preferably of adenovirus 16. 22. An adenovirus capsid having been deprived of a tissue tropism for liver cells wherein said capsid preferably comprises proteins from at least two different adenoviruses and wherein at least a tissue tropism determining fragment of a fiber protein is derived from a subgroup B adenovirus, preferably of adenovirus 16. - 23 The use of an adenovirus capsid according to claim 21 or claim 22 in a gene dehvery vehicle for the preparation of a medicament for the treatment of a disease, wherein said disease is treatable by dehvery of nucleic acid to smooth muscle cells. 24. Construct pBr/Ad.BamRAFib, comprising adenovirus 5 sequences 21562-31094 and 32794-35938. 25. Construct pBr/AdBamRfibl6, comprising adenovirus 5 sequences 21562-31094 and 32794-35938, further comprising an adenovirus 16 gene encoding fiber protein. 26 Construct pBr/AdBamR.pac/fibl6, comprising adenovirus 5 sequences 21562-31094 and 32794-35938, further comprising an adenovirus 16 gene encoding fiber protein, and further comprising a unique PacI-site in the proximity of the adenovirus 5 right terminal repeat, in the non-adenovirus sequence backbone of said construct. 27 Construct pWE/Ad.AflIIrITRfibl6, comprising adenovirus 5 sequences 3534-31094 ,and 32794-35938, further comprising an adenovirus 16 gene encoding fiber protein. 28 Construct pWE/Ad.AfHlrITRDE2Afibl6, comprising adenovirus 5 sequences 3534-22443, 24033-31094 and 32794-35938, further comprising an adenovirus 16 gene encoding fiber protein. L'^ i. i -*J V -61- intellectual property office of n.z. 2 3 nov 2001 received ^ The use of a construct according to any one the claims 24-28 for the generation of a gene dehvery vehicle according to any one of the claims 1-16 or an adenovirus capsid according to claim 21 or claim 22. 30 /The production of a gene dehvery vehicle according to anvone of the claims 1-17 or. >an adenovirus capsid according to claim 21 or claim 22. 31 The use of a fiber protein of adenovirus 16 in a gene delivery vehicle for the preparation of a medicament for the treatment of a disease, wherein said disease is treatable by dehvery of nucleic acid to smooth muscle cells. 32. The use of a fiber protein of adenovirus 16 in an adenovirus capsid for depriving said capsid of a tissue tropism for liver cells. END OF CLAIMS Figure 2 BamHI Ndel Sbfl Fiber ITR NY-UP f NY-DOWN PCR fragment y r ; Ndel Nsil Sbfl NY-UP 5'-CGA CAT ATG TAG ATG CAT TAG TTT GTG TTA TGT TTC A AC GTG-3' Ndel Nsil NY-DOWN . 