NO179756B - Method of perforating a well - Google Patents
Method of perforating a well Download PDFInfo
- Publication number
- NO179756B NO179756B NO902009A NO902009A NO179756B NO 179756 B NO179756 B NO 179756B NO 902009 A NO902009 A NO 902009A NO 902009 A NO902009 A NO 902009A NO 179756 B NO179756 B NO 179756B
- Authority
- NO
- Norway
- Prior art keywords
- pressure
- well
- pipe string
- piston
- packing
- Prior art date
Links
- 238000000034 method Methods 0.000 title claims description 9
- 239000012530 fluid Substances 0.000 claims description 28
- 238000012856 packing Methods 0.000 claims description 26
- 230000007246 mechanism Effects 0.000 claims description 20
- 230000004913 activation Effects 0.000 claims description 16
- 238000010304 firing Methods 0.000 claims description 15
- 238000004891 communication Methods 0.000 claims description 11
- 230000000694 effects Effects 0.000 claims description 4
- 238000012360 testing method Methods 0.000 description 18
- 238000007789 sealing Methods 0.000 description 14
- 230000015572 biosynthetic process Effects 0.000 description 10
- 210000002445 nipple Anatomy 0.000 description 10
- 238000012546 transfer Methods 0.000 description 6
- 238000004519 manufacturing process Methods 0.000 description 5
- 238000010276 construction Methods 0.000 description 4
- 230000007704 transition Effects 0.000 description 4
- 238000005520 cutting process Methods 0.000 description 3
- 238000005553 drilling Methods 0.000 description 3
- 239000002360 explosive Substances 0.000 description 3
- 230000006378 damage Effects 0.000 description 2
- 238000005474 detonation Methods 0.000 description 2
- 238000009527 percussion Methods 0.000 description 2
- 208000027418 Wounds and injury Diseases 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 108010038083 amyloid fibril protein AS-SAM Proteins 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 238000004140 cleaning Methods 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 230000002706 hydrostatic effect Effects 0.000 description 1
- 208000014674 injury Diseases 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 230000002028 premature Effects 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
Description
Denne oppfinnelse angår en fremgangsmåte for perforering av en brønn under anvendelse av en perforeringskanon fastholdt i nedre ende av en rørstreng, hvilken rørstreng innbefatter en pakning, et hus tilknyttet perforeringskanonen, en detonator opphengt under pakningen innrettet til ved avfyring å perfore-re brønnen i den avsperrete brønndel, et aksielt bevegbart tennstempel avtettet mot huset innrettet for antenning av detonatoren, og en aktiviseringsmekanisme som reagerer på hydraulisk trykk montert i forhold til huset for aktivisering av tennstempelet, idet tennstempelet stenger mot et lavt, fortrinnsvis atmosfærisk, trykk på sin mot detonatoren vendte ende og som mot sin andre ende står i fluidkommunikasjon med ringrommet mellom rørstrengen og brønnveggene over pakningen, omfattende trinnene This invention relates to a method for perforating a well using a perforating gun held at the lower end of a pipe string, which pipe string includes a packing, a housing connected to the perforating gun, a detonator suspended below the packing designed to perforate the well in the sealed well portion, an axially movable firing piston sealed against the housing adapted to ignite the detonator, and an activation mechanism responsive to hydraulic pressure mounted relative to the housing for activating the firing piston, the firing piston closing against a low, preferably atmospheric, pressure on its side facing the detonator end and which towards its other end is in fluid communication with the annulus between the pipe string and the well walls above the packing, comprising the steps
a) nedføring av perforeringskanonen til det sted hvor perforeringen skal utføres, idet pakningen deler brønnen i en a) lowering the perforating gun to the place where the perforating is to be carried out, as the packing divides the well into a
avsperret brønndel under pakningen og et ringrom mellom rørstrengen og brønnveggene over pakningen opp til overflaten, sealed off part of the well below the packing and an annulus between the pipe string and the well walls above the packing up to the surface,
b) opprettelse av fluidkommunikasjon mellom den avsperrete brønndelen og brønnoverflaten gjennom rørstrengen og ved b) creation of fluid communication between the blocked well part and the well surface through the pipe string and by
åpning av en ventilinnretning i rørstrengen som samtidig gir fluidkommunikasjon med en lavtrykkside av aktive-ringsmekanismen , c) opprettelse av fluidkommunikasjon mellom ringrommet og en høytrykkside av aktiviseringsmekanismen gjennom en port, d) utløsning av aktiviseringsmekanismen for å bevirke avfyring av perforeringskanonen når trykket i rørstrengen er opening of a valve device in the pipe string which simultaneously provides fluid communication with a low pressure side of the activation mechanism, c) creation of fluid communication between the annulus and a high pressure side of the activation mechanism through a port, d) triggering of the activation mechanism to cause firing of the perforating gun when the pressure in the pipe string is
lave- re enn trykket i den avsperrete brønndelen. lower than the pressure in the blocked well section.
Det foreligger tallrike forslag til systemer for perforering av en brønn. Eksempler på tidligere kjente systemer som anvendes i forbindelse med en rørstreng er vist i US patent-skrifter nr. 2 092 337, 2 169 559, 2 330 509 og 2 760 408. I henhold til disse publikasjoner blir tennmekanismen som utlø-ser perforeringsladningen påvirket ved hjelp av elektriske innretninger, ved manipulering av rørstrengen eller ved å slippe en støtstav (vanligvis kalt "go-devil") gjennom rør-strengen. Elektrisk påvirkning krever vanligvis nedføring av en vaier i rørstrengen, hvilket innebærer tungvinte og ofte tidkrevende operasjoner. Systemer som benytter seg av rør-strengmanipulering innbefatter typisk nokså kompliserte mekaniske konstruksjoner, og kan medføre for tidlig utløsning når rørstrengen nedføres i brønnen. Systemer basert på fallstaver ansees ikke for å være praktisk brukbare i awiksbrønner da man risikerer at staven ikke når bunnen. I alle tilfeller er selvsagt sikkerheten av avgjørende betydning. There are numerous proposals for systems for perforating a well. Examples of previously known systems which are used in connection with a pipe string are shown in US Patent Nos. 2,092,337, 2,169,559, 2,330,509 and 2,760,408. According to these publications, the ignition mechanism that triggers the perforating charge is affected by means of electrical devices, by manipulating the pipe string or by dropping a shock rod (commonly called a "go-devil") through the pipe string. Electrical influence usually requires lowering a wire into the pipe string, which involves cumbersome and often time-consuming operations. Systems that use pipe string manipulation typically include fairly complicated mechanical constructions, and can lead to premature release when the pipe string is lowered into the well. Systems based on drop rods are not considered to be practically usable in awiks wells as there is a risk that the rod will not reach the bottom. In all cases, of course, safety is of crucial importance.
