KR20240115357A - Novel CT-26 tumor cell specific antibody - Google Patents
Novel CT-26 tumor cell specific antibody Download PDFInfo
- Publication number
- KR20240115357A KR20240115357A KR1020230006866A KR20230006866A KR20240115357A KR 20240115357 A KR20240115357 A KR 20240115357A KR 1020230006866 A KR1020230006866 A KR 1020230006866A KR 20230006866 A KR20230006866 A KR 20230006866A KR 20240115357 A KR20240115357 A KR 20240115357A
- Authority
- KR
- South Korea
- Prior art keywords
- antibody
- seq
- cells
- antigen
- amino acid
- Prior art date
Links
- 210000004881 tumor cell Anatomy 0.000 title description 7
- 102000036639 antigens Human genes 0.000 claims abstract description 46
- 108091007433 antigens Proteins 0.000 claims abstract description 46
- 230000027455 binding Effects 0.000 claims abstract description 46
- 239000000427 antigen Substances 0.000 claims abstract description 45
- 239000012634 fragment Substances 0.000 claims abstract description 37
- 239000000203 mixture Substances 0.000 claims abstract description 12
- 108091033319 polynucleotide Proteins 0.000 claims description 35
- 102000040430 polynucleotide Human genes 0.000 claims description 35
- 239000002157 polynucleotide Substances 0.000 claims description 35
- 108010047041 Complementarity Determining Regions Proteins 0.000 claims description 26
- 239000002773 nucleotide Substances 0.000 claims description 17
- 125000003729 nucleotide group Chemical group 0.000 claims description 17
- 239000013604 expression vector Substances 0.000 claims description 12
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 3
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 claims description 3
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 claims description 3
- 238000001514 detection method Methods 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 12
- 238000000034 method Methods 0.000 abstract description 19
- 210000004027 cell Anatomy 0.000 description 91
- 150000001413 amino acids Chemical group 0.000 description 32
- 206010028980 Neoplasm Diseases 0.000 description 25
- 108090000623 proteins and genes Proteins 0.000 description 19
- 102000004190 Enzymes Human genes 0.000 description 13
- 108090000790 Enzymes Proteins 0.000 description 13
- 229940088598 enzyme Drugs 0.000 description 13
- 238000004458 analytical method Methods 0.000 description 12
- 235000018102 proteins Nutrition 0.000 description 12
- 102000004169 proteins and genes Human genes 0.000 description 12
- 239000013598 vector Substances 0.000 description 10
- 108091008875 B cell receptors Proteins 0.000 description 9
- 210000003719 b-lymphocyte Anatomy 0.000 description 9
- 241000699666 Mus <mouse, genus> Species 0.000 description 7
- 230000006870 function Effects 0.000 description 7
- -1 antibody Proteins 0.000 description 6
- 239000000126 substance Substances 0.000 description 6
- 125000003412 L-alanyl group Chemical group [H]N([H])[C@@](C([H])([H])[H])(C(=O)[*])[H] 0.000 description 5
- 241001465754 Metazoa Species 0.000 description 5
- 241000699670 Mus sp. Species 0.000 description 5
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 5
- 235000001014 amino acid Nutrition 0.000 description 5
- 239000000969 carrier Substances 0.000 description 5
- 230000000694 effects Effects 0.000 description 5
- 230000014509 gene expression Effects 0.000 description 5
- 230000004048 modification Effects 0.000 description 5
- 238000012986 modification Methods 0.000 description 5
- 239000000243 solution Substances 0.000 description 5
- AZQWKYJCGOJGHM-UHFFFAOYSA-N 1,4-benzoquinone Chemical compound O=C1C=CC(=O)C=C1 AZQWKYJCGOJGHM-UHFFFAOYSA-N 0.000 description 4
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 4
- 108060003951 Immunoglobulin Proteins 0.000 description 4
- 201000011510 cancer Diseases 0.000 description 4
- 238000000684 flow cytometry Methods 0.000 description 4
- 102000018358 immunoglobulin Human genes 0.000 description 4
- 210000004180 plasmocyte Anatomy 0.000 description 4
- 238000011160 research Methods 0.000 description 4
- 206010009944 Colon cancer Diseases 0.000 description 3
- 101800001467 Envelope glycoprotein E2 Proteins 0.000 description 3
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 3
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 3
- 125000000570 L-alpha-aspartyl group Chemical group [H]OC(=O)C([H])([H])[C@]([H])(N([H])[H])C(*)=O 0.000 description 3
- 241000283984 Rodentia Species 0.000 description 3
- 101800001271 Surface protein Proteins 0.000 description 3
- 210000001744 T-lymphocyte Anatomy 0.000 description 3
- 239000003593 chromogenic compound Substances 0.000 description 3
- 208000029742 colonic neoplasm Diseases 0.000 description 3
- 230000001900 immune effect Effects 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 238000010172 mouse model Methods 0.000 description 3
- 102000039446 nucleic acids Human genes 0.000 description 3
- 108020004707 nucleic acids Proteins 0.000 description 3
- 150000007523 nucleic acids Chemical class 0.000 description 3
- 230000009257 reactivity Effects 0.000 description 3
- 239000000758 substrate Substances 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- JRBJSXQPQWSCCF-UHFFFAOYSA-N 3,3'-Dimethoxybenzidine Chemical compound C1=C(N)C(OC)=CC(C=2C=C(OC)C(N)=CC=2)=C1 JRBJSXQPQWSCCF-UHFFFAOYSA-N 0.000 description 2
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 2
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 2
- 241000196324 Embryophyta Species 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- QIGBRXMKCJKVMJ-UHFFFAOYSA-N Hydroquinone Chemical compound OC1=CC=C(O)C=C1 QIGBRXMKCJKVMJ-UHFFFAOYSA-N 0.000 description 2
- 125000003440 L-leucyl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])C(C([H])([H])[H])([H])C([H])([H])[H] 0.000 description 2
- 125000002842 L-seryl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])O[H] 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 2
- 238000010171 animal model Methods 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 230000022131 cell cycle Effects 0.000 description 2
- 230000024245 cell differentiation Effects 0.000 description 2
- 239000006285 cell suspension Substances 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 230000029087 digestion Effects 0.000 description 2
- 238000010494 dissociation reaction Methods 0.000 description 2
- 230000005593 dissociations Effects 0.000 description 2
- 238000001378 electrochemiluminescence detection Methods 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 239000012091 fetal bovine serum Substances 0.000 description 2
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 2
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 2
- 210000002865 immune cell Anatomy 0.000 description 2
- 238000003119 immunoblot Methods 0.000 description 2
- 238000010166 immunofluorescence Methods 0.000 description 2
- 230000016784 immunoglobulin production Effects 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 238000011081 inoculation Methods 0.000 description 2
- 238000007912 intraperitoneal administration Methods 0.000 description 2
- 239000004816 latex Substances 0.000 description 2
- 229920000126 latex Polymers 0.000 description 2
- 239000003446 ligand Substances 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 229910052751 metal Inorganic materials 0.000 description 2
- 239000002184 metal Substances 0.000 description 2
- 230000011987 methylation Effects 0.000 description 2
- 238000007069 methylation reaction Methods 0.000 description 2
- 239000011859 microparticle Substances 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- 239000008363 phosphate buffer Substances 0.000 description 2
- 238000001556 precipitation Methods 0.000 description 2
- 238000000513 principal component analysis Methods 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 210000001236 prokaryotic cell Anatomy 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- 238000012174 single-cell RNA sequencing Methods 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 230000009870 specific binding Effects 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 238000006467 substitution reaction Methods 0.000 description 2
- 238000001262 western blot Methods 0.000 description 2
- 210000005253 yeast cell Anatomy 0.000 description 2
- DGWDWLRHFOUZCX-UHFFFAOYSA-N (25R)-26-[(D-Glucopyranosyl)oxy]-2hydroxyfurosta-5,20(22)-dien-3yl O-D-glucopyranosyl-(1‘Â∆3)-O-D-glucopyranosyl-(1‘Â∆2)-O-[D-xylopyranosyl-(1‘Â∆3)]-O-D-glucopyranosyl-(1‘Â∆4)-D-ga Natural products O1C(CO)C(O)C(O)C(O)C1OCC(C)CCC(O1)=C(C)C(C2(CCC3C4(C)CC5O)C)C1CC2C3CC=C4CC5OC(C(C1O)O)OC(CO)C1OC(C1OC2C(C(OC3C(C(O)C(O)C(CO)O3)O)C(O)C(CO)O2)O)OC(CO)C(O)C1OC1OCC(O)C(O)C1O DGWDWLRHFOUZCX-UHFFFAOYSA-N 0.000 description 1
- QRXMUCSWCMTJGU-UHFFFAOYSA-L (5-bromo-4-chloro-1h-indol-3-yl) phosphate Chemical compound C1=C(Br)C(Cl)=C2C(OP([O-])(=O)[O-])=CNC2=C1 QRXMUCSWCMTJGU-UHFFFAOYSA-L 0.000 description 1
- GEYOCULIXLDCMW-UHFFFAOYSA-N 1,2-phenylenediamine Chemical compound NC1=CC=CC=C1N GEYOCULIXLDCMW-UHFFFAOYSA-N 0.000 description 1
- 229940005561 1,4-benzoquinone Drugs 0.000 description 1
- NHBKXEKEPDILRR-UHFFFAOYSA-N 2,3-bis(butanoylsulfanyl)propyl butanoate Chemical compound CCCC(=O)OCC(SC(=O)CCC)CSC(=O)CCC NHBKXEKEPDILRR-UHFFFAOYSA-N 0.000 description 1
- KUWPCJHYPSUOFW-YBXAARCKSA-N 2-nitrophenyl beta-D-galactoside Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1OC1=CC=CC=C1[N+]([O-])=O KUWPCJHYPSUOFW-YBXAARCKSA-N 0.000 description 1
- UAIUNKRWKOVEES-UHFFFAOYSA-N 3,3',5,5'-tetramethylbenzidine Chemical compound CC1=C(N)C(C)=CC(C=2C=C(C)C(N)=C(C)C=2)=C1 UAIUNKRWKOVEES-UHFFFAOYSA-N 0.000 description 1
- HSTOKWSFWGCZMH-UHFFFAOYSA-N 3,3'-diaminobenzidine Chemical compound C1=C(N)C(N)=CC=C1C1=CC=C(N)C(N)=C1 HSTOKWSFWGCZMH-UHFFFAOYSA-N 0.000 description 1
- ZTOJFFHGPLIVKC-UHFFFAOYSA-N 3-ethyl-2-[(3-ethyl-6-sulfo-1,3-benzothiazol-2-ylidene)hydrazinylidene]-1,3-benzothiazole-6-sulfonic acid Chemical compound S1C2=CC(S(O)(=O)=O)=CC=C2N(CC)C1=NN=C1SC2=CC(S(O)(=O)=O)=CC=C2N1CC ZTOJFFHGPLIVKC-UHFFFAOYSA-N 0.000 description 1
- XZKIHKMTEMTJQX-UHFFFAOYSA-N 4-Nitrophenyl Phosphate Chemical compound OP(O)(=O)OC1=CC=C([N+]([O-])=O)C=C1 XZKIHKMTEMTJQX-UHFFFAOYSA-N 0.000 description 1
- LVSPDZAGCBEQAV-UHFFFAOYSA-N 4-chloronaphthalen-1-ol Chemical compound C1=CC=C2C(O)=CC=C(Cl)C2=C1 LVSPDZAGCBEQAV-UHFFFAOYSA-N 0.000 description 1
- 102100031126 6-phosphogluconolactonase Human genes 0.000 description 1
- 108010029731 6-phosphogluconolactonase Proteins 0.000 description 1
- OXEUETBFKVCRNP-UHFFFAOYSA-N 9-ethyl-3-carbazolamine Chemical compound NC1=CC=C2N(CC)C3=CC=CC=C3C2=C1 OXEUETBFKVCRNP-UHFFFAOYSA-N 0.000 description 1
- 102000012440 Acetylcholinesterase Human genes 0.000 description 1
- 108010022752 Acetylcholinesterase Proteins 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- 101001073212 Arabidopsis thaliana Peroxidase 33 Proteins 0.000 description 1
- 238000011725 BALB/c mouse Methods 0.000 description 1
- 229940045513 CTLA4 antagonist Drugs 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 102100021658 Embigin Human genes 0.000 description 1
- 108700038048 Embigin Proteins 0.000 description 1
- 108010087819 Fc receptors Proteins 0.000 description 1
- 102000009109 Fc receptors Human genes 0.000 description 1
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 1
- 108091092584 GDNA Proteins 0.000 description 1
- 108010018962 Glucosephosphate Dehydrogenase Proteins 0.000 description 1
- 108010060309 Glucuronidase Proteins 0.000 description 1
- 102000053187 Glucuronidase Human genes 0.000 description 1
- 102000005720 Glutathione transferase Human genes 0.000 description 1
- 108010070675 Glutathione transferase Proteins 0.000 description 1
- 102000005548 Hexokinase Human genes 0.000 description 1
- 108700040460 Hexokinases Proteins 0.000 description 1
- 108010093488 His-His-His-His-His-His Proteins 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 1
- 101001123325 Homo sapiens Peroxisome proliferator-activated receptor gamma coactivator 1-beta Proteins 0.000 description 1
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 1
