KR20240019215A - Cosmetic composition for skin moisturizing and skin soothing comprising an improved cell-permeable nuclear transport inhibitor - Google Patents

Cosmetic composition for skin moisturizing and skin soothing comprising an improved cell-permeable nuclear transport inhibitor Download PDF

Info

Publication number
KR20240019215A
KR20240019215A KR1020247000047A KR20247000047A KR20240019215A KR 20240019215 A KR20240019215 A KR 20240019215A KR 1020247000047 A KR1020247000047 A KR 1020247000047A KR 20247000047 A KR20247000047 A KR 20247000047A KR 20240019215 A KR20240019215 A KR 20240019215A
Authority
KR
South Korea
Prior art keywords
skin
cosmetic composition
icp
lotion
present
Prior art date
Application number
KR1020247000047A
Other languages
Korean (ko)
Inventor
조대웅
Original Assignee
(주)셀리버리
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by (주)셀리버리 filed Critical (주)셀리버리
Publication of KR20240019215A publication Critical patent/KR20240019215A/en

Links

Images

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K8/00Cosmetics or similar toiletry preparations
    • A61K8/18Cosmetics or similar toiletry preparations characterised by the composition
    • A61K8/30Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
    • A61K8/64Proteins; Peptides; Derivatives or degradation products thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K36/00Medicinal preparations of undetermined constitution containing material from algae, lichens, fungi or plants, or derivatives thereof, e.g. traditional herbal medicines
    • A61K36/16Ginkgophyta, e.g. Ginkgoaceae (Ginkgo family)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61QSPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q19/00Preparations for care of the skin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61QSPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q19/00Preparations for care of the skin
    • A61Q19/005Preparations for sensitive skin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61QSPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q19/00Preparations for care of the skin
    • A61Q19/007Preparations for dry skin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61QSPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q19/00Preparations for care of the skin
    • A61Q19/08Anti-ageing preparations
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2800/00Properties of cosmetic compositions or active ingredients thereof or formulation aids used therein and process related aspects
    • A61K2800/40Chemical, physico-chemical or functional or structural properties of particular ingredients
    • A61K2800/52Stabilizers
    • A61K2800/522Antioxidants; Radical scavengers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2800/00Properties of cosmetic compositions or active ingredients thereof or formulation aids used therein and process related aspects
    • A61K2800/74Biological properties of particular ingredients
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2800/00Properties of cosmetic compositions or active ingredients thereof or formulation aids used therein and process related aspects
    • A61K2800/74Biological properties of particular ingredients
    • A61K2800/75Anti-irritant
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/18Antioxidants, e.g. antiradicals

Abstract

본 발명은 개선된 세포 투과성 핵 수송 억제제(improved cell-permeable nuclear import inhibitor, iCP-NI) 펩티드를 포함하는 조성물에 관한 것으로, 보다 상세하게는 피부 보습, 피부 가려움증 개선 및 홍반 완화 효과를 갖는 서열번호 1을 유효성분으로 포함하는 화장료 조성물 또는 피부 외용제에 관한 것이다. The present invention relates to a composition comprising an improved cell-permeable nuclear import inhibitor (iCP-NI) peptide, and more specifically, to a composition having the effects of skin moisturizing, skin itching improvement, and erythema alleviation. It relates to a cosmetic composition or external skin preparation containing 1 as an active ingredient.

Description

개선된 세포 투과성 핵 수송 억제제를 포함하는 피부 보습 및 피부 진정용 화장료 조성물Cosmetic composition for skin moisturizing and skin soothing comprising an improved cell-permeable nuclear transport inhibitor

관련 출원에 대한 상호 참조Cross-reference to related applications

본 출원은 2021년 8월 13일에 출원된 미국 가특허출원 일련번호 63/232,766의 혜택과 우선권을 주장하며, 그 전체가 여기에 참조로 포함된다.This application claims the benefit and priority of U.S. Provisional Patent Application Serial No. 63/232,766, filed August 13, 2021, which is incorporated herein by reference in its entirety.

본 발명은 개선된 세포 투과성 핵 수송 억제제(improved cell-permeable nuclear import inhibitor, iCP-NI) 펩티드를 포함하는 조성물에 관한 것으로, 보다 상세하게는 피부 보습, 피부 가려움증 개선 및 홍반 완화 효과를 갖는 서열번호 1을 유효성분으로 포함하는 화장료 조성물 또는 피부 외용제에 관한 것이다. The present invention relates to a composition comprising an improved cell-permeable nuclear import inhibitor (iCP-NI) peptide, and more specifically, to a composition having the effects of skin moisturizing, skin itching improvement, and erythema alleviation. It relates to a cosmetic composition or external skin preparation containing 1 as an active ingredient.

피부는 표피, 진피, 피하지방 조직의 3개 층으로 크게 구분되며, 인체를 외부 환경으로부터의 물리적, 화학적인 자극으로부터 보호해 주는 기능을 한다. 특히 피부는 인체가 갖고 있는 약 65~70%의 수분, 즉 인체에 필요한 각종 생리 활성 물질을 운반하며, 피부가 부드럽고 촉촉한 상태를 유지할 수 있도록 도와주는 역할을 한다. 또한, 표피는 외부로부터 각질층, 과립층, 유극층, 기저층의 순서로 구분되는데, 각질층의 세포들은 벽돌과 같은 역할을 하고, 각질세포 사이의 세포간 지질들은 모르타르와 같은 역할로 작용하여 피부 장벽을 구성한다(J. Invest. Dermatol. 80(Suppl.), 44-49. 1983). 표피의 각질층은 약 10~20%의 수분을 함유하며 인체의 최외각에 존재함으로써 체외로의 수분 증발을 억제하는 한편 외부로부터의 물질 과잉 침투를 차단한다. 이들 각질층 표면은 피지선에서 나온 피지와 땀샘에서 나온 땀으로 만들어진 얇은 천연 보호막으로 감싸져 있어서 수분의 증발을 예방할 수 있다. 피부의 각질층을 구성하고 있는 세포에는 수용성 성분인 고농도의 자연보습인자(Natural Moisturizing Factor, NMF)가 존재하여 피부가 유연성을 나타내도록 작용함은 물론 적절한 수분을 유지할 수 있도록 돕는데, 예를 들면 아미노산과 같은 물질은 수용성일 뿐만 아니라 효과적으로 수분과 결합하여 피부에서 수분이 건조되는 것을 억제한다(J. Invest. Dermatol. 54, 24-31, 1970).The skin is largely divided into three layers: epidermis, dermis, and subcutaneous fat tissue, and its function is to protect the human body from physical and chemical stimulation from the external environment. In particular, the skin transports about 65 to 70% of the moisture contained in the human body, that is, various physiologically active substances necessary for the human body, and plays a role in helping the skin maintain a soft and moist state. In addition, the epidermis is divided from the outside into the stratum corneum, stratum granulosum, stratum spinosum, and stratum basale. The cells of the stratum corneum act like bricks, and the intercellular lipids between keratinocytes act like mortar, forming a skin barrier. (J. Invest. Dermatol. 80(Suppl.), 44-49. 1983). The stratum corneum of the epidermis contains about 10 to 20% of moisture and is present in the outermost layer of the human body, suppressing moisture evaporation to the outside of the body and blocking excessive penetration of substances from the outside. The surface of these stratum corneum is covered with a thin natural protective film made of sebum from sebaceous glands and sweat from sweat glands, preventing evaporation of moisture. The cells that make up the stratum corneum of the skin contain a high concentration of Natural Moisturizing Factor (NMF), a water-soluble ingredient that not only acts to make the skin more flexible but also helps it maintain adequate moisture. For example, amino acids and The same substance is not only water-soluble, but also effectively binds moisture and prevents moisture from drying out of the skin (J. Invest. Dermatol. 54, 24-31, 1970).

그러나, 환경의 변화 또는 생활 패턴의 변화에 따른 인위적인 온도 조절, 사회 생활에서 발생되는 각종 스트레스와 환경오염으로 인한 피부 스트레스, 화장 습관에 따른 잦은 세안 및 연령 증가에 따른 자연적인 피부 노화 등의 여러 가지 원인으로 인하여 각질층의 수분이 감소하여 피부가 건조해지고 표면이 거칠게 되며 피부가 윤기를 잃어 칙칙하게 보이는 등의 현상이 발생하기 때문에 피부 보습제의 필요가 증가하고 있다.However, various factors such as artificial temperature control due to changes in the environment or lifestyle patterns, skin stress due to various stresses and environmental pollution arising from social life, frequent face washing due to makeup habits, and natural skin aging due to age increase, etc. Due to this, the moisture in the stratum corneum decreases, causing the skin to dry out, the surface to become rough, the skin to lose its luster and appear dull, etc., so the need for skin moisturizers is increasing.