Fra US patentskrift nr. 3 189 094 er det kjent en fremgangsmåte av den innledningsvis angitte art, dvs der utløsnin-gen skjer ved hjelp av fluidtrykk, slik at man unngår ulempeme ved ovennevnte mekanisk utløste konstruksjoner. Denne kjente fremgangsmåte er slik at låsemekanismen og detonatoren reagerer på samme trykkforskjell, hvilket innebærer en fare for personskade dersom tennanordningen klikker og perforeringsinn-retningen deretter trekkes opp fra borehullet til boreplatt-formen. From US patent no. 3 189 094, a method of the kind indicated at the outset is known, i.e. in which the release takes place by means of fluid pressure, so that the disadvantages of the above-mentioned mechanically released constructions are avoided. This known method is such that the locking mechanism and the detonator react to the same pressure difference, which entails a risk of personal injury if the ignition device clicks and the perforation device is then pulled up from the drill hole to the drill plate form.
Formålet med foreliggende oppfinnelse er å tilveiebringe en fremgangsmåte av nevnte art, som gjør det mulig å påvirke perforeringskanonen under kontrollerte brønnforhold, med større sikkerhet og pålitelighet enn hva som tidligere har vært mulig. The purpose of the present invention is to provide a method of the aforementioned kind, which makes it possible to influence the perforating gun under controlled well conditions, with greater safety and reliability than has previously been possible.
Dette oppnås ifølge oppfinnelsen ved at This is achieved according to the invention by
fluidkommunikasjonen i trinn b) opprettes ved påføring av en økning av trykket i ringrommet ved brønnoverflaten i the fluid communication in step b) is created by applying an increase in the pressure in the annulus at the well surface in
forhold til trykket i rørstrengen for å oppnå en første forutbestemt trykkforskjell, hvilken trykkforskjell be virker at ventilinnretningen åpnes, in relation to the pressure in the pipe string to achieve a first predetermined pressure difference, which pressure difference causes the valve device to open,
avfyringen av perforeringskanonen i trinn d) bevirkes ved påføring av ytterligere økning av trykket i ringrommet eller avlaste trykket i rørstrengen ved brønnoverflaten for å oppnå en andre forutbestemt trykkforskjell mellom ringrommet og rørstrengen som er større enn den første forutbestemte trykkforskjell, hvilken andre trykkforskjell utløser aktiviseringsmekanismen for å bevirke at tennstempelet beveges til antenning av detonatoren og the firing of the perforating gun in step d) is effected by applying a further increase in the pressure in the annulus or relieving the pressure in the tubing string at the well surface to achieve a second predetermined pressure difference between the annulus and the tubing string that is greater than the first predetermined pressure difference, which second pressure difference triggers the activation mechanism for to cause the firing piston to move to ignite the detonator and
derved bevirke avfyring av perforeringskanonen, dersom, og bare dersom, trykket i den avsprrete brønndelen er høyere enn det lave, fortrinnsvis atmosfæriske, trykket mellom tennstempelet og detonatoren. thereby causing firing of the perforating gun, if, and only if, the pressure in the cut-off well part is higher than the low, preferably atmospheric, pressure between the ignition piston and the detonator.
Utføringsformer av oppfinnelsen er valgt med henblikk på å anskueliggjøre og beskrive både fremgangsmåten og en anord-ning som brukes for utførelse av denne, og er vist i de med-følgende tegninger, hvor: Fig. 1 er et skjematisk riss av en utføringsform av et rørbefordret brønnperforeringssystem ifølge foreliggende oppfinnelse, eksempelvis vist som en del av en teststreng anordnet i en brønn, Fig. 2A - 2D er lengdesnitt (bare høyre side vist) av en del av det i fig. 1 viste system, idet hver påfølgende figur utgjør en nedre fortsettelse av den foregående figur, og Fig. 3A - 3D er riss tilsvarende fig. 2A - 2D av en modifisert utføringsform av brønnperforeringssystemet vist i fig. 1 og 2A - 2D. Embodiments of the invention have been chosen with a view to illustrating and describing both the method and a device used for carrying it out, and are shown in the accompanying drawings, where: Fig. 1 is a schematic diagram of an embodiment of a pipe-borne well perforation system according to the present invention, for example shown as part of a test string arranged in a well, Fig. 2A - 2D are longitudinal sections (only the right side shown) of a part of the in fig. 1 shown system, with each subsequent figure constituting a lower continuation of the previous figure, and Figs. 3A - 3D are drawings corresponding to Figs. 2A - 2D of a modified embodiment of the well perforation system shown in fig. 1 and 2A - 2D.
Idet det først henvises til fig. 1 er det skjematisk vist en streng av formasjonsteste- og perforeringsverktøy som er opphengt i et foret brønnhull på en rørstreng 10. Verktøy-strengen omfatter en hoved-testeventilenhet 11 av den type som er vist i US patent Re 29 638 som innbefatter et ventillegeme som reagerer på trykkendringer i fluider i ringrommet 12 for åpning og stenging av en strømningskanal som strekker seg oppad gjennom ventilenheten. Nedre ende av hoved-testeventilenheten 11 er forbundet med en registreringsseksjon 13 som opptar en trykkregistreringsinnretning som registrerer fluidtrykket i kanalen som en funksjon av medgått tid etterhvert som testen skrider frem. Nedre ende av registreringsseksjonen 13 er forbundet med en trykkoverføringsseksjon 14 som har sideåpninger 15 i forbindelse med brønn-ringrommet, og over-førings seksjonen er forbundet med en tetningsnippel 16 som strekker seg nedad gjennom boringen i en pakning 17 av konvensjonell konstruksjon. Pakningen 17, som kan være av permanent anspent type, innbefatter typisk normalt tilbaketrukne kiler og pakningselementer som kan ekspanderes for å danne en for-ankret pakning i brønnens foringsrør 18. Pakningsdoren har en tetningsboring som opptar tetningsnippelen 16, og et oppad stengende ventillegeme som f.eks. et klaffelement 20 virker til automatisk å stenge boringen mot oppadstrømmende fluider når tetningsnippelen og de underliggende komponenter trekkes tilbake. As reference is first made to fig. 1 schematically shows a string of formation testing and perforating tools suspended in a lined wellbore on a pipe string 10. The tool string comprises a main test valve assembly 11 of the type shown in US patent Re 29,638 which includes a valve body which reacts to pressure changes in fluids in the annulus 12 to open and close a flow channel which extends upwards through the valve assembly. The lower end of the main test valve unit 11 is connected to a recording section 13 which accommodates a pressure recording device which records the fluid pressure in the channel as a function of elapsed time as the test progresses. The lower end of the recording section 13 is connected to a pressure transfer section 14 which has side openings 15 in connection with the well annulus, and the transfer section is connected to a sealing nipple 16 which extends downwards through the bore in a gasket 17 of conventional construction. The packing 17, which may be of the permanently tensioned type, typically includes normally retracted wedges and packing elements which can be expanded to form an anchored packing in the well casing 18. The packing mandrel has a sealing bore which receives the sealing nipple 16, and an upwardly closing valve body which f .ex. a flap element 20 acts to automatically close the bore against upward-flowing fluids when the sealing nipple and underlying components are retracted.
