KR20220063744A - Coronavirus vaccine using replication-deficient adenovirus that simultaneously expresses coronavirus spike protein and nucleocapsid protein - Google Patents

Coronavirus vaccine using replication-deficient adenovirus that simultaneously expresses coronavirus spike protein and nucleocapsid protein Download PDF

Info

Publication number
KR20220063744A
KR20220063744A KR1020210152517A KR20210152517A KR20220063744A KR 20220063744 A KR20220063744 A KR 20220063744A KR 1020210152517 A KR1020210152517 A KR 1020210152517A KR 20210152517 A KR20210152517 A KR 20210152517A KR 20220063744 A KR20220063744 A KR 20220063744A
Authority
KR
South Korea
Prior art keywords
leu
val
thr
ser
ala
Prior art date
Application number
KR1020210152517A
Other languages
Korean (ko)
Other versions
KR102399308B1 (en
Inventor
최정우
정광일
최강석
손승은
Original Assignee
주식회사 비엘
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 비엘 filed Critical 주식회사 비엘
Priority to PCT/KR2021/016258 priority Critical patent/WO2022103126A1/en
Priority to KR1020220015550A priority patent/KR20220063760A/en
Publication of KR20220063744A publication Critical patent/KR20220063744A/en
Application granted granted Critical
Publication of KR102399308B1 publication Critical patent/KR102399308B1/en

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86—Viral vectors
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/12—Viral antigens
    • A61K39/215—Coronaviridae, e.g. avian infectious bronchitis virus
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A61P31/14—Antivirals for RNA viruses
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011—Details
    • C12N2710/10011—Adenoviridae
    • C12N2710/10041—Use of virus, viral particle or viral elements as a vector
    • C12N2710/10043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011—Details
    • C12N2770/20011—Coronaviridae
    • C12N2770/20034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Virology (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Communicable Diseases (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Biomedical Technology (AREA)
  • Biophysics (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Physics & Mathematics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Immunology (AREA)
  • Pulmonology (AREA)
  • Epidemiology (AREA)
  • Mycology (AREA)
  • Oncology (AREA)
  • Plant Pathology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

The present invention relates to a recombinant adenovirus in which spike protein and nucleocapsid protein of the coronavirus and PgsA are expressed in an inserted form into replication-deficient adenovirus E1 and E3 regions, and a coronavirus vaccine using the same. The vaccine composition according to the present invention can induce an immune reaction to the SARS-CoV-2 and mutant viruses thereof by inducing a humoral immune reaction and a cell-mediated reaction.

Description

코로나바이러스의 스파이크 단백질 및 뉴클레오캡시드 단백질을 동시발현하는 복제불능 아데노바이러스를 이용한 코로나바이러스 백신 {Coronavirus vaccine using replication-deficient adenovirus that simultaneously expresses coronavirus spike protein and nucleocapsid protein}Coronavirus vaccine using replication-deficient adenovirus that simultaneously expresses coronavirus spike protein and nucleocapsid protein

본 발명은 코로나바이러스의 스파이크(spike) 단백질과 뉴클레오캡시드(nucleocapsid) 단백질이 복제불능 아데노바이러스의 E1영역과 E3영역에 삽입된 형태로 발현되는 재조합 아데노바이러스 및 이를 이용한 코로나바이러스 백신에 관한 발명이다.The present invention relates to a recombinant adenovirus in which the spike protein and the nucleocapsid protein of the coronavirus are inserted into the E1 region and the E3 region of the replication-deficient adenovirus, and a coronavirus vaccine using the same. .