한편, 이러한 피부 보습을 유지하기 위한 방안으로 수분 증발을 방지하는 폐쇄 보습제(occlusive moisturizer)를 사용하여 각질층에서의 수분 보유를 증가시키는 방식이 가장 널리 사용되고 있으나, 이들은 피부에 도포 시 폴리올의 고유 점성과 물성으로 인하여 끈적임이 심하거나 눅진한 느낌이 드는 단점이 있으며, 이외에도 종래 사용되고 있는 피부 보습제는 피부 트러블 등이 유발될 수 있어 피부 안전성에도 문제가 있다. 따라서 보다 안정적이면서도 우수한 보습 효과를 갖는 피부 보습제의 개발이 필요한 실정이다.Meanwhile, as a way to maintain skin moisture, the most widely used method is to increase moisture retention in the stratum corneum using occlusive moisturizers that prevent moisture evaporation. However, these methods have Due to its physical properties, it has the disadvantage of being very sticky or feeling damp, and in addition, conventionally used skin moisturizers can cause skin problems, so there is a problem with skin safety. Therefore, there is a need to develop a skin moisturizer that is more stable and has an excellent moisturizing effect.

본 발명자들은 위와 같은 배경 하에서 세포 투과성 핵 유입 억제제(CP-NI, cSN50.1 펩티드)에 TSDT(therapeuticmolecule systemic delivery technology)를 기반으로 하는 aMTD(advanced macromolecule transduction domain)을 도입해 용해성과 안정성이 향상된 펩티드로서 개선된 세포 투과성 핵 수송 억제제(improved cell-permeable nuclear import inhibitor, iCP-NI)를 제조하였으며, 상기 iCP-NI는 생체 적합성이 뛰어날 뿐만 아니라, 피부 보습 효과, 가려움증 개선 및 홍반 완화 효과가 있음을 확인하고, 본 발명을 완성하기에 이르렀다. Under the above background, the present inventors introduced aMTD (advanced macromolecule transduction domain) based on TSDT (therapeutic molecule systemic delivery technology) into a cell-permeable nuclear import inhibitor (CP-NI, cSN50.1 peptide) to develop a peptide with improved solubility and stability. An improved cell-permeable nuclear import inhibitor (iCP-NI) was manufactured, and the iCP-NI not only has excellent biocompatibility, but also has a skin moisturizing effect, itching improvement, and erythema alleviation effect. After confirmation, the present invention was completed.

본 발명은 서열번호 1로 표시되는 아미노산 서열로 이루어진 개선된 세포 투과성 핵 수송 억제제(improved cell-permeable nuclear import inhibitor, iCP-NI) 펩티드를 유효성분으로 포함하는 피부 보습 및 피부 진정용 화장료 조성물을 제공하는 것을 목적으로 한다. The present invention provides a skin moisturizing and skin soothing cosmetic composition containing an improved cell-permeable nuclear import inhibitor (iCP-NI) peptide consisting of the amino acid sequence shown in SEQ ID NO: 1 as an active ingredient. The purpose is to

본 발명에 따른 화장료 조성물에 있어서, 상기 피부 진정은 피부 가려움증 감소, 피부 홍반 감성 및 피부 붉은기 개선을 포함할 수 있다. In the cosmetic composition according to the present invention, the skin soothing may include reducing skin itching, improving skin erythema sensitivity, and skin redness.

본 발명에 따른 화장료 조성물에 있어서, 상기 iCP-NI 펩티드는 화장료 조성물 내 0.001 내지 20 mM의 농도로 함유될 수 있다. In the cosmetic composition according to the present invention, the iCP-NI peptide may be contained at a concentration of 0.001 to 20 mM in the cosmetic composition.

본 발명에 따른 화장료 조성물에 있어서, 상기 화장료 조성물의 제형은 화장수(스킨로션), 스킨소프너, 스킨토너, 아스트린젠트, 로션, 밀크로션, 모이스쳐 로션, 영양 로션, 마사지 크림, 영양 크림, 아이 크림, 모이스쳐 크림, 핸드크림, 파운데이션, 에센스, 영양 에센스, 팩, 비누, 클렌징폼, 클렌징로션, 클렌징크림, 바디로션 및 바디클렌저로 이루어진 군으로부터 하나 또는 그 이상 선택될 수 있다. In the cosmetic composition according to the present invention, the formulation of the cosmetic composition includes lotion (skin lotion), skin softener, skin toner, astringent, lotion, milk lotion, moisture lotion, nutritional lotion, massage cream, nutritional cream, eye cream, and moisture. One or more may be selected from the group consisting of cream, hand cream, foundation, essence, nutritional essence, pack, soap, cleansing foam, cleansing lotion, cleansing cream, body lotion, and body cleanser.

본 발명은 또한 서열번호 1로 표시되는 아미노산 서열로 이루어진 개선된 세포 투과성 핵 수송 억제제(improved cell-permeable nuclear import inhibitor, iCP-NI) 펩티드를 유효성분으로 포함하는 피부 보습 및 피부 진정용 피부 외용제를 제공하는 것을 목적으로 한다. The present invention also provides a skin external agent for moisturizing and soothing skin containing an improved cell-permeable nuclear import inhibitor (iCP-NI) peptide consisting of the amino acid sequence shown in SEQ ID NO: 1 as an active ingredient. The purpose is to provide

본 발명에 따른 피부 외용제에 있어서, 상기 외용제의 제형은 크림, 젤, 패취, 분무제, 연고제, 경고제, 로션제, 리니멘트제, 파스타제 및 카타플라스마제로 이루어진 군으로부터 하나 또는 그 이상 선택될 수 있다. In the skin external preparation according to the present invention, the formulation of the external preparation may be one or more selected from the group consisting of creams, gels, patches, sprays, ointments, warning agents, lotions, liniment agents, pasta agents, and cataplasma agents. there is.

본 발명은 또한 서열번호 1로 표시되는 아미노산 서열로 이루어진 개선된 세포 투과성 핵 수송 억제제(improved cell-permeable nuclear import inhibitor, iCP-NI) 펩티드를 개체에게 도포하는 단계를 포함하는 피부 보습 및 피부 진정 방법을 제공하는 것을 목적으로 한다. The present invention also provides a skin moisturizing and skin soothing method comprising applying to a subject an improved cell-permeable nuclear import inhibitor (iCP-NI) peptide consisting of the amino acid sequence shown in SEQ ID NO: 1. The purpose is to provide.

본 발명에 따른 iCP-NI 펩티드는 생체 적합성이 뛰어날 뿐만 아니라 피부 보습 효과 및 피부 건조에 의한 가려움증을 완화시킬 뿐만 아니라 피부 홍반 완화 등의 피부 미용에 있어서 우수한 효과를 나타내므로 화장료 조성물 또는 피부 외용제로 유효하게 사용될 수 있을 것으로 기대된다. The iCP-NI peptide according to the present invention not only has excellent biocompatibility, but also has a skin moisturizing effect and relieves itching caused by skin dryness, and has excellent skin care effects such as alleviating skin erythema, so it is effective as a cosmetic composition or external skin agent. It is expected that it can be used effectively.

한편, 전술한 바와 같은 효과들에 의해 본 발명의 범위가 제한되는 것은 아니다.Meanwhile, the scope of the present invention is not limited by the effects described above.

도 1은 본 발명에 따른 iCP-NI 펩티드의 생체 적합성을 나타낸다.
도 2는 본 발명에 따른 iCP-NI를 포함하는 화장료 조성물의 홍반 개선 효과를 나타낸다.
도 3은 본 발명에 따른 iCP-NI를 포함하는 화장료 조성물의 피부 붉은기 개선 효과를 나타낸다.
Figure 1 shows the biocompatibility of the iCP-NI peptide according to the present invention.
Figure 2 shows the erythema improvement effect of a cosmetic composition containing iCP-NI according to the present invention.
Figure 3 shows the effect of improving skin redness of a cosmetic composition containing iCP-NI according to the present invention.

발명의 실시를 위한 최선의 형태Best mode for carrying out the invention

이하, 본 발명의 구체적인 실시예에 따른 개선된 세포 투과성 핵 수송 억제제(improved cell-permeable nuclear import inhibitor, iCP-NI) 펩티드를 포함하는 화장료 조성물을 자세히 설명한다. 다만, 이는 예시를 위한 실시예에 불과하며, 본 발명의 범위가 이에 한정되는 것은 아니며, 본 발명의 범위 내에서 다양한 실시예에 대한 변형이 가능함은 당업자에게 자명하다.Hereinafter, a cosmetic composition containing an improved cell-permeable nuclear import inhibitor (iCP-NI) peptide according to a specific embodiment of the present invention will be described in detail. However, this is only an illustrative example, the scope of the present invention is not limited thereto, and it is obvious to those skilled in the art that various modifications to the embodiments are possible within the scope of the present invention.