En slisset eller perforert seksjon av en produksjonsrør-forlengelse 21 er tilkoplet under tetningsnippelen 16 og virker til å slippe formasjonsfluider inn i strømningskanalen gjennom verktøyene når ventillegemet i hoved-testeventilenheten 11 er åpent. Nedre ende av produksjonsrørforlengelsen 21 er tilkoplet en hydraulisk påvirkbar tennseksjon 22 som er konstruert i henhold til foreliggende oppfinnelse. Tennseksjonen 22 er innrettet til å bevirke selektiv utløsning av en perforeringskanon 23 som er tilkoplet dens nedre ende, idet kanonen innbefatter et antall sprengstoffladninger (f.eks. profilerte ladninger) som ved detonering danner perforeringer gjennom foringsrørets 18 vegg og inn i formasjonen slik at formasjonsfluider kan strømme inn i brønnhullet. En annen registreringsinnretning 24 kan være tilkoplet nedre ende av perforeringskanonen 23 for å skaffe ytterligere trykkregistre-ringer. A slotted or perforated section of a production tubing extension 21 is connected below the seal nipple 16 and acts to admit formation fluids into the flow channel through the tools when the valve body of the main test valve assembly 11 is open. The lower end of the production pipe extension 21 is connected to a hydraulically actuable igniter section 22 which is constructed according to the present invention. The igniter section 22 is arranged to cause selective release of a perforating cannon 23 which is connected to its lower end, the cannon including a number of explosive charges (e.g. profiled charges) which, on detonation, form perforations through the wall of the casing 18 and into the formation so that formation fluids can flow into the wellbore. Another recording device 24 can be connected to the lower end of the perforating gun 23 in order to provide additional pressure recordings.
I fig. 2A er de forskjellige konstruksjonsdeler utfø-ringsf ormen består av vist i detalj. Trykkoverføringsseksjo-nen 14 har en innvendig gjenget muffe 30 for tilkopling til registreringshuset 13 og en gjenget tapp 31 for tilkopling til øvre ende av tetningsnippelens 16 dor 32. Et antall radielt forløpende åpninger 15 strekker seg gjennom veggen i seksjonen 14 for å sette brønn-ringrommet over pakningen 17.i forbindelse med den innvendige boring 33 i et trykkrør 34 med liten diameter, som strekker seg ned gjennom tetningsnippeldoren 32. Det ringformete rom 35 mellom tetningsnippelens 16 innvendige vegg og rørets 34 yttervegg utgjør en del av testekanalen som via vertikale åpninger 36 står i forbindelse med testekanal-partiet over overføringsseksjonen 14. Typiske tetningselemen-ter 37 er anordnet på tetningsnippelens ytre omkrets, og ligger an mot veggflater på pakningsdoren for å hindre fluid-lekkasje. In fig. 2A, the various structural parts the embodiment consists of are shown in detail. The pressure transfer section 14 has an internally threaded sleeve 30 for connection to the registration housing 13 and a threaded stud 31 for connection to the upper end of the mandrel 32 of the sealing nipple 16. A number of radially extending openings 15 extend through the wall of the section 14 to set the well annulus above the gasket 17. in connection with the internal bore 33 in a pressure pipe 34 with a small diameter, which extends down through the sealing nipple mandrel 32. The annular space 35 between the inner wall of the sealing nipple 16 and the outer wall of the pipe 34 forms part of the test channel which via vertical openings 36 is in connection with the test channel section above the transfer section 14. Typical sealing elements 37 are arranged on the outer circumference of the sealing nipple, and rest against the wall surfaces of the packing mandrel to prevent fluid leakage.
Tetningsnippelens 16 nedre ende er ved hjelp av en muffe 38 koplet til øvre ende av den slissete rørforlengelse 21 som har et antall åpninger 40 gjennom hvilke formasjonsfluider kan strømme inn. Et overgangsstykke 41 og en muffe forbinder nedre ende av rørforlengelsen 21 med en rørseksjon 42 som kan brukes til å holde tennseksjonen og perforeringskanonen i en forutvalgt avstand under pakningen 17. Nedre ende av trykk-røret 34 er avtettet ved hjelp av O-ringer mot overgangsstykket 41. The lower end of the sealing nipple 16 is connected by means of a sleeve 38 to the upper end of the slotted pipe extension 21 which has a number of openings 40 through which formation fluids can flow in. A transition piece 41 and a sleeve connect the lower end of the tube extension 21 with a tube section 42 which can be used to hold the igniter section and the perforating gun at a preselected distance below the gasket 17. The lower end of the pressure tube 34 is sealed by means of O-rings against the transition piece 41.
Som vist i fig. 2C er rørseksjonens 42 nedre ende ved hjelp av gjenger 43 tilkoplet øvre ende av tennhodeenheten 22. Enheten 22 innbefatter et øvre overgangsstykke 45 som er fastskrudd til en øvre husseksjon 46 som i sin tur er fastskrudd til en nedre husseksjon 47. Overgangsstykket 45 har en tverrvegg 48 med åpninger 49 som setter husseksjonens 46 innvendige boring 51 i forbindelse med boringen 52 i røret 42 og følgelig med boringen 33 i det ovenforliggende trykkrør 34. I husseksjonens 46 boring er der bevegelig anordnet et aktiv-iserings-hylsestempel 53 forsynt med tetningsringer 54 som ligger an mot husseksjonens 46 sylindriske veggflate 55. Hylsestempelet 53 har en lukket øvre ende, og en utvendig, oppadvendt brystning 56 som normalt ligger an mot en nedadvendt ansats 57 på husseksjonen 46. En bruddpinne 58 som er innskrudd i veggen til husseksjonen 46, har et innvendig endeparti 60 som danner inngrep med et utvendig, ringformet spor 61 i stempelet 53. Hylsestempelets 53 nedre endeparti 62 danner en innadvendt, ringformet låseflate 63 som normalt danner inngrep med et antall omkretsmessig fordelte paler 64 som strekker seg gjennom åpninger i den øvre endeseksjon 65 av en forlengerhylse 66 og til inngrep med et ringformet spor 67 som er utformet i øvre ende av et langstrakt tennstempel 70. Når palene 64 er i inngrep som vist hindrer de aksiell bevegelse av tennstempelet 70 fra den i fig. 2C viste stilling. As shown in fig. 2C, the lower end of the tube section 42 is connected by means of threads 43 to the upper end of the igniter head unit 22. The unit 22 includes an upper transition piece 45 which is screwed to an upper housing section 46 which in turn is screwed to a lower housing section 47. The transition piece 45 has a transverse wall 48 with openings 49 which connect the internal bore 51 of the housing section 46 in connection with the bore 52 in the pipe 42 and consequently with the bore 33 in the above pressure pipe 34. In the bore of the housing section 46 there is a movably arranged activation sleeve piston 53 provided with sealing rings 54 which rests against the cylindrical wall surface 55 of the housing section 46. The sleeve piston 53 has a closed upper end, and an external, upward-facing parapet 56 which normally rests against a downward-facing shoulder 57 on the housing section 46. A break pin 58 which is screwed into the wall of the housing section 46, has an internal end part 60 which forms an engagement with an external, ring-shaped groove 61 in the piston 53. The lower end part 62 of the sleeve piston 53 forms an inward facing annular locking surface 63 which normally engages a number of circumferentially spaced pawls 64 extending through openings in the upper end section 65 of an extension sleeve 66 and for engagement with an annular groove 67 formed in the upper end of an elongate ignition piston 70 When the pawls 64 are engaged as shown, they prevent axial movement of the ignition piston 70 from that in fig. 2C showed position.
