NO302032B1

NO302032B1 - Antibodies to fibrin, immunogenic peptide that binds to the antibodies, use of such antibody, and diagnostic kit for determining fibrin

Info

Publication number: NO302032B1
Application number: NO903375A
Authority: NO
Inventors: Willem Nieuwenhuizen
Original assignee: Tno
Priority date: 1990-07-31
Filing date: 1990-07-31
Publication date: 1998-01-12
Also published as: NO903375D0; NO903375L

Description

Oppfinnelsen vedrører antistoffer som reagerer spesifikt med fibrin, immunogent peptid som binder til antistoffene, anvendelse av et slikt antistoff, samt diagnosesett for bestemmelse av fibrin. The invention relates to antibodies that react specifically with fibrin, immunogenic peptide that binds to the antibodies, use of such an antibody, and diagnostic kits for determining fibrin.

Trombin løsner enzymatisk i rekkefølge fibrinopeptidene A i Aa-kjedene og fibrinopeptidene B i Bp-kjedene fra fibrinogenet som normalt er til stede i blod, slik at det dannes hhv. monomer fibrin type I og monomer fibrin type II. Opp til en viss konsentrasjon er disse monomere fibrinene i stand til å forbli i oppløsning. Ved høyere konsentrasjon kan monomer fibrin polymerisere til en fibrinklump. For å påvise en forestående dannelse av en fibrinklump (trombose) tidlig og for å være i stand til å forhindre blodklumper (tromber) i blodårene, er det ønskelig med en tidlig påvisning av fibrin i blodet, idet det er nødvendig for midlene for påvisning å skjelne mellom fibrinogenet og selve fibrinet. Thrombin enzymatically detaches in sequence the fibrinopeptides A in the Aa chains and the fibrinopeptides B in the Bp chains from the fibrinogen that is normally present in blood, so that it forms monomeric fibrin type I and monomeric fibrin type II. Up to a certain concentration, these monomeric fibrins are able to remain in solution. At higher concentrations, monomeric fibrin can polymerize into a fibrin clot. In order to detect an imminent formation of a fibrin clot (thrombosis) early and to be able to prevent blood clots (thrombi) in the blood vessels, it is desirable to have an early detection of fibrin in the blood, as it is necessary for the means of detection to distinguish between the fibrinogen and the fibrin itself.

Påvisningen kan i prinsippet utføres ved hjelp av antistoffer mot fibrin. De fleste undersøkte antistoffer mot fibrin er imidlertid ikke brukbare ettersom de reagerer med fibrinogen. Det er også blitt beskrevet antistoffer som faktisk skjelner mellom fibrin og fibrinogen. Således har Kudryk et al. (Molecular Immunology, 21, s. 89-94 (1984), EP-A 151.239) beskrevet et monoklonalt antistoff som induseres ved hjelp av fibrinfragmenter som antigener og binder seg til aminoenden av p-kjeden i fibrin. Hui et al. (Hybridoma, 5, The detection can in principle be carried out using antibodies against fibrin. However, most anti-fibrin antibodies tested are not useful as they react with fibrinogen. Antibodies have also been described that actually distinguish between fibrin and fibrinogen. Thus, Kudryk et al. (Molecular Immunology, 21, pp. 89-94 (1984), EP-A 151,239) described a monoclonal antibody which is induced by means of fibrin fragments as antigens and binds to the amino end of the β-chain in fibrin. Hui et al. (Hybridoma, 5,

s. 215-222 (1986)) har også beskrevet et antistoff som fås ved å immunisere med et peptid fra p-kjedeenden av fibrin. pp. 215-222 (1986)) have also described an antibody obtained by immunizing with a peptide from the β-chain end of fibrin.

Disse antistoffene har imidlertid den ulempe at de gjenkjenner bare aminoenden av p-kjeden i fibrin som frigjøres etter at fibrinopeptid B er løsnet, og de er derfor ikke anvendbare for påvisning av fibrin I. However, these antibodies have the disadvantage that they only recognize the amino end of the p-chain in fibrin that is released after fibrinopeptide B is released, and they are therefore not applicable for the detection of fibrin I.

Europeisk patentsøknad nr. 152.612 beskriver en frem-gangsmåte for å bestemme fibrin ved hjelp av et antistoff som induseres ved å immunisere et dyr med et peptid fra den nye aminoenden i a-kjeden som fremstilles ved å løsne fibrinopeptid A. I dette tilfelle er særlig aminoenden av a-kjeden i fibrin involvert. European patent application no. 152,612 describes a method for determining fibrin by means of an antibody which is induced by immunizing an animal with a peptide from the new amino end of the α-chain which is produced by releasing fibrinopeptide A. In this case, particularly the amino end of the a-chain in fibrin involved.

I internasjonal patentsøknad WO 88.01514 beskrives et antistoff mot fibrin som induseres ved å anvende humanfibrin som antigen. Antistoffet er særlig rettet mot et avsnitt av a-kjeden i fibrin. In international patent application WO 88.01514, an antibody against fibrin is described which is induced by using human fibrin as antigen. The antibody is particularly directed against a section of the a-chain in fibrin.