본 명세서에서 사용된 용어 "포함하다(include)" 또는 "포함하다(comprise)" 는 본 명세서 전체에 걸쳐 달리 언급되지 않는 한 특별한 제한 없이 특정한 구성(또는 요소)를 포함하는 것을 의미하며, 다른 구성(또는 요소)의 추가를 배제하는 것으로 해석될 수 없다.As used herein, the term “include” or “comprise” means including a specific component (or element) without specific limitation, unless otherwise stated throughout the specification, and other components It cannot be interpreted as excluding the addition of (or elements).

본 명세서에서 사용된 용어 "아미노산"은 가장 넓은 의미에서, 자연 발생한 L α-아미노산 또는 이의 잔기 뿐만 아니라 D-아미노산 및 화학적으로 변형된 아미노산을 포함한다. 예를 들어, 아미노산은 전술한 아미노산의 모방체 및 유사체를 포함할 수 있다. 본 개시에서, 모방체 및 유사체는 기능적 등가물을 포함할 수 있다.As used herein, the term “amino acid” in its broadest sense includes naturally occurring L α-amino acids or residues thereof as well as D-amino acids and chemically modified amino acids. For example, amino acids may include mimetics and analogs of the amino acids described above. In the present disclosure, mimetics and analogs may include functional equivalents.

본 명세서에서 사용된 용어 "피부"는 동물의 체표를 덮는 조직을 의미하는 것으로서, 얼굴 또는 바디 등의 체표를 덮는 조직뿐만 아니라, 두피와 모발을 포함하는 최광의의 개념이다.The term “skin” used herein refers to the tissue that covers the body surface of an animal, and is the broadest concept that includes not only the tissue that covers the body surface of the face or body, but also the scalp and hair.

본 명세서에서 사용된 용어 "피부 가려움증"은 피부를 긁거나 문지르고 싶은 욕망을 일으키는 불쾌한 감각을 의미하며, 하나의 예시로서, 피부건조에 의한 가려움증; 두드러기에 의한 가려움증; 벌레물림에 의한 가려움증; 땀띠, 여드름, 짓무름, 동상, 접촉성 피부염, 지루성 피부염 또는 건선 등으로 유발되는 가려움증; 각종 피부질환에 의한 가려움증; 두피 가려움증 등을 포함한다. 그러나, 본 발명에서는 이상에서 열거한 피부 가려움증 이외의 다양한 원인의 피부 가려움증을 배제하는 것이 아님은 물론이다. 본 발명은 당업계에 알려진 모든 가려움증, 예를 들어 피부과적 원인 가려움증, 전신성 원인 가려움증, 신경병증성 원인 가려움증 및 심인성 원인 가려움증 등을 포함한다.As used herein, the term “skin itching” refers to an unpleasant sensation that causes a desire to scratch or rub the skin, and examples include itching caused by dry skin; Itching caused by hives; Itching caused by insect bites; Itching caused by heat rash, acne, ulcers, frostbite, contact dermatitis, seborrheic dermatitis, or psoriasis; Itching due to various skin diseases; Including scalp itching, etc. However, it goes without saying that the present invention does not exclude various causes of skin itching other than the skin itching listed above. The present invention includes all itch known in the art, such as itch of dermatological etiology, itch of systemic etiology, itch of neuropathic etiology and itch of psychogenic etiology.

본 명세서에서 사용된 용어 "피부 보습"은 피부의 수분이 체외로 증발되는 것을 억제하고 외부 물질의 과잉 침투를 차단함으로써, 피부 각질층의 수분을 유지하고 피부가 건조해지거나 표면이 거칠어지는 것을 방지하여, 피부가 부드럽고 촉촉한 상태를 유지할 수 있도록 하는 것 등을 의미한다.The term “skin moisturizing” used in this specification refers to preventing evaporation of moisture from the skin to the outside of the body and blocking excessive penetration of external substances, thereby maintaining moisture in the stratum corneum of the skin and preventing the skin from drying out or the surface from becoming rough. , which means keeping the skin soft and moist.

본 명세서에서 사용된 용어 "피부 진정"은 홍반 또는 자극 받은 피부 부위 등을 완화시키고 가라앉히는 것을 의미한다.The term “skin soothing” used herein means alleviating and soothing erythema or irritated skin areas.

상기 "피부 홍반"이란 피부가 외적/내적 자극으로 인해 피부가 붉게 변하거나 혈관의 비정상적 확장, 또는 피부 조직 등에 피가 고여 발색한 홍반에서 전체, 또는 부분적으로 붉은 색이 띄는 현상을 의미한다. The term “skin erythema” refers to a phenomenon in which the skin turns red due to external/internal stimulation, abnormal expansion of blood vessels, or erythema that develops due to blood pooling in skin tissue, etc., causing the skin to turn completely or partially red.

본 명세서에서 사용된 용어 "개선" 또는 "치료"는 개체에서 피부염 질환의 (a) 발전의 억제 (b) 경감 및 (c) 제거를 의미한다.As used herein, the term “improvement” or “treatment” means (a) inhibiting the development of, (b) alleviating, and (c) eliminating a dermatitis disease in an individual.

본 명세서에서 사용된 용어 "예방"은 질환 또는 질병을 보유하고 있다고 진단된 적은 없으나, 이러한 질환 또는 질병에 걸리기 쉬운 경향이 있는 개체에서 질환 또는 질병의 발생을 억제하는 것을 의미한다.As used herein, the term “prevention” refers to suppressing the occurrence of a disease or disease in an individual who has not been diagnosed as having the disease or disease but is prone to such disease or disease.

본 명세서에서 사용된 용어 "도포"는 어떠한 적절한 방법으로 개체의 피부에 본 발명에 따른 조성물을 접촉시키는 모든 방법을 의미하며, 이를 통해 해당 조성물을 피부 내부로 흡수시키는 것을 목적으로 한다.The term “application” used herein refers to any method of contacting the composition according to the present invention to the skin of an individual by any appropriate method, and the purpose is to allow the composition to be absorbed into the skin.

제1구현예에 따르면, According to the first implementation example,

본 발명은 서열번호 1의 아미노산으로 이루어진 개선된 세포 투과성 핵 수송 억제제(improved cell-permeable nuclear import inhibitor, iCP-NI) 펩티드를 유효성분으로 포함하는 피부 보습 및 피부 진정용 화장료 조성물을 제공한다. The present invention provides a cosmetic composition for moisturizing and soothing skin containing an improved cell-permeable nuclear import inhibitor (iCP-NI) peptide consisting of the amino acid of SEQ ID NO: 1 as an active ingredient.

본 발명에 따른 iCP-NI 펩티드는 화장료 조성물 내 0.01 내지 10000 ppm의 농도로 함유되는 것이 바람직하고, 0.01 내지 1000ppm의 농도로 함유되는 것이 더욱 바람직하나 이에 한정되지 않는다. 상기 펩티드의 농도가 0.01ppm 미만이면 원하는 피부 보습 및 피부 진정효과를 얻기 어렵고, 10000ppm을 초과하면 함유량 증가에 따른 뚜렷한 효과의 증가가 나타나지 않아서 생산 경제성이 떨어지는 문제점이 있다.The iCP-NI peptide according to the present invention is preferably contained in a cosmetic composition at a concentration of 0.01 to 10000 ppm, and more preferably contained at a concentration of 0.01 to 1000 ppm, but is not limited thereto. If the concentration of the peptide is less than 0.01 ppm, it is difficult to obtain the desired skin moisturizing and skin soothing effects, and if it exceeds 10000 ppm, there is no clear increase in effect as the content increases, resulting in low production economics.

본 발명에 따른 iCP-NI 펩티드는 일반적인 화학합성, 예를 들어 고체상 펩티드 합성기술(solid-phase peptide synthesis)에 의해 제조될 수 있고, 상기 펩티드를 코딩하는 핵산을 함유하는 재조합 벡터로 형질전환된 미생물을 배양하여 상기 펩티드를 발현시킨 다음, 통상의 방법으로 정제하여 제조할 수도 있으나, 이에 한정되지 않는다.The iCP-NI peptide according to the present invention can be produced by general chemical synthesis, for example, solid-phase peptide synthesis, and can be produced by a microorganism transformed with a recombinant vector containing a nucleic acid encoding the peptide. The peptide may be expressed by culturing and then purified and manufactured by a conventional method, but the peptide is not limited to this.