Én eller flere åpninger 71 strekker seg gjennom veggen i husseksjonen 46 og setter derved det indre parti av hylsestem- One or more openings 71 extend through the wall of the housing section 46 and thereby place the inner part of the sleeve
pelet 53 via én eller flere åpninger 71' og tennstempelets 70 øvre endeflate i forbindelse med trykkfluidene i den avsperrete del av brønnen under pakningen 17. the pile 53 via one or more openings 71' and the upper end surface of the ignition piston 70 in connection with the pressure fluids in the sealed-off part of the well below the gasket 17.
Tennstempelet 70 strekker seg ned gjennom en tetning 72 (fig. 2D) og det øvre endeparti 73 av den nedre husseksjon 47, og er utstyrt med en nedadvendt brystning 74 mot hvilken en holder 75 trykkes ved hjelp av en skruefjær 76. Nedre ende av fjæren 76 ligger an mot en oppadvendt ansats 77 på en styre-ring 78 som er innskrudd i husseksjonen 47. Nedre ende av tennstempelet 70 er forsynt med et fremspring 80 som er innrettet til, ved nedadbevegelse av stempelet 70, å støte mot og bevirke antenning av en detonator i form av en slagpatron 81 som er montert i en holderenhet 82. Den øvre ende av en lengde av Primacord ™ detonerende lunte 83 er innpasset i nedre ende av hoIderenheten 82 og er på kjent måte innrettet til å antennes når patronen 81 detoneres. Perforeringskanonen 23, som er avtettet ved atmosfærisk trykk på vanlig måte, omfatter et hus 85 som lunten 83 strekker seg ned gjennom. The ignition piston 70 extends down through a seal 72 (Fig. 2D) and the upper end portion 73 of the lower housing section 47, and is provided with a downward facing parapet 74 against which a retainer 75 is pressed by means of a coil spring 76. Lower end of the spring 76 rests against an upwardly facing shoulder 77 on a guide ring 78 which is screwed into the housing section 47. The lower end of the ignition piston 70 is provided with a projection 80 which is arranged to, during downward movement of the piston 70, collide with and cause ignition of a detonator in the form of a percussion cartridge 81 which is mounted in a holder unit 82. The upper end of a length of Primacord™ detonating fuse 83 is fitted into the lower end of the holder unit 82 and is arranged in a known manner to ignite when the cartridge 81 is detonated. The perforating gun 23, which is sealed at atmospheric pressure in the usual way, comprises a housing 85 through which the fuse 83 extends down.
Den antente lunte frembringer detonering av de profilerte ladninger som på kjent måte bevirker perforering av foringsrø-ret 18. The ignited fuse produces detonation of the profiled charges which, in a known manner, cause perforation of the casing pipe 18.
Ved bruk er delene og komponentene i utføringsformen av peforeringssystemet montert som vist i fig. 1 og 2A -2D. Pakningen 17 blir på konvensjonell måte brakt i tettende tilstand i brønn-foringsrøret for avsperring av en del av borehullet. Verktøystrengen nedsenkes i brønnen, idet dens nedre ende innføres gjennom boringen i pakningen 17, og her-under skyver klaffventilen 20 til åpen stilling. Verktøy-strengen nedsenkes inntil tetningsnippelen 16 kommer inn i og stopper i pakningsdorens boring for derved å avtette brønnpar-tiet under pakningen fra det hydrostatiske trykk av-fluidet som står i brønnringrommet over pakningen. Rørstrengen 10 kan være fylt av en vannsøyle som danner en pute eller buffer i den hensikt å muliggjøre kontroll av trykkforskjellen når testeventilenheten 11 åpnes. In use, the parts and components in the embodiment of the perforation system are assembled as shown in fig. 1 and 2A -2D. The gasket 17 is conventionally brought into a sealing state in the well casing to block off part of the borehole. The tool string is immersed in the well, its lower end being introduced through the bore in the gasket 17, and here below the flap valve 20 pushes to the open position. The tool string is lowered until the sealing nipple 16 enters and stops in the bore of the packing mandrel to thereby seal the well portion below the packing from the hydrostatic pressure release fluid that is in the well annulus above the packing. The pipe string 10 can be filled with a column of water which forms a cushion or buffer in order to enable control of the pressure difference when the test valve unit 11 is opened.
For åpning av testeventilenheten 11 blir brønnringrommet 12 satt under trykk fra overflaten for å påvirke ventillegemet i ringrommet på en måte som vist i US patentskrift Re 29 638. Dette trykket virker via overforingsseksjonens åpning 15, trykkrøret 34 og boringen i røret 42 på hylsestempelets 53 øvre endeflate. Bruddpinnens 58 styrke er slik valgt at den ikke vil svikte og derved forårsake utløsning av tennstempelet 70, før den utsettes for et større differensialtrykk enn det som trengs for å påvirke hovedtesteventilenheten 11. For opening the test valve unit 11, the well annulus 12 is pressurized from the surface to influence the valve body in the annulus in a manner as shown in US patent document Re 29 638. This pressure acts via the transfer section opening 15, the pressure pipe 34 and the bore in the pipe 42 on the sleeve piston 53 upper end face. The strength of the rupture pin 58 is chosen so that it will not fail and thereby cause the ignition piston 70 to release, before it is subjected to a greater differential pressure than is needed to affect the main test valve unit 11.
Med hovedventilen 11 åpen kan passende ventiler manøvre-res ved overflaten for gradvis avlasting av trykket i rørs-trengen 10 for derved å øke trykkforskjellen som virker på hylsestempelet 53 inntil pinnen 58 avskjæres. Når pinnen 58 avskjæres blir hylsestempelet 53 plutselig ført nedad hvorved låseflaten 63 bringes i stilling under låsepalene 64 som så forskyves utad for derved å frigjøre tennstempelet 70. Tennstempelet 70 tvinges så nedad på grunn av trykket i brønnhul-let underpakningen, og treffer slagpatronen 81 som bevirker antenning av lunten 83 som igjen utløser perforeringskanonen 23. Ettersom trykket i den avsperrete del av brønnen er vesentlig redusert utføres perforeringene ved "undertrykk", dvs trykket i brønnhullet er mindre en formasjonsfluidtrykket, slik at der umiddelbart oppstår en renseeffekt idet formasjonsfluider strømmer inn i brønn-foringsrøret. Ettersom alt fluidet strømmer mot brønnhullet, blir der ingen skade på formasjonen slik det kunne skjedd dersom perforeringen fore-gikk under overtrykk. With the main valve 11 open, suitable valves can be maneuvered at the surface to gradually relieve the pressure in the pipe string 10 to thereby increase the pressure difference acting on the sleeve piston 53 until the pin 58 is cut off. When the pin 58 is cut off, the sleeve piston 53 is suddenly moved downwards, whereby the locking surface 63 is brought into position under the locking pawls 64, which are then displaced outwards to thereby release the ignition piston 70. The ignition piston 70 is then forced downwards due to the pressure in the well bore of the sub-packing, and hits the percussion cartridge 81 which causes ignition of the fuse 83, which in turn triggers the perforation gun 23. As the pressure in the blocked part of the well is significantly reduced, the perforations are carried out at "negative pressure", i.e. the pressure in the wellbore is less than the formation fluid pressure, so that a cleaning effect immediately occurs as formation fluids flow into the well casing. As all the fluid flows towards the wellbore, there is no damage to the formation as could happen if the perforation took place under overpressure.
