NO319856B1

NO319856B1 - Vaccine to alleviate the symptoms of, or prevent the onset of, IgE-mediated allergic reactions in a mammal, and use of the amino acid sequence from the constant CH2-CH3 domains in the epsilon chain to produce a vaccine against IgE-mediated allergic reactions.

Info

Publication number: NO319856B1
Application number: NO19941096A
Authority: NO
Inventors: Lars T Hellman
Original assignee: Lars T Hellman
Priority date: 1991-09-26
Filing date: 1994-03-25
Publication date: 2005-09-26
Also published as: NO941096L; NO941096D0

Description

Foreliggende oppfinnelse angår vaksine for å lindre symptomene ved, eller forhindre inntreden av, IgE-formidlede, allergiske reaksjoner hos et pattedyr,samt anvendelse av aminosyresekvensen fra de konstante CH2-CH3-domener i epsilon-kjeden for fremstilling av en vaksine mot IgE-formidlede allergiske reaksjoner. Selv om foreliggende oppfinnelse generelt angår en vaksine til anvendelse på et pattedyr, angår en foretrukket utførelsesform derav en vaksine til anvendelse på mennesker, og derfor vil foreliggende oppfinnelse i det etter-følgende beskrives generelt med referanse til en slik vaksine til anvendelse på mennesker. The present invention relates to a vaccine to alleviate the symptoms of, or prevent the onset of, IgE-mediated allergic reactions in a mammal, as well as the use of the amino acid sequence from the constant CH2-CH3 domains in the epsilon chain for the production of a vaccine against IgE-mediated allergic reactions. Although the present invention generally relates to a vaccine for use on a mammal, a preferred embodiment thereof relates to a vaccine for use on humans, and therefore the present invention will in the following be described generally with reference to such a vaccine for use on humans.

Bakgrunn for oppfinnelsen Background for the invention

IgE (immunglobulin E) er, til tross for dets vanligvis meget lave konsentrasjon i humant plasma {10-400 ng/ml)( en hovedårsak til hypersensitiviteter funnet innen den humane befolkning. Denne egenskap skyldes dets interaksjon med høy-affinitetsreseptoren for IgE på mastceller og basofile leukocytter. IgE (immunoglobulin E), despite its usually very low concentration in human plasma {10-400 ng/ml)() is a major cause of hypersensitivity found within the human population. This property is due to its interaction with the high-affinity receptor for IgE on mast cells and basophilic leukocytes.

Tverrbinding av to IgE-reseptorer på overflaten av disse celletyper, ved allergenbinding, initierer frigivelsen av et antall fysiologisk aktive stoffer, slik som histamin, PAF (blodplateaktiverende faktor), heparin, kjemotaktiske fak-torer for eosinofile og nøytrofile granulocytter, leukotri-ener, prostaglandiner og tromboksaner. Det er disse formidlere som forårsaker de direkte symptomer for IgE-formidlede, allergiske reaksjoner (type I hypersensitivitet). Sykdomstilstander som tilhører denne gruppe, inkluderer de fleste typer av astma, pelsallergier, pollenallergier, mange typer mataller-gier og visse typer eksem. Cross-linking of two IgE receptors on the surface of these cell types, upon allergen binding, initiates the release of a number of physiologically active substances, such as histamine, PAF (platelet activating factor), heparin, chemotactic factors for eosinophil and neutrophil granulocytes, leukotrienes, prostaglandins and thromboxanes. It is these mediators that cause the direct symptoms of IgE-mediated allergic reactions (type I hypersensitivity). Disease conditions belonging to this group include most types of asthma, fur allergies, pollen allergies, many types of food allergies and certain types of eczema.

Høyaffinitetsreseptoren for IgE er blitt karakterisert på både protein- og gennivå i mus, rotte og menneske (Kinet et al., 1987; Shimizu et al., 1988; Tepler et al., 1989; Blank et al., 1989; Kinet et al., 1989). Denne reseptor er antagelig til stede kun på mastceller og basofile leukocytter i menneskekroppen. Reseptoren er et kompleks av tre forskjellige subenheter, de såkalte a-, J3- og y-kjeder. Det er a-kjeden, hovedsakelig lokalisert ekstracellulært, som reagerer med IgE-molekylet. The high-affinity receptor for IgE has been characterized at both protein and gene level in mice, rats and humans (Kinet et al., 1987; Shimizu et al., 1988; Tepler et al., 1989; Blank et al., 1989; Kinet et al. ., 1989). This receptor is presumably present only on mast cells and basophilic leukocytes in the human body. The receptor is a complex of three different subunits, the so-called α-, J3- and γ-chains. It is the α-chain, mainly located extracellularly, that reacts with the IgE molecule.

Detaljerte undersøkelser angående området av epsilon-kjeden av IgE-molekylet som reagerer med høyaffinitetsresep-toren for IgE, har vist at et område på 76 aminosyrer ved grensen mellom CH2- og CH3-domenene (CH = konstante domener i den tunge kjede) er av avgjørende betydning for reaksjonen mellom IgE-molekylet og dets høyaffinitetsreseptor. Detailed investigations concerning the region of the epsilon chain of the IgE molecule that reacts with the high-affinity receptor for IgE have shown that a region of 76 amino acids at the boundary between the CH2 and CH3 domains (CH = heavy chain constant domains) is of crucial for the reaction between the IgE molecule and its high-affinity receptor.

Dette peptid er in vitro vist å være i stand til å inhibere reaksjonen mellom nativt IgE og dets høyaffinitets-reseptor i et molart forhold på nesten 1:1 sammenlignet med det totale CH2-CH3-CH4-område (Helm et al., 1988). Peptidet er også vist å være i stand til å inhibere en IgE-formidlet opp-blussingsreaksjon i allergenstimulering. I dette tilfellet er imidlertid konsentrasjonen ca. 10 ganger høyere enn konsentrasjonen som tilveiebringer den samme inhiberende effekt med nativt IgE (Helm et al., 1989). This peptide has been shown in vitro to be able to inhibit the reaction between native IgE and its high-affinity receptor in a molar ratio of nearly 1:1 compared to the total CH2-CH3-CH4 region (Helm et al., 1988). . The peptide has also been shown to be able to inhibit an IgE-mediated flare reaction in allergen stimulation. In this case, however, the concentration is approx. 10 times higher than the concentration that provides the same inhibitory effect with native IgE (Helm et al., 1989).

Når IgE-molekylet bindes til sin reseptor, vil visse områder av epsilon-kjeden blokkeres med hensyn til interaksjon med andre molekyler, slik som f.eks. antistoffer rettet mot epitoper innen det samme område av IgE-molekylet. IgE-antistoffet kan da kun bindes til enten et IgE-antistoff mot CH2-CH3-området av IgE-molekylet, eller til reseptoren, og således aldri til begge disse molekyler samtidig. Antistoffer som bindes til epitoper utenfor området som direkte reagerer med reseptoren, vil i motsetning til de ovennevnte, forårsake tverrbinding av IgE-molekylene som er bundet til overflaten av en mastcelle. I dette tilfellet vil det forekomme en meget sterk frigivelse av granuler og et anafylaktisk sjokk hos sub-jektet hvori et slikt antistoff injiseres. Antistoffene som binder seg til reseptorbindingsdelen, vil, i motsetning til dette, ikke være i stand til å tverrbinde disse reseptorer, og det oppstår ingen umiddelbar reaksjon, men en effekt av den mer forlengede reduksjon av konsentrasjonen av fritt sirkulerende IgE. Dette vil formodentlig forhindre frigivelse av granuler ved at IgE-antistoffer ikke lenger er til stede i subjektets plasma. When the IgE molecule binds to its receptor, certain areas of the epsilon chain will be blocked with regard to interaction with other molecules, such as e.g. antibodies directed against epitopes within the same region of the IgE molecule. The IgE antibody can then only bind to either an IgE antibody against the CH2-CH3 region of the IgE molecule, or to the receptor, and thus never to both of these molecules at the same time. Antibodies that bind to epitopes outside the area that directly react with the receptor will, in contrast to those mentioned above, cause cross-linking of the IgE molecules that are bound to the surface of a mast cell. In this case, there will be a very strong release of granules and an anaphylactic shock in the subject into which such an antibody is injected. The antibodies that bind to the receptor-binding part, in contrast, will not be able to cross-link these receptors, and no immediate reaction occurs, but an effect of the more prolonged reduction of the concentration of free circulating IgE. This will presumably prevent the release of granules by the fact that IgE antibodies are no longer present in the subject's plasma.

Disse anti-IgE-antistoffer vil formodentlig også mer varig slå ut den IgE-produserende B-cellepopulasjon, hvilket øker muligheten for å oppnå en mer langvarig undertrykkelse av IgE-syntesen. Under perioder med kraftige pollenangrep vil da antistoffene binde og fullstendig eliminere forrådet av IgE som er årsaken til den sterke inflammatoriske reaksjon hos pollenallergiske subjekter. Et antall observasjoner indikerer at ikke-allergiske subjekter har en forholdsvis høy konsentrasjon av endogene anti-IgE-antistoffer, hvilket antas å ha en lignende allergiinhiberende effekt. These anti-IgE antibodies will presumably also knock out the IgE-producing B-cell population more permanently, which increases the possibility of achieving a longer-lasting suppression of IgE synthesis. During periods of strong pollen attacks, the antibodies will bind and completely eliminate the supply of IgE, which is the cause of the strong inflammatory reaction in pollen-allergic subjects. A number of observations indicate that non-allergic subjects have a relatively high concentration of endogenous anti-IgE antibodies, which is believed to have a similar allergy-inhibiting effect.

Virkningen av vaksinen ifølge foreliggende oppfinnelse er basert på dens evne til å indusere en immunrespons mot kroppens,eget IgE, hvilket av denne grunn vil forhindre bindingen av IgE-antistoffene til disse reseptorer. Av denne årsak vil frigivelsen av de allergiinduserende stoffer lagret i mastcellene, forhindres. The effect of the vaccine according to the present invention is based on its ability to induce an immune response against the body's own IgE, which will therefore prevent the binding of the IgE antibodies to these receptors. For this reason, the release of the allergy-inducing substances stored in the mast cells will be prevented.