본 발명에 따른 화장료 조성물은 상기 펩티드 외에 본 발명이 목적으로 하는 효과를 손상시키지 않는 범위 내에서, 바람직하게는 상기 펩티드의 효과에 상승 효과를 줄 수 있는 다른 성분 등을 추가로 함유할 수 있다. 예를 들면, 본 발명의 화장료 조성물은 피부 보습 및 피부 진정 효과가 알려져 있는 임의의 다른 물질들 뿐만 아니라, 항산화제, 안정화제, 용해화제, 비타민, 안료 및 향료와 같은 통상적인 보조제, 또는 담체를 포함할 수 있다.In addition to the above-mentioned peptide, the cosmetic composition according to the present invention may further contain other ingredients that can preferably have a synergistic effect on the effect of the above-mentioned peptide within a range that does not impair the effect aimed at by the present invention. For example, the cosmetic composition of the present invention contains conventional auxiliaries such as antioxidants, stabilizers, solubilizers, vitamins, pigments and fragrances, or carriers, as well as any other substances known to have skin moisturizing and skin soothing effects. It can be included.

본 발명에 따른 화장료 조성물은 그 제형에 있어서 특별히 한정되지 않고, 본 기술분야에서 통상적으로 제조되는 어떠한 제형으로도 제조될 수 있으며, 예를 들면, 용액, 현탁액, 유탁액, 페이스트, 겔, 크림, 로션, 파우더, 비누, 계면활성제-함유 클렌징, 오일, 분말 파운데이션, 유탁액 파운데이션, 왁스 파운데이션 및 스프레이 등으로 제형화될 수 있다. 다른 한편으로, 두피 트리트먼트제, 비누, 헤어토닉, 샴푸, 린스, 헤어팩, 헤어젤, 로션, 컨디셔너, 헤어오일, 무스, 크림, 고형제, 용액제, 유제, 분산제, 미셀, 리포좀, 연고제, 화장수, 에센스, 패취 또는 분무제의 제형으로 제조될 수도 있다.The cosmetic composition according to the present invention is not particularly limited in its formulation and can be prepared in any formulation commonly manufactured in the art, for example, solution, suspension, emulsion, paste, gel, cream, It can be formulated as lotion, powder, soap, surfactant-containing cleansing, oil, powder foundation, emulsion foundation, wax foundation and spray. On the other hand, scalp treatments, soaps, hair tonics, shampoos, rinses, hair packs, hair gels, lotions, conditioners, hair oils, mousses, creams, solids, solutions, emulsions, dispersants, micelles, liposomes, ointments, It may also be manufactured in the form of lotion, essence, patch, or spray.

상기 화장료 조성물의 제형이 페이스트, 크림 또는 겔인 경우에는 담체 성분으로서 동물성유, 식물성유, 왁스, 파라핀, 전분, 트라칸트, 셀룰로오스 유도체, 폴리에틸렌글리콜, 실리콘, 벤토나이트, 실리카, 탈크 또는 산화아연 등이 이용될 수 있고, 파우더 또는 스프레이인 경우에는 담체 성분으로서 락토스, 탈크, 실리카, 알루미늄 히드록시드, 칼슘 실리케이트 또는 폴리아미드 파우더가 이용될 수 있으며, 특히 스프레이인 경우에는 추가적으로 클로로플루오로히드로카본, 프로판/부탄 또는 디메틸에테르와 같은 추진체를 포함할 수 있다.When the formulation of the cosmetic composition is paste, cream or gel, animal oil, vegetable oil, wax, paraffin, starch, tracant, cellulose derivative, polyethylene glycol, silicone, bentonite, silica, talc or zinc oxide are used as carrier ingredients. In the case of powder or spray, lactose, talc, silica, aluminum hydroxide, calcium silicate, or polyamide powder may be used as carrier ingredients, and especially in the case of spray, chlorofluorohydrocarbon, propane/ It may contain a propellant such as butane or dimethyl ether.

상기 화장료 조성물의 제형이 용액 또는 유탁액인 경우에는 담체 성분으로서 용매, 용해화제 또는 유탁화제가 이용될 수 있고, 예를 들어 물, 에탄올, 이소프로판올, 에틸 카보네이트, 에틸아세테이트, 벤질알코올, 벤질벤조에이트, 프로필렌글리콜, 1,3-부틸글리콜 오일, 글리세롤 지방족 에스테르, 폴리에틸렌글리콜 또는 소르비탄의 지방산 에스테르가 있다.When the formulation of the cosmetic composition is a solution or emulsion, a solvent, solubilizing agent, or emulsifying agent may be used as a carrier component, for example, water, ethanol, isopropanol, ethyl carbonate, ethyl acetate, benzyl alcohol, and benzyl benzoate. , propylene glycol, 1,3-butyl glycol oil, glycerol fatty esters, polyethylene glycol, or fatty acid esters of sorbitan.

상기 화장료 조성물의 제형이 현탁액인 경우에는 담체 성분으로서 물, 에탄올 또는 프로필렌글리콜과 같은 액상의 희석제, 에톡실화이소스테아릴 알코올, 폴리옥시에틸렌 소르비톨 에스테르 및 폴리옥시에틸렌 소르비탄 에스테르와 같은 현탁제, 미소결정성 셀룰로오스, 알루미늄 메타히드록시드, 벤토나이트, 아가 또는 트라칸트 등이 이용될 수 있으며, 계면활성제 함유 클렌징인 경우에는 담체 성분으로서 지방족 알코올 설페이트, 지방족 알코올 에테르 설페이트, 설포숙신산 모노에스테르, 이세티오네이트, 이미다졸리늄 유도체, 메틸타우레이트, 사르코시네이트, 지방산 아미드 에테르 설페이트, 알킬아미도베타인, 지방족 알코올, 지방산 글리세리드, 지방산 디에탄올아미드, 식물성유, 라놀린 유도체 또는 에톡실화 글리세롤 지방산 에스테르 등이 이용될 수 있다.When the formulation of the cosmetic composition is a suspension, the carrier ingredients include water, a liquid diluent such as ethanol or propylene glycol, a suspending agent such as ethoxylated isostearyl alcohol, polyoxyethylene sorbitol ester, and polyoxyethylene sorbitan ester, and miso. Crystalline cellulose, aluminum metahydroxide, bentonite, agar, or tracant can be used, and in the case of cleansing containing surfactants, aliphatic alcohol sulfate, aliphatic alcohol ether sulfate, sulfosuccinic acid monoester, and isethionate are used as carrier ingredients. , imidazolinium derivatives, methyl taurate, sarcosinate, fatty acid amide ether sulfate, alkylamidobetaine, fatty alcohol, fatty acid glyceride, fatty acid diethanolamide, vegetable oil, lanolin derivative or ethoxylated glycerol fatty acid ester, etc. It can be used.

본 발명의 구체적인 구현예에 따르면, 본 발명의 iCP-NI 펩티드는 생체 적합성이 뛰어나며, 피부 가려움 감소, 피부 수분량 및 유전율 증가, 경피수분손실량 감소, 자외선에 의한 피부 홍반 감소 및 피부 붉은기 개선 효과를 갖는다. 따라서, 본 발명의 iCP-NI 펩티드는 피부 보습 및 피부 진정을 위한 화장료 조성물의 유효성분으로서 유용하게 사용될 수 있다.According to a specific embodiment of the present invention, the iCP-NI peptide of the present invention has excellent biocompatibility and has the effect of reducing skin itchiness, increasing skin moisture and dielectric constant, reducing transepidermal water loss, reducing skin erythema caused by ultraviolet rays, and improving skin redness. have Therefore, the iCP-NI peptide of the present invention can be usefully used as an active ingredient in cosmetic compositions for skin moisturization and skin soothing.

제2구현예에 따르면, According to the second implementation,

본 발명은 서열번호 1의 아미노산으로 이루어진 개선된 세포 투과성 핵 수송 억제제(improved cell-permeable nuclear import inhibitor, iCP-NI) 펩티드를 유효성분으로 포함하는 피부 보습 및 피부 진정용 약제학적 조성물을 제공한다. The present invention provides a pharmaceutical composition for skin moisturizing and skin soothing comprising an improved cell-permeable nuclear import inhibitor (iCP-NI) peptide consisting of the amino acid of SEQ ID NO: 1 as an active ingredient.

본 발명에 따른 약제학적 조성물은 피부, 구강, 정맥내, 근육내, 동맥내, 경피, 피하, 복강내, 비강내, 장관, 국소, 설하 또는 직장 투여가 포함되고, 경구 또는 비경구 투여가 바람직하나 이에 한정되지 않는다. 상기 비경구 투여는 피하, 피내, 정맥내, 근육내, 병소내 주사 또는 주입기술을 포함한다.The pharmaceutical composition according to the present invention includes dermal, oral, intravenous, intramuscular, intraarterial, transdermal, subcutaneous, intraperitoneal, intranasal, enteral, topical, sublingual or rectal administration, and oral or parenteral administration is preferred. However, it is not limited to this. The parenteral administration includes subcutaneous, intradermal, intravenous, intramuscular, and intralesional injection or infusion techniques.