Såsnart der et opprettet forbindelse gjennom foringsrøret mellom formasjonen og den avsperrete del av brønnen, kan en testing av brønnen utføres på vanlig måte ved avstengning og åpning av ventilen i testeenheten 11 for vekselvis avstengning av og utstrømning fra formasjonen. Utstrømnings- og avsteng-ningstrykkene registreres ved hjelp av målerne ved 13 og 24. Når testingen er fullført kan verktøystrengen trekkes ut av pakningselementet 17 og fjernes fra brønnen. Pakningen 17 forblir i stilling for påfølgende produksjonsoperasjoner. As soon as a connection is established through the casing between the formation and the blocked part of the well, a test of the well can be carried out in the usual way by shutting off and opening the valve in the test unit 11 to alternately shut off and outflow from the formation. The outflow and shut-off pressures are recorded using the gauges at 13 and 24. When the testing is complete, the tool string can be pulled out of the packing element 17 and removed from the well. The gasket 17 remains in position for subsequent production operations.
Selv om bruk av en produksjonspakning 17 av permanent type er vist og beskrevet her, skal det forstås at man også kunne bruke en typisk opptrekkbar pakningstype som utgjør en enhetlig del av verktøystrengen beliggende mellom overførings-seksjonen 14 og den slissete rørforlengelse 21. I dette tilfelle måtte selvsagt pakningselementet nedføres i forings-røret med verktøystrengen og betjenes for midlertidig avtet-ting av brønnpartiet som skal perforeres og testes. Although the use of a permanent type production packing 17 is shown and described herein, it should be understood that a typical pull-up packing type could also be used which forms a unitary part of the tool string located between the transfer section 14 and the slotted pipe extension 21. In this case of course the packing element had to be lowered into the casing with the tool string and operated for temporary sealing of the well section to be perforated and tested.
Fig. 3A - 3D viser en modifisert utføringsform av brønn-perf orer ingssystemet anordnet som en del av en rørstreng. Utføringsformen ifølge fig. 3A - 3D er en utføringsform med "full boring", som kan nedføres sammen med testeverktøy, eller uten noen testeverktøy som del av et permanent brønnkomplette-ringssystem. Som vist på tegningen er perforeringsverktøyene opptatt i strengen på en slik måte at den sentrale boring er fri for hindringer. Dette gir den fordel at verktøyene ved hjelp av en vaier eller rør med mindre diameter kan nedføres gjennom rørstrengen, uhindret av komponentene i perforerings-systemet. Videre står den ubrutte sentrale boring til rådig-het for å virke som en rørledning for fluider som produseres etter at brønnen er perforert. Fig. 3A - 3D show a modified embodiment of the well-perforating system arranged as part of a pipe string. The embodiment according to fig. 3A - 3D is an embodiment with "full drilling", which can be lowered together with test tools, or without any test tools as part of a permanent well completion system. As shown in the drawing, the perforating tools are engaged in the string in such a way that the central bore is free of obstructions. This gives the advantage that the tools can be lowered through the pipe string with the help of a wire or pipe with a smaller diameter, unimpeded by the components of the perforation system. Furthermore, the unbroken central bore is available to act as a pipeline for fluids produced after the well has been perforated.
Tennmekanismen i arrangementet på fig. 3A - 3D er av stort sett ringformet konstruksjon, idet tennstempelet og utløserenhetene er anordnet i rørstrengen, omkretsmessig rundt dens sentrale boring. The ignition mechanism in the arrangement of fig. 3A - 3D are of largely annular construction, the ignition piston and release units being arranged in the tube string, circumferentially around its central bore.
Som vist i fig. 3A - 3D innbefatter en toppseksjon 100 med "full" gjennomgående boring en gjenget muffe ved sin øvre ende for innkopling i rørstrengen. Et antall rørelementer som er suksessivt tilkoplet under toppseksjonen 100, virker til å oppta perforeringssystemelementene som en del av rørstrengen, hvilke rørelementer har konstant utvendig diameter og danner en ubrutt, gjennomgående sentral boring uten hindringer. Disse andre rørelementer innbefatter et bruddpinnehus 102 som er fastskrudd til et mellomparti på toppseksjonen 100, (fig. 3A - 3B), et fjærhus 104 er ved en gjengekopling tilkoplet under huset 102 (fig. 3B - 3C), et tennstempelhus 106 er ved gjengekopling tilkoplet under huset 104 (fig. 3C - 3D), og et detonatorhus 108 er ved en gjengekopling tilkoplet huset 106 (fig. 3D). Detonatorhuset 108 utgjør et tilkoplingspunkt for resten av rørstrengen 110 som innbefatter en perforeringskanon. Slike andre verktøy og rørstrengelementer, (f.eks. det slissete parti av rørforlengelsen, testeverktøy osv) kan være tilkoplet i nedre del av rørstrengen 110, avhengig av den spesielle anvendelse. Den ubrutte eller uhindrete gjennomgående boring i perforeringssystemarrangementet ifølge 3A - 3D gir stort spillerom med hensyn til dets tilkoplingspunkt i rørstrengen. Tennmekanismen kan endog være tilkoplet i sin helhet over det sted der en pakning anvendes til å avsperre brønndelen som perforeres. I et slikt tilfelle kan en forlen-get detonerende lunte føres ned langs rørstrengens omkrets gjennom pakningen og tilkoples den under pakningen beliggende perforeringskanon. As shown in fig. 3A-3D, a "full" through-bore top section 100 includes a threaded sleeve at its upper end for engagement in the pipe string. A number of tubular elements successively connected below the top section 100 act to accommodate the perforation system elements as part of the tubular string, which tubular elements have a constant outside diameter and form an unbroken, continuous central bore without obstructions. These other pipe elements include a break pin housing 102 which is screwed to an intermediate part of the top section 100, (Fig. 3A - 3B), a spring housing 104 is by a threaded connection connected below the housing 102 (Fig. 3B - 3C), an ignition piston housing 106 is by a threaded connection connected below the housing 104 (Fig. 3C - 3D), and a detonator housing 108 is connected to the housing 106 (Fig. 3D) by a threaded connection. The detonator housing 108 forms a connection point for the rest of the pipe string 110 which includes a perforating gun. Such other tools and pipe string elements, (e.g. the slotted part of the pipe extension, testing tools, etc.) may be connected in the lower part of the pipe string 110, depending on the particular application. The unbroken or unobstructed through bore in the perforating system arrangement of 3A - 3D provides great latitude with respect to its connection point in the pipe string. The ignition mechanism can even be connected in its entirety above the place where a gasket is used to seal off the part of the well that is being perforated. In such a case, an extended detonating fuse can be guided down along the circumference of the pipe string through the gasket and connected to the perforating gun located under the gasket.