5-GGA GAC CAC TGC CAT GTT G-3' Figure 3 Figure 4A: Sequence of Ad5 fiber ATGAAGCGCGCAAGACCGTCTGAAGATACCTTCAACCCCGTGTATCCATAjtGACACGGAAjft.CCGGTC CTCCAACTGTGCCTTTTCTTACTCCTCCCTTTGTATCCCCCAATGGGTTTCAAGAGAGTCCCCCTGG GGTACTCTCTTTGCGCCTATCCGAACCTCTAGTTACCTCCAATGGCATGCTTGCGCTCAAAATGGGC AACGGCCTCTCTCTGGACGAGGCCGGCAACCTTACCTCCCAAAATGTAACCACTGTGAGCCCACCTC TCAAAAAAACCAAGTCAAACATAAACCTGGAAATATCTGCACCCCTCACAGTTACCTCAGAAGCCCT AACTGTGGCTGCCGCCGCACCTCTAATGGTCGCGGGCAACACACTCACCATGCAATCACAGGCCCCG CTAACCGTGCACGACTCCAAACTTAGCATTGCCACCCAAGGACCCCTCACAGTGTCAGAAGGAAAGC TAGCCCTGCAAACATCAGGCCCCCTCACCACCACCGATAGCAGTACCCTTACTATCACTGCCTCACC CCCTCTAACTACTGCCACTGGTAGCTTGGGCATTGACTTGAAAGAGCCCATTTATACACAAAATGGA AAACTAGGACTAAAGTACGGGGCTCCTTTGCATGTAACAGACGACCTAAACACTTTGACCGTAGCAA CTGGTCCAGGTGTGACTATTAATAATACTTCCTTGCAAACTAAAGTTACTGGAGCCTTGGGTTTTGA TTCACAAGGCAATATGCAACTTAATGTAGCAGGAGGACTAAGGATTGATTCTCAAAACAGACGCCTT ATACTTGATGTTAGTTATCCGTTTGATGCTCAAAACCAACTAAATCTAAGACTAGGACAGGGCCCTC TTTTTATAAACTCAGCCCACAACTTGGATATTAACTACAACAAAGGCCTTTACTTGTTTACAGCTTC AAACAATTCCAAAAAGCTTGAGGTTAACCTAAGCACTGCCAAGGGGTTGATGTTTGACGCTACAGCC ATAGCCATTAATGCAGGAGATGGGCTTGAATTTGGTTCACCTAATGCACCAAACACAAATCCCCTCA AAACAAAAATTGGCCATGGCCTAGAATTTGATTCAAACAAGGCTATGGTTCCTAAACTAGGAACTGG CCTTAGTTTTGACAGCACAGGTGCCATTACAGTAGGAAACAAAAATAATGATAAGCTAACTTTGTGG ACCACACCAGCTCCATCTCCTAACTGTAGACTAAATGCAGAGAAAGATGCTAAACTCACTTTGGTCT TAACAAAATGTGGCAGTCAAATACTTGCTACAGTTTCAGTTTTGGCTGTTAAAGGCAGTTTGGCTCC AATATCTGGAACAGTTCAAAGTGCTCATCTTATTATAAGATTTGACGAAAATGGAGTGCTACTAAAC AATTCCTTCCTGGACCCAGAATATTGGAACTTTAGAAATGGAGATCTTACTGAAGGCACAGCCTATA CAAACGCTGTTGGATTTATGCCTAACCTATCAGCTTATCCAAAATCTCACGGTAAAACTGCCAAAAG TAACATTGTCAGTCAAGTTTACTTAAACGGAGACAAAACTAAACCTGTAACACTAACCATTACACTA AACGGTACACAGGAAACAGGAGACACAACTCCAAGTGCATACTCTATGTCATTTTCATGGGACTGGT CTGGCCACAACTACATTAATGAAATATTTGCCACATCCTCTTACACTTTTTCATACATTGCCCAAGA ATAA . Figure 4B: Sequence of Ad5/fibl2 chimeric fiber atgaagcgcgcaagaccgtctgaagataccttcaaccccgtgtatccatatgacccatttgacacat cagacgtaccctttgttacacccccttttacttcttccaatggtcttcaagaaaaaccaccaggtgt attagcacttaattacaaagaccccattgtaactgaaaatggaacccttacactcaagctaggggac ggaataaaacttaatgcccaaggtcaacttacagctagtaataatatcaatgttttggagcccctta ccaacacctcacaaggtcttaaactttcttggagcgcccccctagcagtaaaggctagtgccctcac acttaacacaagagcgcccttaaccacaacggatgaaagcttagccttaataaccgcccctcccatt acagtagagtcttcgcgtttgggcttggccaccatagcccctctaagcttagatggaggtggaaacc taggtttaaatctttctgctcccctggacgttagtaacaacaatttgcatctcaccactgaaactcc