코로나바이러스감염증-19(coronavirus disease 2019, 이하 “COVID-19”라 함)는 2019년 12월 중국 우한에서 처음 발생한 이후 중국 전역과 전 세계로 확산된 새로운 유형의 코로나바이러스(이하 “SARS-CoV-2”라 함)에 의한 호흡기 감염질환을 말하는데, 감염자의 비말(침방울)이 호흡기나 눈·코·입의 점막으로 침투될 때 전염되며, 약 2~14일(추정)의 잠복기를 거친 뒤 발열 및 기침이나 호흡곤란 등 호흡기 증상, 폐렴이 주증상으로 나타나지만 무증상 감염 사례 빈도도 높게 나오고 있다. Coronavirus disease 2019 (hereinafter referred to as “COVID-19”) is a new type of coronavirus (hereinafter referred to as “SARS-CoV- 2”)), which is transmitted when droplets (saliva) of an infected person penetrate the respiratory tract or the mucous membranes of the eyes, nose, and mouth. Respiratory symptoms such as cough or shortness of breath and pneumonia are the main symptoms, but the frequency of asymptomatic infections is also high.

“SARS-CoV-2”는 외피를 가지며, 유전체로서 약 30kb 길이의 단일 가닥 RNA를 가지는데, 바이러스 유전체인 RNA 자체가 전사체로 작용하는 양성 가닥(positive-strand) RNA 유전자에 해당하고, 코로나바이러스의 유전자는 뉴클레오캡시드(nucleocapsid, N) 단백질, 막(membrane, M) 단백질, 외피(envelope, E) 단백질, 스파이크(spike, S) 당단백질 등의 구조 단백질을 암호화한다(도 1). 인간코로나바이러스(HCoV) 중 일부에서는 hemagglutinin-esterase(HE) 단백질을 생성하며, 바이러스 입자의 세포 표면의 부착 및 유리 과정에서 중요한 역할을 하는 것으로 알려져 있다.“SARS-CoV-2” has an envelope and has a single-stranded RNA of about 30 kb as a genome. The gene encodes structural proteins such as a nucleocapsid (N) protein, a membrane (M) protein, an envelope (E) protein, and a spike (S) glycoprotein ( FIG. 1 ). Some of the human coronaviruses (HCoV) produce hemagglutinin-esterase (HE) protein, which is known to play an important role in the attachment and release of virus particles to the cell surface.

이 중 스파이크 단백질은 숙주세포의 표면에 부착과 관련하여 감염 개시에 있어 중요한 역할을 하는 것으로 알려져 있으며 특히 스파이크 단백질의 S1 도메인은 세포 수용체에 특이적인 결합을 매개하는 수용체 결합 도메인(receptor binding domain: RBD)을 포함하고 있는 것으로 알려져 있으며, 뉴클레오캡티드 단백질은 바이러스 게놈의 패키징 및 복제 과정에 관여하는 단백질로서 연결부위(linkage region)로 연결된 2개의 바이러스 RNA 결합부위로 구성되며, 연결부위는 세린/아르기닌이 풍부하게 존재하며 보존적인 부분으로 알려져 있다(Sebastano et al., 2020).Among them, the spike protein is known to play an important role in the initiation of infection in relation to the attachment to the surface of the host cell. In particular, the S1 domain of the spike protein is a receptor binding domain (RBD) that mediates specific binding to cell receptors. ), a nucleocaptid protein is a protein involved in the packaging and replication process of the viral genome, and consists of two viral RNA binding sites linked by a linkage region, and the linkage region is serine/ Arginine is abundant and known to be a conserved fraction (Sebastano et al., 2020).