En tennmekanisme-aktuator i form av et rørstempel er forskyvbart montert i husdelene 100, 102, 104, 106 og 108 som vist i fig. 3B - 3D. Aktuatoren omfatter øvre og nedre sek-sjoner bestående av en låsedor 112 som ved en gjengeforbin-delse er tilkoplet over et tennstempelaktiviserings-hylseenhet 114. Aktiviseringsstempelet er montert for aksiell bevegelse i rørstrengen fra en stilling der toppen av låsedoren 112 støter mot bunnen av et med innsnevret utvendig diameter utformet parti av toppseksjonen 100 (fig. 3B) til en stilling der bunnen av hylseenheten 114 bringes i kontakt med en innvendig ansats som dannes av et utvidet innvendig boringsparti ved toppen av detonatorhuset 108. An ignition mechanism actuator in the form of a tube piston is displaceably mounted in the housing parts 100, 102, 104, 106 and 108 as shown in fig. 3B - 3D. The actuator comprises upper and lower sections consisting of a locking mandrel 112 which is connected via a threaded connection over an ignition piston activation sleeve unit 114. The activation piston is mounted for axial movement in the pipe string from a position where the top of the locking mandrel 112 abuts the bottom of a constricted outside diameter portion of the top section 100 (Fig. 3B) to a position where the bottom of the sleeve assembly 114 is brought into contact with an internal shoulder formed by an enlarged internal bore portion at the top of the detonator housing 108.
Aktiviseringsstempelenheten er slik montert at når den føres til sin nedre stilling driver den tennstempelet 116 nedad mot en slagdetonator 118 (fig. 3C - 3D), for derved å antenne et antall sprengstoffladninger som er montert i en perforeringskanon som er opplagret i nedre del av rørstrengen 110. The activation piston unit is mounted so that when it is brought to its lower position it drives the ignition piston 116 downwards towards an impact detonator 118 (Figs. 3C - 3D), thereby igniting a number of explosive charges which are mounted in a perforating gun which is stored in the lower part of the pipe string 110.
Tennstempelet 116 er i form av en spiss stang som henger ned fra et ringformet fjærhoIderelement 120 (se fig. 3C). Tennstempelets 116 nedre parti er opptatt i en rørformet boring i detonatorhuset 108 som strekker seg parallelt med rørstrengens akse. Detonatoren 118 er også stangformet og rager oppad inn i et med større diameter utformet parti av samme boring ved nedre del av huset 108. En "Primacord ™" detonerende lunte eller annen egnet innretning for levering av detoneringseffekten fra detonatoren 118 til sprengladningene beliggende i perforeringskanonen, er tilkoplet under detonatoren 118. The ignition piston 116 is in the form of a pointed rod which hangs down from an annular spring holder element 120 (see Fig. 3C). The lower part of the ignition piston 116 is occupied in a tubular bore in the detonator housing 108 which extends parallel to the axis of the tube string. The detonator 118 is also rod-shaped and projects upwards into a larger diameter shaped portion of the same bore at the lower part of the housing 108. A "Primacord ™" detonating fuse or other suitable device for delivering the detonating effect from the detonator 118 to the explosive charges located in the perforating gun, is connected below the detonator 118.
En skruefjær 122 er plassert i et hulrom som dannes av en med innsnevret utvendig diameter utformet nedre del av hylseenheten 114, et med større innvendig diameter utformet nedre parti av tennstempelhuset 106 og toppen av detonatorhuset 108. Fjæren 122 danner forbindelse mellom toppen av huset 108 og fjærholderelementet 120, og virker til å spenne tennstempelet 116 i en stilling i avstand fra detonatoren 118, med toppen av elementet 120 i anlegg mot den innvendige ansats ved toppen av det innvendige utvidete parti av huset 106. For å lette betjeningen har en funnet det fordelaktig å anordne et antall tennstempeler 116 som er opphengt med regelmessig innbyrdes avstand fra ringelementet 120 i et tilsvarende antall omkretsmessig fordelte boringer i huset 108. Det er tilstrekkelig at bare én av boringene er utstyrt med en detonator 118. De tennstempeler som ikke samvirker med en detonator virker imidlertid som føringer eller styringer for å sikre jevn bevegelse av det tennstempelet som samvirker med en detonator. A coil spring 122 is placed in a cavity formed by a lower part of the sleeve unit 114 designed with a narrowed outer diameter, a lower part of the igniter piston housing 106 designed with a larger inner diameter and the top of the detonator housing 108. The spring 122 forms a connection between the top of the housing 108 and the spring retainer member 120, and acts to tension the firing piston 116 in a position spaced from the detonator 118, with the top of the member 120 abutting the internal shoulder at the top of the internal extended portion of the housing 106. For ease of operation, it has been found advantageous to arrange a number of ignition pistons 116 which are suspended at a regular distance from the ring element 120 in a corresponding number of circumferentially distributed bores in the housing 108. It is sufficient that only one of the bores is equipped with a detonator 118. The ignition pistons which do not interact with a detonator however, act as guides or controls to ensure smooth movement of the ignition piston as sam works with a detonator.
En annen skruefjær 124 er plassert i et ringformet hulrom som dannes av det nedre, med større innvendig diameter utfor-mete parti av fjærhuset 104, det øvre, ytre parti av hylseenheten 114, nedre del av låsedoren 112, og toppen av tennstempelhuset 106 (fig. 3C). Fjæren 124 er opptatt mellom en ringformet fjærstyring 126 ved toppen av hulrommet og en fjærskive 128 som er plassert ved bunnen av hulrommet. Toppen av fjær-styringen 126 ligger an mot en innvendig ansats i huset 104 og bunnen av doren 112, som vist i fig. 3C. Et avtettet atmosfærisk kammer 129 er anordnet mellom husets 106 innside og utsi-den av aktiviseringshylsen 114. Fjæren 124 virker til å spenne aktiviseringsstempelet 112, 114 i dets øverste stilling med toppen av doren 112 plassert nær bunnen av toppseksjonen 100. Atmosfærekammeret 129 virker til å spenne stempelet 112, 114 nedad når trykket er større i den sentrale boring. Another coil spring 124 is placed in an annular cavity formed by the lower, larger internal diameter formed part of the spring housing 104, the upper, outer part of the sleeve unit 114, lower part of the locking mandrel 112, and the top of the ignition piston housing 106 (Fig .3C). The spring 124 is caught between an annular spring guide 126 at the top of the cavity and a spring disc 128 which is located at the bottom of the cavity. The top of the spring guide 126 rests against an internal shoulder in the housing 104 and the bottom of the mandrel 112, as shown in fig. 3C. A sealed atmospheric chamber 129 is provided between the inside of the housing 106 and the outside of the actuating sleeve 114. The spring 124 acts to bias the actuating piston 112, 114 in its uppermost position with the top of the mandrel 112 located near the bottom of the top section 100. The atmospheric chamber 129 acts to tension the piston 112, 114 downwards when the pressure is greater in the central bore.