본 발명에 따른 약제학적 조성물은 본 발명에 따른 iCP-NI 펩티드에 추가로 동일 또는 유사한 기능을 나타내는 유효성분을 1종 이상 함유할 수 있다. 상기 조성물은 각각 통상의 방법에 따라 산제, 과립제, 정제, 캡슐제, 현탁액, 에멀젼, 시럽 등의 경구형 제형, 외용제, 좌제 및 멸균 주사용액의 형태로 제형화하여 사용될 수 있다.The pharmaceutical composition according to the present invention may contain one or more active ingredients that exhibit the same or similar functions in addition to the iCP-NI peptide according to the present invention. The composition can be formulated and used in the form of oral dosage forms such as powders, granules, tablets, capsules, suspensions, emulsions, syrups, external preparations, suppositories, and sterile injection solutions according to conventional methods.

상기 약제학적 조성물의 경구투여를 위한 고형제제에는 산제, 과립제, 정제, 캡슐제, 연질캅셀제, 환 등이 포함된다. 경구를 위한 액상 제제로는 현탁제, 내용액제, 유제, 시럽제 등이 해당되는데 흔히 사용되는 단순희석제인 물, 리퀴드 파라핀 이외에 여러 가지 부형제, 예를 들면 습윤제, 감미제, 방향제, 보존제 등이 포함될 수 있다. 비경구 투여를 위한 제제로는 각각 통상의 방법에 따라 산제, 과립제, 정제, 캡슐제, 멸균된 수용액, 액제, 비수성용제, 현탁제, 에멀젼, 시럽, 좌제, 에어로졸 등의 외용제 및 멸균 주사제제의 형태로 제형화하여 사용될 수 있으며, 바람직하게는 크림, 젤, 패취, 분무제, 연고제, 경고제, 로션제, 리니멘트제, 파스타제 또는 카타플라스마제의 피부 외용 약학적 조성물을 제조하여 사용할 수 있으나, 이에 한정하는 것은 아니다. 비수성용제, 현탁제로는 프로필렌글리콜(propylene glycol), 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테르 등이 사용될 수 있다. 좌제의 기제로는 위텝솔(witepsol), 마크로골, 트윈(tween) 61, 카카오지, 라우린지, 글리세로제라틴 등이 사용될 수 있다.Solid preparations for oral administration of the pharmaceutical composition include powders, granules, tablets, capsules, soft capsules, pills, etc. Liquid preparations for oral use include suspensions, oral solutions, emulsions, syrups, etc. In addition to the commonly used simple diluents such as water and liquid paraffin, various excipients such as wetting agents, sweeteners, fragrances, and preservatives may be included. . Preparations for parenteral administration include external preparations such as powders, granules, tablets, capsules, sterilized aqueous solutions, solutions, non-aqueous solvents, suspensions, emulsions, syrups, suppositories, aerosols, etc. and sterilized injection preparations according to conventional methods. It can be formulated and used in the form of a cream, gel, patch, spray, ointment, warning agent, lotion, liniment agent, pasta agent, or cataplasma agent. It can be prepared and used as a pharmaceutical composition for external use on the skin. , but is not limited to this. Non-aqueous solvents and suspensions may include propylene glycol, polyethylene glycol, vegetable oil such as olive oil, and injectable ester such as ethyl oleate. As a base for suppositories, witepsol, macrogol, tween 61, cacao, laurin, glycerogeratin, etc. can be used.

본 발명에 따른 약제학적 조성물은 방부제, 안정화제, 수화제 또는 유화 촉진제, 삼투압 조절을 위한 염 및/또는 완충제 등의 보조제, 및 기타 치료적으로 유용한 물질을 추가로 함유할 수 있으며, 통상적인 방법인 혼합, 과립화 또는 코팅 방법에 따라 제형화할 수 있다.The pharmaceutical composition according to the present invention may further contain preservatives, stabilizers, hydrating agents or emulsification accelerators, auxiliaries such as salts and/or buffering agents for adjusting osmotic pressure, and other therapeutically useful substances, and may be prepared by conventional methods. It can be formulated according to mixing, granulating or coating methods.

본 발명에 따른 약제학적 조성물은 개체의 연령, 체중, 일반적인 건강, 성별, 투여시간, 투여 경로, 배출률, 약물 배합 및 특정 질환의 중증을 포함한 여러 요인에 따라 다양하게 변할 수 있다.The pharmaceutical composition according to the present invention may vary depending on various factors, including the subject's age, weight, general health, gender, administration time, administration route, excretion rate, drug combination, and severity of a specific disease.

본 발명에 따른 약제학적 조성물이 상기 iCP-NI 펩티드를 유효성분으로 함유하는 약제학적 조성물을 단위 용량 형태로 제형화하는 경우, 유효성분으로서 상기 iCP-NI 펩티드를 약 0.01 내지 1,500 ㎎의 단위용량으로 함유되는 것이 바람직하고, 성인 치료에 필요한 투여량은 투여의 빈도와 강도에 따라 하루에 약 1 내지 500 ㎎ 범위가 보통이나 이에 한정되지 않는다. 성인에게 근육 내 또는 정맥 내 투여 시 일 회 투여량으로는 하루에 보통 약 5 내지 300 ㎎의 전체 투여량이면 충분할 것이나, 일부 환자의 경우 더 높은 일일 투여량이 바람직할 수 있다. 본 발명의 조성물은 단독으로, 또는 수술, 방사선 치료, 호르몬 치료, 화학 치료 및 생물학적 반응 조절제를 사용하는 방법들과 병용하여 사용할 수 있다.When the pharmaceutical composition according to the present invention is formulated in a unit dose form containing the iCP-NI peptide as an active ingredient, the iCP-NI peptide as an active ingredient is administered in a unit dose of about 0.01 to 1,500 mg. It is preferable to contain it, and the dosage required for adult treatment is usually in the range of about 1 to 500 mg per day depending on the frequency and intensity of administration, but is not limited thereto. When administered intramuscularly or intravenously to adults, a single dose of approximately 5 to 300 mg per day will usually be sufficient, although higher daily doses may be desirable for some patients. The composition of the present invention can be used alone or in combination with surgery, radiation therapy, hormone therapy, chemotherapy, and methods using biological response modifiers.

제3구현예에 따르면, According to the third implementation example,

본 발명은 화장품학적 또는 약제학적으로 유효한 양의 서열번호 1의 아미노산으로 이루어진 개선된 세포 투과성 핵 수송 억제제(improved cell-permeable nuclear import inhibitor, iCP-NI) 펩티드를 개체에 처리 또는 투여하는 단계를 포함하는 피부 보습 및 피부 진정 방법을 제공한다.The present invention includes the step of treating or administering a cosmetically or pharmaceutically effective amount of an improved cell-permeable nuclear import inhibitor (iCP-NI) peptide consisting of the amino acid of SEQ ID NO: 1 to an individual. Provides skin moisturizing and skin soothing methods.

본 발명에 따른 방법에 있어서, 상기 화장품학적 또는 약제학적으로 유효한 양이란 0.0001 내지 100 ㎎/㎏이고, 바람직하게는 0.001 내지 10 ㎎/㎏이며, 이에 제한되는 것은 아니다. 처리 또는 투여량은 특정 환자의 체중, 연령, 성별, 건강상태, 식이, 투여기간, 투여방법, 제거율, 질환의 중증도 등에 따라 조절될 수 있다. 처리 또는 투여는 하루에 한번 투여할 수도 있고, 수회 나누어 실시할 수도 있다.In the method according to the present invention, the cosmetically or pharmaceutically effective amount is 0.0001 to 100 mg/kg, preferably 0.001 to 10 mg/kg, but is not limited thereto. Treatment or dosage can be adjusted depending on the specific patient's weight, age, gender, health condition, diet, administration period, administration method, clearance rate, disease severity, etc. Treatment or administration may be administered once a day or may be divided into several times.

본 발명에 따른 방법에 있어서, 상기 개체는 척추동물이고 바람직하게는 포유동물이며, 보다 바람직하게는 인간 또는 쥐, 토끼, 기니아피그, 햄스터, 개, 고양이와 같은 실험동물이고, 가장 바람직하게는 인간일 수 있으나 이에 한정되는 것은 아니다.In the method according to the present invention, the subject is a vertebrate, preferably a mammal, more preferably a human or laboratory animal such as a rat, rabbit, guinea pig, hamster, dog, or cat, and most preferably a human. It may be, but is not limited to this.