Foreliggende oppfinnelse omfatter vaksine for å lindre symptomene ved, eller forhindre inntreden av, IgE-formidlede, allergiske reaksjoner hos et pattedyr, kjennetegnet ved at den omfatter et immunogent konjugat, omfattende et heterologt bærerprotein til hvilket det er koblet et protein som har (a) hele aminosyresekvensen for de konstante CH2-CH3-domener i epsilonkjeden av IgE-molekylet fra den aktuelle pattedyrart, eller (b) en strukturelt stabil enhet av denne aminosyresekvens inneholdende mer enn 12 aminosyrer, hvori nevnte hele aminosyresekvens eller nevnte strukturelt stabile enhet derav er i sin opprinnelige eller i en lett mutert eller multimerisert form, videre kjennetegnet ved at når pattedyret injiseres med det immunogene konjugat, produserer det polyklonale antistoffer som har evnen til å binde til sirkulerende, nativt IgE og hvori slike polyklonale antistoffer er rettet mot og har evnen til samtidig å binde til ulike epitoper innen CH2-CH3-området av et IgE-antistoff, og er også kjennetegnet ved at vaksinen eventuelt kan inneholde et adjuvans. Også omfattet av oppfinnelsen er anvendelse av hele aminosyresekvensen for de konstante CH2-CH3-domener i epsilonkjeden i IgE-molekylet fra en pattedyrart, eller en strukturelt stabil enhet av denne aminosyresekvens inneholdende mer enn 12 aminosyrer, i dens opprinnelige eller i en lett mutert eller multimerisert form, for fremstilling av en vaksine mot IgE-formidlede, allergiske reaksjoner i de aktuelle pattedyrarter, hvori administreringen av vaksinen til pattedyret muliggjør at pattedyret etter å ha mottatt nevnte immunogene konjugat ved injeksjon, produserer polyklonale antistoffer som har evne til å binde til sirkulerende, nativt IgE, hvor i slike polyklonale antistoffer er rettet mot og har evnen til å binde samtidig til ulike epitoper innen CH2-CH3-området av et IgE-antistoff. The present invention comprises a vaccine to alleviate the symptoms of, or prevent the onset of, IgE-mediated allergic reactions in a mammal, characterized in that it comprises an immunogenic conjugate, comprising a heterologous carrier protein to which is linked a protein having (a) the entire amino acid sequence for the constant CH2-CH3 domains in the epsilon chain of the IgE molecule from the relevant mammalian species, or (b) a structurally stable unit of this amino acid sequence containing more than 12 amino acids, wherein said entire amino acid sequence or said structurally stable unit thereof is in its original or in a slightly mutated or multimerized form, further characterized in that when the mammal is injected with the immunogenic conjugate, it produces polyclonal antibodies having the ability to bind to circulating, native IgE and wherein such polyclonal antibodies are directed against and have the ability to simultaneously binding to various epitopes within the CH2-CH3 region of an IgE antibody, and is also characterized by the fact that the vaccine may possibly contain an adjuvant. Also covered by the invention is the use of the entire amino acid sequence for the constant CH2-CH3 domains in the epsilon chain of the IgE molecule from a mammalian species, or a structurally stable unit of this amino acid sequence containing more than 12 amino acids, in its original form or in a slightly mutated or multimerized form, for the production of a vaccine against IgE-mediated allergic reactions in the relevant mammalian species, in which the administration of the vaccine to the mammal enables the mammal, after receiving said immunogenic conjugate by injection, to produce polyclonal antibodies capable of binding to circulating , native IgE, where in such polyclonal antibodies are directed against and have the ability to bind simultaneously to different epitopes within the CH2-CH3 region of an IgE antibody.

Kjent teknikk Known technique

A. Reseptorbindingspeptider og andre reseptorantagonister A. Receptor binding peptides and other receptor antagonists

I dag arbeider flere forskningsgrupper over hele verden med å fremstille korte peptider eller andre molekyler med evnen til å bindes til IgE-reseptoren og derved forhindre binding av antigen-spesifikt IgE. Disse stoffer forventes da å være i stand til å anvendes som legemidler ved behandling av allergier. Today, several research groups around the world are working to produce short peptides or other molecules with the ability to bind to the IgE receptor and thereby prevent the binding of antigen-specific IgE. These substances are then expected to be able to be used as medicines in the treatment of allergies.

Problemet i dette tilfelle er den store vanskelighet med å erholde et molekyl som har en bindingsstyrke til reseptoren som tilsvarer den meget sterke interaksjon mellom det native IgE-molekyl og dets reseptor. For å erholde et effek-tivt preparat må det formodentlig arbeides med stoffer som bindes irreversibelt til reseptoren. Slike stoffer er imidlertid forholdsvis toksiske fordi de kan bindes kovalent og blokkere andre strukturelt lignende molekyler i kroppen. Av interesse i denne sammenheng er at IgE-reseptorens a-kjede tilhører en større genfamilie hvor blant annet flere av de forskjellige IgG Fc-reseptorer er inneholdt. Disse reseptorer er absolutt nødvendige for kroppens forsvar mot blant annet bakterieinfek-sjoner. Molekyler aktiverte for kovalent binding, er dessuten ofte forholdsvis ustabile, og derfor må de formodentlig administreres flere ganger pr. dag og da i forholdsvis høye konsentrasjoner for å gjøre det mulig å fullstendig blokkere det kontinuerlig fornyende forråd av IgE-reseptorer på mastceller og basofile leukocytter. The problem in this case is the great difficulty in obtaining a molecule that has a binding strength to the receptor that corresponds to the very strong interaction between the native IgE molecule and its receptor. In order to obtain an effective preparation, it is presumably necessary to work with substances that bind irreversibly to the receptor. However, such substances are relatively toxic because they can bind covalently and block other structurally similar molecules in the body. Of interest in this context is that the IgE receptor's a-chain belongs to a larger gene family in which, among other things, several of the different IgG Fc receptors are contained. These receptors are absolutely necessary for the body's defense against, among other things, bacterial infections. Molecules activated for covalent binding are also often relatively unstable, and therefore they probably have to be administered several times per day and then in relatively high concentrations to make it possible to completely block the continuously renewing supply of IgE receptors on mast cells and basophilic leukocytes.

B. Anti- IgE- monoklonale antistoffer for behandling av allergi B. Anti-IgE monoclonal antibodies for the treatment of allergy

Et bioteknologifirma i USA arbeider etter en modell som involverer produksjon av monoklonale antistoffer i mus A biotechnology company in the United States is working on a model that involves the production of monoclonal antibodies in mice

rettet mot IgE-reseptorbindingsområdet av det humane IgE-molekyl. Disse antistoffer blir deretter "humanisert" ved hjelp av genteknikk ved at de konstante områder av det muse-monoklonale antistoff erstattes med de tilsvarende humane områder. Disse targeting the IgE receptor binding region of the human IgE molecule. These antibodies are then "humanized" by means of genetic engineering by replacing the constant regions of the mouse monoclonal antibody with the corresponding human regions. These

antistoffer må deretter fremstilles i ren form i stor skala for å kunne anvendes til injeksjon. Humaniseringen utføres for å redusere kroppens immunreaksjon mot disse antistoffer, noe som ellers, etter den andre eller tredje injeksjon, vil forårsake en massiv dannelse av immunkompleks som kan føre til direkte livstruende komplikasjoner. antibodies must then be produced in pure form on a large scale in order to be used for injection. The humanization is carried out to reduce the body's immune reaction against these antibodies, which otherwise, after the second or third injection, will cause a massive formation of immune complex which can lead to directly life-threatening complications.

For behandling av pollenallergiske personer vil det antakeligvis være nødvendig å injisere disse antistoffer én eller flere ganger pr. uke under perioder med høye pollenkon-sentrasjoner. Problemet med injeksjon av monoklonale antistoffer er at de, selv om de er "humanisert", vil inneholde høye konsentrasjoner av nye epitoper som kroppen aldri tidligere er blitt utsatt for, og antagelig vil høye antistofftitere mot disse monoklonale antistoffer forekomme forholdsvis hurtig. Dette vil formodentlig, på samme måte som for muse-monoklonale antistoffer, frembringe livstruende komplikasjoner ved immun-kompleksdannelse, fordi de monoklonale antistoffer fremdeles inneholder "rammeverk"-områdene fra muse-V-området. For å unngå disse komplikasjoner vil det antakeligvis være nødvendig å anvende et meget stort utvalg av humaniserte antistoffer som vellykket kan alterneres under behandlingsforløpet. Selv om de administreres meget nøyaktig, vil de imidlertid hele tiden følges av risikoen for når og i hvilken grad immunkomplekser vil dannes. For the treatment of people allergic to pollen, it will probably be necessary to inject these antibodies one or more times per week during periods of high pollen concentrations. The problem with injecting monoclonal antibodies is that, even if they are "humanised", they will contain high concentrations of new epitopes to which the body has never been previously exposed, and presumably high antibody titers against these monoclonal antibodies will occur relatively quickly. This will presumably, in the same way as for mouse monoclonal antibodies, produce life-threatening complications of immune complex formation, because the monoclonal antibodies still contain the "framework" regions from the mouse V region. To avoid these complications, it will probably be necessary to use a very large selection of humanized antibodies that can be successfully alternated during the course of treatment. Even if they are administered very accurately, however, they will always be accompanied by the risk of when and to what extent immune complexes will form.

C. Peptidvaksiner ( CH4- e) C. Peptide vaccines (CH4-e)

En forskningsgruppe ledet av dr. Stanworth, har ar-beidet etter en strategi som inkluderer anvendelsen av et humant peptid koblet til et heterologt bærerprotein for immunisering i kanin eller rotte. I eksperimentene beskrevet av dr. Stanworth, er det anvendt heterologt antiserum fra kanin for å behandle rotter. De har ikke vært i stand til å påvise noen immunrespons ved hjelp av ELISA i kaninene hvori anti-genet er injisert, noe som viser at immunresponsen, selv med et ikke-artsspesifikt peptid, er så svak at den ikke kan påvises med noen av de mest sensitive metoder som er kjent i dag (Stanworth et al., 1990). Forskningsgruppen anvender korte peptider fra et område som klart ligger utenfor reseptorbindingsdelen (CH2-CH3) av IgE-molekylet, hvilket derved er klart forskjellig fra foreliggende oppfinnelsesidé som vil beskrives i detalj nedenfor. En generell ufordelaktighet ved anvendelse av korte peptider er at de nesten fullstendig mangler evnen til å danne en stabil sekundærstruktur, hvilket antakeligvis også er en av årsakene til den meget svake immunrespons i modellsystemet til dr. Stanworth. A research group led by Dr. Stanworth has been working on a strategy that includes the use of a human peptide linked to a heterologous carrier protein for immunization in rabbits or rats. In the experiments described by Dr. Stanworth, heterologous rabbit antiserum has been used to treat rats. They have been unable to detect any immune response by ELISA in the rabbits injected with the antigen, showing that the immune response, even with a non-species-specific peptide, is so weak that it cannot be detected with any of the most sensitive methods known today (Stanworth et al., 1990). The research group uses short peptides from an area which is clearly outside the receptor binding part (CH2-CH3) of the IgE molecule, which is thereby clearly different from the present invention idea which will be described in detail below. A general disadvantage of using short peptides is that they almost completely lack the ability to form a stable secondary structure, which is probably also one of the reasons for the very weak immune response in Dr. Stanworth's model system.

EP 0403312 omfatter fremstilling av kanin- og museantistoffer mot human IgE ved anvendelse av et kort peptid fra det humane CH4-domenet på IgE. EP 0403312 comprises the production of rabbit and mouse antibodies against human IgE using a short peptide from the human CH4 domain of IgE.

Burt et al. { Mol. Immunol. 24:379-389, 1987) beskriver fremstilling av kaninantistoffer mot rotte-IgE ved anvendelse av et kort peptid fra rotte-CH3-domenet på IgE. Burt et al. { Mol. Immunol. 24:379-389, 1987) describes the production of rabbit antibodies against rat IgE using a short peptide from the rat CH3 domain of IgE.

EP 0303625 og Gold et al. (Int. Archs. Allergy Appl. Immun. 82:392-393, 1987) omfatter anvendelse av 76 aminosyrer fra CH2-CH3-domenene av IgE for å konkurrere med nativt IgE for binding til IgE-reseptorseter. EP 0303625 and Gold et al. (Int. Archs. Allergy Appl. Immun. 82:392-393, 1987) involves the use of 76 amino acids from the CH2-CH3 domains of IgE to compete with native IgE for binding to IgE receptor sites.

WO 9804834 omfatter anvendelse av et aminosyrepoly-peptid og 208 aminosyrer fra CH3-CH4-området av IgE for å konkurrerere med nativt IgE med hensyn til binding til lavaffinitets-IgE-reseptorseter på mastceller og basofiler. WO 9804834 encompasses the use of an amino acid polypeptide and 208 amino acids from the CH3-CH4 region of IgE to compete with native IgE for binding to low-affinity IgE receptor sites on mast cells and basophils.

EP 0396505 beskriver fremstilling av (a) rotteantistoffer mot muse-IgE, og (b) museantistoffer mot human IgE. Dette mothold omfatter også anvendelse av antistoffene som blokkerer binding av IgE til FC-reseptorer. EP 0396505 describes the production of (a) rat antibodies against mouse IgE, and (b) mouse antibodies against human IgE. This resistance also includes the use of the antibodies that block the binding of IgE to FC receptors.