Det er nå blitt funnet antistoffer som reagerer spesifikt med fibrin, men ikke med fibrinogen, for anvendelse in vitro, og som kan fås ved å immunisere et dyr med et immunogen som inneholder et avsnitt om aminosyresekvensen til fibrin som ikke er aktiv i fibrinogen, men som er aktiv i fibrinene av type I og type II i immunreaksjoner. Antibodies have now been found which react specifically with fibrin, but not with fibrinogen, for use in vitro, and which can be obtained by immunizing an animal with an immunogen containing a segment of the amino acid sequence of fibrin which is not active in fibrinogen, but which is active in the fibrins of type I and type II in immune reactions.

Antistoffene ifølge oppfinnelsen er kjennetegnet ved at de er rettet mot et peptid med 5-69 aminosyrerester, hvorav en sekvens på minst 5 aminosyrerester er identisk med en sekvens som finnes i aminosyresekvensen 311-379 i y^jeden til fibrinogen. The antibodies according to the invention are characterized by the fact that they are directed against a peptide with 5-69 amino acid residues, of which a sequence of at least 5 amino acid residues is identical to a sequence found in the amino acid sequence 311-379 in the γ-end of fibrinogen.

Fortrinnsvis befinner 5 eller flere aminosyrerester i peptidet seg i den samme relative stilling som de samme aminosyrerestene i aminosyresekvensen 311-369 i Y-kj©den i fibrin. Helst befinner 5 eller flere aminosyrerester seg i den samme relative stilling som de samme aminosyrerestene i sekvensen y-311-336, og særlig som de samme aminosyrerestene i en mindre del av denne sekvensen som 315-322. Preferably, 5 or more amino acid residues in the peptide are in the same relative position as the same amino acid residues in the amino acid sequence 311-369 in the Y-chain in fibrin. Preferably, 5 or more amino acid residues are in the same relative position as the same amino acid residues in the sequence y-311-336, and in particular as the same amino acid residues in a smaller part of this sequence such as 315-322.

Aminosyresekvensen y-311-379 i fibrin er kjent og er: The amino acid sequence y-311-379 in fibrin is known and is:

(311)QFSTWDNDNDKFEGNCAEQDGSGWWM(336)NKCHAGHLNGVYYQGGTYSKASTPN-GYDNGIIWATWKTRWYSM(379). Denne aminosyresekvensen med en av-kobling mellom M(336) og N(337), men med en disulfidbro mellom C(326) og C(339), oppstår også som fragment FCB-5 ved dekompo-neringen av fibrin med cyanbromid (se A. Henschen, Haemo-staseologie, I (1981), s. 49-61). Det nevnte FCB-5 kan også anvendes til å fremstille antistoffer ifølge oppfinnelsen. (311)QFSTWDNDNDKFEGNCAEQDGSGWWM(336)NKCHAGHLNGVYYQGGTYSKASTPN-GYDNGIIWATWKTRWYSM(379). This amino acid sequence with a disconnection between M(336) and N(337), but with a disulfide bridge between C(326) and C(339), also occurs as fragment FCB-5 during the decomposition of fibrin with cyanogen bromide (see A. Henschen, Haemo-staseologie, I (1981), pp. 49-61). The aforementioned FCB-5 can also be used to produce antibodies according to the invention.

Den immunogene aminosyresekvens kan fremstilles på kjent måte, f.eks. ved hjelp av en standard SPPS-metode, slik som beskrevet av Stewart, J.M., Young, J.D. i "Solid Phase Peptide Synthesis", Pierce Chemical Company, 2. opplag, 1984. Under disse omstendigheter beskyttes sidekjedene i aminosyrene som inneholder en funksjonell gruppe, og som ikke bør delta i koblingsreaksjonen, reversibelt. Den frie karboksylgruppe i en derivatisert aminosyre aktiveres og bringes derfor til å reagere med aminogruppen i den derivatiserte aminosyre som skal tilkobles. Denne aktiveringen kan gjøres med DCC (forkortelsene er forklart nedenunder), DCC/HOBt eller DCC/HONSu. Preferansen er for aktivering med DCC/HOBt. The immunogenic amino acid sequence can be prepared in a known manner, e.g. using a standard SPPS method, as described by Stewart, J.M., Young, J.D. in "Solid Phase Peptide Synthesis", Pierce Chemical Company, 2nd ed., 1984. Under these circumstances, the side chains of the amino acids containing a functional group, which should not participate in the coupling reaction, are reversibly protected. The free carboxyl group in a derivatized amino acid is activated and is therefore made to react with the amino group in the derivatized amino acid to be connected. This activation can be done with DCC (the abbreviations are explained below), DCC/HOBt or DCC/HONSu. The preference is for activation with DCC/HOBt.

Boe, Fmoc eller Trt kan anvendes som beskyttelses-gruppe for a-aminogruppen i aminosyrer. Boe, Fmoc or Trt can be used as a protecting group for the α-amino group in amino acids.