cttagttgtaaattctagcggtgccctatctgttgctactgcagaccccataagtgttcgcaacaac gctcttaccctacctacggcagatccgttaatggtgagctccgatgggttgggaataagtgtcacta gtcccattacagtaataaacggttccttagccttgtctacaactgctcccctcaacagcacaggatc cactttaagtctgtctgttgccaatcctctgactatttcacaagacacattgactgtttccactggt aacggtcttcaagtgtcggggtctcaattagtaacaagaataggggatggtttaacattcgataatg gggtcatgaaagtaaacgttgccgggggaatgagaacttctggcggtagaataattttagatgttaa ttatccctttgatgcgagcaataacctgtccttaagacggggattgggactaatttataaccaatct acaaactggaacttaacaactgatattagtaccgaaaaaggtttaatgtttagtggcaatcaaatag ctcttaatgcaggtcaggggcttacatttaataatggccaacttagggttaagttgggagctggact tatttttgattcaaacaataacattgccttaggcagcagcagcaacactccatacgaccctctgaca ctgtggacaactcctgacccaccaccaaactgcagcctcatacaagagctagatgcaaaactcaccc tgtgcttaacaaaaaacggatctattgttaatggcattgtaagtttagtgggtgttaagggtaatct cctaaatatccaaagtactactaccactgtaggagtgcatttagtgtttgatgaacagggaagatta atcacatcaacccctactgccctggttccccaagcttcgtggggatatagacaaggccaatcagtgt ctaccaatactgttaccaatggtctaggttttatgcctaatgtgagtgcttaccctagaccaaatgc cagtgaggctaaaagccaaatggtaagtctcacgtacttacagggagatacatctaaacctataaca atgaaagttgcatttaatggcattacgtcgctaaatggatactctttaacattcatgtggtcaggtc tatcaaactatataaatcagcctttctctacaccatcctgctccttntcttacattgcccaagaata aatgcattag Figure 4C: Sequence of Ad5/fibl6 chimeric fiber ATGAAGCGCGCAAGACCGTCTGAAGATACCTTCAACCCCGTGTATCCATATGAAGATGAAAGCAGCT CACAACACCCCTTTATAAACCCTGGTTTCATTTCCTCAAATGGTTTTGCACAAAGCCCAGATGGAGT TCTAACTCTTAAATGTGTTAATCCACTCACTACCGCCAGCGGACCCCTCCAACTTAAAGTTGGAAGC AGTCTTACAGTAGATACTATCGATGGGTCTTTGGAGGAAAATATAACTGCCGAAGCGCCACTCACTA AAACTAACCACTCCATAGGTTTATTAATAGGATCTGGCTTGCAAACAAAGGATGATAAACTTTGTTT ATCGCTGGGAGATGGGTTGGTAACAAAGGATGATAAACTATGTTTATCGCTGGGAGATGGGTTAATA ACAAAAAATGATGTACTATGTGCCAAACTAGGACATGGCCTTGTGTTTGACTCTTCCAATGCTATCA CCATAGAAAACAACACCTTGTGGACAGGCGCAAAACCAAGCGCCAACTGTGTAATTAAAGAGGGAGA AGATTCCCCAGACTGTAAGCTCACTTTAGTTCTAGTGAAGAATGGAGGACTGATAAATGGATACATA ACATTAATGGGAGCCTCAGAATATACTAACACCTTGTTTAAAAACAATCAAGTTACAATCGATGTAA ACCTCGCATTTGATAATACTGGCCAAATTATTACTTACCTATCATCCCTTAAAAGTAACCTGAACTT TAAAGACAACCAAAACATGGCTACTGGAACCATAACCAGTGCCAAAGGCTTCATGCCCAGCACCACC GCCTATCCATTTATAACATACGCCACTGAGACCCTAAATGAAGATTACATTTATGGAGAGTGTTACT ACAAATCTACCAATGGAACTCTCTTTCCACTAAAAGTTACTGTCACACTAAACAGACGTATGTTAGC TTCTGGAATGGCCTATGCTATGAATTTTTCATGGTCTCTAAATGCAGAGGAAGCCCCGGAAACTACC GAAGTCACTCTCATTACCTCCCCCTTCTTTTTTTCTTATATCAGAGAAGATGACTGAATGCATTAG Figure 4D: Sequence of Ad5/fib28 chimeric fiber