한편, SARS-CoV-2 연구를 기반으로 영장류 모델에서 SARS-CoV-2 백신을 개발하고 있으며, 개발중인 SARS-CoV-2 백신은 접종을 통해 체액성 및 세포성 면역반응을 증가시키는 것으로 나타났다(도 2). 다만, 최근 일부 제약회사들이 SARS-CoV-2 백신개발을 추진 중인 상태이나, 아직 개발단계로서 전임상, 임상 시험 등을 통한 유효성 검증이 필요한 상황으로, SARS-CoV-2 감염예방을 위한 백신이 절실히 요구되는 상황이며, 나아가 현재 사용되고 있는 SARS-CoV-2 백신은 Wuhan-hu 바이러스 균주 정보를 기반으로 만들어진 것으로서, SARS-CoV-2 변이바이러스를 방어할 수 있도록 특화되어 있지 않은 바, SARS-CoV-2 변이바이러스의 전파까지 유효하게 예방이 가능하고 범용으로 사용될 수 있는 차세대백신의 개발이 시급한 상황이다.On the other hand, SARS-CoV-2 vaccine is being developed in a primate model based on SARS-CoV-2 research, and the SARS-CoV-2 vaccine under development has been shown to increase humoral and cellular immune responses through inoculation ( 2). However, some pharmaceutical companies are currently pursuing the development of a SARS-CoV-2 vaccine, but as it is still in the development stage, it is necessary to verify the effectiveness through preclinical and clinical trials. This is a required situation, and furthermore, the SARS-CoV-2 vaccine currently used is made based on information on the Wuhan-hu virus strain, and is not specialized to protect against SARS-CoV-2 mutant virus, SARS-CoV- 2 There is an urgent need to develop a next-generation vaccine that can effectively prevent the spread of mutated viruses and can be used universally.

본 발명의 목적은 SARS-CoV-2 감염예방을 위한 백신 조성물을 제공하는 것이다.It is an object of the present invention to provide a vaccine composition for preventing SARS-CoV-2 infection.

상기 목적을 달성하기 위하여 본 발명은 코로나바이러스(SARS-CoV-2)의 스파이크(spike) 단백질이 복제불능 아데노바이러스의 E1영역에 삽입되고, PgsA 및 코로나바이러스(SARS-CoV-2)의 뉴클레오캡시드(nucleocapsid) 단백질이 복제불능 아데노바이러스의 E3영역에 삽입된 형태로 발현되는 재조합 아데노바이러스를 제공한다.In order to achieve the above object, the present invention provides that a spike protein of a coronavirus (SARS-CoV-2) is inserted into the E1 region of a replication-deficient adenovirus, PgsA and a nucleo of a coronavirus (SARS-CoV-2) Provided is a recombinant adenovirus in which a capsid (nucleocapsid) protein is expressed in a form inserted into the E3 region of the replication-deficient adenovirus.

또한 본 발명은 E1영역에 서열번호 1의 아미노산서열을 포함하고, E3영역에 서열변호 2의 아미노산서열을 포함하는 재조합 아데노바이러스를 제공한다. The present invention also provides a recombinant adenovirus comprising the amino acid sequence of SEQ ID NO: 1 in the E1 region and the amino acid sequence of SEQ ID NO: 2 in the E3 region.

또한 본 발명은 상기 재조합 아데노바이러스에 의하여 제조되는 코로나바이러스(SARS-CoV-2) 백신을 제공한다. The present invention also provides a coronavirus (SARS-CoV-2) vaccine produced by the recombinant adenovirus.

또한 본 발명은 SARS-CoV-2 변이 바이러스에 작용하는 것을 특징으로 하는 코로나바이러스 백신을 제공한다. The present invention also provides a coronavirus vaccine characterized in that it acts on a SARS-CoV-2 mutant virus.

또한 본 발명은 D614G 변이 바이러스에 작용하는 것을 특징으로 하는 코로나바이러스 백신을 제공한다. The present invention also provides a coronavirus vaccine characterized in that it acts on the D614G mutant virus.

또한 본 발명은 어주번트(adjuvant)를 추가로 포함하는 것을 특징으로 하는 코로나바이러스 백신을 제공한다.The present invention also provides a coronavirus vaccine, characterized in that it further comprises an adjuvant.

본 발명에 의한 백신조성물은 체액성 면역반응 및 세포 매개성 반응을 유도하여 SARS-CoV-2에 대한 면역반응을 유도할 수 있다. The vaccine composition according to the present invention can induce an immune response against SARS-CoV-2 by inducing a humoral immune response and a cell-mediated response.