Sidekjedegruppene, slik som karboksyl-, hydroksyl-, guanidino- og aminogruppene, kan beskyttes i overensstemmelse med deres reaktivitet med beskyttelsesgruppene, noe som er standard innen peptidkjemi. Alifatiske eller aromatiske rester som skriver seg fra alkoholer, slik som metanol, tert.-butanol eller benzylalkohol, kan anvendes som beskyttelse for karbok-sylgruppene i Asp og Glu. I denne sammenheng er tert.-butanol foretrukket. Hydroksylgruppene i Ser og Thr kan også beskyttes ved hjelp av foretring med tert.-butanol. Merkaptogruppen i cystein kan beskyttes med tritylgruppen. Tosyl-, nitro- eller Pms-gruppen eller protonisering kan anvendes for å beskytte guanidinogruppen i Arg. £-aminogruppen i Lys kan beskyttes ved hjelp av Boe- eller Msc-gruppen. I dette tilfelle er Boc-gruppen foretrukket. I betraktning av beskyttelsesgruppens lave stabilitet overfor baser for a-aminogruppen (Fmoc) må bindingen av den første aminosyre til den faste harpiks være stabil overfor en base. Forankringen til den såkalte p-alk-oksybenzylalkoholharpiksen gir en labil esterbinding i syre-mediet, og denne forankringen er foretrukket i denne sammenheng. The side chain groups, such as the carboxyl, hydroxyl, guanidino and amino groups, can be protected according to their reactivity with the protecting groups, which is standard in peptide chemistry. Aliphatic or aromatic residues derived from alcohols, such as methanol, tert.-butanol or benzyl alcohol, can be used as protection for the carboxyl groups in Asp and Glu. In this context, tert.-butanol is preferred. The hydroxyl groups in Ser and Thr can also be protected by etherification with tert.-butanol. The mercapto group in cysteine can be protected with the trityl group. The tosyl, nitro or Pms group or protonation can be used to protect the guanidino group in Arg. The £-amino group in Lys can be protected by means of the Boe or Msc group. In this case, the Boc group is preferred. Considering the low stability of the protecting group towards bases for the α-amino group (Fmoc), the binding of the first amino acid to the solid resin must be stable towards a base. The anchoring of the so-called p-alk-oxybenzyl alcohol resin gives a labile ester bond in the acid medium, and this anchoring is preferred in this context.

Det eventuelle "avstandsstykke", avsnittet som for-binder enden av et syntetisk peptid til et bærerprotein, kan være sammensatt på forskjellige måter. Forbindelsene egnet for dette formål har f.eks. to identiske eller to forskjellige reaktive grupper i endene til en alkylgruppe som inneholder f.eks. 2-8 karbonatomer. Disse gruppene omfatter bl.a. slike dialdehyder som glutaraldehyd, slike diisocyanater som 1,6-heksametylendiisocyanat, slike diaminer som 1,6-heksametylen-diamin, eller slike o-aminokarboksylsyrer som 6-aminokapron-syre, 6-maleimidkapronsyre. Disse bifunksjonelle reagenser bindes, eventuelt etter aktivering, på kjent måte til på den ene side det syntetiske peptid og på den annen side til bærerproteinet. E-maleimidkapronsyre er foretrukket som et avsnitt i det totale "avstandsstykke". Det andre avsnittet i "avstandsstykket" kan bestå av en merkaptoacetylgruppe som skriver seg fra acetyltioeddiksyre og aminosyrenorleucinet (Nie), som ikke opptrer i naturen. The eventual "spacer", the section that connects the end of a synthetic peptide to a carrier protein, can be composed in different ways. The compounds suitable for this purpose have e.g. two identical or two different reactive groups at the ends of an alkyl group containing e.g. 2-8 carbon atoms. These groups include, among other things, such dialdehydes as glutaraldehyde, such diisocyanates as 1,6-hexamethylene diisocyanate, such diamines as 1,6-hexamethylene diamine, or such o-aminocarboxylic acids as 6-aminocaproic acid, 6-maleimidocaproic acid. These bifunctional reagents are bound, possibly after activation, in a known manner to, on the one hand, the synthetic peptide and, on the other hand, to the carrier protein. E-maleimide caproic acid is preferred as a section in the overall "spacer". The second paragraph in the "spacer" can consist of a mercaptoacetyl group that is written from acetylthioacetic acid and the amino acid norleucine (Nie), which does not occur in nature.

For å innføre "avstandsstykket", acyleres det beskyt-tede peptid med Nie og acetyltioeddiksyre mens det fortsatt er bundet til harpiksen. e-maleimidkapronsyren aktiveres ved hjelp av HONSu og DCC, hvorved man får maleimidoheksanoyl-N-hydroksysuccinimid. Etter at et bærerprotein er blitt tilføyd, aminolyseres de aktive estermolekylene ved hjelp av de frie aminogruppene i bærerproteinet. To introduce the "spacer", the protected peptide is acylated with Ni and acetylthioacetic acid while still bound to the resin. The e-maleimidocaproic acid is activated with HONSu and DCC, whereby maleimidohexanoyl-N-hydroxysuccinimide is obtained. After a carrier protein has been added, the active ester molecules are aminolysed with the help of the free amino groups in the carrier protein.