ATGTTGTTGCAGATGAAGCGCGCAAGACCGTCTGAAGATACCTTCAACCCCGTGTATCCATATGGCT ACGCGCGGAATCAGAATATCCCCTTCCTCACTCCCCCCTTTGTTTCTTCCGATGGATTCCAAAACTT CCCACCTGGGGTCCTGTCACTCAAACTGGCTGACCCAATCACCATCGCTAATGGGGATGTCTCACTC AAGTTGGGAGGCGGACTGACGGTGGAAAAAGAGTCTGGAAACTTAACTGTGAACCCTAAGGCTCCCT TGCAAGTTGCAAGTGGACAATTGGAATTAGCATATGATTCTCCATTTGATGTTAAAAACAATATGCT TACTCTTAAAGCAGGTCACGGCTTAGCAGTTGTAACGAAAGACAATACTGATTTACAACCACTAATG GGCACACTTGTTGTTTTAACTGGCAAAGGCATTGGCACTGGCACAAGTGCTCACGGTGGAACCATAG ATGTGAGAATAGGAAAAAACGGAAGTCTGGCATTTGACAAAAATGGAGATTTGGTGGCCTGGGATAA AGAAAATGACAGGCGCACTCTATGGACAACTCCAGACACATCTCCAAATTGCAAAATGAGTGAAGTC AAAGACTCAAAGCTTACTCTTATTCTTACAAAATGCGGAAGTCAAATTCTAGGAAGTGTATCTTTGC TTGCTGTAAAAGGAGAATATCAAAATATGACTGCCAGTACTAATAAGAATGTAAAAATAACACTGCT ATTTGATGCTAATGGAGTCTTGTTAGAAGGATCCAGTCTTGATAAAGAGTACTGGAACTTTAGAAAC AATGATTCTACTGTGTCTGGAAAATATGAAAATGCTGTTCCGTTCATGCCTAACATAACAGCTTATA AACCCGTCAATTCTAAAAGCTATGCCAGAAGTCACATATTTGGAAATGTATATATTGCTGCTAAGCC ATATAATCCAGTGGTTATTAAAATTAGCTTCAATCAAGAGACACAAAACAATTGTGTCTATTCTATA TCATTTGACTACACTTGCTCTAAAGAGTATACAGGTATGCAATTCGATGTTACATCTTTCACCTTCT CCTATATCGCCCAAGAATGAATGCATTAG Figure 4E: Sequence of Ad5/fib40-L chimeric fiber ATGTTGTTGCAGATGAAGCGCGCAAGACCGTCTGAAGATACCTTCAACCCCGTGTATCCATATGAAC ACTACAATCCCCTTGACATTCCATTTATTACACCCCCGTTTGCTTCCTCCAACGGCTTGCAAGAAAA ACCTCCGGGAGTCCTCAGCCTGAAATACACTGATCCACTTACAACCAAAAACGGGGCTTTAACCTTA AAATTGGGCACGGGACTAAACATTGATAAAAATGGAGATCTTTCTTCAGATGCTAGCGTGGAAGTTA GCGCCCCTATCACTAAAACCAACAAAATCGTAGGTTTAAATTACACTAAGCCTCTCGCTCTGCAAAA TAACGCGCTTACTCTTTCTTACAACGCGCCCTTTAACGTAGTAAATAATAATTTAGCTCTAAATATG TCACAGCCTGTTACTATTAATGCAAACAACGAACTTTCTCTCTTAATAGACGCCCCACTTAATGCTG ACACGGGCACTCTTCGCCTTCGAAGTGATGCACCTCTTGGACTAGTAGACAAAACACTAAAGGTTTT GTTTTCTAGCCCCCTCTATCTAGATAATAACTTTCTTACACTAGCCATTGAACGCCCGCTAGCTCTA TCCAGTAACAGAGCAGTGGCCCTTAAGTATTCACCACCTTTAAAAATAGAAAACGAAAACTTAACCC TAAGCACAGGCGGACCTTTTACTGTAAGCGGGGGAAATTTAAACCTGGCAACATCGGCACCCCTCTC CGTGCAAAACAATTCTCTCTCCTTAGGGGTTAACCCGCCTTTTCTCATCACTGACTCTGGATTAGCT ATGGACTTAGGAGACGGTCTTGCATTAGGTGGCTCTAAGTTAATAATCAATCTTGGTCCAGGTTTAC AAATGTCTAATGGAGCTATTACTTTAGCACTAGATGCAGCGCTGCCTTTGCAATATAAAAACAACCA ACTTCAACTCAGAATTGGCTCCGCGTCTGCTTTAATTATGAGCGGAGTAACACAAACATTAAACGTC AATGCCAATACCAGCAAAGGTCTTGCTATTGAAAATAACTCACTAGTTGTTAAGCTAGGAAACGGTC TTCGCTTTGATAGCTGGGGAAGCATAGCTGTCTCACCTACTACCACTACCCCTACCACCCTATGGAC CACCGCGGACCCGTCTCCTAACGCCACTTTTTATGAATCACTAGACGCCAAAGTGTGGCTAGTTTTA GTAAAATGCAACGGCATGGTTAACGGGACCATATCCATTAAAGCTCAAAAAGGCACTTTACTTAAAC CCACAGCTAGCTTTATTTCCTTTGTCATGTATTTTTACAGCGACGGAACGTGGAGGAAAAACTATCC