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 102000037984 Inhibitory immune checkpoint proteins Human genes 0.000 description 1
- 108091008026 Inhibitory immune checkpoint proteins Proteins 0.000 description 1
- 241000235058 Komagataella pastoris Species 0.000 description 1
- 125000001176 L-lysyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C([H])([H])C([H])([H])C([H])([H])C(N([H])[H])([H])[H] 0.000 description 1
- 125000000769 L-threonyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])[C@](O[H])(C([H])([H])[H])[H] 0.000 description 1
- 125000003580 L-valyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(C([H])([H])[H])(C([H])([H])[H])[H] 0.000 description 1
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 1
- 102000013460 Malate Dehydrogenase Human genes 0.000 description 1
- 108010026217 Malate Dehydrogenase Proteins 0.000 description 1
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 1
- 241000699673 Mesocricetus auratus Species 0.000 description 1
- 108020005196 Mitochondrial DNA Proteins 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 108090000854 Oxidoreductases Proteins 0.000 description 1
- 102000004316 Oxidoreductases Human genes 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 102000003992 Peroxidases Human genes 0.000 description 1
- 102100028961 Peroxisome proliferator-activated receptor gamma coactivator 1-beta Human genes 0.000 description 1
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 1
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 1
- 108010053210 Phycocyanin Proteins 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- 239000004743 Polypropylene Substances 0.000 description 1
- 239000004793 Polystyrene Substances 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 239000012083 RIPA buffer Substances 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 1
- 239000012327 Ruthenium complex Substances 0.000 description 1
- 241000293869 Salmonella enterica subsp. enterica serovar Typhimurium Species 0.000 description 1
- 241000256248 Spodoptera Species 0.000 description 1
- 241000187747 Streptomyces Species 0.000 description 1
- 108010046334 Urease Proteins 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 229940022698 acetylcholinesterase Drugs 0.000 description 1
- 238000007792 addition Methods 0.000 description 1
- 108010004469 allophycocyanin Proteins 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 108010051210 beta-Fructofuranosidase Proteins 0.000 description 1
- 102000005936 beta-Galactosidase Human genes 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 239000000090 biomarker Substances 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 125000004057 biotinyl group Chemical class [H]N1C(=O)N([H])[C@]2([H])[C@@]([H])(SC([H])([H])[C@]12[H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C(*)=O 0.000 description 1
- 239000007853 buffer solution Substances 0.000 description 1
- 229910001417 caesium ion Inorganic materials 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 210000004748 cultured cell Anatomy 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 238000002716 delivery method Methods 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- RAABOESOVLLHRU-UHFFFAOYSA-N diazene Chemical compound N=N RAABOESOVLLHRU-UHFFFAOYSA-N 0.000 description 1
- 229910000071 diazene Inorganic materials 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 229940000406 drug candidate Drugs 0.000 description 1
- 230000006126 farnesylation Effects 0.000 description 1
- KTWOOEGAPBSYNW-UHFFFAOYSA-N ferrocene Chemical compound [Fe+2].C=1C=C[CH-]C=1.C=1C=C[CH-]C=1 KTWOOEGAPBSYNW-UHFFFAOYSA-N 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 239000010419 fine particle Substances 0.000 description 1
- 230000003325 follicular Effects 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 description 1
- 230000000951 immunodiffusion Effects 0.000 description 1
- 238000000760 immunoelectrophoresis Methods 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 238000012744 immunostaining Methods 0.000 description 1
- 230000001506 immunosuppresive effect Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 230000008595 infiltration Effects 0.000 description 1
- 238000001764 infiltration Methods 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 239000001573 invertase Substances 0.000 description 1
- 235000011073 invertase Nutrition 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 150000002540 isothiocyanates Chemical class 0.000 description 1
- 210000003292 kidney cell Anatomy 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- KBOPZPXVLCULAV-UHFFFAOYSA-N mesalamine Chemical compound NC1=CC=C(O)C(C(O)=O)=C1 KBOPZPXVLCULAV-UHFFFAOYSA-N 0.000 description 1
- 229960004963 mesalazine Drugs 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 239000002547 new drug Substances 0.000 description 1
- JPXMTWWFLBLUCD-UHFFFAOYSA-N nitro blue tetrazolium(2+) Chemical compound COC1=CC(C=2C=C(OC)C(=CC=2)[N+]=2N(N=C(N=2)C=2C=CC=CC=2)C=2C=CC(=CC=2)[N+]([O-])=O)=CC=C1[N+]1=NC(C=2C=CC=CC=2)=NN1C1=CC=C([N+]([O-])=O)C=C1 JPXMTWWFLBLUCD-UHFFFAOYSA-N 0.000 description 1
- 230000009871 nonspecific binding Effects 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 239000000123 paper Substances 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- RXNXLAHQOVLMIE-UHFFFAOYSA-N phenyl 10-methylacridin-10-ium-9-carboxylate Chemical compound C12=CC=CC=C2[N+](C)=C2C=CC=CC2=C1C(=O)OC1=CC=CC=C1 RXNXLAHQOVLMIE-UHFFFAOYSA-N 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 229920002239 polyacrylonitrile Polymers 0.000 description 1
- 229920000728 polyester Polymers 0.000 description 1
- 229920000573 polyethylene Polymers 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 229920001155 polypropylene Polymers 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 229920002223 polystyrene Polymers 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 229940024999 proteolytic enzymes for treatment of wounds and ulcers Drugs 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 239000000941 radioactive substance Substances 0.000 description 1
- 238000003127 radioimmunoassay Methods 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 210000001525 retina Anatomy 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- 239000012723 sample buffer Substances 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 230000019635 sulfation Effects 0.000 description 1
- 238000005670 sulfation reaction Methods 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 239000000107 tumor biomarker Substances 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57407—Specifically defined cancers
- G01N33/57419—Specifically defined cancers of colon
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- Urology & Nephrology (AREA)
- Medicinal Chemistry (AREA)
- Cell Biology (AREA)
- Hematology (AREA)
- Organic Chemistry (AREA)
- Biomedical Technology (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Analytical Chemistry (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Biotechnology (AREA)
- Hospice & Palliative Care (AREA)
- Oncology (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Microbiology (AREA)
- Peptides Or Proteins (AREA)
Abstract
본 발명은 CT-26 세포를 특이적으로 인식하는 항체 또는 이의 항원 결합 단편에 관한 것으로, 보다 상세하게는, CT-26 세포 검출용 항체, 상기 항체를 포함하는 CT-26 세포 검출용 조성물, 키트, 및 CT-26 세포의 검출 방법을 제공한다. The present invention relates to an antibody or antigen-binding fragment thereof that specifically recognizes CT-26 cells, and more specifically, to an antibody for detecting CT-26 cells, a composition for detecting CT-26 cells containing the antibody, and a kit. , and a method for detecting CT-26 cells.
Description
본 발명은 CT-26 마우스 종양세포를 특이적으로 인지하는 항체에 관한 것이다.The present invention relates to an antibody that specifically recognizes CT-26 mouse tumor cells.
Balb/c 마우스는 종양, 염증 등의 연구분야에서 가장 흔히 사용되는 동물이며, CT-26 세포는 BALB/c 마우스 결장 유래 대장암 세포이다. CT-26 세포는 인 비트로 수준에서 세포 분화, 유전자 발현, 생체 조절물질의 반응효과 등 다양한 연구 분야에 활용이 가능하며 면역원성이 높아 다양한 면역관문억제제에 대해 객관적인 반응을 보이는 경향이 있다. 또한 주변 미세환경의 변화 등 생체 내 생물학적 연구에 보다 강점을 가지는 동종이식마우스 종양모델(syngeneic mouse model)을 통한 전임상 연구에도 활용이 가능하여 특정 유전자와 질병의 관계를 연구하고 신약 후보 물질을 시험하는 것에도 사용할 수 있다. Balb/c mice are the most commonly used animals in research fields such as tumors and inflammation, and CT-26 cells are colon cancer cells derived from the BALB/c mouse colon. CT-26 cells can be used in various research fields such as cell differentiation, gene expression, and response effects of biological regulators at the in vitro level, and due to their high immunogenicity, they tend to show objective responses to various immune checkpoint inhibitors. In addition, it can be used for preclinical research using a syngeneic mouse tumor model, which has strengths in in vivo biological research such as changes in the surrounding microenvironment, to study the relationship between specific genes and diseases and to test new drug candidates. It can also be used for things.
다만, 이러한 활용도에 비해 CT-26 세포 특이적으로 발현하는 암 바이오마커는 잘 알려져 있지 않아, 종래 기술에서는 정상세포와 암세포를 구분할 방법이 없다는 문제점이 존재하였다. 예를 들어, 종양-면역 환경 연구를 위해 종양 마우스 모델의 종양조직에서 세포를 분리하면 접종한 종양세포 외에 면역세포, 암관련섬유아세포, 대식세포 등 다양한 주변 정상세포들이 섞여 있으므로 암세포 특이적 기능 분석에는 한계가 있었다. 또한, CT-26 세포는 결장암을 포함한 일부 암세포주에서 gp70 단백질을 발현하는 것으로 알려져 있으나 이를 통해 CT-26 세포를 분리해내는 것에는 한계가 있었다.However, compared to this utility, cancer biomarkers specifically expressed in CT-26 cells are not well known, and there was a problem in the prior art that there was no way to distinguish normal cells from cancer cells. For example, when cells are isolated from the tumor tissue of a tumor mouse model to study the tumor-immune environment, various surrounding normal cells such as immune cells, cancer-related fibroblasts, and macrophages are mixed in addition to the inoculated tumor cells, so cancer cell-specific function analysis is performed. There were limits. In addition, CT-26 cells are known to express gp70 protein in some cancer cell lines, including colon cancer, but there are limitations in isolating CT-26 cells through this.
한편, B세포가 항원을 만나면 자극을 받아 형질세포로 성숙되며 면역글로불린을 분비한다. 이러한 2차 면역반응에 의해 생산되는 항체는 항원에 대응하는 데에 효과적이다. 따라서, 본 발명자들은 CT-26 종양 모델의 BCR(B cell receptor) 서열을 재조합한 항체를 이용하여 생체 내 환경에서 CT-26 세포를 보다 특이적으로 분리하기 위한 항체 개발을 위해 노력하였다. 그 결과 본 발명자들은 CT-26 표적 항체를 발굴하여 본 발명을 완성하였다.Meanwhile, when B cells encounter an antigen, they are stimulated, mature into plasma cells, and secrete immunoglobulin. Antibodies produced by this secondary immune response are effective in responding to antigens. Therefore, the present inventors tried to develop an antibody to more specifically isolate CT-26 cells in an in vivo environment using an antibody recombinant with the BCR (B cell receptor) sequence of the CT-26 tumor model. As a result, the present inventors discovered the CT-26 targeting antibody and completed the present invention.
본 발명의 목적은 CT-26 세포에 특이적인 신규 항체를 제공하는 것이다.The purpose of the present invention is to provide a new antibody specific for CT-26 cells.
본 발명의 또 다른 목적은 상기 항체를 제조하는 방법을 제공하는 것이다.Another object of the present invention is to provide a method for producing the antibody.
본 발명의 또 다른 목적은 상기 항체를 암호화하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드가 포함된 발현 벡터, 및 상기 벡터가 도입된 숙주세포를 제공하는 것이다.Another object of the present invention is to provide a polynucleotide encoding the antibody, an expression vector containing the polynucleotide, and a host cell into which the vector is introduced.
본 발명의 또 다른 목적은 상기 항체를 포함하는 CT-26 세포 검출용 조성물 및 키트를 제공하는 것이다.Another object of the present invention is to provide a composition and kit for detecting CT-26 cells containing the above antibody.
본 발명의 또 다른 목적은 상기 항체를 이용하여 CT-26 세포를 검출하는 방법을 제공하는 것이다. Another object of the present invention is to provide a method for detecting CT-26 cells using the antibody.
상기 목적을 달성하기 위하여, 본 발명자들은 CT-26 종양 모델의 BCR(B cell receptor) 서열을 프로파일링하고, 분화 과정이 확인된 항체 클론을 선별하여 재구성한 결과, CT-26를 특이적으로 분리해낼 수 있는 항체를 제작하였다.In order to achieve the above objective, the present inventors profiled the BCR (B cell receptor) sequence of the CT-26 tumor model, selected antibody clones for which the differentiation process was confirmed, and reconstituted them to specifically isolate CT-26. We created an antibody that could do this.