Aktiviseringsstempelet 112, 114 låses i sin øverste stilling ved hjelp av en låsemekanisme 130. Låsemekanismen 130 innbefatter et låselement 132 (fig. 3B) som låser en delt låsering 134 i inngrep med et utvendig ringformet spor eller utsparing i låsedoren 112. En stoppring 136 som er plassert over toppen av fjærhuset 104 bærer låseringen 134 mot nedadbevegelse. Når ringen 134 er i det ytre spor i doren 112 er stempelaktuatoren 112, 114 låst mot nedadbevegelse, og påvirkning av tennelementet 116 er forhindret. Toppen av låselementet 132 innbefatter en nedadvendt ansats som danner inngrep med en utvendig oppadvendt ansats på et forlengelses-element 138 som ved hjelp av en skruforbindelse er tilkoplet bunnen av et låsestempel 140. De to ansatser tvinges i inngrep ved hjelp av en låsefjær 142 som vist i fig. 3B. En bruddpinne 144 som strekker seg gjennom en boring i øvre del av bruddpinnehuset 102 mellom huset 102 og låsestempelet 140, fastholder låsestempelet 140 mot nedadbevegelse (fig. 3A). Komponentene i låsemekanismen 130 er opptatt i et ringformet hulrom som avgrenses av en øvre del 146 og en nedre del 148. The activation piston 112, 114 is locked in its uppermost position by means of a locking mechanism 130. The locking mechanism 130 includes a locking element 132 (Fig. 3B) which locks a split locking ring 134 into engagement with an outer annular groove or recess in the locking mandrel 112. A stop ring 136 which is placed above the top of the spring housing 104 supports the locking ring 134 against downward movement. When the ring 134 is in the outer groove in the mandrel 112, the piston actuator 112, 114 is locked against downward movement, and the impact of the ignition element 116 is prevented. The top of the locking element 132 includes a downward-facing shoulder which forms an engagement with an external upward-facing shoulder on an extension member 138 which is connected by means of a screw connection to the bottom of a locking piston 140. The two shoulders are forced into engagement by means of a locking spring 142 as shown in fig. 3B. A break pin 144 which extends through a bore in the upper part of the break pin housing 102 between the housing 102 and the locking piston 140, holds the locking piston 140 against downward movement (Fig. 3A). The components in the locking mechanism 130 are occupied in an annular cavity which is delimited by an upper part 146 and a lower part 148.
Én eller flere åpninger 150 (fig. 3A) virker til å opp-rettholde trykket i den øvre del 146 i likevekt med trykket i ringrommet i borehullet. Tetninger 152, 153 (fig. 3B) virker til å avsperre den nedre del av hulrommet 148 fra trykket i øvre del av hulrommet 146. Én eller flere åpninger 154 (fig. 3B) i JLås^doren 112^virker til å utligne trykket i den nedre hulromdel 148 til trykket i den indre sentrale boring i rør-strengen. Det vil derfor være klart fra fig. 3A og 3B at trykkforskjellen mellom trykket i ringrommet som leveres ved åpningen 150 og trykket i rørstrengens sentrale boring som leveres ved åpningen 154 bringes til å virke på låsestempelet 140. Dersom ringromtrykket som virker på øvre hulromdel 146 overskrider rørstrengtrykket som virker på den undre hulromdel 148 med en verdi som er større enn bruddpinnens 144 skjærfast-het, vil låsestempelet 140 bli drevet nedad mot låselementet 132. Bruken av ansats- og fjærarrangementet i låsemekanismen 130 (vist ved elementene 132, 138, 140 og 142 i fig. 3B) virker til å avsperre den nødvendige kraft for avskjæring av pin- One or more openings 150 (Fig. 3A) act to maintain the pressure in the upper part 146 in equilibrium with the pressure in the annulus in the borehole. Seals 152, 153 (Fig. 3B) act to isolate the lower part of the cavity 148 from the pressure in the upper part of the cavity 146. One or more openings 154 (Fig. 3B) in the JLås^doren 112^ act to equalize the pressure in the lower cavity portion 148 to the pressure in the inner central bore of the pipe string. It will therefore be clear from fig. 3A and 3B that the pressure difference between the pressure in the annulus delivered at the opening 150 and the pressure in the central bore of the pipe string delivered at the opening 154 is brought to act on the locking piston 140. If the annulus pressure acting on the upper cavity part 146 exceeds the pipe string pressure acting on the lower cavity part 148 with a value greater than the shear strength of the breaking pin 144, the locking piston 140 will be driven downwards against the locking element 132. The use of the shoulder and spring arrangement in the locking mechanism 130 (shown by the elements 132, 138, 140 and 142 in Fig. 3B) works to to cut off the necessary force for cutting off the pin-
nen 144 fra virkningen av treghets- og friksjonskreftene i forbindelse med låselementets 132 nedadbevegelse. En viss "dødgang" er anordnet mellom avskjæringen av pinnen 144 og det punkt der nedadbevegelsen av låsestempelets 140 bunn skyver låselementet 132 nedad. Dette sikrer en "ren" avskjæring av pinnen 144. nen 144 from the effect of the inertial and frictional forces in connection with the downward movement of the locking element 132. A certain "dead end" is arranged between the cut-off of the pin 144 and the point where the downward movement of the bottom of the locking piston 140 pushes the locking element 132 downwards. This ensures a "clean" cut off of the pin 144.
Ved typisk drift med sikte på produksjon, vil trykket i den øvre hulromdel 146 være lik fluidtrykket i borehullets ringrom over en pakning som er anbrakt for å avsperre den del av brønnen som skal perforeres. Trykket som den nedre hulromdel 148 utsettes for vil typisk svare til fluidtrykket i den avsperrete del av brønnen under pakningen. Pinnens 144 skjær-fasthet og fjærens 122, 124 og 142 fjærkonstanter velges slik at når den ønskete trykkforskjell mellom ringrommet og rør-strengboringen foreligger, vil pinnen 144 avskjæres, låsemekanismen 130 frigjøres og aktiviseringsstempelet 112, 114 vil drive tennstempelet 116 nedad mot detonatoren 118. Når pinnen 144 avskjæres tvinges låsestempelet 140 nedad på grunn av den trykkforskjell som virker over stempelet. Etter et kort død-gangsintervall kommer låsestempelet 140 i berøring med låselementet 132 som derved skyves nedad til et punkt der et med større innvendig diameter utformet parti av låselementet 132 beveges i stilling nær den delte låsering 134. Låseringen 134 føres ut av det utvendige spor i doren 112, hvorved aktiviseringsstempelet 112, 114 frigjøres for nedadbevegelse mot kraften både fra fjæren 124 og kammeret 129, og tennstempelet 116 drives mot kraften fra fjæren 122 til stempelet slår mot detonatoren 118 og derved avfyrer kanonen. In typical operation with a view to production, the pressure in the upper cavity part 146 will be equal to the fluid pressure in the annulus of the borehole above a seal which is placed to seal off the part of the well to be perforated. The pressure to which the lower cavity part 148 is exposed will typically correspond to the fluid pressure in the shut-off part of the well below the packing. The shear strength of the pin 144 and the spring constants of the spring 122, 124 and 142 are selected so that when the desired pressure difference between the annulus and the pipe string bore exists, the pin 144 will shear off, the locking mechanism 130 will be released and the activation piston 112, 114 will drive the ignition piston 116 downwards towards the detonator 118. When the pin 144 is cut off, the locking piston 140 is forced downwards due to the pressure difference acting across the piston. After a short idle interval, the locking piston 140 comes into contact with the locking element 132, which is thereby pushed downwards to a point where a part of the locking element 132 designed with a larger internal diameter is moved into position near the split locking ring 134. The locking ring 134 is guided out of the outer groove in the mandrel 112, whereby the activation piston 112, 114 is released for downward movement against the force of both the spring 124 and the chamber 129, and the firing piston 116 is driven against the force of the spring 122 until the piston strikes the detonator 118 and thereby fires the cannon.