Foreliggende oppfinnelse avviker fra omfanget av de ovennevnte publikasjoner ved at de blant annet tilveiebringer en vaksine som fører til produksjon av polyklonale antistoffer mot nativ IgE i et pattedyr. I tillegg fører de tilveiebrakte vaksiner til en anti-selv-IgE-respons som kan forebygge eller lindre allergiske reaksjoner. The present invention deviates from the scope of the above-mentioned publications in that, among other things, they provide a vaccine which leads to the production of polyclonal antibodies against native IgE in a mammal. In addition, the vaccines provided lead to an anti-self IgE response that can prevent or alleviate allergic reactions.

Mål for foreliggende oppfinnelse Objectives of the present invention

Målet for foreliggende oppfinnelse er å tilveiebringe en vaksine utformet for å lindre symptomene eller induksjonen av IgE-formidlede, allergiske reaksjoner i et pattedyr, inklu-dert menneske, hvilken vaksine induserer en immunrespons mot kroppens eget IgE og vil derved forhindre bindingen av IgE-antistof f er til IgE-reseptorene, hvorved frigivelsen av de allergiinduserende stoffer lagret i mastcellene, vil forhindres . The aim of the present invention is to provide a vaccine designed to relieve the symptoms or the induction of IgE-mediated allergic reactions in a mammal, including humans, which vaccine induces an immune response against the body's own IgE and will thereby prevent the binding of IgE antibody f is to the IgE receptors, whereby the release of the allergy-inducing substances stored in the mast cells will be prevented.

Sammendrag av oppfinnelsen Summary of the invention

Det ovenfor angitte mål oppnås ifølge foreliggende oppfinnelse ved hjelp av en vaksine som er kjennetegnet ved at den inneholder protein som inkluderer hele aminosyresekvensen for de konstante CH2-CH3-domener av epsilon-kjeden av IgE-molekylet fra de aktuelle pattedyrarter, eller en strukturelt stabil enhet av denne aminosyresekvens inneholdende mer enn 12 aminosyrer, i dens opprinnelige form eller i en mutert eller multimerisert form, hvor proteinet eventuelt er koblet til ett eller flere heterologe bærerproteiner, og eventuelt inneholdende et adjuvans. The above stated aim is achieved according to the present invention by means of a vaccine which is characterized in that it contains protein which includes the entire amino acid sequence for the constant CH2-CH3 domains of the epsilon chain of the IgE molecule from the relevant mammalian species, or a structurally stable unit of this amino acid sequence containing more than 12 amino acids, in its original form or in a mutated or multimerized form, where the protein is optionally linked to one or more heterologous carrier proteins, and optionally containing an adjuvant.

Foreliggende oppfinnelse angår også en fremgangsmåte for fremstilling av vaksinen og anvendelse av hele aminosyresekvensen for de konstante CH2-CH3-domener av epsilon-kjeden av IgE-molekylet fra en pattedyrart, eller en strukturelt stabil enhet av aminosyresekvensen inneholdende mer enn 12 aminosyrer, i dens opprinnelige eller i en mutert eller multimerisert form, for fremstilling av en vaksine mot IgE-formidlede, allergiske reaksjoner i den aktuelle pattedyrart. The present invention also relates to a method for producing the vaccine and using the entire amino acid sequence for the constant CH2-CH3 domains of the epsilon chain of the IgE molecule from a mammalian species, or a structurally stable unit of the amino acid sequence containing more than 12 amino acids, in its original or in a mutated or multimerized form, for the production of a vaccine against IgE-mediated allergic reactions in the relevant mammalian species.

Kort beskrivelse av figurene Brief description of the figures

De tilhørende figurer viser følgende: The associated figures show the following:

Figur la og lb viser antistoffresponsen (mengden av anti-IgE-antistoffer) i et panel av fire forskjellige rottestammer, ved hjelp av ELISA-måling av antistofftitere mot nativt rotte-IgE og mot humant IgE (som kontroll). Figur 2 viser undertrykkelsen av en IgE-formidlet, inflammatorisk reaksjon i en vaksinert rotte sammenlignet med en blindprøve-immunisert rotte ved injeksjon av polyklonalt ant i-IgE-ant i serum. Figures la and lb show the antibody response (amount of anti-IgE antibodies) in a panel of four different rat strains, by means of ELISA measurement of antibody titers against native rat IgE and against human IgE (as a control). Figure 2 shows the suppression of an IgE-mediated inflammatory reaction in a vaccinated rat compared to a blank immunized rat by injection of polyclonal ant i-IgE ant into serum.

Beskrivelse av foreliggende oppfinnelse Description of the present invention

Angivelsen at aminosyresekvensen (hele sekvensen eller deler derav) av de konstante CH2-CH3-domener er til stede i "mutert" form, betyr at aminosyrene i sekvensen kan være mutert ved henholdsvis direkte utskiftning eller ved deler inger og innføyeIser. En "ubetydelig" mutert form betyr da at hoveddelen av aminosyresekvensen fremdeles er sekvensen av proteinet i dets opprinnelige form, og at virkningen således er nesten den samme eller muligens noe redusert i forhold til den opprinnelige sekvens; proteinet med den "ubetydelig" mut-erte aminosyresekvens blir således fremdeles tolerert av kroppen og må derfor, i likhet med sin opprinnelige form, bli koblet, i overensstemmelse med foreliggende oppfinnelse, til et heterologt bærerprotein for å virke som et antigen. The indication that the amino acid sequence (the whole sequence or parts thereof) of the constant CH2-CH3 domains is present in "mutated" form means that the amino acids in the sequence can be mutated respectively by direct replacement or by parts and insertions. A "negligible" mutated form then means that the main part of the amino acid sequence is still the sequence of the protein in its original form, and that the effect is thus almost the same or possibly somewhat reduced compared to the original sequence; the protein with the "negligible" mutated amino acid sequence is thus still tolerated by the body and must therefore, like its original form, be linked, in accordance with the present invention, to a heterologous carrier protein in order to act as an antigen.

Med "kraftig" mutert form er det ment at utskiftnin-gen, deleringen og/eller innføyelsen av aminosyrer involverer et slikt inngrep i den opprinnelige aminosyresekvens at den virker som et antigen i seg selv fordi nye T-celle-epitoper dannes ved den utførte mutasjon mot hvilken kroppen ikke er tolerant; i dette tilfelle er det ikke nødvendig å koble proteinet til et heterologt bærerprotein. By "strongly" mutated form, it is meant that the replacement gene, the division and/or the insertion of amino acids involves such an intervention in the original amino acid sequence that it acts as an antigen in itself because new T-cell epitopes are formed by the carried out mutation to which the body is not tolerant; in this case it is not necessary to link the protein to a heterologous carrier protein.

Ved "multimerisert" form er det ment at aminosyresekvensen (hele sekvensen eller en del derav) av proteinet er polymerisert til en form inneholdende to eller flere gjen-takende enheter derav; ved denne prosedyre kan nye T-celle-epitoper dannes ved grensen mellom de atskilte enheter og muliggjør også at denne multimeriserte form av proteinet kan virke som et antigen i seg selv, hvorved enhver kobling til et heterologt bærerprotein ikke er nødvendig. By "multimerized" form, it is meant that the amino acid sequence (the entire sequence or part thereof) of the protein is polymerized into a form containing two or more repeating units thereof; by this procedure, new T-cell epitopes can be formed at the boundary between the separated units and also enables this multimerized form of the protein to act as an antigen in itself, whereby any linkage to a heterologous carrier protein is not necessary.

Den foretrukne utføreIsesform av foreliggende oppfinnelse er anvendelse av et protein hvor aminosyresekvensen (hele sekvensen eller en del derav) for de konstante CH2-CH3-domener av epsilon-kjeden av IgE-molekylet foreligger i sin opprinnelige form, idet proteinet er koblet til ett eller flere heterologe bærerproteiner, og derfor vil foreliggende oppfinnelse bli beskrevet i detalj i det etterfølgende med referanse til denne spesielle utførelsesform. The preferred embodiment of the present invention is the use of a protein in which the amino acid sequence (the whole sequence or part thereof) for the constant CH2-CH3 domains of the epsilon chain of the IgE molecule is in its original form, the protein being linked to one or several heterologous carrier proteins, and therefore the present invention will be described in detail in the following with reference to this particular embodiment.

Foreliggende oppfinnelse er basert på et fullstendig nytt konsept for å løse problemene forbundet med kjente metoder for immunisering mot IgE-formidlede, allergiske reaksjoner, ved at vaksinen ifølge foreliggende oppfinnelse har evnen til å indusere en immunrespons mot kroppens eget IgE. The present invention is based on a completely new concept to solve the problems associated with known methods of immunization against IgE-mediated allergic reactions, in that the vaccine according to the present invention has the ability to induce an immune response against the body's own IgE.

Ved å utløse at kroppen selv produserer en polyklonal anti-IgE-respons, erholdes antistoffer som er fullstendig artsspesifikke og derfor mye mindre immunogene. Disse antistoffer vil deretter binde det frie forråd av IgE som sirkulerer i kroppen og derved forhindre bindingen til IgE-reseptoren. Det faktum at immunresponsen er polyklonal og derved at antallet molekyler av den samme idiotype er meget lavt, vil forårsake den nesten fullstendige eliminering av problemet med en anti-idiotype-respons. By triggering the body itself to produce a polyclonal anti-IgE response, antibodies are obtained that are completely species-specific and therefore much less immunogenic. These antibodies will then bind the free supply of IgE circulating in the body and thereby prevent binding to the IgE receptor. The fact that the immune response is polyclonal and thus the number of molecules of the same idiotype is very low will cause the almost complete elimination of the problem of an anti-idiotype response.

Det faktum at fremgangsmåten beskrevet heri ikke er forsøkt i teknikken, er antakeligvis forbundet med problemet med hvordan en sterk IgG-respons mot kroppens eget IgE kan oppnås, fordi dette er et molekyl som kroppen har vært tolerant overfor siden fødselen og således ikke reagerer mot immunologisk. For å løse dette problem anvendes det ifølge foreliggende oppfinnelse en egenskap for immunsystemet som nesten ikke er kjent, men som på en enestående måte kan løse problemene som med stor sannsynlighet vil påvirke de monoklonale prosjekter. Ved å koble CH2-CH3-området (proteinet) til et ikke-artsspesifikt protein omgås toleransen av immunsystemet overfor kroppens eget IgE. Dette fører til tilgang av en ikke-tolererende T-cellepopulasjon som vanligvis kun ville ha frembrakt en antistoffrespons mot det fremmede molekyl utvalgt som bærer, men som også vil hjelpe B-celler til å prod-usere antistoffer mot artsspesifikt molekyl. Denne effekt oppnås ved å koble CH2-CH3-området direkte til bærerproteinet. The fact that the method described herein has not been tried in the art is probably connected to the problem of how a strong IgG response against the body's own IgE can be achieved, because this is a molecule to which the body has been tolerant since birth and thus does not react against immunologically . In order to solve this problem, according to the present invention, a characteristic of the immune system is used which is almost unknown, but which can in a unique way solve the problems which are very likely to affect the monoclonal projects. By linking the CH2-CH3 region (the protein) to a non-species-specific protein, the tolerance of the immune system to the body's own IgE is bypassed. This leads to access of a non-tolerant T-cell population which would normally only have produced an antibody response against the foreign molecule selected as a carrier, but which will also help B cells to produce antibodies against the species-specific molecule. This effect is achieved by connecting the CH2-CH3 region directly to the carrier protein.