이에, 본 발명은Accordingly, the present invention
서열번호 1, 서열번호 2 및 서열번호 3의 아미노산 서열로 각각 표시되는 중쇄 CDR1(complementarity determining region 1), CDR2 및 CDR3을 포함하는 중쇄 가변 영역; 및 서열번호 4, 서열번호 5 및 서열번호 6의 아미노산 서열로 각각 표시되는 경쇄 CDR1, CDR2 및 CDR3을 포함하는 경쇄 가변 영역; A heavy chain variable region comprising heavy chain complementarity determining region 1 (CDR1), CDR2, and CDR3 represented by the amino acid sequences of SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3, respectively; and a light chain variable region comprising light chain CDR1, CDR2, and CDR3 represented by the amino acid sequences of SEQ ID NO: 4, SEQ ID NO: 5, and SEQ ID NO: 6, respectively;
또는 서열번호 7, 서열번호 8 및 DY의 아미노산 서열로 각각 표시되는 중쇄 CDR1(complementarity determining region 1), CDR2 및 CDR3을 포함하는 중쇄 가변 영역; 및 서열번호 9, 서열번호 10 및 서열번호 11의 아미노산 서열로 각각 표시되는 경쇄 CDR1, CDR2 및 CDR3을 포함하는 경쇄 가변 영역을 포함하는, CT-26 세포 검출용 항체 또는 이의 항원 결합 단편을 제공한다.or a heavy chain variable region comprising heavy chain complementarity determining region 1 (CDR1), CDR2, and CDR3 represented by the amino acid sequences of SEQ ID NO: 7, SEQ ID NO: 8, and DY, respectively; and a light chain variable region comprising light chain CDR1, CDR2, and CDR3 represented by the amino acid sequences of SEQ ID NO: 9, SEQ ID NO: 10, and SEQ ID NO: 11, respectively. .
본 발명의 일 구현예에서, 상기 CT-26 세포 검출용 항체 또는 이의 항원 결합 단편은 서열번호 12로 표시되는 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 13으로 표시되는 아미노산 서열을 포함하는 경쇄 가변 영역; 또는 서열번호 14로 표시되는 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 15로 표시되는 아미노산 서열을 포함하는 경쇄 가변 영역을 포함할 수 있다. In one embodiment of the present invention, the antibody or antigen-binding fragment thereof for detecting CT-26 cells has a heavy chain variable region comprising the amino acid sequence shown in SEQ ID NO: 12 and a light chain variable region containing the amino acid sequence shown in SEQ ID NO: 13. area; Alternatively, it may include a heavy chain variable region including the amino acid sequence shown in SEQ ID NO: 14 and a light chain variable region including the amino acid sequence shown in SEQ ID NO: 15.
본 발명의 또 다른 구현예에서, 상기 CT-26 세포 검출용 항체 또는 이의 항원 결합 단편은 서열번호 16으로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 17로 표시되는 아미노산 서열을 포함하는 경쇄; 또는 서열번호 18로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 19로 표시되는 아미노산 서열을 포함하는 경쇄를 포함할 수 있다. In another embodiment of the present invention, the antibody or antigen-binding fragment thereof for detecting CT-26 cells includes a heavy chain comprising the amino acid sequence shown in SEQ ID NO: 16 and a light chain containing the amino acid sequence shown in SEQ ID NO: 17; Alternatively, it may include a heavy chain containing the amino acid sequence shown in SEQ ID NO: 18 and a light chain containing the amino acid sequence shown in SEQ ID NO: 19.
본 발명에서, 용어 "항체(antibody)"는 면역학적으로 특정 항원과 반응성을 갖는 면역글로불린 분자를 포함하는, 항원을 특이적으로 인식하는 수용체 역할을 하는 단백질 분자를 의미하며, 다클론항체, 단일클론항체 및 완전한 형태의 항체 모두를 포함한다. 또한, 상기 용어는 키메라성 항체 (chimeric antibody), 인간화 항체(humanized antibody) 및 이가(bivalent) 또는 양특이성 분자(예를 들어, 양특이성 항체), 디아바디, 트리아바디 및 테트라바디를 포함한다. In the present invention, the term "antibody" refers to a protein molecule that acts as a receptor that specifically recognizes an antigen, including immunoglobulin molecules that are immunologically reactive with a specific antigen, and includes polyclonal antibodies, single antibodies, and Includes both clonal antibodies and intact antibodies. The term also includes chimeric antibodies, humanized antibodies and bivalent or bispecific molecules (e.g., bispecific antibodies), diabodies, triabodies and tetrabodies.
바람직하게는, 본 발명에서 상기 항체는 단일클론항체일 수 있다. 더욱 바람직하게는, 상기 항체는 본 발명에서 클론 6-B 또는 클론 13으로 지칭되는 단일클론항체일 수 있다. 본 발명에서, 용어 "단일클론항체(monoclonal antibody)"는 상기 항체 분자가 단일 분자로 구성되도록 제조된 것을 의미한다. 단일클론항체는 동일한 에피토프를 갖는 항원에 대해서만 반응하는 특이성을 가지며, 또한 특정 에피토프에 대해서만 친화성을 나타낸다. 본 발명의 단일클론항체는 CT-26 세포를 특이적으로 인식하는 것일 수 있다. Preferably, in the present invention, the antibody may be a monoclonal antibody. More preferably, the antibody may be a monoclonal antibody referred to in the present invention as clone 6-B or clone 13. In the present invention, the term “monoclonal antibody” means that the antibody molecule is manufactured to consist of a single molecule. Monoclonal antibodies have the specificity of reacting only to antigens with the same epitope, and also show affinity only to specific epitopes. The monoclonal antibody of the present invention may specifically recognize CT-26 cells.
항체는 2개의 중쇄(heavy chain)와 2개의 경쇄(light chain)로 구성되며, 대상 항원의 종류에 따라 아미노산 서열이 달라지는 가변 영역(variable region)과 서열이 달라지지 않는 불변 영역(constant region)을 갖는다. 경쇄 및 중쇄의 가변 영역들은 "상보성 결정 부위(complementarity-determining region, CDR)"라고 하는 매우 가변적인 3개의 영역을 포함한다.Antibodies are composed of two heavy chains and two light chains, with a variable region whose amino acid sequence varies depending on the type of target antigen and a constant region whose sequence does not change. have The variable regions of the light and heavy chains contain three highly variable regions called “complementarity-determining regions (CDRs)”.
본 발명에서, 용어, "CDR(complementarity determining region)"은 항체의 중쇄 및 경쇄에서 고가변 영역(hypervariable region)의 아미노산 서열을 의미한다. 중쇄 및 경쇄는 각각 3개의 CDR을 포함할 수 있다 (CDRH1, CDRH2, CDRH3 및 CDRL1, CDRL2, CDRL3). 상기 CDR은 항체가 항원 또는 에피토프에 결합하는 데 있어서 주요한 접촉 잔기를 제공할 수 있다.In the present invention, the term “complementarity determining region (CDR)” refers to the amino acid sequence of the hypervariable region in the heavy and light chains of an antibody. The heavy and light chains may each contain three CDRs (CDRH1, CDRH2, CDRH3 and CDRL1, CDRL2, CDRL3). The CDR may provide key contact residues for the antibody to bind to the antigen or epitope.
완전한 항체는 2개의 전체 길이의 경쇄 및 2개의 전체 길이의 중쇄를 가지는 구조이며 각각의 경쇄는 중쇄와 다이설파이드 결합으로 연결되어 있다. 중쇄는 IgG, IgM, IgD, IgA의 타입을 가지고, 경쇄는 카파(κ) 및 람다(λ) 타입을 가진다. IgG는, 이에 제한되는 것은 아니지만, IgG1, IgG2a, IgG2b, IgG3 및 IgG4를 포함한 몇 개의 서브클래스를 갖는다. 바람직하게는, 본 발명의 상기 항체에서 중쇄는 IgG이고, 경쇄는 카파 타입일 수 있다. 더욱 바람직하게는, 상기 항체는 IgG2a 중쇄를 포함하는 것일 수 있다. A complete antibody has two full-length light chains and two full-length heavy chains, with each light chain connected to the heavy chain by a disulfide bond. Heavy chains have the following types: IgG, IgM, IgD, and IgA, and light chains have kappa (κ) and lambda (λ) types. IgG has several subclasses including, but not limited to, IgG1, IgG2a, IgG2b, IgG3, and IgG4. Preferably, in the antibody of the present invention, the heavy chain may be IgG and the light chain may be of the kappa type. More preferably, the antibody may include an IgG2a heavy chain.
본 발명에서, 용어, "항원 결합 단편(antigen binding fragment)"은 완전한 항체 분자 내에서 항원-항체 결합 기능을 보유하고 있는 단편을 의미하며, 예를 들어 Fab (fragment antigen binding), Fab', F(ab')2, scFv (single-chain Fv), Fv (variable fragment), dsFv (disulfice-stabilized Fv fragments), diabody, Fd, Fd' 및 BiTE(bispecific T-cell engager)로 이루어진 군으로부터 선택될 수 있으나, 이에 한정하지 않는다.In the present invention, the term "antigen binding fragment" refers to a fragment that retains the antigen-antibody binding function within a complete antibody molecule, for example, Fab (fragment antigen binding), Fab', F (ab')2, scFv (single-chain Fv), Fv (variable fragment), dsFv (disulfice-stabilized Fv fragments), diabody, Fd, Fd', and BiTE (bispecific T-cell engager). However, it is not limited to this.
상기 항원 결합 단편 중 Fab는 경쇄 및 중쇄의 가변 영역과 경쇄의 불변 영역 및 중쇄의 첫 번째 불변 영역(CH1)을 가지는 구조로 1개의 항원 결합 부위를 가진다. Fab'는 중쇄 CH1 도메인의 C-말단에 하나 이상의 시스테인 잔기를 포함하는 힌지 영역(hinge region)을 가진다는 점에서 Fab와 차이가 있다. F(ab')2 항체는 Fab'의 힌지 영역의 시스테인 잔기가 다이설파이드 결합을 이루면서 생성된다.Among the antigen-binding fragments, Fab has one antigen-binding site with a structure having variable regions of light and heavy chains, a constant region of the light chain, and the first constant region (CH1) of the heavy chain. Fab' differs from Fab in that it has a hinge region containing one or more cysteine residues at the C-terminus of the heavy chain CH1 domain. The F(ab')2 antibody is produced when the cysteine residue in the hinge region of Fab' forms a disulfide bond.
Fv는 중쇄 가변 영역 및 경쇄 가변 영역만을 가지고 있는 최소의 항체조각으로 Fv 단편을 생성하는 재조합 기술은 당업계에 공지되어 있다. 이중쇄 Fv(two-chain Fv)는 비공유 결합으로 중쇄 가변 영역과 경쇄 가변 영역이 연결되어 있고 단쇄 Fv(single-chain variable fragment, scFv)는 경쇄 사슬과 중쇄 사슬로부터 항원결합부위를 구성하는 가변영역만을 링커로 연결하여 재구성한 재조합 항체 절편이다. Fd는 중쇄의 가변 영역(VH)과 첫 번째 불변 영역(CH1) 도메인으로 이루어진 항체 단편이다.Fv is a minimal antibody fragment containing only the heavy chain variable region and the light chain variable region, and recombinant techniques for producing Fv fragments are known in the art. A double-chain Fv (two-chain Fv) is a variable region in which the heavy chain variable region and a light chain variable region are connected by a non-covalent bond, and a single-chain variable fragment (scFv) is a variable region that constitutes an antigen-binding site from the light and heavy chains. It is a recombinant antibody fragment reconstituted by connecting only the antibodies with a linker. Fd is an antibody fragment consisting of the variable region (VH) and first constant region (CH1) domains of the heavy chain.
상기 항원 결합 단편들은 단백질 가수분해 효소를 이용해서 얻을 수 있고(예를 들어, 전체 항체를 파파인으로 제한 절단하면 Fab를 얻을 수 있고 펩신으로 절단하면 F(ab')2 단편을 얻을 수 있다), 유전자 재조합 기술을 통하여 제작할 수 있다.The antigen-binding fragments can be obtained using proteolytic enzymes (for example, Fab can be obtained by restriction digestion of the entire antibody with papain, and F(ab')2 fragment can be obtained by digestion with pepsin), It can be produced through genetic recombination technology.
본 발명에서, 용어 "프레임워크(Framework)" 또는 "FR"은 CDR로도 불리는 초가변 영역(hypervariable region, HVR) 잔기 이외의 가변 도메인 잔기를 나타낸다. 가변 도메인의 FR은 일반적으로 4 개의 FR 도메인 FR1, FR2, FR3 및 FR4로 구성된다. 따라서, HVR (CDR) 및 FR 서열은 일반적으로 중쇄 가변 영역(VH)에서 다음의 순서로 나타난다:In the present invention, the term “Framework” or “FR” refers to variable domain residues other than hypervariable region (HVR) residues, also called CDR. FRs in variable domains generally consist of four FR domains FR1, FR2, FR3 and FR4. Accordingly, HVR (CDR) and FR sequences generally appear in the heavy chain variable region (VH) in the following order:
FRH1-CDRH1-FRH2-CDRH2-FRH3-CDRH3-FRH4.FRH1-CDRH1-FRH2-CDRH2-FRH3-CDRH3-FRH4.
또한, HVR (CDR) 및 FR 서열은 일반적으로 경쇄 가변 영역(VL; 경쇄의 타입에 따라 Vκ 또는 Vλ로도 표기됨)에서 다음의 순서로 나타난다:Additionally, HVR (CDR) and FR sequences generally occur in the light chain variable region (VL; also written as Vκ or Vλ, depending on the type of light chain) in the following order:
FRL1-CDRL1-FRL2-CDRL2-FRL3-CDRL3-FRL4.FRL1-CDRL1-FRL2-CDRL2-FRL3-CDRL3-FRL4.