Etter løsning fra harpiksen, avbeskyttelse og rensing av peptidet som er forlenget med et avsnitt av "avstandsstykket", avbeskyttes aminoendedelen, f.eks. ved behandling med en blanding av 4 N NaOH/metanol/dioksan (1/5/14), og som et resultat av dette løsnes acetylgruppen. Koblingen mellom bærerproteinet tilveiebrakt med en maleimidogruppe og det syntetiserte peptid forlenget med en merkaptoacetylgruppe for-løper spontant. After release from the resin, deprotection and purification of the peptide extended by a segment of the "spacer", the amino terminus is deprotected, e.g. by treatment with a mixture of 4 N NaOH/methanol/dioxane (1/5/14), and as a result the acetyl group is released. The coupling between the carrier protein provided with a maleimido group and the synthesized peptide extended with a mercaptoacetyl group proceeds spontaneously.

Prinsipielt kan hvilket som helst protein, f.eks. bovint serumalbumin (BSA), men også andre egnede organiske eller uorganiske materialer, anvendes som bærer. In principle, any protein, e.g. bovine serum albumin (BSA), but also other suitable organic or inorganic materials, are used as carriers.

Med immunogenet erholdt på denne måte er det mulig å immunisere forsøksdyr, slik som mus, rotter, kaniner eller geiter, på kjent måte. På en annen måte fås antisera inne-holdende polyklonale antistoffer. With the immunogen obtained in this way, it is possible to immunize experimental animals, such as mice, rats, rabbits or goats, in a known manner. In another way, antisera containing polyclonal antibodies are obtained.

Monoklonale antistoffer induseres fortrinnsvis på en tilsvarende måte, slik som ifølge Kohler, G., Milstein, C,. Nature, 256 (1975), s. 495-497. For dette formål kan de kjente musmyelomcellelinjene anvendes. Gunstige resultater oppnås ved å anvende en cellelinje som ikke i seg selv produserer noe immunglobulin. Monoclonal antibodies are preferably induced in a similar manner, such as according to Kohler, G., Milstein, C,. Nature, 256 (1975), pp. 495-497. For this purpose, the known mouse myeloma cell lines can be used. Favorable results are obtained by using a cell line that does not itself produce any immunoglobulin.

Miltceller fra immuniserte Balb/c-mus fusjoneres med en myelomcellelinje (fortrinnsvis cellelinjen Sp 2/0 AG14 eller P3 x 63 Ag 8653), som ikke produserer noe immunglobulin. De fusjonerte cellene velges ut ved dyrking i et seleksjons-medium hvor ufusjonerte miltceller og myelomceller dør, og hvor bare miltceller som er fusjonert med myelomcellene (hybridomceller) overlever. Etter dette seleksjonstrinnet velges de hybridomcellene som produserer de fibrinspesifikke antistoffene ut i et ELISA-system. Hybridomcellene som produserer fibrinspesifikke antistoffer, innføres i bukhulen til Balb/c-mus hvor de dyrkes og produserer ascitesvæske som kan tappes ut, og som tjener som en kilde for rensing av de på-krevde monoklonale antistoffer. Spleen cells from immunized Balb/c mice are fused with a myeloma cell line (preferably the cell line Sp 2/0 AG14 or P3 x 63 Ag 8653), which does not produce any immunoglobulin. The fused cells are selected by cultivation in a selection medium where unfused spleen cells and myeloma cells die, and where only spleen cells that have been fused with the myeloma cells (hybridoma cells) survive. After this selection step, the hybridoma cells that produce the fibrin-specific antibodies are selected in an ELISA system. The hybridoma cells that produce fibrin-specific antibodies are introduced into the abdominal cavity of Balb/c mice where they are cultured and produce drainable ascites fluid that serves as a source for purification of the required monoclonal antibodies.

Oppfinnelsen vedrører også et immunogent peptid som er kjennetegnet ved at det har 5-69 aminosyrerester, hvorav en sekvens på minst 5 aminosyrerester er identisk med en sekvens som finnes i aminosyresekvensen 311-379 i y_kjeden "til fibrinogen, og binder til antistoffet ifølge krav 1. The invention also relates to an immunogenic peptide which is characterized in that it has 5-69 amino acid residues, of which a sequence of at least 5 amino acid residues is identical to a sequence found in the amino acid sequence 311-379 in the y_chain "of fibrinogen, and binds to the antibody according to claim 1 .

Antistoffene ifølge oppfinnelsen reagerer ikke med fibrinogen, men reagerer med fibrin type I og type II. Denne reaksjonens følsomhet er i størrelsesorden 0,1 pl/ml, og føl-somheten begrenses ikke av fibrinogen som er til stede i et 20.000 gangers overskudd. The antibodies according to the invention do not react with fibrinogen, but react with fibrin type I and type II. The sensitivity of this reaction is of the order of 0.1 µl/ml, and the sensitivity is not limited by fibrinogen which is present in a 20,000-fold excess.