Konsekvensene av dette fenomen er blitt nesten fullstendig ignorert i det immunologiske forskningsmiljøet, noe som kan forklare hvorfor ingen andre forskningsgrupper i verden har forsøkt en lignende fremgangsmåte. Da meget få eller ingen lignende undersøkelser er utført, har foreliggende oppfinner analysert i detalj muligheten til å anvende dette fenomen. I de utførte undersøkelser med kobling av peptider er det blitt anvendt humane peptider til injeksjon i kanin, mus eller rotte, og ikke peptider fra den samme dyreart, og årsaken til dette er den dominerende oppfatning at det ikke kan produseres en sterk immunrespons mot artsspesifikke molekyler. The consequences of this phenomenon have been almost completely ignored in the immunological research community, which may explain why no other research groups in the world have attempted a similar procedure. As very few or no similar investigations have been carried out, the present inventor has analyzed in detail the possibility of using this phenomenon. In the investigations carried out with coupling of peptides, human peptides have been used for injection into rabbits, mice or rats, and not peptides from the same animal species, and the reason for this is the dominant opinion that a strong immune response cannot be produced against species-specific molecules .

For å bekrefte at det ifølge foreliggende oppfinnelse kan oppnås en sterk immunrespons mot et artsspesifikt IgE, er det utført eksperimenter hvor et panel av rottestammer er immunisert med et fusjonsprotein inneholdende et bærermolekyl koblet til de fullstendige CH2-CH3-domener av IgE hos rotte In order to confirm that according to the present invention a strong immune response can be achieved against a species-specific IgE, experiments have been carried out in which a panel of rat strains are immunized with a fusion protein containing a carrier molecule linked to the complete CH2-CH3 domains of rat IgE

(eksempel 2). I disse rotter er det oppnådd (etter kun 4 uker) en sterk antistoffrespons mot nativt rotte-IgE, dvs. i form av IgE som sirkulerer i rotteplasmaet. Denne antistoffrespons har en styrke som kun er ubetydelig lavere ann nivået (av antistoff respons) som ved ELISA-målinger erholdes mot et fullstendig ikke-artsspesifikt protein, i dette tilfelle humant IgG (figur 1). (example 2). In these rats, a strong antibody response against native rat IgE has been achieved (after only 4 weeks), i.e. in the form of IgE circulating in the rat plasma. This antibody response has a strength that is only insignificantly lower than the level (of antibody response) obtained in ELISA measurements against a completely non-species-specific protein, in this case human IgG (figure 1).

Årsaken til at foreliggende oppfinner, i motsetning til dr. Stanworth, oppnår en slik sterk immunrespons, er formodentlig fordi det ved foreliggende oppfinnelse anvendes større områder enn peptider med en lengde på kun 10 aminosyrer, dvs. i dette tilfelle opp til de fullstendige CH2-CH3-domener. Dette er årsaken til at det erholdes et mye større antall epitoper, mot hvilke antistoffer kan dannes, og videre at disse epitoper foreligger i den samme konformasjon som i det native IgE-molekyl. The reason why the present inventor, in contrast to Dr. Stanworth, achieves such a strong immune response is presumably because the present invention uses larger areas than peptides with a length of only 10 amino acids, i.e. in this case up to the complete CH2- CH3 domains. This is the reason why a much larger number of epitopes are obtained, against which antibodies can be formed, and furthermore that these epitopes exist in the same conformation as in the native IgE molecule.

Ved "heterologt bærerprotein" er det heri ment ethvert ikke-artsspesifikt protein som helst ikke utviser for høy homologi med det tilsvarende protein i den art hvori proteinet skal anvendes som bærer. Proteiner som vanligvis ikke eksisterer i våre omgivelser, bør imidlertid unngås, fordi en meget sterk immunreaksjon kan forårsake problemer dersom mennesker ofte utsettes for dette protein. By "heterologous carrier protein" is meant here any non-species-specific protein which preferably does not exhibit too high a homology with the corresponding protein in the species in which the protein is to be used as a carrier. However, proteins that do not normally exist in our environment should be avoided, because a very strong immune reaction can cause problems if people are frequently exposed to this protein.

Ved å koble små peptider til et heterologt bærerprotein, oppnås vanligvis kun en forholdsvis svak immunrespons mot et meget begrenset område av molekylet. Peptider frem-kaller dessuten i meget høy grad en immunrespons som kun reagerer mot peptidet og ikke mot det tilsvarende område i det native protein. By connecting small peptides to a heterologous carrier protein, usually only a relatively weak immune response is achieved against a very limited area of the molecule. Peptides also evoke to a very high degree an immune response that only reacts against the peptide and not against the corresponding area in the native protein.

Det er viktig å oppnå en meget sterk immunrespons som dessuten gjenkjenner nativt IgE, fordi bindingskonstanten for interaksjonen mellom IgE-molekylet og høyaffinitetsreseptoren er meget høy og innenfor området 1 x 10"B til 2,6 x IO'<10> eller høyere (Froese, 1980). Ved oppnåelse etter immunisering av en polyklonal respons vil flere forskjellige antistoffer mot forskjellige epitoper innen CH2-CH3-området være i stand til samtidig å bindes til det samme IgE-antistoff. Dette gir oppnåelse av en meget høy kombinert bindingsstyrke for fritt IgE. Derved vil anti-IgE-antistoffene i vesentlig lettere grad, sammenlignet med tilfellet med et monoklonalt antistoff eller antistoffer dannet mot korte peptider, være i stand til å konkurrere om fritt IgE i den immuniserte person. Dette har stor betydning fordi interaksjonen mellom IgE og høyaffinitetsres-eptoren er meget sterk. Den oppfinneriske idé ved anvendelse av fullstendige domener eller strukturelt stabile deler derav, gir derfor en meget stor fordel og et fullstendig nytt konsept sammenlignet med de tidligere beskrevne peptidfremgangsmåter. It is important to achieve a very strong immune response which also recognizes native IgE, because the binding constant for the interaction between the IgE molecule and the high-affinity receptor is very high and within the range of 1 x 10"B to 2.6 x IO'<10> or higher (Froese , 1980).When a polyclonal response is achieved after immunization, several different antibodies against different epitopes within the CH2-CH3 region will be able to simultaneously bind to the same IgE antibody. This results in the achievement of a very high combined binding strength for free IgE. Thereby, the anti-IgE antibodies will be able to compete for free IgE in the immunized person much more easily, compared to the case of a monoclonal antibody or antibodies formed against short peptides. This is of great importance because the interaction between IgE and the high-affinity receptor is very strong. The inventive idea of using complete domains or structurally stable parts thereof, therefore provides a very strong r advantage and a completely new concept compared to the previously described peptide methods.

Antistoffresponsen mot peptider har ofte liten eller ingen affinitet for det tilsvarende aminosyreområdet i det native protein, hvilket betyr at den erholdte antistoffrespons mot fullstendige domener eller strukturelt stabile enheter av domener, medfører en avgjørende forskjell sammenlignet med tidligere fremgangsmåter i teknikken. The antibody response against peptides often has little or no affinity for the corresponding amino acid region in the native protein, which means that the obtained antibody response against complete domains or structurally stable units of domains entails a decisive difference compared to previous methods in the art.

Ved kun å anvende CH2-CH3-området (og ikke som tidligere beskrevet, heterologe CH4-peptider) av IgE-molekylet, vil kroppen etter immunisering nesten utelukkende danne antistoffer mot det område av IgE-molekylet som reagerer med IgE-reseptoren. I teorien foreligger det en risiko for at antistoffer mot den N-terminale del av CH2-domenet, eller den C-terminale del av CH3-domenet, kan forårsake et anafylaktisk sjokk hos pattedyrene hvori disse antistoffer dannes. Det variable område av antistoffet tilsvarer imidlertid størrelsen av et fullstendig domene, og i de fleste tilfeller vil det derfor oppnås sterisk hindring av reseptorbinding selv med slike antistoffer. I tillegg vil antistoffene mot et stort antall epitoper produseres kontinuerlig under oppbygning av immunresponsen, og derfor er antakeligvis sannsynligheten for at kun ett av disse meget få antistoffer alene skal binde et IgE-molekyl, meget lav. Flere dyretester har imidlertid vist at slike effekter av immuniseringen ikke kan påvises {se eksempel 2 nedenfor). Rottene med høye innhold av anti-CH2-CH3-antistoffer i blodet viser ingen tendens på symptomer på noe anafylaktisk sjokk. Fra et helsesynspunkt kan de ikke skjelnes fra dyr som kun er immunisert med adjuvans (uten antigen) eller fra dyr som er immunisert med humant IgG. Dette indikerer at i testdyr foreligger det ingen påviselige negative effekter av denne immunisering selv om dyrene har meget høye anti-IgE-titere. Det er derved den første gang at det er vist at det kan erholdes høye anti-IgE-titere mot artsspesifikt IgE. Disse rotter viser dessuten ingen påviselige negative effekter av denne behandling, noe som indikerer at behand-lingsprosedyren også med høy sannsynlighet kan anvendes uten komplikasjoner til behandling av mennesker. Disse data indikerer dessuten sterkt at det IgE-reseptorbundne IgE-forråd i disse rotter i realiteten ikke eksisterer. En sterk anafylaktisk reaksjon av anti-IgE-antistoffene som er i stand til å bindes til de tidligere nevnte ytre områder av CH2- og CH3-domenene, skulle ellers bli indusert selv om antistofftiteren er forholdsvis lav for slike antistoffer. Dette skyldes at mastcellene er meget sensitive selv overfor meget lave konsentrasjoner av tverrbindende antistoffer. I innledende under-søkelser er det vist at, ved immunisering, dyrene hvori høye anti-IgE-titere forekommer, har en meget sterkt redusert tendens til å frigi sine mastcellegranuler etter utfordring med anti-IgE-antistoffer (eksempel 3, figur 2). Foreliggende oppfinner utfører for tiden en større undersøkelse som innbefat-ter behandling av rotter som er gjort sterkt allergiske mot hønseovalbumin. Resultatene fra testene på rotter utført så langt, er meget lovende fra flere synspunkter fordi de viser at det erholdes en sterk immunrespons som ikke har noen påviselige negative effekter, og endelig at det oppnås en sterkt redusert frigivelse av granuler ved tilførsel av en polyklonal aktivator i disse rotter. By only using the CH2-CH3 region (and not, as previously described, heterologous CH4 peptides) of the IgE molecule, after immunization the body will almost exclusively form antibodies against the region of the IgE molecule that reacts with the IgE receptor. In theory, there is a risk that antibodies against the N-terminal part of the CH2 domain, or the C-terminal part of the CH3 domain, can cause an anaphylactic shock in the mammals in which these antibodies are formed. However, the variable region of the antibody corresponds to the size of a complete domain, and in most cases, steric hindrance of receptor binding will therefore be achieved even with such antibodies. In addition, the antibodies against a large number of epitopes will be produced continuously during the build-up of the immune response, and therefore the probability that only one of these very few antibodies alone will bind an IgE molecule is probably very low. However, several animal tests have shown that such effects of the immunization cannot be demonstrated (see example 2 below). The rats with a high content of anti-CH2-CH3 antibodies in the blood show no tendency towards symptoms of any anaphylactic shock. From a health point of view, they are indistinguishable from animals immunized only with adjuvant (without antigen) or from animals immunized with human IgG. This indicates that in test animals there are no demonstrable negative effects of this immunization even though the animals have very high anti-IgE titers. This is the first time that it has been shown that high anti-IgE titers against species-specific IgE can be obtained. These rats also show no demonstrable negative effects of this treatment, which indicates that the treatment procedure can also with high probability be used without complications for the treatment of humans. These data also strongly indicate that the IgE receptor-bound IgE store in these rats in reality does not exist. A strong anaphylactic reaction of the anti-IgE antibodies which are able to bind to the previously mentioned outer regions of the CH2 and CH3 domains would otherwise be induced even if the antibody titer is relatively low for such antibodies. This is because the mast cells are very sensitive even to very low concentrations of cross-linking antibodies. In initial investigations it has been shown that, upon immunization, the animals in which high anti-IgE titers occur have a very greatly reduced tendency to release their mast cell granules after challenge with anti-IgE antibodies (Example 3, Figure 2). The present inventor is currently carrying out a larger investigation which includes the treatment of rats that have been made highly allergic to chicken ovalbumin. The results of the tests on rats carried out so far are very promising from several points of view because they show that a strong immune response is obtained which has no detectable negative effects, and finally that a greatly reduced release of granules is obtained when a polyclonal activator is administered in these rats.