På bakgrunn av den ovenfor angitte beskrivelse av oppfinnelsen med særlig vekt på de foretrukne utføringsformer av denne i forbindelse med perforeringssystemer som inngår i en rørstreng, vil det være klart for fagmenn på det området oppfinnelsen angår, etter at de har forstått oppfinnelsen, at forskjellige endringer og modifikasjoner kan utføres på denne uten å avvike fra oppfinnelsens idé og ramme slik den er angitt i de etterfølgende krav. On the basis of the above description of the invention with particular emphasis on the preferred embodiments thereof in connection with perforation systems included in a pipe string, it will be clear to those skilled in the field of the invention, after they have understood the invention, that various changes and modifications can be made to this without deviating from the idea and scope of the invention as stated in the subsequent claims.
Det vil således f.eks. være klart at en tredje måte lett kan anvendes for å oppnå den forutsatte trykkforskjell for avskjæring av bruddpinnen i utføringsformene vist på figur 2 og 3. De to ovenfor beskrevne måter innbefatter 1) tilsetting av trykk til ringrommet, og 2) avlasting av trykk fra boringen i rørstrengen. Også en kombinasjon av de to måter har vært omtalt. En tredje måte går ut på å sette rørstrengboringen i forbindelse med den avsperrete del av brønnen. Førstnevnte kan ha et forholdsvis lavt trykk ettersom alt den behøver å inneholde er luft. Dersom boringen inneholder et fluid kan det være ett som er lettere enn de eksisterende fluider i borehullet. Ved å sette de to i forbindelse med hverandre oppnås et balanse- eller utligningstrykk som kan være vesentlig lavere enn det opprinnelige trykk i den avsperrete del av brønnen, og det vil være tilstrekkelig til å opprette den nødvendige trykkforskjell for avskjæring av bruddpinnen. Denne måte kan brukes alene eller i kombinasjon med én eller begge av de andre to måter. It will thus e.g. be clear that a third way can easily be used to achieve the assumed pressure difference for cutting off the fracture pin in the embodiments shown in Figures 2 and 3. The two ways described above include 1) adding pressure to the annulus, and 2) unloading pressure from the borehole in the pipe string. A combination of the two ways has also been discussed. A third way consists of connecting the pipe string drilling to the blocked part of the well. The former can have a relatively low pressure as all it needs to contain is air. If the drilling contains a fluid, it may be one that is lighter than the existing fluids in the borehole. By putting the two in connection with each other, a balance or compensation pressure is achieved which can be significantly lower than the original pressure in the blocked part of the well, and this will be sufficient to create the necessary pressure difference for cutting off the fracture pin. This method can be used alone or in combination with one or both of the other two methods.
Rørstrengboringen kan bringes i forbindelse med den avsperrete del av brønnen ved hjelp av hvilken som helst passende borehullventil som kan påvirkes ved hjelp av hvilken som helst ønsket innretning. F.eks. kan denne ventil være testeventilen 11 som drives av trykket i borehullet, som ovenfor forklart. Den kan også være en annen ventil som manøvreres av trykket eller den kan manøvreres ved elektriske eller mekaniske midler. The string bore can be brought into communication with the shut-off part of the well by means of any suitable downhole valve which can be actuated by means of any desired device. E.g. this valve can be the test valve 11 which is operated by the pressure in the borehole, as explained above. It can also be another valve that is operated by the pressure or it can be operated by electrical or mechanical means.
Claims (1)
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
NO902009A NO179756C (en) | 1982-04-16 | 1990-05-07 | Method of perforating a well |
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US06/369,209 US4509604A (en) | 1982-04-16 | 1982-04-16 | Pressure responsive perforating and testing system |
NO831208A NO172073C (en) | 1982-04-16 | 1983-04-05 | FLUID PRESSURE ACTIVATED TURNTABLE FOR USE WITH A BROWN PERFORMANCE SYSTEM |
NO902009A NO179756C (en) | 1982-04-16 | 1990-05-07 | Method of perforating a well |
Publications (4)
Publication Number | Publication Date |
---|---|
NO902009L NO902009L (en) | 1983-10-17 |
NO902009D0 NO902009D0 (en) | 1990-05-07 |
NO179756B true NO179756B (en) | 1996-09-02 |
NO179756C NO179756C (en) | 1996-12-11 |
Family
ID=27352852
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
NO902009A NO179756C (en) | 1982-04-16 | 1990-05-07 | Method of perforating a well |
Country Status (1)
Country | Link |
---|---|
NO (1) | NO179756C (en) |
-
1990
- 1990-05-07 NO NO902009A patent/NO179756C/en not_active IP Right Cessation
Also Published As
Publication number | Publication date |
---|---|
NO179756C (en) | 1996-12-11 |
NO902009L (en) | 1983-10-17 |
NO902009D0 (en) | 1990-05-07 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
NO172073B (en) | FLUID PRESSURE ACTIVATED TURNTABLE FOR USE WITH A BROWN PERFORMANCE SYSTEM | |
US4544034A (en) | Actuation of a gun firing head | |
US4576233A (en) | Differential pressure actuated vent assembly | |
US4560000A (en) | Pressure-activated well perforating apparatus | |
US9476290B2 (en) | Bottom hole firing head and method | |
US5398760A (en) | Methods of perforating a well using coiled tubing | |
US8813848B2 (en) | Isolation tool actuated by gas generation | |
US5680905A (en) | Apparatus and method for perforating wellbores | |
US4650010A (en) | Borehole devices actuated by fluid pressure | |
US4862964A (en) | Method and apparatus for perforating well bores using differential pressure | |
US5062485A (en) | Variable time delay firing head | |
EP0752514A2 (en) | Selective perforation of multiple well zones | |
NO179561B (en) | Device for perforating a well | |
JPH03156092A (en) | Ignition head | |
NO316191B1 (en) | Pressure controlled circulation valve | |
NO327684B1 (en) | System for centralizing a casing in a well | |
CA1284768C (en) | Firing head for a tubing conveyed perforating gun | |
US4690227A (en) | Gun firing head | |
EP0425568B1 (en) | Apparatus and method for detonating well perforators | |
AU615237B2 (en) | Method and apparatus for perforating a well | |
US4538680A (en) | Gun below packer completion tool string | |
US4498541A (en) | Method of well completion | |
GB2138925A (en) | Firing of well perforation guns | |
NO179756B (en) | Method of perforating a well | |
EP0184377A2 (en) | Borehole devices disarmed by fluid pressure |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
MM1K | Lapsed by not paying the annual fees |
Free format text: LAPSED IN OCTOBER 2002 |