Fordelen ved å bestemme fibrin type I er at det første trinnet av alle i sammenklumpingen er dannelsen av fibrin I. På grunn av at bestemmelsen av "oppløselig fibrin" er rettet nøyaktig mot å påvise den aller tidligste sammen-klumping, har en test rettet mot fibrin I en bedre diagnostisk verdi enn en som er rettet bare mot fibrin II. Dannelsen av fibrin II forløper via fibrin I. The advantage of determining fibrin type I is that the first step of all in clumping is the formation of fibrin I. Because the determination of "soluble fibrin" is aimed precisely at detecting the very earliest clumping, a test aimed at fibrin I a better diagnostic value than one directed only at fibrin II. The formation of fibrin II proceeds via fibrin I.

En ytterligere fordel ved antistoffene ifølge oppfinnelsen er at de er rettet mot et sted i fibrinet som er involvert i fremskyndelsen av aktiveringen av plasminogen med t-PA (vevplasminogenaktivator); dvs. i fremskyndet plasmindannelse. Kompleksdannelse av dette stedet med antistoffet vil motvirke denne fremskyndelsen og således hjelpe til å holde det fibrin som er til stede i plasma intakt under bestemmelsen av det. Dette er umulig med antistoffene mot fibrin som hittil har vært kjent. A further advantage of the antibodies according to the invention is that they are directed against a site in the fibrin which is involved in the acceleration of the activation of plasminogen by t-PA (tissue plasminogen activator); i.e. in accelerated plasmin formation. Complexation of this site with the antibody will counteract this acceleration and thus help to keep the fibrin present in the plasma intact during its determination. This is impossible with the antibodies against fibrin that have been known up to now.

Oppfinnelsen vedrører derfor en anvendelse av et antistoff ifølge krav 1 for bestemmelse av fibrin, særlig i blod. Dette kan finne sted f.eks. med en såkalt "sandwich"-ELISA eller "sandwich"-EIA. The invention therefore relates to the use of an antibody according to claim 1 for the determination of fibrin, particularly in blood. This can take place e.g. with a so-called "sandwich" ELISA or "sandwich" EIA.

Det rensede monoklonale antistoff immobiliseres under disse betingelsene på en fast bærer og bringes i kontakt i den tilstand med væsken (blod/plasma) som det er ønsket å bestemme fibrininnholdet i. Så bestemmes mengden av fibrin bundet på denne måte ved hjelp av de monoklonale antistoffene ved å tilsette et andre antistoff som er merket med en påvisbar markør, slik som et radioaktivt atom, en fluorescerende eller lumi-nescerende gruppe, eller særlig et enzym (f.eks. pepperrotperoksidase (HRP)). Mengden av det bundne, andre antistoff bestemmes så ved å måle aktiviteten, f.eks. enzymaktiviteten, til markøren. Denne aktiviteten er et mål for fibrinkonsentra-sjonen i blodet eller plasmaet som anvendes. The purified monoclonal antibody is immobilized under these conditions on a solid support and brought into contact in the state with the liquid (blood/plasma) in which it is desired to determine the fibrin content. The amount of fibrin bound in this way is then determined using the monoclonal antibodies by adding a second antibody labeled with a detectable marker, such as a radioactive atom, a fluorescent or luminescent group, or especially an enzyme (eg horseradish peroxidase (HRP)). The amount of the bound second antibody is then determined by measuring the activity, e.g. the enzyme activity, to the marker. This activity is a measure of the fibrin concentration in the blood or plasma used.

Oppfinnelsen vedrører videre et diagnosesett for bestemmelse av fibrin som er kjennetegnet ved at det omfatter et antistoff ifølge krav 1. Antistoffet kan foreligge f.eks. i et antiserum, og settet kan også inneholde ytterligere be-standdeler som trengs for å bestemme fibrin. The invention further relates to a diagnostic kit for the determination of fibrin which is characterized in that it comprises an antibody according to claim 1. The antibody can be present, e.g. in an antiserum, and the kit may also contain additional components needed to determine fibrin.

Ovenfor og i eksemplene nedenunder har forkortelsene de følgende betydninger: Above and in the examples below, the abbreviations have the following meanings:

Ata-OH acetyltioeddiksyre Ata-OH acetylthioacetic acid

BSA bovint serumalbumin BSA bovine serum albumin

Boe tert.-butoksykarbonyl Boe tert.-butoxycarbonyl

Bufc tert.-butyl Bufc tert-butyl

CCD motstrøms fordeling CCD countercurrent distribution

DCC dicykloheksylkarbodiimid DCC dicyclohexylcarbodiimide

DMAP 4-dimetylaminopyridin DMAP 4-Dimethylaminopyridine

DMF dimetylformamid DMF dimethylformamide

Fmoc 9-fluorenylmetyloksykarbony1 Fmoc 9-fluorenylmethyloxycarbony1

HOBt 1-hydroksy-lH-benzotriazol HOBt 1-hydroxy-1H-benzotriazole

HONSu 1-hydroksysuccinimid HONSu 1-Hydroxysuccinimide

MHS 6 - (maleimido )heksanoyl-N-hydi:oksy-succinimid MHS 6 - (maleimido)hexanoyl-N-hydroxy:oxy-succinimide