En vaksine av denne type kan møte visse vanskelig-heter. Én faktor som sterkt påvirker mulighetene, er konsentrasjonen av den forbindelse som ønskes fjernet fra kroppen. Høye konsentrasjoner betyr i dette tilfellet større vanskelig-heter. Dersom i denne sammenheng enhver av de andre immunglo-bulinisotyper ble utvalgt, ville problemet bli enda større på grunn av de generelt mye høyere plasmakonsentrasjoner av disse antistoffer. A vaccine of this type can face certain difficulties. One factor that greatly affects the possibilities is the concentration of the compound that is to be removed from the body. High concentrations in this case mean greater difficulties. If in this context any of the other immunoglobulin isotypes were selected, the problem would be even greater due to the generally much higher plasma concentrations of these antibodies.

I denne sammenheng, på grunn av dets lave plasma-nivåer, er IgE ideelt. Plasmanivåene i en normal populasjon av ikke-allergiske personer er fra 10 til 400 ng/ml. Denne mengde tilsvarer mindre enn 0,01% av den totale immunglobulinmengde i vårt blod. Disse nivåer er ofte noe forhøyet i allergiske personer, men overstiger meget sjelden 5 ug/ml. Som en sammenlig-ning kan det heri nevnes noen tester utført på mus hvor, ved anvendelse av antistoffer mot en av immunglobulinenes lette kjeder, det er blitt erholdt dyr som nesten fullstendig mangler denne type immunglobuliner. I disse tester, ved injeksjon av monoklonale antistoffer mot k-kjeden av muse-immunglobu-linet, tilsvarende ca. 95% av den totale immunglobulinmengde i mus, er det oppnådd et nesten fullstendig tap av disse antistoffer i musenes blod (Weiss et al., 1984). De resterende antistoffer funnet i mus, er nesten 100% av lg A-typen (den originale konsentrasjon av lg A er kun ca. 5%). Dette viser at, selv med betydelig høyere konsentrasjoner av forbindelsen som skal fjernes fra kroppen, foreligger det en mulighet til å fjerne dette materiale fra sirkulasjonen nesten fullstendig. In this context, due to its low plasma levels, IgE is ideal. Plasma levels in a normal population of non-allergic individuals range from 10 to 400 ng/ml. This quantity corresponds to less than 0.01% of the total immunoglobulin quantity in our blood. These levels are often somewhat elevated in allergic people, but very rarely exceed 5 ug/ml. As a comparison, some tests carried out on mice can be mentioned here where, by using antibodies against one of the light chains of the immunoglobulins, animals have been obtained which almost completely lack this type of immunoglobulins. In these tests, by injection of monoclonal antibodies against the k-chain of the mouse immunoglobulin, corresponding to approx. 95% of the total immunoglobulin amount in mice, an almost complete loss of these antibodies in the mice's blood has been achieved (Weiss et al., 1984). The remaining antibodies found in mice are almost 100% of the lg A type (the original concentration of lg A is only about 5%). This shows that, even with significantly higher concentrations of the compound to be removed from the body, there is a possibility to remove this material from the circulation almost completely.

En annen mulig komplikasjon er at ingenting er kjent om langtidsvirkningene ved å indusere en sterk autoimmunitet. En fordel er imidlertid at i dette tilfellet anvendes T-celler mot ikke-artsspesifikke molekyler for å danne en immunrespons mot et artsspesifikt antigen. Dersom vaksinasjonsprogrammet avsluttes, vil antistoffresponsen mot kroppens eget IgE lang-somt reduseres til ikke-påviselige nivåer etter noen måneder. Dette forekommer dersom man ikke forsterker med CH2-CH3 koblet til det samme bærermolekyl som anvendes ved den innledende vaksinasjon. Dette fenomen er vist ved mange detaljerte under-søkelser av mus hvor det er vist at den sekundære immunrespons mot haptener, koblet til forskjellige bærere, er fullstendig avhengig av det opprinnelig utvalgte bærermolekyl. Dersom noe subjekt av en usannsynlig uforutsigbar årsak reagerer negativt på denne immunisering, kan immuniseringen avsluttes, og antistofftiterne vil formodentlig nå upåviselige nivåer innen noen få måneder. Dette er lignende det som ville være tilfellet ved injeksjon av monoklonale antistoffer mot kroppens eget IgE. Another possible complication is that nothing is known about the long-term effects of inducing a strong autoimmunity. An advantage, however, is that in this case T cells are used against non-species-specific molecules to form an immune response against a species-specific antigen. If the vaccination program ends, the antibody response against the body's own IgE will slowly decrease to undetectable levels after a few months. This occurs if you do not amplify with CH2-CH3 linked to the same carrier molecule that is used in the initial vaccination. This phenomenon has been shown in many detailed studies of mice where it has been shown that the secondary immune response against haptens, linked to different carriers, is completely dependent on the originally selected carrier molecule. If any subject for an unlikely unforeseeable reason reacts negatively to this immunization, the immunization can be terminated and the antibody titers will presumably reach undetectable levels within a few months. This is similar to what would be the case when injecting monoclonal antibodies against the body's own IgE.

Det koblede protein anvendt som den viktigste be-standdel av anti-allergivaksinen, kan fra et teknisk stand-punkt fremstilles på to forskjellige måter. Én måte innbe-fatter produksjonen av et allerede koblet protein, et såkalt fusjonsprotein, i prokaryotiske eller eukaryotiske vertsceller. Som prokaryotiske vertsceller anvendes vanligvis bak-terien Escherichia coli, mens et stort antall forskjellige systemer, slik som gjærceller eller cellelinjer, kan anvendes som eukaryotiske vertsceller. Cellelinjene kan stamme fra insekter til mennesker. Menneskeceller blir imidlertid vanligvis unngått for klinisk anvendelse fordi det bestandig foreligger en risiko for forurensning av humant virus i cellekul-turene. Den andre teknikk er basert på en direkte kjemisk kobling av bærerproteinet og den aktive artsspesifikke komponent, i dette tilfelle hele, eller deler av, CH2-CH3-området av IgE-molekylet. Ved denne teknikk produseres proteinene hver for seg. Denne teknikk er den eneste som vanligvis anvendes ved immuniseringer med syntetiske peptider, så vel som ved immunisering med små haptener (av forbindelser som ikke er proteiner) , og er basert på kjemisk aktivering av bærerproteinet med f.eks. CNBr, etterfulgt av blanding av den aktiverte bærer med peptidet eller proteinfragmentet som man ønsker å koble sammen. Disse to kobles deretter kovalent til hverandre. The linked protein used as the most important component of the anti-allergy vaccine can, from a technical point of view, be produced in two different ways. One way involves the production of an already linked protein, a so-called fusion protein, in prokaryotic or eukaryotic host cells. The bacterium Escherichia coli is usually used as prokaryotic host cells, while a large number of different systems, such as yeast cells or cell lines, can be used as eukaryotic host cells. The cell lines can originate from insects to humans. However, human cells are usually avoided for clinical use because there is always a risk of human virus contamination in the cell cultures. The second technique is based on a direct chemical coupling of the carrier protein and the active species-specific component, in this case all or parts of the CH2-CH3 region of the IgE molecule. With this technique, the proteins are produced separately. This technique is the only one that is usually used in immunizations with synthetic peptides, as well as in immunizations with small haptens (of compounds that are not proteins), and is based on chemical activation of the carrier protein with e.g. CNBr, followed by mixing the activated carrier with the peptide or protein fragment that one wishes to link. These two are then covalently linked to each other.

Immuniseringen utføres ved å blande oppløselig eller aggregert proteinvaksine med et immunresponspotensierende materiale (adjuvans), hvilket deretter injiseres subkutant, intraperitonealt eller intramuskulært. De hittil undersøkte rotter er blitt injisert med vaksinen subkutant eller intraperitonealt. I disse tester er det anvendt mengder på ca. The immunization is carried out by mixing soluble or aggregated protein vaccine with an immune response potentiating material (adjuvant), which is then injected subcutaneously, intraperitoneally or intramuscularly. The rats examined so far have been injected with the vaccine subcutaneously or intraperitoneally. In these tests, quantities of approx.

100 ug antigen pr. rotte og immuniseringstilfelle, og med disse konsentrasjoner er det oppnådd meget sterke immunres- 100 ug antigen per rat and immunization case, and with these concentrations very strong immune responses have been achieved

ponser i et panel av forskjellige rottestammer (figur 1). For mennesker vil det først og fremst anvendes forholdsvis svake, ikke-toksiske adjuvanser, slik som alun, eller som et alter-nativ, injeksjoner av større mengder aggregert fusjonsprotein uten tilsetning av adjuvans. Det aggregerte fusjonsprotein er ment å øke proteinets immunogenitet. pons in a panel of different rat strains (Figure 1). For humans, primarily relatively weak, non-toxic adjuvants will be used, such as alum, or as an alternative, injections of larger amounts of aggregated fusion protein without the addition of adjuvants. The aggregated fusion protein is intended to increase the protein's immunogenicity.

For mennesker vil det videre antakeligvis anvendes betydelig større mengder antigen, muligens i størrelsesorden 100-500 mg rent protein. Fra et teknisk synspunkt involverer dette ikke noen større problemer fordi det er mulig å erholde meget store mengder av dette fusjonsprotein i en meget ren For humans, significantly larger amounts of antigen will probably be used, possibly in the order of 100-500 mg of pure protein. From a technical point of view this does not involve any major problems because it is possible to obtain very large amounts of this fusion protein in a very pure

form og til en pris som ikke er for avskrekkende. I den nåvær-.v form and at a price that is not too off-putting. In the present tense

ende situasjon foreligger det et stort antall fusjonsprotein-varianter produsert i liten skala for den humane vaksine så vel som for rottevaksinen. Imidlertid venter analysen av den humane vaksine på resultatene fra den meget store undersøkelse som for tiden utføres på forskjellige rottestammer. Finally, there are a large number of fusion protein variants produced on a small scale for the human vaccine as well as for the rat vaccine. However, the analysis of the human vaccine awaits the results of the very large study that is currently being carried out on different strains of rats.

Gjentatte injeksjoner utføres først med ca. 3 ukers mellomrom for å oppnå en sterk immunrespons. Deretter vil det antakeligvis være nødvendig å utføre immuniseringene kun noen få uker før hver pollenperiode på et pollenallergisk subjekt, for å aktivere den ovennevnte immunrespons og sterkt forsterke denne respons før den nye høyrisikoperiode. Repeated injections are first carried out with approx. 3 weeks apart to achieve a strong immune response. Subsequently, it will probably be necessary to carry out the immunizations only a few weeks before each pollen period on a pollen-allergic subject, in order to activate the above-mentioned immune response and strongly reinforce this response before the new high-risk period.