CGTGTTTGACAACGAAGGGATACTAGCAAACAGTGCCACATGGGGTTATCGACAAGGACAGTCTGCC AACACTAACGTTTCCAATGCTGTAGAATTTATGCCTAGCTCTAAAAGGTATCCCAATGAAAAAGGTT CTGAAGTTCAGAACATGGCTCTTACCTACACTTTTTTGCAAGGTGACCCTAACATGGCCATATCTTT TCAGAGCATTTATAATCATGCAATAGAAGGCTACTCATTAAAATTCNCCTGGCGCGTTCGAAATAAT GAACGTTTTGACATCCCCTGTTGCTCATTTTCTTATGTAACAGAACAATAAATGCATTAG INTELLECTUAL PROPERTY OFFICE OF NZ - 7 DEC 1999 RECEIVED Seal Sail (6) Pvul BsrGI spel Fspl Ndel Hindlll Amp Ad5 bp 1-454 CMV promoter EcoRI (1178) BsrGI Sail (6428). Pmll- pAd5/Clipsal.Luc (8445 bp) Luciferase EcoRI (1833) Stul" Bst11071 Ad5 bp3511-6095 intron +polyA -PacI Clal -BamHI "Spel EcoRI (2978) "Notl Hpal Kpnl Aflll (3867) Avrll Figure 5 Figure 6: Generation of (chimaeric) adenoviruses I L1-L3 L4 E3 L5 Sail ITR PacI pAd5/Clipsal.Luc pBr/AdBamRAfibXX Cotransfection into PERC6 | rr~LT Ad5.LucfibXX Figure 7a Figure 7b 5000000 , S 4500000 CD 4000000 Cv 3500000 ^ It. W) £ 3000000 2500000 2000000 1500000 1000000 500000 22500 45000 90000 135000 HUVEC/ well Median Fluorescence of GFP expression per cell Figure 8a £ ■ i-H <L> 900000 800000 700000 o a, 600000 H 500000 400000 300000 200000 100000 0 12 16 28 40-L Recombinant Fiber virus Figure 8b <D 4-> o Oh 6D =L 10000 20000 40000 60000 80000 HUVsmc / well Median fluorescence of GFP expression Figure 8d a 1 <D O V-H 10000000 9000000 8000000 7000000 .6000000 ^ rl~ &Q 5000000 4000000 3000000 2000000 1000000 0 cl,,., 11 16 35 51 Recombinant Fiber virus Ad5. ntLacZ Negative control Figure 8e: Ad5Fiber 16.ntLacZ Ad5Fiber 51.ntLacZ Figure 8f Negative control Negative control Figure 8g Ad5. ntLacZ Ad5Fiber 16.ntLacZ Figure 8h Ad5.ntLacZ Ad5Fiber 16.ntLacZ Ad5Fiber 51.ntLacZ ISfti ' . , > Negative control Figure 9A Alignment Report of Untitled, using Clustal method with Weighted residue weight table Thursday, November 19.1998 18'25 1 AT GGC C AAA C G AG CTCGGCT A A GCA G C T Adl6 genbank.seq 1 ATGlTTGTTGlc a[g1a[tI g aIa G C G c!g c[aI aIg AlcfcldT CTGAAGATAl Ad5/fjbl6.seg 29 CCTTCAATCCGGTCTACCCCTATGAAGATGAAAGCAGCTC Adl6 genbank.seq 41 C C T T C A A0 C C0 G T@ T A0C C0T A T G A A G A T G A A A G C A G C T C Ad5/fibl6.seq 69 ACAACACCCCTTTATAAACCCTGGTTTCATTTCCTCAAAT Adl6 genbank.seq 81 ACAACACCCCTTTATAAACCCTGGTTTCATTTCCTCAAAT Ad5/flbl6.seq 109 GGTTTTGCACAAAGCCCAGATGGAGTTCTAACTCTTAAAT Adl6 genbank.seq 121 GGTTTTGCACAAAGCCCAGATGGAGTTCTAACTCTTAAAT Ad5/fibl6.seq 149 GTGTTAATCCACTCACTACCGCCAGCGGACCCCTCCAACT Adl6 genbank.seq 161 