본 발명에서, 용어, "에피토프(epitope)"는 면역글로불린, 항체 또는 이의 항원 결합 단편이 특이적으로 인식하고 결합할 수 있는 항원 상의 특정 부위를 의미한다. 상기 에피토프는 연속 아미노산으로부터 또는 단백질의 3차 접힘에 의해 병치된 불연속 아미노산으로부터 형성될 수 있다.In the present invention, the term “epitope” refers to a specific site on an antigen that an immunoglobulin, antibody, or antigen-binding fragment thereof can specifically recognize and bind to. The epitope can be formed from continuous amino acids or from discontinuous amino acids juxtaposed by tertiary folding of the protein.
본 발명에서, 용어 "특이적 결합", "특이적 인지", 또는 "특이적 인식"은, 항체 또는 이의 항원 결합 단편, 또는 scFv와 같은 다른 구성물이 생리적 조건 하에서 비교적 안정한 항원과 복합체를 형성한다는 것을 의미한다. 특이적 결합은 적어도 약 1 x 10-6 M이하의 평형 해리 상수 (예를 들어, 이보다 작은 KD는 보다 단단한 결합을 나타냄)로 특성화될 수 있다. 2 개의 분자가 특이적으로 결합하는지 여부를 결정하는 방법은 당업계에 잘 알려져 있으며, 예를 들어 평형 투석, 표면 플라스몬 공명 등을 포함한다.As used herein, the terms "specific binding", "specific recognition", or "specific recognition" mean that an antibody or antigen-binding fragment thereof, or other construct such as an scFv, forms a complex with an antigen that is relatively stable under physiological conditions. means that Specific binding can be characterized by an equilibrium dissociation constant of at least about 1 x 10 -6 M or less (e.g., a smaller KD indicates more rigid binding). Methods for determining whether two molecules bind specifically are well known in the art and include, for example, equilibrium dialysis, surface plasmon resonance, etc.
본 발명의 상기 항체는 인간 항체, 인간화 항체, 또는 키메라 항체일 수 있다.The antibody of the present invention may be a human antibody, humanized antibody, or chimeric antibody.
본원에서 사용된 용어 "인간 항체(human antibody)" 또는 "인간화 항체(humanized antibody)"는 인간 또는 인간 세포에 의해 생성된 항체, 또는 인간 항체 레퍼토리(repertoires) 또는 다른 인간 항체 코딩 서열을 이용하는 비인간 근원으로부터 유래된 항체의 아미노산 서열에 상응하는 아미노산 서열을 보유한다.As used herein, the term “human antibody” or “humanized antibody” refers to an antibody produced by a human or human cell, or from human antibody repertoires or other non-human sources that utilize human antibody coding sequences. It has an amino acid sequence corresponding to the amino acid sequence of the antibody derived from.
본원에서 사용된 용어 "키메라(chimeric) 항체"는 중쇄 및/또는 경쇄의 일부가 특정 근원(source) 또는 종(species)으로부터 유래되고, 중쇄 및/또는 경쇄의 나머지가 상이한 근원 또는 종에서 유래한 항체를 의미한다. 통상적으로, 키메라 항체는 주로 인간 도메인을 갖는 항체를 생성시키기 위해 설치류 또는 토끼 가변 영역 및 인간 불변 영역을 이용한다. 이러한 키메라 항체의 생성은 당 분야에 널리 공지되어 있고, 이는 표준 수단에 의해 달성될 수 있다.As used herein, the term “chimeric antibody” refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species and the remainder of the heavy and/or light chain is derived from a different source or species. It means antibody. Typically, chimeric antibodies utilize rodent or rabbit variable regions and human constant regions to generate antibodies with primarily human domains. The production of such chimeric antibodies is well known in the art and can be accomplished by standard means.
본 발명의 상기 항체 또는 이의 항원 결합 단편은, CT-26 세포를 특이적으로 인식할 수 있는 범위 내에서 첨부한 서열목록에 기재된 아미노산 서열의 변이체를 포함할 수 있다. 예를 들면, 항체의 결합 친화도 및/또는 기타 생물학적 특성을 개선시키기 위하여 항체의 아미노산 서열에 변화를 줄 수 있다. 이러한 변형은, 예를 들어 항체의 아미노산 서열 잔기의 결실, 삽입 및/또는 치환을 포함한다.The antibody or antigen-binding fragment thereof of the present invention may include variants of the amino acid sequence described in the attached sequence list to the extent that it can specifically recognize CT-26 cells. For example, changes can be made to the amino acid sequence of an antibody to improve its binding affinity and/or other biological properties. Such modifications include, for example, deletions, insertions and/or substitutions of amino acid sequence residues of the antibody.
분자의 활성을 전체적으로 변경시키지 않는 단백질에서의 아미노산 교환은 당해 분야에 공지되어 있다(H.Neurath, R.L.Hill, The Proteins, Academic Press, New York, 1979). 가장 통상적으로 일어나는 교환은 아미노산 잔기 Ala/Ser, Val/Ile, Asp/Glu, Thr/Ser, Ala/Gly, Ala/Thr, Ser/Asn, Ala/Val, Ser/Gly, Thy/Phe, Ala/Pro, Lys/Arg, Asp/Asn, Leu/Ile, Leu/Val, Ala/Glu, Asp/Gly 간의 교환이다.Amino acid exchanges in proteins that do not overall alter the activity of the molecule are known in the art (H. Neurath, R. L. Hill, The Proteins, Academic Press, New York, 1979). The most common exchanges are amino acid residues Ala/Ser, Val/Ile, Asp/Glu, Thr/Ser, Ala/Gly, Ala/Thr, Ser/Asn, Ala/Val, Ser/Gly, Thy/Phe, Ala/ It is an exchange between Pro, Lys/Arg, Asp/Asn, Leu/Ile, Leu/Val, Ala/Glu, and Asp/Gly.
또한, 상기 아미노산 서열들은 당업계에 알려진 통상적인 변형이 일어난 아미노산을 포함하는 것일 수 있으며, 상기 아미노산 변형은 예컨대 인산화(phosphorylation), 황화(sulfation), 아크릴화(acrylation), 당화(glycosylation), 메틸화(methylation), 파네실화(farnesylation) 등일 수 있다.In addition, the amino acid sequences may include amino acids that have undergone common modifications known in the art, and the amino acid modifications include, for example, phosphorylation, sulfation, acrylation, glycosylation, and methylation ( methylation), farnesylation, etc.
본 발명은 상기 CT-26 세포 검출용 항체 또는 이의 항원 결합 단편의 중쇄 및/또는 경쇄를 암호화하는 폴리뉴클레오티드를 제공한다.The present invention provides a polynucleotide encoding the heavy chain and/or light chain of the antibody for detecting CT-26 cells or an antigen-binding fragment thereof.
본 발명에서 용어 "폴리뉴클레오티드" 또는 "핵산 분자"는 DNA(gDNA 및 cDNA) 그리고 RNA 분자를 포괄적으로 포함하는 의미를 가지며, 핵산 분자에서 기본 구성단위인 뉴클레오티드는 자연의 뉴클레오티드뿐만 아니라, 당 또는 염기 부위가 변형된 유사체(analogue)도 포함한다. 본 발명의 중쇄 및 경쇄 가변영역을 암호화하는 핵산 분자의 서열은 변형될 수 있다. 상기 변형은 뉴클레오티드의 추가, 결실, 또는 비보존적 치환 또는 보존적 치환을 포함한다.In the present invention, the term "polynucleotide" or "nucleic acid molecule" is meant to comprehensively include DNA (gDNA and cDNA) and RNA molecules, and nucleotides, which are the basic structural units in nucleic acid molecules, include not only natural nucleotides but also sugars or bases. It also includes analogues with modified parts. The sequences of nucleic acid molecules encoding the heavy and light chain variable regions of the present invention may be modified. The modifications include additions, deletions, or non-conservative or conservative substitutions of nucleotides.
본 발명의 폴리뉴클레오티드는 상기한 뉴클레오티드 염기 서열에 대하여 실질적인 동일성을 나타내는 뉴클레오티드 염기 서열도 포함하는 것으로 해석된다. 상기의 실질적인 동일성은, 상기한 본 발명의 뉴클레오티드 서열과 임의의 다른 서열을 최대한 대응되도록 정렬(align)하고, 당업계에서 통상적으로 이용되는 알고리즘을 이용하여 정렬된 서열을 분석한 경우에, 최소 80%의 상동성, 바람직하게는 최소 90%의 상동성, 보다 바람직하게는 최소 95%의 상동성을 나타내는 염기 서열을 의미한다.The polynucleotide of the present invention is interpreted to also include a nucleotide base sequence showing substantial identity to the above-described nucleotide base sequence. The above substantial identity is at least 80% when aligning the nucleotide sequence of the present invention and any other sequence to correspond as much as possible and analyzing the aligned sequence using an algorithm commonly used in the art. It means a base sequence showing % homology, preferably at least 90% homology, more preferably at least 95% homology.
본 발명의 일 구현예에서, 상기 CT-26 세포 검출용 항체 또는 이의 항원 결합 단편의 중쇄를 암호화하는 폴리뉴클레오티드는 서열번호 20으로 표시되는 뉴클레오티드 서열을 포함하는 것일 수 있고, 경쇄를 암호화하는 폴리뉴클레오티드는 서열번호 21로 표시되는 뉴클레오티드 서열을 포함하는 것일 수 있다.In one embodiment of the present invention, the polynucleotide encoding the heavy chain of the antibody for detecting CT-26 cells or an antigen-binding fragment thereof may include the nucleotide sequence represented by SEQ ID NO: 20, and the polynucleotide encoding the light chain may include the nucleotide sequence represented by SEQ ID NO: 21.
본 발명의 또 다른 일 구현예에서, 상기 CT-26 세포 검출용 항체 또는 이의 항원 결합 단편의 중쇄를 암호화하는 폴리뉴클레오티드는 서열번호 22로 표시되는 뉴클레오티드 서열을 포함하는 것일 수 있고, 경쇄를 암호화하는 폴리뉴클레오티드는 서열번호 23으로 표시되는 뉴클레오티드 서열을 포함하는 것일 수 있다.In another embodiment of the present invention, the polynucleotide encoding the heavy chain of the antibody for detecting CT-26 cells or an antigen-binding fragment thereof may include the nucleotide sequence represented by SEQ ID NO: 22, and encoding the light chain. The polynucleotide may include the nucleotide sequence represented by SEQ ID NO: 23.
본 발명은 또한 상기 항체의 중쇄를 암호화하는 폴리뉴클레오티드와 경쇄를 암호화하는 폴리뉴클레오티드 또는 상기 폴리뉴클레오티드 모두를 포함하는 발현 벡터 또는 발현 벡터가 도입된 형질전환체를 제공한다.The present invention also provides an expression vector containing a polynucleotide encoding the heavy chain and a polynucleotide encoding the light chain of the antibody, or both of the polynucleotides, or a transformant into which the expression vector has been introduced.
본 발명에서, 용어 "발현 벡터"는 숙주세포에서 목적 유전자를 발현시키기 위하여, 발현시킬 뉴클레오티드 염기 서열에 작동 가능하게 연결된(operatively linked) 발현 제어 서열을 포함하는 재조합 뉴클레오티드를 포함하는 벡터를 지칭한다. In the present invention, the term "expression vector" refers to a vector containing a recombinant nucleotide containing an expression control sequence operatively linked to the nucleotide base sequence to be expressed in order to express a gene of interest in a host cell.
상기 발현 벡터는 본 발명의 항체 또는 이의 항원 결합 단편을 암호화하는 염기서열 이외에도, 프로모터, 터미네이터 등의 조절서열을 더 포함할 수 있으며, 상기 항체 또는 이의 항원 결합 단편을 암호화하는 염기서열이 프로모터에 작동 가능하게 연결된 것일 수 있다. 상기 작동 가능하게 연결된 것은 조절 서열(예컨대, 프로모터, 시그널 서열, 전사조절인자 결합 위치의 어레이 등)과 다른 염기서열 사이의 기능적인 결합을 의미하며, 이에 의해 상기 조절 서열은 상기 다른 염기서열의 전사 및/또는 번역을 조절할 수 있다.In addition to the base sequence encoding the antibody or antigen-binding fragment thereof of the present invention, the expression vector may further include regulatory sequences such as a promoter and terminator, and the base sequence encoding the antibody or antigen-binding fragment thereof operates on the promoter. It could possibly be connected. The operably linked means a functional linkage between a regulatory sequence (e.g., a promoter, a signal sequence, an array of transcriptional regulator binding sites, etc.) and another base sequence, whereby the control sequence allows the transcription of the other base sequence. and/or control the translation.
또한, 상기 발현 벡터는, 이로부터 발현되는 항체의 정제를 용이하게 하기 위하여 다른 서열과 융합될 수 있다. 융합되는 서열은, 예컨대 글루타티온 S-트랜스퍼라제(Pharmacia, USA), 말토스 결합 단백질(NEB, USA), FLAG(IBI, USA) 및 6x His(hexahistidine; Quiagen, USA) 등이 있다.Additionally, the expression vector may be fused with other sequences to facilitate purification of the antibody expressed therefrom. Sequences to be fused include, for example, glutathione S-transferase (Pharmacia, USA), maltose binding protein (NEB, USA), FLAG (IBI, USA), and 6x His (hexahistidine; Quiagen, USA).