MSA metansulfonsyre MSA methanesulfonic acid

Msc metylsulfonyletyloksykarbonyl Msc methylsulfonylethyloxycarbonyl

Nie D,L-norleucin Nie D,L-norleucine

(P) p-alkoksybenzylalkoholharpiks PBS fosfatbufret saltoppløsning (pH = 6,9, (P) p-Alkoxybenzyl alcohol resin PBS phosphate buffered saline (pH = 6.9,

0,15 M NaCl) 0.15 M NaCl)

Pms pentametylfenylsulfonyl Pms pentamethylphenylsulfonyl

SPPS fastfase-peptidsyntese SPPS solid-phase peptide synthesis

Tha merkaptoacetyl Tha mercaptoacetyl

TFA trifluoreddiksyre TFA trifluoroacetic acid

TLC tynnsjiktskromatografi TLC thin layer chromatography

Trt trityl. Trt trityl.

Eksempel I Example I

Peptidet y-311-336 (QFSTWDNDNDKFEGNCAEQDGSGWWM) ble fremstilt på en p-alkoksybenzylalkoholharpiks ved hjelp av et halvautomatisk peptidfremstillingsapparat ("Labortec SP-640"). Aminosyrene ble koblet i rekkefølgen angitt som Fmoc-aminosyrer iht. en standardmetode ved å starte med C-endemetio-ninet. Ved denne fremgangsmåten ble de følgende beskyttelses-grupper brukt for sidekjedene: [Lys(K): Boe; Cys(C): Trt; Glu(E), Asp(D), Thr(T) og Ser(S): Bu<*>]. Aminosyrene ble koblet ved hjelp av DCC/HOBt. Harpiksen ble til sist avblokkert og frigjort ved behandling med TFA/MSA/tioanisol (10/1/1) i 2 timer ved værelsestemperatur, etterfulgt av filtrering, utfelling med eter og lyofilisering fra vann. Det urene peptid ble renset ved hjelp av CCD i et apparat med elementer på 10 ml av nedre fase. Det ble gjort bruk av et system av buta-nol, eddiksyre og vann i forholdet 5:1:4. Prøver fra toppene ble hydrolysert i 5,7 N saltsyre ved 105°C i 48 timer i for-seglede glassampuller evakuert ved -80°C. Hydrolysatet ble inndampet flere ganger med vann og underkastet aminosyreanalyse i et "JE0L-JLC-6AM"-analyseapparat. Peptide γ-311-336 (QFSTWDNDNDKFEGNCAEQDGSGWWM) was prepared on a p-Alkoxybenzyl alcohol resin using a semi-automatic peptide preparation apparatus ("Labortec SP-640"). The amino acids were linked in the order indicated as Fmoc amino acids according to a standard method by starting with the C-endemethionine. In this procedure, the following protecting groups were used for the side chains: [Lys(K): Boe; Cys(C): Trt; Glu(E), Asp(D), Thr(T) and Ser(S): Bu<*>]. The amino acids were linked using DCC/HOBt. The resin was finally unblocked and released by treatment with TFA/MSA/thioanisole (10/1/1) for 2 hours at room temperature, followed by filtration, precipitation with ether and lyophilization from water. The impure peptide was purified by CCD in an apparatus with elements of 10 ml of lower phase. A system of butanol, acetic acid and water in the ratio 5:1:4 was used. Samples from the peaks were hydrolyzed in 5.7 N hydrochloric acid at 105°C for 48 hours in sealed glass ampoules evacuated at -80°C. The hydrolyzate was evaporated several times with water and subjected to amino acid analysis in a "JE0L-JLC-6AM" analyzer.

Eksempel II Example II

Peptidet merkaptoacetyl-D,L-norleucylfibrinogen-y (311-336), utstyrt med et avsnitt av "avstandsstykket" (ifølge eksempel I), ble erholdt ifølge synteseskjemaet gjengitt i europeisk patentsøknad nr. 347.959. The peptide mercaptoacetyl-D,L-norleucylfibrinogen-γ (311-336), equipped with a section of the "spacer" (according to Example I), was obtained according to the synthetic scheme reproduced in European Patent Application No. 347,959.

Etter rensing ved hjelp av CCD ble peptidetkarakterisert vedhjelp av TLC og aminosyreanalyse. Norleucinet ble tatt med for å være i stand til å bestemme antallet peptider pr. bærermolekyl. Den kjemiske renhet ble bestemt ved hjelp av TLC i forskjellige oppløsningssystemer. After purification by CCD, the peptide was characterized by TLC and amino acid analysis. The norleucine was included to be able to determine the number of peptides per carrier molecule. The chemical purity was determined by TLC in different solvent systems.

Eksempel III Example III

4,5 mg MHS ble tilsatt 50 mg svært rent BSA oppløst i 1 ml fosfatbuffer (pH = 8). Etter omsetning i 5 min blei reaksjonsblandingen renset ved hjelp av gelfiltrering under anvendelse av "Sephadex G-25" med fosfatbuffer (pH = 6) som elueringsmiddel. 37 mg av det aktiverte peptid fra eksempel II ble tilsatt BSA-avstandsstykkeoppløsningen som derved ble erholdt. Etter omsetning i 2 timer ved værelsestemperatur ble reaksjonsblandingen dialysert mot PBS og lyofilisert. 4.5 mg of MHS was added to 50 mg of highly pure BSA dissolved in 1 ml of phosphate buffer (pH = 8). After reaction for 5 min, the reaction mixture was purified by means of gel filtration using "Sephadex G-25" with phosphate buffer (pH = 6) as eluent. 37 mg of the activated peptide from Example II was added to the BSA spacer solution thus obtained. After reaction for 2 hours at room temperature, the reaction mixture was dialyzed against PBS and lyophilized.