GTGTTAATCCACTCACTACCGCCAGCGGACCCCTCCAACT Ad5/fibl6.seq 189 TAAAGTTGGAAGCAGTCTTACAGTAGATACTATCGATGGG Adl6 genbank.seq 201 TAAAGTTGGAAGCAGTCTTACAGTAGATACTATCGATGGG Ad5/fibl6.seq 229 TCTTTGGAGGAAAATATAACTGCCGCAGCGCCACTCACTA Adl6 genbank.secq 241 TCTTTGGAGGAAAATATAACTGCC G0A GCGCCACTCACTA Ad5/f £bl6. seq 269 AAACTAACCACTCCATAGGTTTATTAATAGGATCTGGCTT Adl6 genbank.secq 281 AAACTAACCACTCCATAGGTTTATTAATAGGATCTGGCTT Ad5/fibl6.seq 309 GCAAACAAAGGATGATAAACTTTGTTTATCGCTGGGAGAT Adl6 genbank.seq 321 GCAAACAAAGGATGATAAACTTTGTTTATCGCTGGGAGAT Ad5/fii>16. seq 349 GGGTTGGTAACAAAGGATGATAAACTATGTTTATCGCTGG Adl6 genbank.seq 361 GGGTTGGTAACAAAGGATGATAAACTATGTTTATCGCTGG Ad5/fibl6.seq 389 GAGATGGGTTAATAACAAAAAATGATGTACTATGTGCCAA Adl6 genbank.seq 401 GAGATGGGTTAATAACAAAAAATGATGTACTATGTGCCAA Ad5/fibl6.seq 429 ACTAGGACATGGCCTTGTGTTTGACTCTTCCAATGCTATC Adl6 genbank.seq 441 ACTAGGACATGGCCTTGTGTTTGACTCTTCCAATGCTATC Ad5/fibl6 seq 469 ACCATAGAAAACAACACCTTGTGGACAGGCGCAAAACCAA Adl6 genbank.seq 481 ACCATAGAAAACAACACCTTGTGGACAGGCGCAAAACCAA Sd5/fibl6.seq 509 GCGCCAACTGTGTAATTAAAGAGGGAGAAGATTCCCCAGA Adl6 genbank.seq 521 GCGCCAACTGTGTAATTAAAGAGGGAGAAGATTCCCCAGA Ad5/fibl6.seq 549 CTGTAAGCTCACTTTAGTTCTAGTGAAGAATGGAGGACTG Adl6 genbank.seq 561 CTGTAAGCTCACTTTAGTTCTAGTGAAGAATGGAGGACTG Ad5/flbl6.seq I 1 589 ATAAATGGATACATAACATTAATGGGAGCCTCAGAATATA Adl6 genbank.seq 601 ATAAATGGATACATAACATTAATGGGAGCCTCAGAATATA Ad5/fibl6.seq 629 CTAACACCTTGTTTAAAAACAATCAAGTTACAATCGATGT Adl6 genbank.seq 641 CTAACACCTTGTTTAAAAACAATCAA' GTTACAATCGATGT Ad5/fibl6 .seq 669 AAACCTCGCATTTGATAATACTGGCCAAATTATTACTTAC Adl6 genbank.seq 681 AAACCTCGCATTTGATAATACTGGCCAAATTATTACTTAC Ad5/fibl6.seq 709 CTATCATCCCTTAAAAGTAACCTGAACTTTAAAGACAACC Adl6 genbank.seq 721 CTATCATCCCTTAAAAGTAACCTGAACTTTAAAGACAACC Ad5/fibl6.seq Figure 9A , eontd. Alignment Report of Untitled, using Clustal method with Weighted residue weight table Thursday, November 19, 1998 18 26 749 AAAACATGGCTACTGGAACCATAACCAGTGCCAAAGGCTT M16 genbank seq 761 AAAACATGGCTACTGGAACCATAACCAGTGCCAAAGGCTT Ad5/fii>16 .seq 789 CATGCCCAGCACCACCGCCTATCCATTTATAACATACGCC Sdl6 genbank.seq 801 CATGCCCAGCACCACCGCCTATCCATTTATAACATACGCC Ad5/flbl6.seq 1029 1041 CATGCCCAGCACCACCGCCTATCCATTTATAACATACGCC CATGCCCAGCACCACCGCCTATCCATTTATAACATACGCC ACTGAGACCCTAAATGAAGATTACATTTATGGAGAGTGTT Adl6 genbank seq ACTGAGACCCTAAATGAAGATTACATTTATGGAGAGTGTT Ad5/f£bl6.seq AATCTACCAATGGAACTCTCTTTCCACTAAAAGT ML6 genbank.seq AATCTACCAATGGAACTCTCTTTCCACTAAAAGT Ad5/fibl6.seq