본 발명에서, 상기 항체 또는 이의 항원 결합 단편을 암호화하는 폴리뉴클레오티드를 포함하는 발현 벡터는 특별히 이에 제한되지 않으나, 박테리아 세포(예를 들어, 대장균 등), 포유류 세포(예를 들어, 사람, 원숭이, 토끼, 래트, 햄스터, 마우스 세포 등), 식물 세포, 효모 세포 또는 곤충 세포를 포함하는 원핵 또는 진핵세포에서 상기 폴리뉴클레오티드를 복제 및/또는 발현할 수 있는 벡터가 될 수 있다. 바람직하게는 숙주세포에서 상기 폴리뉴클레오티드가 발현될 수 있도록 적절한 프로모터에 작동 가능하도록 연결되며, 적어도 하나의 선별마커를 포함하는 벡터가 될 수 있다. 예를 들어, 파지미드, 플라스미드, 코스미드, 미니-염색체, 바이러스 또는 레트로바이러스 벡터 등에 상기 폴리뉴클레오티드가 도입된 형태가 될 수 있다.In the present invention, the expression vector containing a polynucleotide encoding the antibody or antigen-binding fragment thereof is not particularly limited thereto, but includes bacterial cells (e.g., Escherichia coli, etc.), mammalian cells (e.g., humans, monkeys, It may be a vector capable of replicating and/or expressing the polynucleotide in prokaryotic or eukaryotic cells, including rabbit, rat, hamster, mouse cells, etc.), plant cells, yeast cells, or insect cells. Preferably, it may be a vector that is operably linked to an appropriate promoter so that the polynucleotide can be expressed in a host cell and includes at least one selection marker. For example, the polynucleotide may be introduced into a phagemid, plasmid, cosmid, mini-chromosome, virus, or retroviral vector.
본 발명의 재조합 벡터 시스템은 당업계에 공지된 다양한 방법을 통해 구축될 수 있으며, 이에 대한 구체적인 방법은 문헌 [Sambrook et al., Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press(2001)] 등에 개시되어 있다. 또한, 본 발명의 항체를 발현하는 벡터는, 경쇄와 중쇄가 하나의 벡터에서 동시에 발현되는 벡터 시스템이거나 또는 경쇄와 중쇄를 각각 별도의 벡터에서 발현시키는 시스템 모두 가능하다.The recombinant vector system of the present invention can be constructed through various methods known in the art, and specific methods are described in Sambrook et al., Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press (2001), etc. It has been disclosed. In addition, the vector expressing the antibody of the present invention can be either a vector system in which the light chain and heavy chain are simultaneously expressed in one vector, or a system in which the light chain and heavy chain are expressed in separate vectors.
본 발명에서, 상기 발현 벡터가 도입된 형질전환체는 특별히 이에 제한되지 않으나, 상기 발현 벡터가 도입되어 형질전환된 대장균, 스트렙토미세스, 살모넬라 티피뮤리움 등의 박테리아 세포; 효모 세포; 피치아 파스토리스 등의 균류세포; 드로조필라, 스포도프테라 Sf9 세포 등의 곤충 세포; CHO(중국 햄스터 난소 세포, chinese hamster ovary cells), HEK(인간 배아신장 세포, human embryonic kidney cells), PERC.6 (인간망막세포) 등의 동물 세포; 또는 식물세포가 될 수 있다.In the present invention, the transformant into which the expression vector is introduced is not particularly limited, but includes bacterial cells such as Escherichia coli, Streptomyces, and Salmonella Typhimurium transformed by introducing the expression vector; yeast cells; Fungal cells such as Pichia pastoris; Insect cells such as Drozophila and Spodoptera Sf9 cells; Animal cells such as CHO (chinese hamster ovary cells), HEK (human embryonic kidney cells), and PERC.6 (human retina cells); Or it can be a plant cell.
상기 폴리뉴클레오티드 또는 이를 포함하는 발현 벡터의 숙주세포/형질전환체 내로의 운반은, 당 업계에 널리 알려진 운반 방법을 사용할 수 있다. 상기 운반 방법은 예를 들어, 숙주세포가 원핵세포이면 CaCl2 방법 또는 전기 천공 방법 등을 사용할 수 있고, 숙주세포가 진핵세포이면 미세 주입법, 칼슘 포스페이트 침전법, 전기 천공법, 리포좀-매개 형질감염법 및 유전자 밤바드먼트 등을 사용할 수 있으나, 이에 한정하지는 않는다.The polynucleotide or an expression vector containing it can be transported into a host cell/transformant using a transport method widely known in the art. For example, if the host cell is a prokaryotic cell, the delivery method may be used, such as the CaCl 2 method or electroporation method, and if the host cell is a eukaryotic cell, microinjection method, calcium phosphate precipitation method, electroporation method, or liposome-mediated transfection may be used. Laws and genetic bombardments can be used, but are not limited to this.
본 발명은 또한 상기 항체 또는 이의 항원 결합 단편을 포함하는 CT-26 세포 검출용 조성물을 제공한다. The present invention also provides a composition for detecting CT-26 cells comprising the antibody or antigen-binding fragment thereof.
전술한 바와 같이, 상기 항체는 CT-26 세포를 인식할 수 있다. 따라서, 이를 포함하는 조성물을 CT-26세포가 포함된 혼성 세포 집단에 처리하면, 상기 항체는 CT-26 세포를 특이적으로 인식하게 되고, 주변 세포들로부터 CT-26 세포를 명확하게 구분할 수 있다.As described above, the antibody can recognize CT-26 cells. Therefore, when a composition containing this is treated with a mixed cell population containing CT-26 cells, the antibody specifically recognizes CT-26 cells and can clearly distinguish CT-26 cells from surrounding cells. .
본 발명에서, 상기 조성물은 CT-26 특이적 항체 이외에 허용 가능한 담체를 포함하여 적절한 제제로 제조될 수 있다. 또한, 상기 조성물은 투여 가능한 형태로 제조될 수 있으며, 투여 방식에 따라 허용 가능한 담체는 당 분야에 공지되어 있다. 예컨대, 상기 제제는 비경구, 피하, 복강 내, 폐 내, 및 비강 내 및 국부적 면역억제치료를 위해 필요하다면 병변 내 투여를 포함하는 적합한 방법에 의해 투여될 수 있다. 비경구 주입에는 근육 내, 정맥 내, 동맥 내, 복강 내 또는 피하 투여가 포함될 수 있다. 본 발명의 항체를 포함하는 조성물의 전형적인 투여량 수준은 표준 임상적 기술을 사용하여 최적화할 수 있다.In the present invention, the composition can be prepared with an appropriate preparation including an acceptable carrier in addition to the CT-26 specific antibody. Additionally, the composition can be prepared in an administrable form, and acceptable carriers depending on the mode of administration are known in the art. For example, the agent can be administered by any suitable method, including parenteral, subcutaneous, intraperitoneal, intrapulmonary, and intranasal and, if necessary, intralesional administration for local immunosuppressive treatment. Parenteral infusion may include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration. Typical dosage levels of compositions comprising antibodies of the invention can be optimized using standard clinical techniques.
또한, 본 발명은 상기 CT-26 세포 검출용 조성물을 포함하는 CT-26 세포 검출용 키트를 제공한다.Additionally, the present invention provides a kit for detecting CT-26 cells including the composition for detecting CT-26 cells.
본 발명의 항체 및/또는 항체를 포함하는 조성물은 항원-항체 복합체 반응을 통해 CT-26 세포를 특이적으로 검출하기 위해 사용될 수 있다. The antibodies and/or compositions containing antibodies of the present invention can be used to specifically detect CT-26 cells through antigen-antibody complex reaction.
이러한 키트는 항체 이외에 면역학적 분석에 사용되는 당업계에 공지된 도구 또는 시약을 추가로 포함할 수 있다. 이러한 도구 또는 시약으로는 적합한 담체, 검출 가능한 신호를 생성할 수 있는 표지물질, 용해제, 세정제, 완충제, 안정화제 등이 포함되나 이로 제한되지 않는다.In addition to antibodies, these kits may further include tools or reagents known in the art used for immunological analysis. These tools or reagents include, but are not limited to, suitable carriers, labels capable of producing a detectable signal, solubilizers, detergents, buffers, stabilizers, etc.
표지 물질이 효소인 경우에는 효소활성을 측정할 수 있는 기질, 적당한 완충용액, 발색 효소 또는 형광물질로 표지된 2차 항체, 발색 기질 및 반응 정지제 등을 포함할 수 있다. 적합한 담체로는, 이에 한정되지는 않으나, 가용성 담체, 예를 들어 당 분야에 공지된 생리학적으로 허용되는 완충액, 예를 들어 PBS, 불용성 담체, 예를 들어 폴리스틸렌, 폴리에틸렌, 폴리프로필렌, 폴리에스테르, 폴리아크릴로니트릴, 불소 수지, 가교 덱스트란, 폴리사카라이드, 라텍스에 금속을 도금한 자성 미립자와 같은 고분자, 기타 종이, 유리, 금속, 아가로스 및 이들의 조합일 수 있다.If the labeling substance is an enzyme, it may include a substrate capable of measuring enzyme activity, an appropriate buffer solution, a secondary antibody labeled with a chromogenic enzyme or a fluorescent substance, a chromogenic substrate, and a reaction stopper. Suitable carriers include, but are not limited to, soluble carriers such as physiologically acceptable buffers known in the art such as PBS, insoluble carriers such as polystyrene, polyethylene, polypropylene, polyester, It may be polyacrylonitrile, fluororesin, cross-linked dextran, polysaccharide, polymers such as magnetic fine particles plated with metal on latex, other paper, glass, metal, agarose, and combinations thereof.
상기에서 면역학적 분석은 항원과 항체의 결합을 측정할 수 있는 있는 방법이라면 모두 포함될 수 있다. 이러한 방법들은 당 분야에 공지되어 있으며, 예를 들어, 웨스턴블랏, ELISA, 방사선면역분석법, 방사면역 확산법, 면역형광분석법, 면역 블롯, 오우크레로니 면역 확산법, 로케트 면역전기영동, 조직면역 염색, 면역 침전분석법, 보체 고정 분석법, 면역크로마토그래피 분석법, FACS, 단백질 칩 등이 있으나, 이에 제한되는 것은 아니다.In the above, immunological analysis may include any method that can measure the binding between an antigen and an antibody. These methods are known in the art and include, for example, Western blot, ELISA, radioimmunoassay, radioimmunodiffusion, immunofluorescence, immunoblot, Ouchreroni immunodiffusion, rocket immunoelectrophoresis, tissue immunostaining, and immunofluorescence. Examples include, but are not limited to, precipitation analysis, complement fixation analysis, immunochromatographic analysis, FACS, and protein chip.
검출 가능한 신호를 생성할 수 있는 표지는 항원-항체 복합체의 형성을 정성 또는 정량적으로 측정가능하게 하며, 이의 예로는 효소, 형광물질, 리간드, 발광물질, 미소입자 (microparticle), 레독스 분자 및 방사성 동위원소 등을 사용할 수 있다. Labels that can generate a detectable signal enable the formation of antigen-antibody complexes to be measured qualitatively or quantitatively, examples of which include enzymes, fluorescent substances, ligands, luminescent substances, microparticles, redox molecules and radioactive substances. Isotopes, etc. can be used.
예컨대, 효소로는 β-글루쿠로니다제, β-D-글루코시다제, 우레아제, 퍼옥시다아제 (호스라디시 퍼옥시다제 등), 알칼라인 포스파타아제, 아세틸콜린에스테라아제, 글리코즈 옥시다아제, 헥소키나제, 말레이트 디하이드로게나아제, 글루코스-6-인산디하이드로게나아제, 인버타아제, 루시퍼라아제 등을 사용할 수 있다. 형광물질로는 플루오레신, 이소티오시아네이트, 로다민, 피코에리테린, 피코시아닌, 알로피코시아닌, 플루오르신이소티옥시아네이트 등을 사용할 수 있다. 리간드로는 바이오틴 유도체 등이 있으며, 발광물질로는 아크리디늄 에스테르, 루시페린 등이 있다. 미소입자로는 콜로이드 금, 착색된 라텍스 등이 있고 레독스 분자로는 페로센, 루테늄 착화합물, 바이올로젠, 퀴논, Ti 이온, Cs 이온, 디이미드, 1,4-벤조퀴논, 하이드로퀴논 등이 있다. 방사성 동위원소로는 3H, 14C, 32P, 35S, 36Cl, 51Cr, 57Co, 58Co, 59Fe, 90Y, 125I, 131I, 186Re 등이 있다. 그러나 상기 예시된 것들 외에 면역학적 분석법에 사용할 수 있은 것이라면 어느 것이라도 사용할 수 있다.For example, enzymes include β-glucuronidase, β-D-glucosidase, urease, peroxidase (horseradish peroxidase, etc.), alkaline phosphatase, acetylcholinesterase, glycose oxidase, and hexokinase. , malate dehydrogenase, glucose-6-phosphate dehydrogenase, invertase, luciferase, etc. can be used. Fluorescein, isothiocyanate, rhodamine, phycoerytherin, phycocyanin, allophycocyanin, fluorescein isothioxyanate, etc. can be used as fluorescent substances. Ligands include biotin derivatives, and luminescent substances include acridinium ester and luciferin. Microparticles include colloidal gold and colored latex, and redox molecules include ferrocene, ruthenium complex, viologen, quinone, Ti ion, Cs ion, diimide, 1,4-benzoquinone, and hydroquinone. Radioactive isotopes include 3 H, 14 C, 32 P, 35 S, 36 Cl, 51 Cr, 57 Co, 58 Co, 59 Fe, 90 Y, 125 I, 131 I, and 186 Re. However, in addition to those exemplified above, any one that can be used in immunological analysis can be used.