Ved anvendelse av et antall heterologe bærermolekyler til hvilke artsspesifikke proteiner eller proteinfragmenter er koblet, vil det prosentvise antall T-celler øke. Disse vil gi hjelp til B-celler som produserer antistoffer mot, som i dette tilfellet, CH2-CH3-området av det humane IgE-molekyl. Ved denne foredling av immuniseringsprotokollen er det forventet at de mengder antigen som må anvendes til immuniseringen, kan reduseres under bibeholdelse av immuniseringseffekten. Dette vil ikke ha umiddelbar interesse før kliniske tester utføres på mennesker, hvor sterke adjuvanser ikke kan anvendes og derfor alle tilgjengelige metoder må benyttes for å øke vaksinens immunogenitet. By using a number of heterologous carrier molecules to which species-specific proteins or protein fragments are linked, the percentage number of T cells will increase. These will help B cells that produce antibodies against, as in this case, the CH2-CH3 region of the human IgE molecule. With this refinement of the immunization protocol, it is expected that the amounts of antigen that must be used for the immunization can be reduced while maintaining the immunization effect. This will not be of immediate interest until clinical tests are carried out on humans, where strong adjuvants cannot be used and therefore all available methods must be used to increase the vaccine's immunogenicity.

Som nevnt ovenfor, er målet for foreliggende oppfinnelse primært å fremstille en vaksine for anvendelse på mennesker. Innen rammen for foreliggende oppfinnelse faller imidlertid også vaksiner for andre pattedyrarter det er økonomisk viktig å vaksinere mot IgE-formidlede, allergiske reaksjoner. Eksempler på slike arter er hunder, hester og griser. As mentioned above, the aim of the present invention is primarily to produce a vaccine for use in humans. However, within the scope of the present invention also fall vaccines for other mammal species where it is economically important to vaccinate against IgE-mediated allergic reactions. Examples of such species are dogs, horses and pigs.

Foreliggende oppfinnelse vil bli nærmere illustrert i det etterfølgende ved hjelp av de spesifikke utførelseseks-empler. The present invention will be further illustrated in what follows with the help of the specific design examples.

Eksempel 1 Example 1

Fremstilling av et fusjonsproteinpreparat av IgE- epsilon-kjedens CH2- CH3- område fra menneske og rotte Preparation of a fusion protein preparation of the CH2-CH3 region of the IgE epsilon chain from human and rat

I dette eksempel er det benyttet et system hvor det artsspesifikke protein og bærerproteinet produseres i bak-terier, i dette tilfellet Escherichia coli, i en koblet form. Ved hjelp av PCR-teknikk (polymerasekjedereaksjon) er cDNA-sekvensene for IgE-epsilon-kjedens CH2-CH3-områder fra både menneske og rotte klonet. Aminosyresekvensen kodet av det amplifiserte, humane cDNA var: NKTFSVCSRDFTPPTVKILQSSCDGGGHFPPTIQLLCLVSGYTPGTINITWLEDGQVMDVDL STASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCADSNPRGVSAYLS RPSPFDLFIRKSPTYTCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTL PVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPR, og aminosyresekvensen kodet av rotte-cDNA var: DLTIRARPVNITKPTVDLLHSSCDPNAFHSTIQLYCFVYGHIQNDVSIHWLMDDRKIYETHAQ NVLIKEEGKLASTYSRLNITQQQWMSESTFTCKVTSQGENYWAHTRRCSDDEPRGVITYLIPP SPLDLYENGTPKLTCLVLDLESEENITVTWVRERKKSIGSASQRSTKHHNATTSITSILPVDA KDWIEGEGYQCRVDHPHFPKPIVRSITKAPGKR. PCR-produktene ble ligert i en kommersielt tilgjengelig vektor for produksjon av et fusjonsprotein i bakterielle verter. Den anvendte vektor er et medlem av de såkalte pGEX-vektorer av form 1, 2 eller 3 med forskjellige avlesningsrammer for ligering av cDNA-fragmenter (Smith og Johnson, 1988). Denne type vektorer er i dette tilfelle vist å gi høye utbytter av rent fusjonsprotein for direkte immunisering. I denne vektorfamilie er hele kodingsområdet for en 26 kD glutation-S-transferase (Sj26) fra den parasittiske mark Schistosoma japonicum klonet inn etter en sterk og induserbar, bakteriell promotor. Denne promotor, en såkalt tac-promotor, er negativt regulert av lac-repressoren. For å erholde store mengder protein oppheves inhibering av promotoren ved hjelp av IPTG (isopropyl-p-D-tiogalaktosid). Etter ligering av CH2-CH3-fragmentet i vektoren i den C-terminale ende av Sj26-genet transformeres denne vektor inn i en E, coli-stamme for produksjon av fusjonsproteinet. En overnattskultur av denne nye bakterie som inneholder vektoren hvori det ønskede fragment er ligert, for-tynnes i forholdet 1:10 i bakterievekstmedium og tillates å vokse i ytterligere 2 timer. IPTG tilsettes deretter til 100 uM, og kulturen inkuberes under kraftig omrøring i ytterligere 4 timer. Bakteriene innhøstes deretter ved sentrifuger-ing, og cellepelleten vaskes deretter tre ganger med PBS. Ettervvask suspenderes cellene i PBS + 1% "Triton X-100" og sonikeres i 5 x 15 sekunder for å nedbryte bakterienes celle-vegger og frigi proteinet fra cellene. Det er vist at for CH2-CH3-fusjonsproteinene fra både rotte og menneske utfelles proteinet intracellulært i form av krystaller og må derfor opp-løses ved hjelp av en løsning inneholdende 8 M urea. Det humane protein kan deretter dialyseres mot rent PBS og bli fullstendig oppløselig. Det pågår for tiden arbeide for å erholde en protokoll for rensing av det humane fusjonsprotein i stor skala til en renhet på nesten 100%. CH2-CH3-fusjonsproteinet fra rotte er imidlertid mer uoppløselig, og det meste av proteinet utfelles allerede etter dialyse i 1/2 til 1 time. I de etterfølgende eksempler er det benyttet et fusjonsproteinpreparat av CH2-CH3 fra rotte med en renhet på ca. 50%. Disse preparater er anvendt for å undersøke muligheten for å erholde en sterk antistoffrespons mot rottens eget IgE og undersøke mulighetene for å blokkere en sterk IgE-formidlet infiammatorisk reaksjon i rotte. De resterende 50% av proteinet i preparatet består av forskjellige kontaminerende bak-terieproteiner, hvorved et enkelt protein ikke utgjør mer enn 10% av det totale protein. In this example, a system is used where the species-specific protein and the carrier protein are produced in bacteria, in this case Escherichia coli, in a linked form. Using the PCR technique (polymerase chain reaction), the cDNA sequences for the CH2-CH3 regions of the IgE epsilon chain from both humans and rats have been cloned. Aminosyresekvensen kodet av det amplifiserte, humane cDNA var: NKTFSVCSRDFTPPTVKILQSSCDGGGHFPPTIQLLCLVSGYTPGTINITWLEDGQVMDVDL STASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCADSNPRGVSAYLS RPSPFDLFIRKSPTYTCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTL PVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPR, og aminosyresekvensen kodet av rotte-cDNA var: DLTIRARPVNITKPTVDLLHSSCDPNAFHSTIQLYCFVYGHIQNDVSIHWLMDDRKIYETHAQ NVLIKEEGKLASTYSRLNITQQQWMSESTFTCKVTSQGENYWAHTRRCSDDEPRGVITYLIPP SPLDLYENGTPKLTCLVLDLESEENITVTWVRERKKSIGSASQRSTKHHNATTSITSILPVDA KDWIEGEGYQCRVDHPHFPKPIVRSITKAPGKR. The PCR products were ligated into a commercially available vector for production of a fusion protein in bacterial hosts. The vector used is a member of the so-called pGEX vectors of form 1, 2 or 3 with different reading frames for ligation of cDNA fragments (Smith and Johnson, 1988). In this case, this type of vector has been shown to give high yields of pure fusion protein for direct immunization. In this vector family, the entire coding region for a 26 kD glutathione-S-transferase (Sj26) from the parasitic marc Schistosoma japonicum has been cloned into a strong and inducible bacterial promoter. This promoter, a so-called tac promoter, is negatively regulated by the lac repressor. In order to obtain large amounts of protein, inhibition of the promoter is abolished by means of IPTG (isopropyl-β-D-thiogalactoside). After ligation of the CH2-CH3 fragment in the vector at the C-terminal end of the Sj26 gene, this vector is transformed into an E. coli strain for production of the fusion protein. An overnight culture of this new bacterium containing the vector in which the desired fragment is ligated is diluted 1:10 in bacterial growth medium and allowed to grow for a further 2 hours. IPTG is then added to 100 µM, and the culture is incubated with vigorous agitation for an additional 4 hours. The bacteria are then harvested by centrifugation, and the cell pellet is then washed three times with PBS. After washing, the cells are suspended in PBS + 1% "Triton X-100" and sonicated for 5 x 15 seconds to break down the bacterial cell walls and release the protein from the cells. It has been shown that for the CH2-CH3 fusion proteins from both rats and humans, the protein precipitates intracellularly in the form of crystals and must therefore be dissolved using a solution containing 8 M urea. The human protein can then be dialyzed against pure PBS and become completely soluble. Work is currently underway to obtain a protocol for purification of the human fusion protein on a large scale to near 100% purity. However, the rat CH2-CH3 fusion protein is more insoluble, and most of the protein precipitates already after dialysis for 1/2 to 1 hour. In the following examples, a fusion protein preparation of CH2-CH3 from rat with a purity of approx. 50%. These preparations have been used to investigate the possibility of obtaining a strong antibody response against the rat's own IgE and to investigate the possibility of blocking a strong IgE-mediated inflammatory reaction in the rat. The remaining 50% of the protein in the preparation consists of various contaminating bacterial proteins, whereby a single protein does not make up more than 10% of the total protein.

Eksempel 2 Example 2

Immunisering av rotte - måling av immunrespons Rat immunization - measurement of immune response

Immunisering eller vaksinering utføres ved hjelp av fusjonsproteinpreparatet fra eksempel 1 i blanding med et immunresponsøkende materiale (adjuvans) for å danne en vaksine. De undersøkte rotter er blitt injisert med vaksinen subkutant eller intraperitonealt med en blanding av oppløselig og aggregert protein. I disse tester er det benyttet mengder på ca. 100 ug antigen pr. rotte i henholdsvis 0,2 ml Freunds fullstendige og ufullstendige adjuvans pr. immuniseringstilfelle og rotte. Med disse konsentrasjoner og adjuvanser er det oppnådd meget sterke immunresponser i et panel av forskjellige rottestammer. Immunization or vaccination is carried out using the fusion protein preparation from Example 1 in admixture with an immune response enhancing material (adjuvant) to form a vaccine. The examined rats have been injected with the vaccine subcutaneously or intraperitoneally with a mixture of soluble and aggregated protein. In these tests, quantities of approx. 100 ug antigen per rat in 0.2 ml Freund's complete and incomplete adjuvant per immunization case and rat. With these concentrations and adjuvants, very strong immune responses have been achieved in a panel of different rat strains.

Figur la og b viser en test med fire forskjellige rottestammer og tre rotter pr. stamme. Antistofftiterne mot nativt IgE er målt ved hjelp av ELISA. Denne analyse er utført på en slik måte at nativt IgE i beleggingsbuffer (5 ug/ml) er anvendt for å belegge ELISA-platene. Suksessive fortynninger (1/5) av rotteserum fra de forskjellige testdyr er deretter testet med hensyn på fargereaksjon i ELISA. Absorpsjonsver-di ene ved 400 nm er avbildet på Y-aksene i figur 1, og de forskjellige 1/5-fortynninger, med økende fortynninger mot venstre i figuren, er avbildet på X-aksene. Figures la and b show a test with four different rat strains and three rats per tribe. Antibody titers against native IgE are measured using ELISA. This analysis is carried out in such a way that native IgE in coating buffer (5 ug/ml) is used to coat the ELISA plates. Successive dilutions (1/5) of rat serum from the various test animals are then tested for color reaction in ELISA. The absorption values at 400 nm are depicted on the Y-axes in Figure 1, and the various 1/5 dilutions, with increasing dilutions towards the left in the figure, are depicted on the X-axes.