TACTGTCACACTAAACAGACGTATGTTAGCTTCTGGAATG Adl6 genbank.seq TACTGTCACACTAAACAGACGTATGTTAGCTTCTGGAATG Ad5/fibl6.seq GCCTATGCTATGAATTTTTCATGGTCTCTAAATGCAGAGG Adl6 genbank.seq GCCTATGCTATGAATTTTTCATGGTCTCTAAATGCAGAGG Ad5/fibl6.seq AAGCCCCGGAAACTACCGAAGTCACTCTCATTACCTCCCC A316 gienbank.seq 829 841 869 A C T A C A 881 A C T A C A 909 921 949 961 989 1001 AAGCCCCGGAAACTACCGAAGTCACTCTCATTACCTCCCC Ad5/fibl6.seq CTTCTTTTTTTCTTATATCAGAGAAGATGACTGA M16 genbank.seq CTTCTTTTTTTCTTATATCAGAGAAGATGACTGA Ad5/fibl6 seq Decoration 'Decoration #1' : Box residues that differ frctn Adl6 genbank.seq. Figure 9B Alignment Report or Untitled, using Clustal method with PAM250 residue weight table. Thursday, November 19, 1998 18"09 1 M A K R A R L S SU S F N P V Y P Y E D E s S S Q H P F I N Adl6 fiber protein GenBank 1 MQ K R A rSSEDS F N P V Y P Y E D E s s S Q H P F I N fldlfilA fib protein 30 P G F I S S N G F A Q S P D G V L T L K C V N P L T T A S G Adl6 fiber protein GeiBank 30 P G F I S S N G F A Q S P D G V L T L K C V N P L T T A S G Adl6A fib protein 60 60 90 90 120 120 PLQLKVGSSLTVDTIDGSLEENIT AJl A P L PLQLKVGSSLTVDTIDGSLEENITA T Adl6 fiber protein GenBank A P L T Adl6A fib protein KTNHSIG K T N H S I G LLIGSGLQTSDDKIitlibLliUBLV AOLb Hlber protei LLIGSGLQTKDDKLCLSLGDGLV Adl6A fib protein GSGLQTKDDKLCLSLGDGLV Adl6 fiber protein GenBank. TKDDKLCLSLGDGLITKNDVLCAKLGHGLV Adl6 fiber protein GenBank TKDDKLCLSLGDGLITKNDVLCAKLGHGLV Adl6A fib protein 150 150 F D S S N A I F D S S N A I TIENNTLWTGAKPSANCVIKEGE Adl6 fiber parotein GenBank TIENNTLWTGAKPSANCVIKEGE Adl6A fib protein 180 DSPDCKLTLVLVKNGGL INGYITLMGASEY Adl6 fiber protein GenBank 180 DSPDCKLTLVLVKNGGLINGYITLMGASEY Adl6A fib protein 210 TNTLFKNNQVTIDVNLAFDNTGQIITYLSS Adtl6 fiber protein GenBank 210 TNTLFKNNQVTIDVNLAFDNTGQIITYLSS Adl6A fib protein 240 LKSNLNFKDNQNMATGTITSAKGFMPSTTA Adl6 fiber protein GenBank 240 LKSNLNFKDNQNMATGTITSAKGFMPSTTA A316A fib protein 270 YPFITYATETLNEDYIYGECYYKSTNGTLF Adl6 fiber protein GenBank 270 YPFITYATETLNEDYIYGECYYKSTNGTLF AdlSA fib protein 300 PLKVTVTLNRRMLASGMAYAMNFSWSLNAE Adl6 fiber protein GenBank 300 PLKVTVTLNRRMLASGMAYAMNFSWSLNAE Adl6A fib protein 330 EAPETTEVTLITSPFFFSYIREDD 330 EAPETTEVTLITSPFFFSYIREDD Adl6 fiber protein GenBank Adl6A fib protein Decoration 'Decoration #1' Box residues that differ frcm the Consensus.
NZ501214A 1998-11-20 1999-11-22 Using adenovirus subgroup B vectors with deprived tissue tropism for liver cells provided by virus capsid NZ501214A (en)