효소 발색 기질로서, 예를 들어 효소 표지로서 호스라디시 퍼옥시다제 (HRP)를 선택한 경우에는 기질로 3-아미노-9-에틸카르바졸, 5-아미노살리실산, 4-클로로-1-나프톨, o-페닐렌디아민, 2,2'-아지노-비스(3-에틸벤즈티아졸린-6-술폰산), 3,3-디아미노벤지딘, 3,3',5,5'-테트라메틸벤지딘, o-디아니시딘, 또는 3,3-디메톡시벤지딘 포함 용액을 사용할 수 있다. 또한, 효소 표지로서 알칼라인 포스파타아제를 선택한 경우에는 기질로 5-브로모-4-클로로-3-인돌릴 포스페이트, 니트로블루 테트라졸륨, 또는 p-니트로페닐 포스페이트 포함 용액을 사용할 수 있다. 또한, 효소 표지로서 β-D-갈락토시다제를 선택한 경우에는 기질로 o-니트로페닐-β-D-갈락토시드 또는 5-브로모-4-클로로-3-인돌-β-D-갈락토피라노시드 포함 용액을 사용할 수 있다. 이 외에도 당업계에 알려진 다양한 효소 및 효소 발색 기질을 사용할 수 있다.As an enzyme chromogenic substrate, for example, when horseradish peroxidase (HRP) was selected as an enzyme label, 3-amino-9-ethylcarbazole, 5-aminosalicylic acid, 4-chloro-1-naphthol, o -Phenylenediamine, 2,2'-azino-bis(3-ethylbenzthiazoline-6-sulfonic acid), 3,3-diaminobenzidine, 3,3',5,5'-tetramethylbenzidine, o- A solution containing dianisidine or 3,3-dimethoxybenzidine can be used. Additionally, when alkaline phosphatase is selected as the enzyme label, a solution containing 5-bromo-4-chloro-3-indolyl phosphate, nitroblue tetrazolium, or p-nitrophenyl phosphate can be used as the substrate. In addition, when β-D-galactosidase is selected as the enzyme label, o-nitrophenyl-β-D-galactoside or 5-bromo-4-chloro-3-indole-β-D-gal is used as the substrate. A solution containing lactopyranoside can be used. In addition, various enzymes and enzyme chromogenic substrates known in the art can be used.
또한, 본 발명은 상기 항체와 혼성 세포 집단을 혼합하여, 상기 혼성 세포 집단 중 상기 항체가 결합된 세포를 CT-26 세포로 결정하는 단계를 포함하는, CT-26 세포 검출 방법을 제공한다.Additionally, the present invention provides a method for detecting CT-26 cells, comprising the step of mixing the antibody and the mixed cell population and determining the cells bound to the antibody among the mixed cell population as CT-26 cells.
본 발명에 따른 항체는 CT-26 세포를 특이적으로 인식하여 CT-26 세포를 특이적으로 분리할 수 있다.The antibody according to the present invention can specifically recognize CT-26 cells and specifically separate CT-26 cells.
도 1은 본 발명의 개요를 나타낸 것으로, 종양 모델 마우스의 종양 침윤 활성화 B세포의 전사체 데이터를 이용하여 BCR 영역 서열 정보를 확인하고 선별한 클론의 서열을 재구성하여 재조합항체를 제작하는 과정을 나타낸 것이다.
도 2의 상단은 단일세포 전사체 데이터의 세포 클러스터 t-SNE 플롯을 도시한 것이다. 세포군별 특이적인 바이오마커를 활용하여 B세포로 예측되는 세포를 사전 분류하고 B세포 하위 아형을 분류한 결과를 나타낸 것이다. 도 2의 하단은 각 클론이 검출된 세포에서 세포 유형을 대표하는 유전자들의 발현 수준을 나타낸 것이다. 성숙된 Naive B 세포로 간주되는 여포성 B세포(Follicular B cell)와 분화된 형태로 항체를 분비하는 형질세포(Plasma cell) 유형에서 동시에 확인되어 세포 분화과정이 확인되었다고 볼 수 있으며 이를 기반으로 항체 클론을 선별한 것이다.
도 3의 상단은 세포배양한 CT-26에서 재조합 항체 결합의 유세포분석 결과를 나타낸 것이다. 도 3의 하단은 CT-26 동종 이식 종양 모델의 종양조직 유래 세포 중 gp70+ CD45- 세포와 재조합 항체 결합의 유세포분석 결과를 나타낸 것이다.
도 4는 세포 배양한 세포 (C)와 조직 유래 세포 (T)에서 재조합 항체의 단백질 면역 블롯 분석 결과를 나타낸 것이다. Figure 1 shows an overview of the present invention, showing the process of producing a recombinant antibody by confirming the BCR region sequence information and reconstructing the sequence of the selected clone using transcriptome data of tumor infiltration activated B cells in tumor model mice. will be.
The top of Figure 2 shows a cell cluster t-SNE plot of single cell transcriptome data. This shows the results of pre-classifying cells predicted to be B cells and classifying B cell sub-subtypes using specific biomarkers for each cell group. The bottom of Figure 2 shows the expression levels of genes representing the cell type in the cells in which each clone was detected. Follicular B cells, which are considered mature naïve B cells, and plasma cell types, which secrete antibodies in a differentiated form, were simultaneously identified, so it can be said that the cell differentiation process has been confirmed, and based on this, the antibody Clones were selected.
The top of Figure 3 shows the results of flow cytometry analysis of recombinant antibody binding in cell cultured CT-26. The bottom of Figure 3 shows the results of flow cytometry analysis of the binding of recombinant antibodies to gp70+ CD45- cells among tumor tissue-derived cells of the CT-26 allograft tumor model.
Figure 4 shows the results of protein immunoblot analysis of recombinant antibodies in cell cultured cells (C) and tissue-derived cells (T).
이하, 본 발명을 실시예에 의해 상세히 설명한다. 단, 하기 실시예는 본 발명을 예시하는 것일 뿐, 본 발명의 내용이 하기 실시예에 한정되는 것은 아니다.Hereinafter, the present invention will be described in detail by examples. However, the following examples only illustrate the present invention, and the content of the present invention is not limited to the following examples.
실시예 1. 단일세포 전사체-BCR 다중오믹스 분석을 통한 후보 항체 선별Example 1. Candidate antibody selection through single cell transcriptome-BCR multi-omics analysis
1-1. 동계 마우스(Syngeneic mouse) 종양 모델1-1. Syngeneic mouse tumor model
5주령의 BALB/c 암컷 마우스를 Orient Bio Inc(대한민국 성남)에서 구입하였다. 동물실험의 모든 절차는 실험동물복지법(Laboratory Animals Welfare Act), 실험실 동물의 관리 및 사용 안내서(Guide for the Care and Use of Laboratory Animals) 및 의과대학 IACUC(Institutional Animal Care and Use Committee)에서 제공하는 설치류 실험지침 및 정책(Guidelines and Policies for Rodent experiment)에 따라 진행되었다. CT-26 결장암 세포주는 mycoplasma-free 세포로 Korean Cell Line Bank (KCLB)에서 구입하였다. Five-week-old BALB/c female mice were purchased from Orient Bio Inc (Seongnam, Korea). All procedures for animal testing are governed by the Laboratory Animals Welfare Act, the Guide for the Care and Use of Laboratory Animals, and the rodents provided by the Medical School's Institutional Animal Care and Use Committee (IACUC). The experiment was conducted in accordance with the Guidelines and Policies for Rodent experiments. CT-26 colon cancer cell line was mycoplasma-free and purchased from Korean Cell Line Bank (KCLB).
CT-26 세포는 10% 우태아혈청(Fetal Bovine Serum, FBS), 1% 페니실린/스트렙토마이신(penicillin/streptomycin)이 함유된 Dulbecco's Modified Eagle Medium(DMEM) 배지를 사용하여 37℃, 5% CO2 조건의 배양기에서 배양하였다. 안정적인 성장이 확인된 세포는 4 x 106 농도로 인산염 완충액에 희석하여 50μl씩 6-7주령 BALB/c 마우스의 왼쪽 및 오른쪽 옆구리에 피하 주사하였다. 그런 다음, 마우스에 100㎍의 항-CTLA-4(9H10) (BioXCell, Lebanon PA, USA) 또는 대조군 용액(인산임 완충액) 또는 다클론 시리아 햄스터 IgG을 종양 접종 후 5일, 8일 및 11일 경과일에 복강내 주사하였다. 마우스는 종양 접종 후 12일(B 세포에 대한 유세포 분석) 또는 13일(단세포 RNA 시퀀싱 및 T 세포에 대한 유세포 분석)에 희생시키고 종양 샘플을 수집하였다.CT-26 cells were grown using Dulbecco's Modified Eagle Medium (DMEM) containing 10% Fetal Bovine Serum (FBS) and 1% penicillin/streptomycin at 37°C and 5% CO2. It was cultured in an incubator. Cells confirmed to have stable growth were diluted in phosphate buffer to a concentration of 4 Then, mice were inoculated with 100 μg of anti-CTLA-4 (9H10) (BioXCell, Lebanon PA, USA) or control solution (phosphate buffer) or polyclonal Syrian hamster IgG on days 5, 8, and 11 after tumor inoculation. It was injected intraperitoneally on the following day. Mice were sacrificed 12 days (flow cytometry for B cells) or 13 days (single-cell RNA sequencing and flow cytometry for T cells) after tumor inoculation, and tumor samples were collected.
1-2. 종양 검체 가공1-2. Tumor specimen processing
5마리의 마우스에서 모은 종양 이식편을 잘게 자르고 Tumor Dissociation Kit, mouse (Miltenyi Biotec, Bergisch Gladbach, Germany)의 효소 혼합물(RPMI1640 배지의 효소 D, R 및 A)을 사용하여 37°C에서 40분 동안 해리하였다. 소화된 조직을 70 μm 스트레이너를 통해 여과하여 단일 세포 현탁액을 얻고 RBC 용해 용액(QIAGEN, Hilden, Germany)으로 처리하였다. 제조업체의 지침에 따라 Dead Cell Removal Kit(Miltenyi Biotec)를 사용하여 죽은 세포를 제거하였다.Tumor explants pooled from five mice were minced and dissociated for 40 min at 37°C using an enzyme mixture (enzymes D, R and A in RPMI1640 medium) from the Tumor Dissociation Kit, mouse (Miltenyi Biotec, Bergisch Gladbach, Germany). did. Digested tissue was filtered through a 70 μm strainer to obtain a single cell suspension and treated with RBC lysis solution (QIAGEN, Hilden, Germany). Dead cells were removed using the Dead Cell Removal Kit (Miltenyi Biotec) according to the manufacturer's instructions.
1-3. 단세포 RNA 시퀀싱1-3. Single cell RNA sequencing
원시 시퀀싱 데이터는 Cell Ranger 파이프라인(버전 5.0.0, 10x genomics)에 따라 처리되었으며 마우스 참조 게놈(mm10-2020-A)에 정렬되었다. 대조군 및 치료군의 카운트 행렬은 Seurat 패키지를 사용하여 병합 및 처리되었다. 간단히 말해서, 병합된 데이터를 필터링하여 고유한 기능 수가 200개 미만이거나 미토콘드리아 유전자 수가 50% 초과인 세포를 제거하였다. 필터링된 세포는 LogNormalize 함수를 사용하여 정규화 되었으며 FindVariableFeatures 함수를 사용하여 데이터 세트의 유전자 발현 분포를 반영할 수 있는 대표 유전자를 선별하였다. 데이터 내 세포 주기 관련 유전자를 점수화하여 세포 주기와 관련된 영향을 배제한 후 z-점수로 조정되었다. 배치 효과를 제거하기 위해 하모니 알고리즘을 사용하였다. RunPCA 함수를 사용하여 조정된 데이터에 대해 주성분 분석(PCA)을 수행하였다. UMAP(Uniform Manifold Approximation and Projection)을 사용한 차원 축소 및 클러스터링은 선택한 주성분(PC) 및 해상도(모든 셀, 28 PC 및 해상도=0.6)를 사용하여 RunUMAP, Findneighbors 및 FindClusters 함수로 수행되었다. T 세포 및 B/형질 세포에 대한 서브클러스터링 분석은 각각 20 PC/해상도=0.9 및 21 PC/해상도=0.6으로 수행되었다.Raw sequencing data were processed according to the Cell Ranger pipeline (version 5.0.0, 10x genomics) and aligned to the mouse reference genome (mm10-2020-A). The count matrices of control and treatment groups were merged and processed using the Seurat package. Briefly, the merged data were filtered to remove cells with fewer than 200 unique functions or more than 50% mitochondrial genes. Filtered cells were normalized using the LogNormalize function, and representative genes that could reflect the gene expression distribution of the data set were selected using the FindVariableFeatures function. Cell cycle-related genes in the data were scored to exclude cell cycle-related effects and then adjusted to z-score. The harmony algorithm was used to remove batch effects. Principal component analysis (PCA) was performed on the adjusted data using the RunPCA function. Dimensionality reduction and clustering using Uniform Manifold Approximation and Projection (UMAP) was performed with the RunUMAP, Findneighbors, and FindClusters functions using selected principal components (PCs) and resolution (all cells, 28 PCs, and resolution=0.6). Subclustering analysis for T cells and B/plasma cells was performed with 20 PCs/resolution=0.9 and 21 PCs/resolution=0.6, respectively.