De fire rottestammer {Lewis, Sprague Dawley, Wistar og Brown Norway) er i det venstre felt analysert med hensyn på deres evne til å reagere mot CH2-CH3-vaksinen, og i det høyre felt mot humant IgG (som kontroll). Den anvendte vaksine er rotte-CH2-CH3, hvilket i rotten fullstendig tilsvarer den humane vaksine. Disse rotter er kun vaksinert to ganger; først en vaksinasjon med Freunds fullstendige adjuvans og protein-oppløsning, og deretter en andre vaksinasjon tre uker senere med den samme proteinoppløsning i Freunds ufullstendige adjuvans. Én uke etter den andre vaksinasjon ble blodprøver tatt fra rottene. Innholdet av anti-IgE-antistoffer i blodet ble deretter bestemt ved hjelp av ELISA-analyse. Som det klart fremgår fra figuren, utviser tre av stammene god respons mot vaksinen, mens den fjerde stammen er en såkalt "non-responder", hvilket ikke er så uvanlig når det, som i dette tilfelle, anvendes innavlede stammer. Med dette menes at akkurat denne rottestammen ikke kan presentere sitt antigen for immunsystemet, og at det derfor ville være nødvendig å anvende et annet heterologt bærerprotein i denne rottestamme for å erholde den ønskede effekt av allergivaksinen. The four rat strains {Lewis, Sprague Dawley, Wistar and Brown Norway) are analyzed in the left field with regard to their ability to react against the CH2-CH3 vaccine, and in the right field against human IgG (as a control). The vaccine used is rat-CH2-CH3, which in the rat completely corresponds to the human vaccine. These rats have only been vaccinated twice; first a vaccination with Freund's complete adjuvant and protein solution, and then a second vaccination three weeks later with the same protein solution in Freund's incomplete adjuvant. One week after the second vaccination, blood samples were taken from the rats. The content of anti-IgE antibodies in the blood was then determined by ELISA analysis. As is clear from the figure, three of the strains show a good response to the vaccine, while the fourth strain is a so-called "non-responder", which is not so unusual when, as in this case, inbred strains are used. This means that this particular strain of rats cannot present its antigen to the immune system, and that it would therefore be necessary to use another heterologous carrier protein in this strain of rats to obtain the desired effect of the allergy vaccine.

Son» det fremgår fra disse innledende ELI SA-mål inger, erholdes en meget sterk immunrespons mot kun to domener av rottens IgE, hvilket må sammenlignes med den kun ubetydelig sterkere reaksjon som erholdes mot det humane IgG, hvilket dessuten har en størrelse som tilsvarer fire domener. Disse rotter som utviser meget høye anti-IgE-titere, viser overhodet ingen negative symptomer. I praksis kan de ikke med noen kri-terier skjelnes fra de rotter som kun er immunisert med rent PBS i Freunds adjuvans (kontrollene, merket "blank" i figur 1) • As it appears from these initial ELI SA measures, a very strong immune response is obtained against only two domains of the rat's IgE, which must be compared with the only slightly stronger reaction obtained against the human IgG, which moreover has a size corresponding to four domains. These rats, which exhibit very high anti-IgE titers, show no negative symptoms at all. In practice, they cannot be distinguished by any criteria from the rats that have only been immunized with pure PBS in Freund's adjuvant (the controls, marked "blank" in figure 1) •

Eksempel 3 Example 3

Immunisering av rotte - undertrykkelse av en IgE- formidlet inflammasjonsreaksjon Rat immunization - suppression of an IgE-mediated inflammatory reaction

Undersøkelser med det mål å vurdere evnen til vaksinen ifølge foreliggende oppfinnelse til å undertrykke en sterk IgE-formidlet inflammasjonsreaksjon, er også utført. Som et analysesystem er det benyttet det faktum at anti-IgE-antistoffer har en evne til å tverrbinde IgE-antistoffer bundet til mastceller i huden, og gjennom deres evne til å tverrbinde disse IgE-molekyler å indusere en kraftig granulfrigivelse og derved utløse en sterk inflammatorisk reaksjon på stedet hvor antistoffene er injisert (i dette tilfelle i huden). I dette tilfellet er det benyttet et polyklonalt anti-IgE-antiserum mot hele det konstante område av IgE. Dette serum bør derfor inneholde store mengder tverrbindende antistoffer, hvilket også bekreftes av resultatene. Styrke på inflammasjonen måles deretter ved hjelp av en fargereaksjon. Permeabiliteten og dermed lekkasjen av forskjellige blodproteiner fra blodet øker kraftig i. området hvor inflammasjonen er fremkalt. Jo kraf-tigere inflammasjonen er, desto større blåsone blir det erholdt dersom det injiseres en 1% Evans blå-oppløsning i blodet til testrottene to timer før avlesning av blåsonens størrelse under huden på testdyrene. Testen som vises skjematisk i figur 2, ble utført på en slik måte at fire injeksjoner, hver på 50 ul av en konsentrert oppløsning av et polyklonalt anti-IgE-antiserum, ble utført under huden på en vaksinert rotte og en blank-immunisert rotte to timer før huden ble fjernet og inflammasjonssonene målt. Som kontroll ble det utført injeksjoner av IgE + anti-IgE på ett punkt pr. rotte og kun PBS på ett punkt. To typiske eksempler på disse rotter er vist i figuren hvor én av rottene ble immunisert med CH2-CH3-vaksine i Freunds adjuvans, og den andre kontrollrotte ble immunisert med PBS i Freunds adjuvans. Sonene for IgE + anti-IgE-kontrollene har svært lignende størrelse for de to rotter, mens deri-mot sonene for injeksjoner med kun anti-IgE-antistoffer er redusert til nesten null for den vaksinerte rotte. Kun anti-IgE-antistoffer ga kraftige blåsoner for den blank-immuniserte rotte (som kontroll). Dette viser at den vaksinerte rotte formodentlig helt mangler IgE-antistoffer på overflaten av sine mastceller, hvilket fullstendig overensstemmer med det resul-tatet som kan forventes fra immuniseringene, hvor det i disse rotter er funnet høye konsentrasjoner av endogene anti-IgE-antistoffer. De mangler imidlertid ikke mastceller fordi det er mulig å erholde en normal blåsone ved å tilsette eksogent IgE sammen med anti-IgE-antistoffene og derved på nytt binde mastcellereseptorene på disse mastceller som opprinnelig formodentlig ikke inneholdt IgE. Investigations with the aim of assessing the ability of the vaccine according to the present invention to suppress a strong IgE-mediated inflammatory reaction have also been carried out. As an analysis system, the fact that anti-IgE antibodies have an ability to cross-link IgE antibodies bound to mast cells in the skin, and through their ability to cross-link these IgE molecules to induce a powerful granule release and thereby trigger a strong inflammatory reaction at the site where the antibodies are injected (in this case the skin). In this case, a polyclonal anti-IgE antiserum against the entire constant region of IgE has been used. This serum should therefore contain large amounts of cross-linking antibodies, which is also confirmed by the results. The strength of the inflammation is then measured using a color reaction. The permeability and thus the leakage of various blood proteins from the blood increases sharply in the area where the inflammation has been caused. The stronger the inflammation, the larger the blue zone is obtained if a 1% Evans blue solution is injected into the blood of the test rats two hours before reading the size of the blue zone under the skin of the test animals. The test shown schematically in Figure 2 was performed in such a way that four injections, each of 50 µl of a concentrated solution of a polyclonal anti-IgE antiserum, were performed under the skin of a vaccinated rat and a blank-immunized rat two hours before the skin was removed and the inflammation zones measured. As a control, injections of IgE + anti-IgE were performed at one point per rat and PBS only at one point. Two typical examples of these rats are shown in the figure, where one of the rats was immunized with CH2-CH3 vaccine in Freund's adjuvant, and the other control rat was immunized with PBS in Freund's adjuvant. The zones for the IgE + anti-IgE controls are very similar in size for the two rats, whereas the zones for injections with only anti-IgE antibodies are reduced to almost zero for the vaccinated rat. Only anti-IgE antibodies produced heavy bruising for the blank-immunized rat (as control). This shows that the vaccinated rat presumably completely lacks IgE antibodies on the surface of its mast cells, which is completely consistent with the result that can be expected from the immunizations, where high concentrations of endogenous anti-IgE antibodies have been found in these rats. However, they do not lack mast cells because it is possible to obtain a normal blue zone by adding exogenous IgE together with the anti-IgE antibodies and thereby re-binding the mast cell receptors on these mast cells which originally presumably did not contain IgE.

For tiden utføres arbeide med meget lovende resultater i en ny rottemodell hvor det først dannes en meget kraftig IgE-respons i Wistar-rotter som viser god respons på rottevaksinen ifølge foreliggende oppfinnelse (se figur 1). Immunisering av rottene utføres med et spesifikt antigen som i dette tilfellet er ovalbumin sammen med toksinet Ricin, ifølge en nylig utviklet protokoll av dr. Kemeny (Diaz-Sanchez og Kemeny, 1991) . Etter et antall uker erholder disse rotter en meget kraftig IgE-respons mot ovalbumin, og denne immunrespons er dessuten forholdsvis langvarig. Innledende undersøkelser har gitt meget gode resultater med denne protokoll. Et antall rotter er analysert med hensyn på deres evne til å forårsake en kraftig inflammatorisk reaksjon i huden etter injeksjon av 50 ul av en oppløsning inneholdende 5 mg/ml ovalbumin. Dette har gitt blåsoner som nesten er dobbelt så store som de tidligere nevnte, positive kontroller med IgE + anti-IgE, hvilket viser at disse rotter er ekstremt allergiske mot ovalbumin. Denne type rotter anvendes i dag for å undersøke muligheten for å blokkere allergireaksjoner i huden og deretter å under-søke effektene på sammentrekninger av bronkier og andre typiske allergirelaterte symptomer. Work is currently being carried out with very promising results in a new rat model where a very strong IgE response is first formed in Wistar rats which show a good response to the rat vaccine according to the present invention (see figure 1). Immunization of the rats is carried out with a specific antigen which in this case is ovalbumin together with the toxin Ricin, according to a recently developed protocol by Dr. Kemeny (Diaz-Sanchez and Kemeny, 1991). After a number of weeks, these rats receive a very strong IgE response against ovalbumin, and this immune response is also relatively long-lasting. Initial investigations have given very good results with this protocol. A number of rats have been analyzed for their ability to cause a strong inflammatory reaction in the skin after injection of 50 µl of a solution containing 5 mg/ml ovalbumin. This has produced blisters almost twice the size of the previously mentioned positive controls with IgE + anti-IgE, showing that these rats are extremely allergic to ovalbumin. This type of rat is used today to investigate the possibility of blocking allergic reactions in the skin and then to examine the effects on contractions of the bronchi and other typical allergy-related symptoms.