본 발명에 따른 방법에 있어서, 상기 처리 또는 투여 방법은 도포, 경구 또는 비경구 투여할 수 있으며, 비경구 투여시 복강내주사, 직장내주사, 피하주사, 정맥주사, 근육내 주사, 자궁내 경막 주사, 뇌혈관내 주사 또는 흉부내 주사에 의해 투여될 수 있다.In the method according to the present invention, the treatment or administration method can be applied, orally or parenterally, and when administered parenterally, intraperitoneal injection, intrarectal injection, subcutaneous injection, intravenous injection, intramuscular injection, intrauterine dura. It may be administered by injection, intracerebrovascular injection, or intrathoracic injection.

발명의 실시를 위한 형태Forms for practicing the invention

이하, 실시예 및 실험예를 통하여 본 발명을 더욱 상세하게 설명한다. 다만, 하기 실시예 및 실험예는 본 발명을 예시하기 위한 것으로, 본 발명의 내용이 하기 실시예 및 실험예에 한정되는 것은 아니다.Hereinafter, the present invention will be described in more detail through examples and experimental examples. However, the following examples and experimental examples are for illustrating the present invention, and the content of the present invention is not limited to the following examples and experimental examples.

<제조예><Manufacturing example>

1. 개선된 세포 투과성 핵 수송 억제제(iCP-NI)의 제조1. Preparation of improved cell-permeable nuclear transport inhibitor (iCP-NI)

본 발명에 따른 서열번호 1의 아미노산 서열로 이루어진 iCP-NI 펩티드는 서열번호 2의 아미노산으로 이루어진 aMTD(advanced macromolecule transduction domain) 및 서열번호 3의 아미노산으로 이루어진 NF-κ핵 위치 서열(NLS)을 이용하여 제조하였다(표 1). The iCP-NI peptide consisting of the amino acid sequence of SEQ ID NO: 1 according to the present invention uses an advanced macromolecule transduction domain (aMTD) consisting of the amino acid of SEQ ID NO: 2 and the NF-κ nuclear site sequence (NLS) consisting of the amino acid of SEQ ID NO: 3. It was prepared (Table 1).

명칭designation 서열order SEQ No.SEQ No. iCP-NIiCP-NI IAAVLAAPALVPCVQRKRQKLMPCIAAVLAAPALVPCVQRKRQKLMPC 서열번호 1SEQ ID NO: 1 aMTDaMTD IAAVLAAPALVPIAAVLAAPALVP 서열번호 2SEQ ID NO: 2 NLSNLS CVQRKRQKLMPCCVQRKRQKLMPC 서열번호 3SEQ ID NO: 3

2. iCP-NI 펩티드의 생체적합성에 대한 in-vitro 효능 평가2. In-vitro efficacy evaluation of biocompatibility of iCP-NI peptide

NHDF 세포를 24-well plate에 2.0×104cells/well의 농도로 접종하여 24시간 배양한 뒤, iCP-NI 펩티드 시료(최종농도가 1, 5, 10, 30 및 50 μM이 되도록 배지로 희석됨)가 포함된 serum-free FBM로 교환한 후 24시간 배양하였다. 배양 후 EZ-Cytox을 한 well당 50 μl씩 첨가하고 1시간 동안 더 배양하였다. 배양한 배지를 96well plate에 옮겨 담고 VERSA max microplate reader (Molecular devices, LCC., USA)를 사용하여 450nm에서 흡광도를 측정하였다. 각 시료군에 대한 평균 흡광도 값을 구하였으며, 대조군의 흡광도 값과 비교하여 세포 생존율을 조사하였다. 그 결과, 본 발명에 따른 iCP-NI 펩티드는 1 ~ 50 μM 농도 범위에서 대조군 대비 세포 독성이 없는 것으로 확인되었다(도 1).NHDF cells were inoculated into a 24 -well plate at a concentration of 2.0 ) was exchanged for serum-free FBM containing FBM and cultured for 24 hours. After incubation, 50 μl of EZ-Cytox was added per well and cultured for another hour. The cultured medium was transferred to a 96-well plate and the absorbance was measured at 450 nm using a VERSA max microplate reader (Molecular devices, LCC., USA). The average absorbance value for each sample group was obtained, and cell survival rate was investigated by comparing it with the absorbance value of the control group. As a result, it was confirmed that the iCP-NI peptide according to the present invention had no cytotoxicity compared to the control group in the concentration range of 1 to 50 μM (Figure 1).

3. iCP-NI 펩티드를 포함하는 화장품의 제조3. Preparation of cosmetics containing iCP-NI peptide

본 발명의 iCP-NI 펩티드를 유효성분으로 함유하는 로션을 하기 표 2와 같이 제조하였다(함량: 중량부).A lotion containing the iCP-NI peptide of the present invention as an active ingredient was prepared as shown in Table 2 below (content: parts by weight).

구분division 성분명Ingredient name 제형예Formulation example 비교예Comparative example 수상Awards WATERWATER To. 100To. 100 To. 100To. 100 GLYCERINGLYCERIN 55 55 1,3-BUTYLENE GLYCOL1,3-BUTYLENE GLYCOL 88 88 1,2-Hexanediol1,2-Hexanediol 22 22 EDTA-2NaEDTA-2Na 0.020.02 0.020.02 AMMONIUM ACRYLOYLDIMETHYLTAURATE/VP COPOLYMERAMMONIUM ACRYLOYLDIMETHYLTAURATE/VP COPOLYMER 0.50.5 0.50.5 유상paid CETEARYL ALCOHOLCETEARYL ALCOHOL 2.02.0 2.02.0 PEG-100 STEARATEPEG-100 STEARATE 1.51.5 1.51.5 GLYCERYL STEARATEGLYCERYL STEARATE 0.70.7 0.70.7 BEESWAXBEESWAX 1One 1One CETYLETHYLHEXANOATECETYLETHYLHEXANOATE 55 55 SQUALANESQUALANE 33 33 C14-22 ALCOHOLC14-22 ALCOHOL 2.02.0 2.02.0 POLYSORBATE 20POLYSORBATE 20 0.50.5 0.50.5 SOLBITAN ISOSTEARATESOLBITAN ISOSTEARATE 1.21.2 1.21.2 C12-20 ALKYLGLUCOSIDEC12-20 ALKYLGLUCOSIDE 0.50.5 0.50.5 CYCLOMETHICONECYCLOMETHICONE 22 22 DIMETHICONEDIMETHICONE 1One 1One DIMETHICONOLDIMETHICONOL 0.50.5 0.50.5 iCP-NI 상iCP-NI Award WATERWATER 1One -- iCP-NIiCP-NI 0.010.01 -- 첨가제상additive FRAGRANCEFRAGRANCE 적량Appropriate amount 적량Appropriate amount

<실험예> <Experimental example>

1. 본 발명에 따른 iCP-NI의 가려움증 완화 효능 평가1. Evaluation of the itching alleviation efficacy of iCP-NI according to the present invention

본 발명에 따른 iCP-NI의 기능성 검증을 위한 인체적용시험을 진행하였다. 얼굴 뺨 부위를 세안 후 항온항습(22±2°C, 50±5%) 조건에서 30분 이상 대기하여 충분히 피부 안정을 취한 다음 시험에 참여하였다. 시험제품 사용 전 후의 가려움 점수(Score), 뺨 부위의 피부 수분량(A.U.), 평균 유전율(ε경피수분손실량(g/m2h)을 측정하여 건조함에 의한 가려움 완화 효능을 평가하였다. A human application test was conducted to verify the functionality of iCP-NI according to the present invention. After washing the face and cheek area, the patient waited at least 30 minutes under constant temperature and humidity (22 ± 2°C, 50 ± 5%) conditions to sufficiently stabilize the skin before participating in the test. The itching score (Score), skin moisture content (A.U.) of the cheek area, and average dielectric constant (ε transepidermal water loss (g/m2h)) were measured before and after using the test product to evaluate the efficacy of relieving itching caused by dryness.

(1) 가려움 점수(1) Itch score

시험제품 사용 전과 2주 사용 후, 4주 사용 후에 시험대상자가 하기의 표 3에 따른 10점 척도의 가려움의 분류를 스스로 평가하도록 하여 점수의 평균을 계산하여 가려움의 개선 정도를 평가하였다.Before using the test product, after using it for 2 weeks, and after using it for 4 weeks, the test subjects were asked to self-evaluate the itching classification on a 10-point scale according to Table 3 below, and the average of the scores was calculated to evaluate the degree of improvement in itching.