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
EP98203921 1998-11-20

Publications (1)

Publication Number Publication Date
NZ501214A true NZ501214A (en) 2002-02-01

Family

ID=8234363

Family Applications (1)

Application Number Title Priority Date Filing Date
NZ501214A NZ501214A (en) 1998-11-20 1999-11-22 Using adenovirus subgroup B vectors with deprived tissue tropism for liver cells provided by virus capsid

Country Status (12)

Country Link
JP (1) JP4683682B2 (en)
AT (1) ATE296894T1 (en)
AU (1) AU770780B2 (en)
CA (1) CA2318492C (en)
DE (1) DE69925567T2 (en)
ES (1) ES2244145T3 (en)
IL (1) IL133032A (en)
MX (1) MXPA99010682A (en)
NO (1) NO995697L (en)
NZ (1) NZ501214A (en)
WO (1) WO2000031285A1 (en)
ZA (1) ZA997213B (en)

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6929946B1 (en) 1998-11-20 2005-08-16 Crucell Holland B.V. Gene delivery vectors provided with a tissue tropism for smooth muscle cells, and/or endothelial cells
AU776067B2 (en) * 1999-03-04 2004-08-26 Crucell Holland B.V. Means and methods for fibroblast-like or macrophage-like cell transduction
US6492169B1 (en) 1999-05-18 2002-12-10 Crucell Holland, B.V. Complementing cell lines
WO2001092547A2 (en) 2000-05-31 2001-12-06 University Of Saskatchewan Modified bovine adenovirus having altered tropism
AU2002223556A1 (en) * 2000-09-20 2002-04-02 Crucell Holland B.V. Transduction of dendritic cells using adenoviral vectors
US6905678B2 (en) * 2001-07-07 2005-06-14 Crucell Holland B.V. Gene delivery vectors with cell type specificity for mesenchymal stem cells
EP1482052A1 (en) * 2003-05-27 2004-12-01 Cytos Biotechnology AG Modified polypeptides for targeting cell-entry of the adenoviruses of subtype B
BR112019024813A2 (en) 2017-05-26 2020-06-09 Epicentrx Inc recombinant adenoviruses carrying transgenes

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5770442A (en) * 1995-02-21 1998-06-23 Cornell Research Foundation, Inc. Chimeric adenoviral fiber protein and methods of using same
ES2333425T5 (en) * 1995-06-15 2012-08-28 Crucell Holland B.V. Packaging systems for human recombinant adenovirus intended for gene therapy
CZ162398A3 (en) * 1995-11-28 1998-10-14 Gen Vec, Inc. Vectors and methods of gene transfer to cells
US5877011A (en) * 1996-11-20 1999-03-02 Genzyme Corporation Chimeric adenoviral vectors
FR2758822B1 (en) * 1997-01-30 1999-07-02 Centre Nat Rech Scient USE OF A POLYPEPTIDE AS A CELLULAR RECEPTOR OF ADENOVIRUS
FR2761689B1 (en) * 1997-04-02 1999-06-25 Transgene Sa MODIFIED ADENOVIRAL FIBER AND TARGET ADENOVIRUS

Also Published As

Publication number Publication date
WO2000031285A1 (en) 2000-06-02
JP4683682B2 (en) 2011-05-18
CA2318492A1 (en) 2000-06-02
DE69925567T2 (en) 2006-05-04
ATE296894T1 (en) 2005-06-15
IL133032A (en) 2007-06-03
NO995697L (en) 2000-05-22
ES2244145T3 (en) 2005-12-01
AU770780B2 (en) 2004-03-04
ZA997213B (en) 2000-05-22
DE69925567D1 (en) 2005-07-07
CA2318492C (en) 2010-05-11
AU5960099A (en) 2000-05-25
NO995697D0 (en) 1999-11-19
JP2000157289A (en) 2000-06-13
IL133032A0 (en) 2001-03-19
MXPA99010682A (en) 2002-03-08

Similar Documents

Publication Publication Date Title
US7968087B2 (en) Gene delivery vectors provided with a tissue tropism for smooth muscle cells, and/or endothelial cells
US6803234B2 (en) Gene delivery vectors with cell type specificity for primary human chondrocytes
US20050181507A1 (en) Gene delivery vectors with cell type specificity for mesenchymal stem cells
CA2364499C (en) Means and methods for fibroblast-like or macrophage-like cell transduction
AU2002315947A1 (en) Adenoviral vectors with cell type specificity for mesenchymal cells
US20060104953A1 (en) Methods and means for enhancing skin transplantation using gene delivery vehicles having tropism for primary fibroblasts, as well as other uses thereof
EP1020529B1 (en) Gene delivery vectors provided with a tissue tropism for smooth muscle cells, and/or endothelial cells
US6869936B1 (en) Means and methods for fibroblast-like or macrophage-like cell transduction
AU770780B2 (en) Gene delivery vectors provided with a tissue tropism for smooth muscle cells, and/or endothelial cells
EP1191105A1 (en) Gene delivery vectors provided with a tissue tropism for T-lymphocytes
EP1191104A1 (en) Gene delivery vehicles and use thereof in the preparation of a medicament and/or vaccine
AU2001294348B2 (en) Transduction of chondrocytes using adenoviral vectors
NZ527634A (en) Means and methods for synoviocyte cell transduction
AU2001294348A1 (en) Transduction of chondrocytes using adenoviral vectors

Legal Events

Date Code Title Description
PSEA Patent sealed
RENW Renewal (renewal fees accepted)
RENW Renewal (renewal fees accepted)
RENW Renewal (renewal fees accepted)
RENW Renewal (renewal fees accepted)
EXPY Patent expired