Nedenfor følger i fire punkter et sammendrag av disse vesentlige forskjeller mellom foreliggende oppfinnelse og kjent teknikk. 1. Foreliggende oppfinnelse er kun rettet på de domener' av IgE-molekylet som er direkte involvert i interaksjonen med IgE-reseptoren, og ikke som i tidligere undersøkelser, på områder i det ikke-reseptorreagerende C4-område. 2. Vaksinen ifølge foreliggende oppfinnelse inneholder artsspesifikke proteinfragmenter koblet til én eller flere heterologe bærere, hvilket gjør det mulig å frembringe en kraftig autoimmunrespons, i motsetning til tidligere under-søkelser hvor det er anvendt epsilon-peptider fra en annen art enn den det koblede peptid injiseres i, dvs. humane peptider i mus, rotte eller kanin. 3. I motsetning til de monoklonale prosjekter som pågår i flere laboratorier rundt om i verden, er foreliggende oppfinnelse basert på dannelsen av en polyklonal immunrespons mot et artsspesifikt protein, hvilket i betydelig grad øker mulighetene for å oppnå et vellykket resultat fordi medfølgende immunkompleksrelaterte komplikasjoner som fører til livstruende inflammatoriske reaksjoner, med stor sannsynlighet vil unngås. 4. Den viktigste forskjell er at det ifølge foreliggende oppfinnelse anvendes hele domener eller strukturelt stabile deler derav (med mer enn 12 aminosyrer) som vaksine. Derved oppnås en kraftig polyklonal respons i testdyrsystemet (allerede vist) mot nativt IgE, hvilket er en meget viktig egenskap for en vaksine av denne type (også vist). Dette oppnås etter kun noen få ukers immunisering, noe som betyr et meget stort fremskritt sammenlignet med de tidligere forsøk utført i teknikken med korte, syntetiske peptider. Below follows in four points a summary of these significant differences between the present invention and prior art. 1. The present invention is only directed at the domains of the IgE molecule that are directly involved in the interaction with the IgE receptor, and not, as in previous investigations, at areas in the non-receptor-reacting C4 area. 2. The vaccine according to the present invention contains species-specific protein fragments linked to one or more heterologous carriers, which makes it possible to produce a strong autoimmune response, in contrast to previous investigations where epsilon peptides from a different species than the linked peptide have been used injected into, i.e., human peptides into mice, rats or rabbits. 3. In contrast to the monoclonal projects that are ongoing in several laboratories around the world, the present invention is based on the formation of a polyclonal immune response against a species-specific protein, which significantly increases the chances of achieving a successful result because accompanying immune complex-related complications such as leads to life-threatening inflammatory reactions, which will most likely be avoided. 4. The most important difference is that, according to the present invention, whole domains or structurally stable parts thereof (with more than 12 amino acids) are used as vaccine. Thereby, a strong polyclonal response is achieved in the test animal system (already shown) against native IgE, which is a very important property for a vaccine of this type (also shown). This is achieved after only a few weeks of immunization, which means a very big advance compared to the previous attempts made in the technique with short, synthetic peptides.

Referanser: References:

Blank U., Miller R., White K., Metzger H. og Kinet J.; Com-plete structure and expression in transfected cells of high affinity IgE receptor. Nature 337 (1989) 187-189. Blank U., Miller R., White K., Metzger H. and Kinet J.; Complete structure and expression in transfected cells of high affinity IgE receptor. Nature 337 (1989) 187-189.

Froese A., CRC crit. Rev. Immunol. 1. (1980) 79-132. Froese A., CRC crit. Fox. Immunol. 1. (1980) 79-132.

Helm B., Marsh P., Vercelli D., Padlan E., Gould H. og Helm B., Marsh P., Vercelli D., Padlan E., Gould H. and

Geha R.; The mast cell binding site on human immunoglobulin E. Nature 331 (1988) 180-183. Geha R.; The mast cell binding site on human immunoglobulin E. Nature 331 (1988) 180-183.

Helm B., Kebo D., Vercelli D., Glovsky M., Gould H., Ishizaka K., Geha R. og Ishizaka T.; Blocking of passive sensitization of human mast cells and basophil granulocytes with IgE antibodies by a recombinant human £-chain fragment of 76 amino acids. Proe. Nati. Acad. Sei. USA. 86 (1989) 9465-9469. Helm B., Kebo D., Vercelli D., Glovsky M., Gould H., Ishizaka K., Geha R. and Ishizaka T.; Blocking of passive sensitization of human mast cells and basophil granulocytes with IgE antibodies by a recombinant human £-chain fragment of 76 amino acids. Pro. Nati. Acad. Pollock. USA. 86 (1989) 9465-9469.

Kinet J.( Metzger H., Hakimi J. og Kochan J.; A cDNA presump-tively coding for the a subunit of the receptor with high affinity for immunoglobulin E. Biochemistry 26 (1987) 4605-4610. Kinet J. ( Metzger H., Hakimi J. and Kochan J.; A cDNA presump-tively coding for the a subunit of the receptor with high affinity for immunoglobulin E. Biochemistry 26 (1987) 4605-4610.

Kinet J., Blank U. , Ra C, White K. , Metzger H. og Kochan J. ; Isolation and characterization of cDNAs coding for the p subunit of the high-affinity receptor for immunoglobulin E. Proe. Nati. Acad. Sei. USA. 85 (1988) 6483-6487. Kinet J., Blank U. , Ra C., White K. , Metzger H. and Kochan J. ; Isolation and characterization of cDNAs coding for the p subunit of the high-affinity receptor for immunoglobulin E. Proe. Nati. Acad. Pollock. USA. 85 (1988) 6483-6487.

Stadier B., Nakajima K., Yang X. og Weck A.; Potential role of anti-IgE antibodies in vivo. Int. Aren. Allergy Applied Immunol. 88 (1989) 206-208. Stadier B., Nakajima K., Yang X. and Weck A.; Potential role of anti-IgE antibodies in vivo. Int. Arena. Allergy Applied Immunol. 88 (1989) 206-208.

Shimizu A., Tepler I., Benfey P., Berenstein E., Siraganian R. og Leder O.; Human and rat mast cell high-affinity immunoglobulin E receptors: Characterization of putative a-chain gene products. Proe. Nati. Acad. Sei. USA 85 (1988) 1907-1911. Shimizu A., Tepler I., Benfey P., Berenstein E., Siraganian R. and Leder O.; Human and rat mast cell high-affinity immunoglobulin E receptors: Characterization of putative a-chain gene products. Pro. Nati. Acad. Pollock. United States 85 (1988) 1907-1911.

Stanworth, D. R. Jones, V. M., Lewin, I. V. og Nayvar, S.; Allergy treatment with a peptide vaccine. The Lancet 336 Stanworth, D.R. Jones, V.M., Lewin, I.V. and Nayvar, S.; Allergy treatment with a peptide vaccine. The Lancet 336

(1990) 1279-1281. (1990) 1279-1281.

Tepler I., Shimizu A. og Leder P.; The gene for the rat mast cell high affinity IgE receptor a chain. J. Biol. Chem. 264 Tepler I., Shimizu A. and Leder P.; The gene for the rat mast cell high affinity IgE receptor a chain. J. Biol. Chem. 264

(1989) 5912-5915. (1989) 5912-5915.

Weiss S.; Lehmann K., Raschke W. C. og Cohn M.; Mice com-pletely suppressed for the expression of immunoglobulin k light chain. Proe. Nati. Acad. Sei. USA. 81 (1984) 211-215. Weiss S.; Lehmann, K., Raschke, W.C., and Cohn, M.; Mice completely suppressed for the expression of immunoglobulin k light chain. Pro. Nati. Acad. Pollock. USA. 81 (1984) 211-215.

Vercelli D., Helm B., Marsh P.( Padlan E., Geha R. og Vercelli D., Helm B., Marsh P. (Padlan E., Geha R. and

Gould H.; The B-cell binding site on human immunoglobulin E. Nature 338 (1989) 649-651. Gould H.; The B-cell binding site on human immunoglobulin E. Nature 338 (1989) 649-651.

Smith, D. B. og Johnson, K. S.; Single-step purification of polypeptides expressed in Escherichia coli as fusion with glutathion S-transferase. Gene 67 (1988) 31-40. Smith, D.B. and Johnson, K.S.; Single-step purification of polypeptides expressed in Escherichia coli as fusion with glutathione S-transferase. Genes 67 (1988) 31-40.

Diaz-Sanchez, D. og Kemeny, D. M.; Generation of long-lived IgE response in high and low responder strains of rat by co-administration of ricin and antigen, Immunology 72 (1991) 297-303. Diaz-Sanchez, D. and Kemeny, D.M.; Generation of long-lived IgE response in high and low responder strains of rat by co-administration of ricin and antigen, Immunology 72 (1991) 297-303.

Claims

1. Vaccine to alleviate the symptoms of, or prevent the onset of, IgE-mediated allergic reactions in a mammal, characterized in that it comprises an immunogenic conjugate, comprising a heterologous carrier protein to which is linked a protein which has (a) the entire amino acid sequence for the constant CH2-CH3 domains in the epsilon chain of the IgE molecule from the relevant mammalian species, or ( b) a structurally stable unit of this amino acid sequence containing more than 12 amino acids, in which said entire amino acid sequence or said structurally stable unit thereof is in its original or in a slightly mutated or multimerized form, further characterized in that when the mammal is injected with the immunogenic conjugate, it produces polyclonal antibodies that have the ability to bind to circulating, native IgE and in which such polyclonal antibodies are directed against and have the ability to simultaneously bind to various epitopes within the CH2-CH3 region of an IgE antibody, and is also characterized by that the vaccine may possibly contain an adjuvant.

2. Vaccine according to claim 1, characterized in that the entire amino acid sequence of the constant CH2-CH3 domains or the structurally stable unit thereof is present in its original or a slightly mutated form.

3. Vaccine according to claim 1, characterized in that the entire amino acid sequence of the constant CH2-CH3 domains or the structurally stable unit thereof exists in a multimerized form.

4. Vaccine according to any one of claims 1 to 3, characterized in that the mammal is human and that the entire amino acid sequence of the CH2-CH3 domains or the structurally stable unit thereof originates from human IgE.

5. Vaccine according to claim 2 or 4, characterized in that the linked protein is a fusion protein produced using recombinant DNA technology in a prokaryotic or eukaryotic host.

6. Vaccine according to claim 5, characterized in that the linked protein is a fusion protein from a prokaryotic host, preferably the bacterium Escherichia coli.

7. Use of the entire amino acid sequence for the constant CH2-CH3 domains in the epsilon chain of the IgE molecule from a mammalian species, or a structurally stable unit of this amino acid sequence containing more than 12 amino acids, in its original form or in a slightly mutated or multimerized form, for the production of a vaccine against IgE-mediated allergic reactions in the relevant mammalian species, in which the administration of the vaccine to the mammal enables the mammal, after receiving said immunogenic conjugate by injection, to produce polyclonal antibodies which have the ability to bind to circulating , native IgE, where in such polyclonal antibodies are directed against and have the ability to bind simultaneously to different epitopes within the CH2-CH3 region of an IgE antibody.

8. Use according to claim 7, characterized in that the mammal species is a human and that the entire amino acid sequence of the constant CH2-CH3 domains or the structurally stable unit thereof is derived from human IgE.

9. Method for producing a vaccine according to claim 2, characterized by cloning the cDNA sequence for the amino acid sequence of the entire CH2-CH3 domain of the IgE epsilon chain, or a structurally stable unit thereof, ligation of this into a suitable vector, transformation of the vector into a eukaryotic or prokaryotic host cell for production of a fusion protein containing the entire CH2-CH3 domain or a structurally stable unit thereof, and purification and possibly isolation of the obtained fusion protein, as well as possibly mixing this with a suitable adjuvant.

10. Method according to claim 9, characterized by. that the host for the transformation of the vector is a bacterial strain, preferably Escherichia coli.

11. Vaccine according to claim 1, characterized in that the structurally stable unit is the CH2 domain or the CH3 domain of the epsilon chain of the IgE molecule from the relevant mammalian species.

12. Use according to claim 7, in which the structurally stable unit is the CH2 domain or the CH3 domain of the epsilon chain of the IgE molecule from the relevant mammalian species.