Eksempel IV Example IV

Pol<y>klonale antistoffer Pol<y>clonal antibodies

Et ensformig, N-ende-koblet peptidbærerprotein-konjugat ble oppløst i 0,15 M NaCl og blandet med et like stort volum av Freunds komplette adjuvans. Et volum av denne blandingen som svarer til 125 ug totalt protein (10 ug koblet peptid), ble injisert i bukhulen til Balb/c-mus. Disse injek-sjonene ble gjentatt fire ganger, men Freunds ukomplette adjuvans ble nå brukt. A uniform, N-terminally linked peptide-carrier protein conjugate was dissolved in 0.15 M NaCl and mixed with an equal volume of Freund's complete adjuvant. A volume of this mixture corresponding to 125 µg total protein (10 µg linked peptide) was injected into the abdominal cavity of Balb/c mice. These injections were repeated four times, but Freund's incomplete adjuvant was now used.

Tilstedeværelsen av antistoffer i blodet til musene immunisert på denne måte, ble bestemt ved hjelp av den ovenfor beskrevne ELISA. The presence of antibodies in the blood of the mice immunized in this way was determined by means of the ELISA described above.

Eksempel V Example V

Monoklonale antistoffer , Monoclonal antibodies,

Balb/c-musene immunisert ifølge eksempel IV ble injisert intravenøst med 250 pg BSA-peptidkonjugat oppløst i 0,15 M NaCl 3 dager før fjerningen av milten. Miltceller fra musene ble blandet med myelomceller i et forhold på 4:1 i nær-vær av 40 % polyetylenglykol (molekylvekt 4000), som beskrevet av Kohler og Milstein (Nature, 256 (1975), s. 495-497. Etter fusjon ble cellesuspensjonen fortynnet og fordelt over veggene i fire mikrotiterplater slik at hver brønn inneholdt 3,3 x10<5>miltceller. The Balb/c mice immunized according to Example IV were injected intravenously with 250 µg of BSA-peptide conjugate dissolved in 0.15 M NaCl 3 days before the removal of the spleen. Spleen cells from the mice were mixed with myeloma cells in a ratio of 4:1 in the presence of 40% polyethylene glycol (molecular weight 4000), as described by Kohler and Milstein (Nature, 256 (1975), pp. 495-497. After fusion, the cell suspension was diluted and distributed over the walls of four microtitre plates so that each well contained 3.3 x10<5> spleen cells.

Etter at miltcellene og myelomcellene hadde dødd i seleksjonsmediet til K6hler og Milstein, ble dyrkningsvæsker fra brønnene som utviste hybridomvekst testet etter 10- 14 dager med hensyn på tilstedeværelsen av fibrinspesifikke antistoffer. After the spleen and myeloma cells had died in the selection medium of K6hler and Milstein, culture fluids from the wells showing hybridoma growth were tested after 10-14 days for the presence of fibrin-specific antibodies.

For dette formål ble brønnene i polystyrenmikrotiter-plater belagt med fibrinogen eller fibrinmonomerer (fremstilt ifølge Belitzer et al., Biochim. Biophys. Acta, 154 (1968), For this purpose, the wells of polystyrene microtiter plates were coated with fibrinogen or fibrin monomers (prepared according to Belitzer et al., Biochim. Biophys. Acta, 154 (1968),

s. 367). Etter vasking ble små volumer av dyrkningsvæsken av hybridomene innført i de belagte brønnene og inkubert der i 1 time ved 37°C. Så ble brønnene på nytt vasket. En oppløsning av polyklonale antistoffer rettet mot musimmunglobuliner og koblet med pepperrotperoksidase ble så innført i brønnene og inkubert der i 1 time ved 37°C. Etter vasking ble tilstedeværelsen av peroksidaseaktivitet i brønnene bestemt og kvanti-fisert som et mål for mengden av og spesifisiteten til de monoklonale antistoffene som er til stede i dyrkningsvæskene. p. 367). After washing, small volumes of the culture fluid of the hybridomas were introduced into the coated wells and incubated there for 1 hour at 37°C. The wells were then washed again. A solution of polyclonal antibodies directed against mouse immunoglobulins and coupled with horseradish peroxidase was then introduced into the wells and incubated there for 1 hour at 37°C. After washing, the presence of peroxidase activity in the wells was determined and quantified as a measure of the amount and specificity of the monoclonal antibodies present in the culture fluids.