1-4. BCR 분석1-4. BCR analysis
항-CTLA4 항체 처리 그룹의 BCR V(D)J FASTQ 파일은 콘티그(contig)에 주석을 달고 클론을 생성하기 위해 cellranger 다중 파이프라인에 따라 처리되었다. 중쇄 및 경쇄를 모두 포함하는 클론을 클론 파일의 CDR3 아미노산 서열로부터 추출하였다. 그런 다음 전장 및 생산 사슬을 포함하는 콘티그를 식별하였다. 필터링 후 여러 B/형질 세포 클러스터가 공유하는 클론을 선택하였다. 선택된 BCR 서열은 Loupe V(D)J Browser(10x genomics)에서 검증되었다.The BCR V(D)J FASTQ files from the anti-CTLA4 antibody treatment group were processed according to the cellranger multiplex pipeline to annotate contigs and generate clones. Clones containing both heavy and light chains were extracted from the CDR3 amino acid sequence of the clone file. Contigs containing the full length and production chain were then identified. After filtering, clones shared by multiple B/plasma cell clusters were selected. Selected BCR sequences were verified in Loupe V(D)J Browser (10x genomics).
그 결과, CT-26 세포를 유의하게 인식하는 2개 클론 (클론 6-B, 클론 13)을 선별하였다. As a result, two clones (clone 6-B, clone 13) that significantly recognized CT-26 cells were selected.
실시예 2. 항원 반응성이 검증된 재조합 항체 단백질 서열Example 2. Recombinant antibody protein sequence with verified antigen reactivity
2-1. 재조합 항체 생성2-1. Recombinant antibody production
가변(V) 영역 서열은 상기에 기술된 바와 같이 BCR 시퀀싱 데이터로부터 얻었다. Loupe V(D)J Browser(10x genomics)에서 뉴클레오티드 변이(클론 6-B 및 클론 13)로 구성된 공통 서열이 리드(read) 수에 대해 우선 순위로 선택되었다(서포팅 리드 카운트>10,000). 구성된 공통 가변 영역 서열은 카파 경쇄를 갖는 뮤린 IgG2a 이소형 형태의 항체 생산을 위해 Genscript(New Jersey, U.S; #SC1796, SC1797)로 보내졌다. 재조합 항체는 TurboCHOTM 발현 시스템을 사용하여 생산되었다.Variable (V) region sequences were obtained from BCR sequencing data as described above. In the Loupe V(D)J Browser (10x genomics), consensus sequences consisting of nucleotide variants (clone 6-B and clone 13) were selected in priority order for read count (supporting read count >10,000). The constructed consensus variable region sequence was sent to Genscript (New Jersey, US; #SC1796, SC1797) for antibody production in the murine IgG2a isotype with kappa light chain. Recombinant antibodies were produced using the TurboCHO ™ expression system.
본 발명에서의 재조합 항체 (클론 6-B, 클론 13)의 서열 정보는 다음과 같다. The sequence information of the recombinant antibody (clone 6-B, clone 13) in the present invention is as follows.
(서열번호 1)NYGMN
(SEQ ID NO: 1)
(서열번호 2)WINTYTGEPTYADDFKG
(SEQ ID NO: 2)
(서열번호 3)SNYYGSSWYFDV
(SEQ ID NO: 3)
(서열번호 4)KSSQSLLDSDGKTYLN
(SEQ ID NO: 4)
(서열번호 5)LVSKLDS
(SEQ ID NO: 5)
(서열번호 6)WQGTHFPWT
(SEQ ID NO: 6)
(서열번호 7)DYYMH
(SEQ ID NO: 7)
(서열번호 8)WIDPENGDTEYAPKFQG
(SEQ ID NO: 8)
(서열번호 9)KSSQSLLDSDGKTYLN
(SEQ ID NO: 9)
(서열번호 10)LVSKLDS
(SEQ ID NO: 10)
(서열번호 11)WQGTHFPYT
(SEQ ID NO: 11)
(서열번호 12)MGWSCIILFLVATATGVHSQIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLKWMGWINTYTGEPTYADDFKGRFAFSLETSASTAYLQINNLKNEDMATYFCARSNYYGSSWYFDVWGAGTTVTVSS
(SEQ ID NO: 12)
(서열번호 13)MGWSCIILFLVATATGVHSDVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPWTFGGGTKLEIK
(SEQ ID NO: 13)
(서열번호 14)MGWSCIILFLVATATGVHSEVQLQQSGAELVRSGASVKLSCTASGFNIKDYYMHWVKQRPEQGLEWIGWIDPENGDTEYAPKFQGKATMTADTSSNTAYLQLSSLTSEDTAVYYCNVDYWGQGTTLTVSS
(SEQ ID NO: 14)
(서열번호 15)MGWSCIILFLVATATGVHSDVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPYTFGGGTKLEIK
(SEQ ID NO: 15)
(서열번호 16)MGWSCIILFLVATATGVHSQIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLKWMGWINTYTGEPTYADDFKGRFAFSLETSASTAYLQINNLKNEDMATYFCARSNYYGSSWYFDVWGAGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLY TLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMMTKKQVTLTCMVTDFMPEDIYVEWT NNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
(SEQ ID NO: 16)
(서열번호 17)MGWSCIILFLVATATGVHSDVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT LTKDEYERHNSYTCEATHKTSTSSPIVKSFNRNEC
(SEQ ID NO: 17)
(서열번호 18)MGWSCIILFLVATATGVHSEVQLQQSGAELVRSGASVKLSCTASGFNIKDYYMHWVKQRPEQGLEWIGWIDPENGDTEYAPKFQGKATMTADTSSNTAYLQLSSLTSEDTAVYYCNVDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLS SSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMMTKKQVTLTCMVTDFMPEDIYVEWTNNNGK TELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
(SEQ ID NO: 18)
(서열번호 19)MGWSCIILFLVATATGVHSDVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT LTKDEYERHNSYTCEATHKTSTSSPIVKSFNRNEC
(SEQ ID NO: 19)
(서열번호 20)ATGGGCTGGTCCTGCATCATCCTGTTCCTGGTGGCCACCGCTACCGGAGTCCACTCTCAAATCCAACTAGTGCAAAGTGGTCCAGAACTGAAAAAACCCGGAGAGACAGTGAAGATCTCCTGCAAGGCCTCTGGCTACACCTTCACCAATTACGGCATGAACTGGGTCAAGCAGGCTCCTGGCAAGGGCCTGAAGTGGATGGGCTGGATCAACACCTATACCGGCGAGCCTACCTACGCCGATGACTTCAAGGGCAGATTCGCC TTCTCCCTGGAAACCTCTGCTTCTACCGCCTACCTGCAGATCAACAACCTGAAGAACGAGGACATGGCCACCTACTTTTGTGCTCGGTCCAACTACTACGGATCCTCTTGGTACTTCGACGTGTGGGGG CGCTGGCACCACAGTGACCGTGTCCAGCGCCAAGACAACAGCTCCTTCCGTGTACCCTCTGGCCCCCGTGTGCGGCGACACCACCGGCTCTTCTGTGACCCTGGGCTGCCTGGTGAAGGGCTACTTTC CTGAGCCCGTCACCCTGACCTGGAACTCCGGATCTCTGTCCTCTGGCGTGCACACCTTCCCTGCCGTGCTGCAGTCCGATCTGTACACCCTGTCCTCCAGCGTGACCGTGACCTCTTCTACATGGCCTTCCCAGTCTATCACCTGCAACGTGGCTCATCCTGCCAGCTCTACCAAAGTGGACAAGAAGATCGAGCCTAGAGGCCCTACAATCAAGCCCTGTCCTCCTTGCAAGTGCCCTGCTCCTAACCT GCTGGGAGGCCCCTCTGTGTTCATCTTCCCTCCTAAGATCAAGGACGTGCTGATGATCTCCCTGTCTCCTATCGTGACCTGTGTGGTGGTCGATGTGTCTGAGGACGACCCTGACGTGCAGATCTCTTGGTTCGTGAACAATGTGGAAGTGCACACCGCCCAGACCCAGACCCACAGAGAGGACTACAACAGCACACTGAGAGTGGTGTCCGCCCTGCCTATCCAGCACCAGGACTGGATGTCCGGCAAAGAG TTCAAGTGCAAGGTGAACAACAAGGACCTGCCCGCCCCCATCGAGCGGACCATCTCCAAGCCTAAAGGCTCCGTGCGGGCCCCTCAAGTGTACGTGCTGCCTCCACCAGAGGAAGAGATGACCAAGAAGCA GGTGACACTGACCTGCATGGTGACCGACTTCATGCCTGAGGATATCTACGTGGAATGGACCAACAACGGCAAGACCGAGCTGAACTACAAGAACACCGAGCCCGTTCTGGACTCCGACGGCTCTTACTT GTACTCCAAGCTGAGAGTGGAGAAGAAAAACTGGGTGGAACGGAACTCCTACTCTTGCTCCGTCGTGCACGAGGGCCTGCACAACCACCACACCACCAAGTCCTTCTCCAGAACCCCTGGCAAG
(SEQ ID NO: 20)
(서열번호 21)
(SEQ ID NO: 21)
(서열번호 22)
(SEQ ID NO: 22)
(서열번호 23)ATGGGCTGGTCCTGCATCATCCTGTTCCTGGTGGCCACCGCTACCGGCGTGCACTCCGATGTGGTGATGACTCAAACTCCACTAACTCTGTCCGTGACCATCGGCCAGCCTGCTTCTATCTCCTGCAAGTCCAGCCAGTCTCTGCTGGACTCCGACGGCAAGACCTATCTGAACTGGCTGCTGCAGCGGCCTGGCCAATCTCCTAAGCGGCTGATCTACCTGGTGTCCAAGCTGGATAGCGGAGTCCCAGATAGATTTA CAGGCTCCGGCTCTGGCACCGACTTCACCCTGAAGATCTCTAGAGTGGAAGCCGAGGACCTGGGCGTGTACTACTGTTGGCAGGGCACACACTTCCCCTACACCTTCGGCGGAGGCACCAAGCTCG AGATCAAAAGAGCCGACGCCGCTCCTACCGTGTCCATCTTCCCTCCTTCCTCCGAGCAGCTGACATCTGGCGGCGCCTCCGTGGTGTGCTTCCTGAACAACTTCTACCCTAAGGACATCAACGTGA AGTGGAAGATCGACGGCTCTGAGAGACAGAACGGCGTGCTGAACTCTTGGACCGACCAGGACTCCAAGGACTCTACCTACTCCATGTCCTCTACACTGACCCTGACCAAGGACGAGTACGAGCGGCACAACTCCTACACCTGCGAGGCCACCCACAAGACCTCCACCTCTCCTATCGTGAAGTCCTTCAACCGGAACGAGTGC
(SEQ ID NO: 23)
실시예 3. CT-26 세포와의 결합 반응성 시험Example 3. Binding reactivity test with CT-26 cells
3-1. FACS 데이터3-1. FACS data
CT-26 세포주 및 CT-26 종양 이식에서 분리된 세포를 사용하여 종양 세포 반응성을 입증하였다. 세포를 TruStain FcX™ 항-마우스 CD16/32 항체(BioLegend)와 함께 배양하여 Fc 수용체에 대한 면역글로불린의 비특이적 결합을 차단하였다. 그 다음, 2개의 재조합 항체(클론 6-B, 클론 13) 및 Embigin 항체(Invitrogen; 클론 G7.43.1)를 최종 2ug/100ul 농도로 첨가하였다. 이식을 위해 항-CD45-APC(Biolegend; 클론 30-F11)를 추가하여 마우스 면역 세포를 표시하였다. 세포를 4℃에서 40분 동안 인큐베이션한 후 세척하고 PE 또는 APC가 접합된 2차 항체(Biolegend)와 함께 4℃에서 30분 동안 인큐베이션하였다. 염색된 세포는 셀 스트레이너에 통과시킨 후 FACSCanto II(BD Biosciences)에서 산란광 및 형광 신호를 측정하고 FlowJo v.10.8.1을 사용하여 분석하였다.Tumor cell reactivity was demonstrated using the CT-26 cell line and cells isolated from CT-26 tumor explants. Cells were incubated with TruStain FcX™ anti-mouse CD16/32 antibody (BioLegend) to block non-specific binding of immunoglobulins to Fc receptors. Next, two recombinant antibodies (clone 6-B, clone 13) and an Embigin antibody (Invitrogen; clone G7.43.1) were added to a final concentration of 2ug/100ul. For transplantation, anti-CD45-APC (Biolegend; clone 30-F11) was added to mark mouse immune cells. Cells were incubated at 4°C for 40 minutes, washed, and incubated with PE- or APC-conjugated secondary antibody (Biolegend) for 30 minutes at 4°C. Stained cells were passed through a cell strainer, and then scattered light and fluorescence signals were measured on a FACSCanto II (BD Biosciences) and analyzed using FlowJo v.10.8.1.