점수score 가려움의 정도Degree of itching 0점0 points 가려움이 없음no itchiness 1점 이상 3점 미만1 point or more but less than 3 points 경증의 가려움(mild pruritus)Mild pruritus 3점 이상 7점 미만3 or more points but less than 7 points 중등도의 가려움(moderate pruritus)Moderate pruritus 7점 이상 9점 미만7 or more points but less than 9 points 중증 가려움(severe pruritus)Severe pruritus 10점10 points 매우 중증 가려움(very severe pruritus)very severe pruritus

그 결과, 본 발명에 따른 iCP-NI를 포함하는 화장료 조성물은 사용 전과 비교하여 2주 사용 후, 4주 사용 후 가려움 점수(Score)가 모두 유의하게 감소시키는 것으로 확인되었다. As a result, it was confirmed that the cosmetic composition containing iCP-NI according to the present invention significantly reduced the itching scores after 2 weeks of use and 4 weeks of use compared to before use.

구분division 평균 ± 표준편차Mean ± standard deviation 개선율improvement rate p-valuep-value 시험 부위test site 시험전Before exam 4.95±1.764.95±1.76 -- <0.001<0.001 시험 2주 후2 weeks after exam 2.73±1.702.73±1.70 44.95%44.95% 시험 4주 후4 weeks after exam 1.59±0.731.59±0.73 67.89%67.89%

(2) 피부 수분량(A.U.)(2) Skin moisture content (A.U.)

Corneometer CM825 Probe (Courage+Khazaka GmbH, Germany)를 이용하여 피부 표면으로부터 10∼㎛ 이내의 각질층 전기용량(Capacitance)을 측정하여 피부 수분량을 평가하였다. 그 결과, 본 발명에 따른 iCP-NI를 포함하는 화장료 조성물은 사용 전과 비교하여 2주 사용 후, 4주 사용 후 피부 수분량을 모두 유의하게 증가시키는 것으로 확인되었다. The skin moisture content was evaluated by measuring the capacitance of the stratum corneum within 10 ㎛ from the skin surface using the Corneometer CM825 Probe (Courage+Khazaka GmbH, Germany). As a result, it was confirmed that the cosmetic composition containing iCP-NI according to the present invention significantly increased the amount of skin moisture after 2 weeks of use and after 4 weeks of use compared to before use.

구분division 평균 ± 표준편차Mean ± standard deviation 개선율improvement rate p-valuep-value 시험 부위test site 시험전Before exam 27.00±2.2527.00±2.25 -- <0.001<0.001 시험 2주 후2 weeks after exam 31.42±3.5931.42±3.59 16.37%16.37% 시험 4주 후4 weeks after exam 34.40±3.4634.40±3.46 27.42%27.42%

(3) 평균 유전율 (3) Average permittivity

Epsilon E100 (Biox Systems Ltd., England)은 50㎛ 특수 해상도를 가진 CMOS 지문 인식 센서를 이용하여 12.8mm*15mm 영역의 센서에 접촉된 피부 표면 수분량을 평균 유전율(ε값으로 산출하였다. 그 결과, 본 발명에 따른 iCP-NI를 포함하는 화장료 조성물은 사용 전과 비교하여 2주 사용 후, 4주 사용 후 피부 유전율을 모두 유의하게 증가시키는 것으로 확인되었다. Epsilon E100 (Biox Systems Ltd., England) used a CMOS fingerprint recognition sensor with a special resolution of 50㎛ to calculate the average dielectric constant (ε value) of the amount of moisture on the skin surface in contact with the sensor in an area of 12.8mm*15mm. As a result, It was confirmed that the cosmetic composition containing iCP-NI according to the present invention significantly increased the skin permittivity after 2 weeks of use and after 4 weeks of use compared to before use.

구분division 평균 ± 표준편차Mean ± standard deviation 개선율improvement rate p-valuep-value 시험 부위test site 시험전Before exam 18.99±5.9018.99±5.90 -- <0.001<0.001 시험 2주 후2 weeks after exam 22.28±5.9022.28±5.90 17.31%17.31% 시험 4주 후4 weeks after exam 24.88±5.7624.88±5.76 31.01%31.01%

(4) 경피수분손실량(4) Transepidermal water loss

Vapometer (Delfin Technologies Ltd., Finland)는 표피를 통한 수분의 손실 지표인 경피수분손실량 (TEWL, Transepidermal Water Loss)을 평가하였다. 그 결과, 본 발명에 따른 iCP-NI를 포함하는 화장료 조성물은 사용 전과 비교하여 2주 사용 후, 4주 사용 후 피부 유전율을 모두 유의하게 감소시키는 것으로 확인되었다. Vapometer (Delfin Technologies Ltd., Finland) evaluated transepidermal water loss (TEWL), an indicator of water loss through the epidermis. As a result, it was confirmed that the cosmetic composition containing iCP-NI according to the present invention significantly reduced the skin dielectric constant after 2 weeks of use and after 4 weeks of use compared to before use.

구분division 평균 ± 표준편차Mean ± standard deviation 개선율improvement rate p-valuep-value 시험 부위test site 시험전Before exam 18.96±5.0518.96±5.05 -- <0.001<0.001 시험 2주 후2 weeks after exam 16.86±4.5416.86±4.54 11.10%11.10% 시험 4주 후4 weeks after exam 15.47±4.7115.47±4.71 18.42%18.42%

2. 본 발명에 따른 iCP-NI의 자외선 자극에 의한 피부 진정 효능 평가2. Evaluation of skin soothing efficacy by ultraviolet ray stimulation of iCP-NI according to the present invention

인체의 피부에 자외선을 통한 자극을 유도하고 이로 인해 형성된 홍반 부위에 iCP-NI (0.01%)를 도포한 후, 48 시간 뒤 무도포군과 비교하였다. 분광측색계 Spectrophotometer CM-26dG (Konica Minolta)를 이용하여 시험 부위의 a* value (붉은 기)를 측정하였다. 그 결과, 본 발명에 따른 iCP-NI를 포함하는 화장료 조성물은 자외선으로부터 유도된 최소홍반정도 (minimum erythema degree, MED)을 48 시간 뒤 감소시키는 것으로 확인되었다(도 2). Stimulation through ultraviolet rays was induced on human skin, and iCP-NI (0.01%) was applied to the erythema area formed as a result, and then compared with the non-application group 48 hours later. The a* value (redness) of the test area was measured using a spectrophotometer CM-26dG (Konica Minolta). As a result, it was confirmed that the cosmetic composition containing iCP-NI according to the present invention reduces the minimum erythema degree (MED) induced by ultraviolet rays after 48 hours (FIG. 2).

3. 본 발명에 따른 iCP-NI의 피부 붉은기 개선 효능 평가3. Evaluation of the skin redness improvement efficacy of iCP-NI according to the present invention

시험 대상자 20명을 대상으로 인체적용시험을 진행함. 얼굴 볼 부위를 세안 후 항온항습(22±2°C, 50±5%) 조건에서 30분 이상 대기하여 충분히 피부 안정을 취한 다음 시험에 참여하였다. 시험제품 사용 전과 4주 사용 후 VISIA-CR을 이용한 사진촬영 및 이미지 분석 프로그램을 이용한 볼 부위의 피부 붉은기 평가하였다. 그 결과, 본 발명에 따른 iCP-NI를 포함하는 화장료 조성물은 피부 붉은기를 사용 4주 후 약 42% 개선시키는 것으로 확인되었다 (도 3).A human application test was conducted on 20 test subjects. After washing the cheek area of the face, the patient waited at least 30 minutes under constant temperature and humidity (22 ± 2°C, 50 ± 5%) conditions to sufficiently stabilize the skin before participating in the test. Before using the test product and after using it for 4 weeks, skin redness was evaluated on the cheek area using photography and image analysis program using VISIA-CR. As a result, it was confirmed that the cosmetic composition containing iCP-NI according to the present invention improved skin redness by about 42% after 4 weeks of use (FIG. 3).

본 발명의 iCP-NI 펩티드는 생체 적합성이 뛰어나며, 피부 가려움 감소, 피부 수분량 및 유전율 증가, 경피수분손실량 감소, 자외선에 의한 피부 홍반 감소 및 피부 붉은기 개선 효과를 갖는다. 따라서, 본 발명의 iCP-NI 펩티드는 피부 보습 및 피부 진정을 위한 화장료 조성물의 유효성분으로서 유용하게 사용될 수 있다.The iCP-NI peptide of the present invention has excellent biocompatibility and has the effect of reducing skin itchiness, increasing skin moisture and dielectric constant, reducing transepidermal water loss, reducing skin erythema caused by ultraviolet rays, and improving skin redness. Therefore, the iCP-NI peptide of the present invention can be usefully used as an active ingredient in cosmetic compositions for skin moisturization and skin soothing.