Cellelinjene som produserer et fibrinspesifikt antistoff ble så klonet to ytterligere ganger, som beskrevet av McKearn (T.J. McKearn i "Monoclonal Antibodies, Hybridomas: a new dimension in biological analysis. Plenum, New York, 1980, s. 374. The cell lines producing a fibrin-specific antibody were then cloned two additional times, as described by McKearn (T.J. McKearn in "Monoclonal Antibodies, Hybridomas: a new dimension in biological analysis. Plenum, New York, 1980, p. 374.

Eksempler på to cellelinjer funnet på denne måte: Examples of two cell lines found in this way:

Eksempel VI Example VI

Bestemmelse av fibrin i blod Determination of fibrin in blood

Nytappet blod fra friske givere ble behandlet et kort tidsrom med en liten mengde trombin. Ved denne fremgangsmåten ble en mengde oppløselig fibrin fremstilt i plasmaet. En opp-løsning (10 ug/ml) av et monoklonalt antistoff (i 0,04 M tris/Hel, pH 7,5) fremstilt ifølge oppfinnelsen, ble innført i brønnene i en polystyrenmikrotiterplate og inkubert der i 16 timer ved 4°C. Ved denne inkubasjonen ble de monoklonale antistoffene adsorbert på veggen i brønnene. Etter vasking ble fortynningsserier av plasmaet behandlet med trombin og av det samme plasma uten trombinbehandling pipettert over i brønnene. Etter inkubering i 1 time, fortrinnsvis ved 4°C, ble brønnene vasket og en oppløsning av et pepperrotperoksidasekonjugat med et annet monoklonalt antistoff (som ikke behøver å være fibrinspesifikt) innført i brønnene. Etter å ha inkubert på Freshly drawn blood from healthy donors was treated for a short time with a small amount of thrombin. By this method, a quantity of soluble fibrin was produced in the plasma. A solution (10 µg/ml) of a monoclonal antibody (in 0.04 M tris/Hel, pH 7.5) prepared according to the invention was introduced into the wells of a polystyrene microtiter plate and incubated there for 16 hours at 4°C . During this incubation, the monoclonal antibodies were adsorbed on the wall of the wells. After washing, dilution series of the plasma treated with thrombin and of the same plasma without thrombin treatment were pipetted into the wells. After incubation for 1 hour, preferably at 4°C, the wells were washed and a solution of a horseradish peroxidase conjugate with another monoclonal antibody (which need not be fibrin specific) was introduced into the wells. After incubating on

nytt i 1 time (fortrinnsvis ved 4°C) ble brønnene vasket og peroksidaseaktiviteten anvendt som et mål for mengden av fibrin som er blitt bundet til brønnene belagt med det fibrinspesifikke antistoff. Dette gjøres ved å anvende en blanding av tetrametylbenzidin og hydrogenperoksid som substrat for peroksidase (E.S. Bos et al., J. Immunoassay, 2 (1981), again for 1 hour (preferably at 4°C), the wells were washed and the peroxidase activity used as a measure of the amount of fibrin that has been bound to the wells coated with the fibrin-specific antibody. This is done by using a mixture of tetramethylbenzidine and hydrogen peroxide as a substrate for peroxidase (E.S. Bos et al., J. Immunoassay, 2 (1981),

s. 187). Som et resultat av virkningen av peroksidase ble det på denne måte fremstilt et blått produkt som forandres til gult når reaksjonen stanses ved å tilsette 1 M H2S04€»tter inkubasjon i 10 min ved 37°C. Styrken på den gule fargen ble målt ved en bølgelengde på 405 m/u og er et mål for peroksi-daseaktivi teten . p. 187). As a result of the action of peroxidase, a blue product was thus produced which changes to yellow when the reaction is stopped by adding 1 M H 2 SO 4 followed by incubation for 10 min at 37°C. The strength of the yellow color was measured at a wavelength of 405 m/u and is a measure of the peroxidase activity.

Et eksempel: An example:

Claims

1. Antibodies which react specifically with fibrin, but not with fibrinogen, for use in vitro, characterized in that the antibodies are directed against a peptide with 5-69 amino acid residues, of which a sequence of at least 5 amino acid residues is identical to a sequence found in the amino acid sequence 311 -379 in the y chain of fibrinogen.

2. Antibodies according to claim 1, characterized in that they are directed against a peptide in which at least five amino acid residues are identical to a sequence found in the amino acid sequence y-311-336.

3. Antibodies according to claim 1, characterized in that they are directed against a peptide containing the amino acid sequence y-315-322.

4. Antibodies according to claim 3, characterized in that they are directed against a peptide containing the amino acid sequence y-311-336.

5. Antibodies according to claim 1, characterized in that they are obtained by immunizing with an amino acid sequence that is bound to an immunogenic carrier, optionally via a "spacer".

6. Antibodies according to claim 1, characterized in that the antibodies are monoclonal.

7. Immunogenic peptide, characterized in that it has 5-69 amino acid residues, of which a sequence of at least 5 amino acid residues is identical to a sequence found in the amino acid sequence 311-379 in the y-chain of fibrinogen, and binds to the antibody according to claim 1.

8. Use of an antibody according to claim 1 for the determination of fibrin.

9. Diagnostic kit for the determination of fibrin, characterized in that it comprises an antibody according to claim 1.