그 결과, 음성 대조군에 비해 클론 6-B 및 클론 13의 높은 항원-항체 친화도를 확인하였다 (도 3). 도 3의 상단 점도표는 CT-26 세포주에서 확인된 항체 결합능 결과이고, 도 3의 하단 히스토그램은 이식된 원발성 종양세포에서 재조합 항체와의 결합을 나타내는 결과이다. 원발성 종양세포는 종양조직 전체를 해리하여 얻은 단일세포 현탁액이 사용되었으므로, 기존에 CT-26 세포에서 발현이 높다고 알려진 gp70을 발현하면서 조혈모세포의 양성 표면 마커인 CD45를 발현하지 않는 세포를 대상으로 항체 결합능을 확인하였다.As a result, higher antigen-antibody affinity of clone 6-B and clone 13 was confirmed compared to the negative control (Figure 3). The upper dot plot in Figure 3 shows the antibody binding ability results confirmed in the CT-26 cell line, and the lower histogram in Figure 3 shows the results showing binding to the recombinant antibody in transplanted primary tumor cells. Since the primary tumor cells were single-cell suspensions obtained by dissociating the entire tumor tissue, the antibody was targeted at cells that express gp70, which is known to be highly expressed in CT-26 cells, but do not express CD45, a positive surface marker of hematopoietic stem cells. Binding ability was confirmed.
3-2. 웨스턴 블롯3-2. western blot
C: CT-26 세포주 C: CT-26 cell line
T: 이식된 원발성 종양 세포(동계 마우스 모델에 이식된 종양 조직의 세포).T: Transplanted primary tumor cells (cells from tumor tissue transplanted into a syngeneic mouse model).
포스파타제 억제제 및 프로테아제 억제제와 함께 냉각된 RIPA 완충액(Biosesang #RC2002-050-00)에 의해 전체 단백질을 추출하였다. 용해된 현탁액을 1ml 주사기에 부착된 바늘을 통해 5~10회 통과시켰다. 4℃에서 20분 동안 16000G에서 원심분리한 후 상층액을 신선한 튜브에 수집하고 얼음 위에 두었다. SDS-PAGE 실행 샘플 버퍼를 추가하고 단백질을 환원 및 변성시키기 위해 95℃에서 5분 동안 가열하였다. 단백질을 4-15% 소듐 도데실 설페이트(SDS)-폴리아크릴아미드 겔(Bio-Rad, Marnes-La-Coquette, France #BR4561084)에서 분자량 마커와 함께 분리한 다음 40V에서 3시간동안 멤브레인(Bio-Rad #1620115)으로 이동시켰다. 이동한 단백질을 재조합 항체(클론 6-B; 클론 13)로 탐침한 다음 HRP가 결합된 2차 항체로 면역반응성 단백질을 검출하였다. 항원-항체 검출을 위해 강화된 화학발광(ECL) 블랏팅 분석 시스템(Thermo Scientific, #34095)과 LAS4000 생체분자 이미징 시스템(GE Healthcare)을 사용하였다.Total proteins were extracted by chilled RIPA buffer (Biosesang #RC2002-050-00) with phosphatase inhibitors and protease inhibitors. The dissolved suspension was passed 5 to 10 times through a needle attached to a 1 ml syringe. After centrifugation at 16000 G for 20 min at 4°C, the supernatant was collected in a fresh tube and placed on ice. SDS-PAGE run sample buffer was added and heated at 95°C for 5 min to reduce and denature the proteins. Proteins were separated along with molecular weight markers on a 4-15% sodium dodecyl sulfate (SDS)-polyacrylamide gel (Bio-Rad, Marnes-La-Coquette, France #BR4561084) and then incubated on a membrane (Bio-Rad) for 3 hours at 40 V. It was moved to Rad #1620115). The migrated protein was probed with a recombinant antibody (clone 6-B; clone 13), and then the immunoreactive protein was detected with an HRP-conjugated secondary antibody. For antigen-antibody detection, an enhanced chemiluminescence (ECL) blotting analysis system (Thermo Scientific, #34095) and a LAS4000 biomolecular imaging system (GE Healthcare) were used.
그 결과, 음성 대조군에 비해 클론 6-B 및 클론 13에서 CT-26 세포 단백질 항원과의 항체 결합 친화력을 높게 확인하였다 (도 4). As a result, the antibody binding affinity to the CT-26 cell protein antigen was confirmed to be higher in clone 6-B and clone 13 compared to the negative control group (Figure 4).
본 발명은 상술한 실시예 및 실험예를 참고로 설명되었으나 이는 예시적인 것에 불과하며, 당해 기술분야에서 통상의 지식을 가진 자라면 이로부터 다양한 변형 및 균등한 다른 실시예 및 실험예가 가능하다는 점을 이해할 것이다. 따라서 본 발명의 진정한 기술적 보호 범위는 첨부된 특허청구범위의 기술적 사상에 의하여 정해져야 할 것이다.The present invention has been described with reference to the above-described examples and experimental examples, but these are merely illustrative, and those skilled in the art will recognize that various modifications and equivalent other examples and experimental examples are possible therefrom. You will understand. Therefore, the true scope of technical protection of the present invention should be determined by the technical spirit of the attached patent claims.
서열목록 전자파일 첨부Sequence list electronic file attached
Claims (20)
서열번호 4, 서열번호 5 및 서열번호 6의 아미노산 서열로 각각 표시되는 경쇄 CDR1, CDR2 및 CDR3을 포함하는 경쇄 가변 영역을 포함하는,
CT-26 세포 검출용 항체 또는 이의 항원 결합 단편.A heavy chain variable region comprising heavy chain complementarity determining region 1 (CDR1), CDR2, and CDR3 represented by the amino acid sequences of SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3, respectively; and
Comprising a light chain variable region comprising light chain CDR1, CDR2, and CDR3 represented by the amino acid sequences of SEQ ID NO: 4, SEQ ID NO: 5, and SEQ ID NO: 6, respectively,
Antibody or antigen-binding fragment thereof for detecting CT-26 cells.
서열번호 9, 서열번호 10 및 서열번호 11의 아미노산 서열로 각각 표시되는 경쇄 CDR1, CDR2 및 CDR3을 포함하는 경쇄 가변 영역을 포함하는,
CT-26 세포 검출용 항체 또는 이의 항원 결합 단편.A heavy chain variable region comprising heavy chain CDR1, CDR2, and CDR3 represented by the amino acid sequences of SEQ ID NO: 7, SEQ ID NO: 8, and DY, respectively; and
Comprising a light chain variable region comprising light chain CDR1, CDR2, and CDR3 represented by the amino acid sequences of SEQ ID NO: 9, SEQ ID NO: 10, and SEQ ID NO: 11, respectively,
Antibody or antigen-binding fragment thereof for detecting CT-26 cells.
상기 항체는 서열번호 12로 표시되는 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 13으로 표시되는 아미노산 서열을 포함하는 경쇄 가변 영역을 포함하는,
CT-26 세포 검출용 항체 또는 이의 항원 결합 단편.According to paragraph 1,
The antibody includes a heavy chain variable region containing the amino acid sequence shown in SEQ ID NO: 12 and a light chain variable region containing the amino acid sequence shown in SEQ ID NO: 13,
Antibody or antigen-binding fragment thereof for detecting CT-26 cells.
상기 항체는 서열번호 14로 표시되는 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 15로 표시되는 아미노산 서열을 포함하는 경쇄 가변 영역을 포함하는,
CT-26 세포 검출용 항체 또는 이의 항원 결합 단편.According to paragraph 2,
The antibody includes a heavy chain variable region containing the amino acid sequence shown in SEQ ID NO: 14 and a light chain variable region containing the amino acid sequence shown in SEQ ID NO: 15,
Antibody or antigen-binding fragment thereof for detecting CT-26 cells.
상기 항체는 서열번호 16으로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 17로 표시되는 아미노산 서열을 포함하는 경쇄를 포함하는,
CT-26 세포 검출용 항체 또는 이의 항원 결합 단편.According to paragraph 1,
The antibody includes a heavy chain containing the amino acid sequence shown in SEQ ID NO: 16 and a light chain containing the amino acid sequence shown in SEQ ID NO: 17.
Antibody or antigen-binding fragment thereof for detecting CT-26 cells.
상기 항체는 서열번호 18로 표시되는 아미노산 서열을 포함하는 중쇄 및 서열번호 19로 표시되는 아미노산 서열을 포함하는 경쇄를 포함하는,
CT-26 세포 검출용 항체 또는 이의 항원 결합 단편.According to paragraph 2,
The antibody comprises a heavy chain containing the amino acid sequence shown in SEQ ID NO: 18 and a light chain containing the amino acid sequence shown in SEQ ID NO: 19,
Antibody or antigen-binding fragment thereof for detecting CT-26 cells.
상기 항체는 IgG2a 중쇄 및 카파(κ) 경쇄를 포함하는 것을 특징으로 하는,
CT-26 세포 검출용 항체 또는 이의 항원 결합 단편.According to any one of claims 1 to 6,
The antibody is characterized in that it comprises an IgG2a heavy chain and a kappa (κ) light chain,
Antibody or antigen-binding fragment thereof for detecting CT-26 cells.
상기 항원 결합 단편은 Fab (fragment antigen binding), Fab', F(ab')2, Fv (variable fragment), dsFv (disulfice-stabilized Fv fragments), scFv (single-chain Fv), diabody, Fd, 및 Fd'로 이루어진 군으로부터 선택되는,
CT-26 세포 검출용 항체 또는 이의 항원 결합 단편.According to any one of claims 1 to 6,
The antigen-binding fragments include Fab (fragment antigen binding), Fab', F(ab')2, Fv (variable fragment), dsFv (disulfice-stabilized Fv fragments), scFv (single-chain Fv), diabody, Fd, and selected from the group consisting of Fd',
Antibody or antigen-binding fragment thereof for detecting CT-26 cells.
CT-26 세포 검출용 조성물.Comprising the antibody or antigen-binding fragment thereof of any one of claims 1 to 6,
Composition for detecting CT-26 cells.
CT-26 세포 검출용 키트.
Comprising the composition of claim 19,
Kit for CT-26 cell detection.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020230006866A KR20240115357A (en) | 2023-01-17 | 2023-01-17 | Novel CT-26 tumor cell specific antibody |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020230006866A KR20240115357A (en) | 2023-01-17 | 2023-01-17 | Novel CT-26 tumor cell specific antibody |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| KR20240115357A true KR20240115357A (en) | 2024-07-25 |
Family
ID=92173190
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| KR1020230006866A KR20240115357A (en) | 2023-01-17 | 2023-01-17 | Novel CT-26 tumor cell specific antibody |
Country Status (1)
| Country | Link |
|---|---|
| KR (1) | KR20240115357A (en) |
-
2023
- 2023-01-17 KR KR1020230006866A patent/KR20240115357A/en unknown
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN105579471B (en) | Antibodies that bind human programmed death ligand 1(PD-L1) | |
| JP5631733B2 (en) | Anti-EpCAM antibodies and uses thereof | |
| EP2363471B1 (en) | Immunoassay method for human cxcl1 protein | |
| CN113527489A (en) | anti-CD 73 antibodies and uses thereof | |
| US20140243265A1 (en) | Antibodies to modified human igf-1/e peptides | |
| US11906520B2 (en) | Composition and methods for detecting cancer | |
| Chang et al. | [27] Monoclonal antibodies to oncoproteins | |
| WO2006085441A1 (en) | Antibody for assay of adamts13 activity and method of activity assay | |
| KR20240115357A (en) | Novel CT-26 tumor cell specific antibody | |
| CN110579610A (en) | Kit for detecting V-domain immunosuppressive factor activated by T cells | |
| JP3888695B2 (en) | ANTIBODY TO HUMAN LECT2, CELL PRODUCING THE SAME, MEASUREMENT METHOD AND MEASUREMENT KIT | |
| CN111434686A (en) | Anti-human PBX1 monoclonal antibody, preparation method thereof and application thereof in clinical diagnosis of recurrent abortion | |
| CN112679608B (en) | anti-FGF 19 antibody and application thereof | |
| CN114213542B (en) | CPS-I antibodies and uses thereof | |
| CN112250767B (en) | Antibody combined with Strep-Tag II label and application thereof | |
| JP3472664B2 (en) | Anti-fibroblast growth factor 5 monoclonal antibody | |
| EP2957571A1 (en) | Monoclonal Anti-pVHL antibodies and uses thereof | |
| KR100996486B1 (en) | Monoclonal antibody against human MUDENG protein | |
| Ishikawa et al. | A Novel Anti-CD44 Variant 10 Monoclonal Antibody is Useful for Immunohistochemical Analysis against Oral Squamous cell carcinomas | |
| JP3522877B2 (en) | Anti-tyrosinase monoclonal antibody F (ab ') 2 fragment | |
| CN115825415A (en) | Blocking agent, in-vitro immunodiagnosis product and application | |
| JPH1084958A (en) | Monoclonal antibody of anti-fibroblast cell growth factor 6 | |
| CN115433277A (en) | Preparation and application of anti-CD 38 rabbit recombinant monoclonal antibody | |
| CN118598997A (en) | Anti-B7-H3 antibody and anti-tumor application thereof | |
| CN118791620A (en) | Anti-glycogen phosphorylase GPBB monoclonal antibody and application thereof |