Claims (7)

서열번호 1로 표시되는 아미노산 서열로 이루어진 개선된 세포 투과성 핵 수송 억제제(improved cell-permeable nuclear import inhibitor, iCP-NI) 펩티드를 유효성분으로 포함하는 피부 보습 및 피부 진정용 화장료 조성물.A cosmetic composition for skin moisturizing and skin soothing comprising an improved cell-permeable nuclear import inhibitor (iCP-NI) peptide consisting of the amino acid sequence shown in SEQ ID NO: 1 as an active ingredient. 제1항에 있어서,
상기 피부 진정은 피부 가려움증 감소, 피부 홍반 감성 및 피부 붉은기 개선을 포함하는 것을 특징으로 하는 것인, 화장료 조성물.
According to paragraph 1,
A cosmetic composition, wherein the skin soothing includes reducing skin itching, improving skin erythema sensitivity, and skin redness.
제1항에 있어서,
상기 iCP-NI 펩티드는 화장료 조성물 내 0.01 내지 10000 ppm 의 농도로 함유되는 것을 특징으로 하는 것인, 화장료 조성물
According to paragraph 1,
A cosmetic composition, wherein the iCP-NI peptide is contained in a concentration of 0.01 to 10000 ppm in the cosmetic composition.
제1항에 있어서,
상기 화장료 조성물의 제형은 화장수(스킨로션), 스킨소프너, 스킨토너, 아스트린젠트, 로션, 밀크로션, 모이스쳐 로션, 영양 로션, 마사지 크림, 영양 크림, 아이 크림, 모이스쳐 크림, 핸드크림, 파운데이션, 에센스, 영양 에센스, 팩, 비누, 클렌징폼, 클렌징로션, 클렌징크림, 바디로션 및 바디클렌저로 이루어진 군으로부터 하나 또는 그 이상 선택되는 것을 특징으로 하는 것인, 화장료 조성물.
According to paragraph 1,
The formulation of the cosmetic composition includes lotion (skin lotion), skin softener, skin toner, astringent, lotion, milk lotion, moisture lotion, nutritional lotion, massage cream, nutritional cream, eye cream, moisture cream, hand cream, foundation, essence, A cosmetic composition characterized by one or more selected from the group consisting of nutritional essence, pack, soap, cleansing foam, cleansing lotion, cleansing cream, body lotion and body cleanser.
서열번호 1로 표시되는 아미노산 서열로 이루어진 개선된 세포 투과성 핵 수송 억제제(improved cell-permeable nuclear import inhibitor, iCP-NI) 펩티드를 유효성분으로 포함하는 피부 보습 및 피부 진정용 피부 외용제.An external skin preparation for moisturizing and soothing skin containing an improved cell-permeable nuclear import inhibitor (iCP-NI) peptide consisting of the amino acid sequence shown in SEQ ID NO: 1 as an active ingredient. 제5항에 있어서,
상기 외용제의 제형은 크림, 젤, 패취, 분무제, 연고제, 경고제, 로션제, 리니멘트제, 파스타제 및 카타플라스마제로 이루어진 군으로부터 하나 또는 그 이상 선택되는 것을 특징으로 하는 것인, 피부 외용제.
According to clause 5,
The formulation of the external preparation is one or more selected from the group consisting of creams, gels, patches, sprays, ointments, warning agents, lotions, liniment agents, pasta agents, and cataplasma agents.
서열번호 1로 표시되는 아미노산 서열로 이루어진 개선된 세포 투과성 핵 수송 억제제(improved cell-permeable nuclear import inhibitor, iCP-NI) 펩티드를 개체에게 도포하는 단계를 포함하는 피부 보습 및 피부 진정 방법.A skin moisturizing and skin soothing method comprising applying to a subject an improved cell-permeable nuclear import inhibitor (iCP-NI) peptide consisting of the amino acid sequence represented by SEQ ID NO: 1.
KR1020247000047A 2021-08-13 2022-08-16 Cosmetic composition for skin moisturizing and skin soothing comprising an improved cell-permeable nuclear transport inhibitor KR20240019215A (en)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
US202163232766P 2021-08-13 2021-08-13
US63/232,766 2021-08-13
PCT/KR2022/012185 WO2023018315A1 (en) 2021-08-13 2022-08-16 Cosmetic composition for skin moisturizing and skin soothing comprising improved cell-permeable nuclear import inhibitor

Publications (1)

Publication Number Publication Date
KR20240019215A true KR20240019215A (en) 2024-02-14

Family

ID=85200200

Family Applications (2)

Application Number Title Priority Date Filing Date
KR1020247000047A KR20240019215A (en) 2021-08-13 2022-08-16 Cosmetic composition for skin moisturizing and skin soothing comprising an improved cell-permeable nuclear transport inhibitor
KR1020247000048A KR20240019216A (en) 2021-08-13 2022-08-16 Cosmetic composition for preventing skin aging or improving skin wrinkles comprising an improved cell-permeable nuclear transport inhibitor

Family Applications After (1)

Application Number Title Priority Date Filing Date
KR1020247000048A KR20240019216A (en) 2021-08-13 2022-08-16 Cosmetic composition for preventing skin aging or improving skin wrinkles comprising an improved cell-permeable nuclear transport inhibitor

Country Status (2)

Country Link
KR (2) KR20240019215A (en)
WO (2) WO2023018315A1 (en)

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7553929B2 (en) * 1994-06-13 2009-06-30 Vanderbilt University Cell permeable peptides for inhibition of inflammatory reactions and methods of use
US9492544B2 (en) * 2013-04-11 2016-11-15 Vanderbilt University Compositions and methods for targeting nuclear import shuttles and treating inflammatory disorders
US10323063B2 (en) * 2014-08-17 2019-06-18 Cellivery Therapeutics, Inc. Advanced macromolecule transduction domain (aMTD) sequences for improvement of cell-permeability, polynucleotides encoding the same, method to identify the unique features of aMTDs comprising the same, method to develop the aMTD sequences comprising the same
WO2017026779A1 (en) * 2015-08-10 2017-02-16 Cellivery Therapeutics, Inc. Improved cell-permeable cre (icp-cre) recombinant protein and use thereof
JP2022501337A (en) * 2018-09-14 2022-01-06 ヴァンダービルト ユニヴァーシティ Methods and compositions for treating skin disorders

Also Published As

Publication number Publication date
WO2023018315A1 (en) 2023-02-16
KR20240019216A (en) 2024-02-14
WO2023018316A1 (en) 2023-02-16

Similar Documents

Publication Publication Date Title
US20070160548A1 (en) Moisturizing sunless tanning composition
US7994141B2 (en) Compositions comprising compounds of natural origin for damaged skin
CA2866527C (en) Use of isoeugenol esters in treating hyperpigmentation
US9622950B2 (en) Compositions for use in treatment of dermatological diseases and conditions
TWI682782B (en) Methods and compositions for topical delivery for skin care
CA2761732C (en) Composition for preventing hair loss or for stimulating hair growth
PL214285B1 (en) Use of purslane to treat facial wrinkles
US20040086538A1 (en) Use of calcium-releasing or binding substances for the targeted weakening or strengthening of the barrier function of the skin
EP1172084A2 (en) Cosmetic and dermatologic composition to eliminate sebum
KR20110130434A (en) Composition comprising n2-(1-oxohexadecyl)-lysyl-valyl-lysine for treating rosacea and its symptoms
EP1396261B1 (en) Skincare composition containing caffeine
KR20140055155A (en) Salidroside improving skin aging or inflammation with protecting skin from external harmful materials such as ultraviolet ray etc
US20230210746A1 (en) Anti-aging cosmetic compositions comprising nmn
KR20240019215A (en) Cosmetic composition for skin moisturizing and skin soothing comprising an improved cell-permeable nuclear transport inhibitor
KR101550727B1 (en) Composition containing polygalacic acid for improving skin aging and inflammation
KR102464017B1 (en) Composition for preventing or improving acne comprising a novel peptide
US11052127B2 (en) HSP for use in treatment for imiquimod related side effects
KR20120075766A (en) Composition for preventing hair loss or promoting hair growth
US10064831B2 (en) Active substances and cosmetic or dermatological preparations containing said active substances for the care of the skin of patients of diabetes mellitus
CN116509831A (en) Use of external preparation containing crocetin or pharmaceutically acceptable salt thereof
KR100789344B1 (en) Agent for preventing skin aging containing oligonucleotide
KR20140055154A (en) Amygdalin improving skin aging or inflammation with protecting skin from external harmful materials such as ultraviolet ray etc
KR20140055969A (en) Composition containing tetramethylpyrazine for improving skin aging and inflammation
KR20140055156A (en) Sitosterin improving skin aging or inflammation with protecting skin from external harmful materials such as ultraviolet ray etc
KR20120070681A (en) Compositions for improving skin conditions comprising cyst aninas an active ingredient