도 1은 SARS-CoV-2 구조 및 이를 암호화하는 유전자를 나타낸 것이다.
도 2는 백신접종을 통한 체액성 및 세포성 면역반응을 나타낸 것이다.
도 3은 아데노바이러스에 SARS-CoV-2 스파이크 단백질(S protein), PgsA 및 SARS-CoV-2 뉴클레오캡시드 단백질(N protein)을 코딩하는 유전자를 삽입한 모식도를 나타낸 것이다.
도 4는 본 발명에 의하여 재조합된 아데노바이러스를 감염시킨 세포의 스파이크 단백질 및 뉴클레오캡시드 단백질 발현여부를 나타낸 것이다.
도 5는 본 발명에 의하여 재조합된 아데노바이러스에 의한 CD80, CD86 및 MHCII 발현정도를 나타낸 것이다.
도 6은 본 발명에 의한 백신의 스파이크 항원에 대한 항체가를 나타낸 그래프이다.
도 7은 본 발명에 의한 백신 면역원성 형성의 안정성 평가를 나타낸 그래프이다.
도 8은 본 발명에 의한 백신의 중화능 평가를 나타낸 그래프이다.
도 9는 스파이크 항원에 대한 세포독성 T세포(cytotoxic T cell)의 기억능에 관한 그래프이다.
도 10은 스파이크 항원에 대한 도움 T세포(helper T cell)의 기억능에 관한 그래프이다.
도 11은 스파이크 항원에 의하여 세포특이적 면역반응이 유도되었음을 나타내는 그래프이다.
도 12는 본 발명에 의한 백신의 뉴클레오캡시드 항원에 대한 항체가를 나타낸 그래프이다.
도 13는 뉴클레오캡시드 항원에 대한 세포독성 T세포(cytotoxic T cell)의 기억능에 관한 그래프이다.
도 14은 뉴클레오캡시드 항원에 대한 도움 T세포(helper T cell)의 기억능에 관한 그래프이다.
도 15는 뉴클레오캡시드 항원에 의하여 세포특이적 면역반응이 유도되었음을 나타내는 그래프이다.
도 16, 17은 본 발명에 의하여 재조합된 아데노바이러스를 감염시킨 세포에서 발현되는 항원과 완치환자의 항체 사이에 일어나는 항원항체 반응을 확인한 것이다.
도 18은 본 발명에 의한 백신의 SARS-CoV-2 D614G 변이바이러스에 대한 체액성 면역을 나타내는 그래프이다. 1 shows the SARS-CoV-2 structure and a gene encoding the same.
Figure 2 shows the humoral and cellular immune responses through vaccination.
3 is a schematic diagram showing the insertion of genes encoding SARS-CoV-2 spike protein (S protein), PgsA and SARS-CoV-2 nucleocapsid protein (N protein) into adenovirus.
4 shows the expression of spike protein and nucleocapsid protein in cells infected with a recombinant adenovirus according to the present invention.
5 shows the expression levels of CD80, CD86 and MHCII by the adenovirus recombined according to the present invention.
6 is a graph showing the antibody titer to the spike antigen of the vaccine according to the present invention.
7 is a graph showing the evaluation of stability of vaccine immunogenicity formation according to the present invention.
8 is a graph showing the evaluation of the neutralizing ability of the vaccine according to the present invention.
9 is a graph relating to the memory capacity of cytotoxic T cells to the spike antigen.
10 is a graph relating to the memory capacity of helper T cells for the spike antigen.
11 is a graph showing that a cell-specific immune response was induced by the spike antigen.
12 is a graph showing the antibody titer to the nucleocapsid antigen of the vaccine according to the present invention.
13 is a graph showing the memory capacity of cytotoxic T cells to the nucleocapsid antigen.
14 is a graph relating to the memory capacity of helper T cells for the nucleocapsid antigen.
15 is a graph showing that a cell-specific immune response was induced by a nucleocapsid antigen.
16 and 17 confirm the antigen-antibody reaction between the antigen expressed in the cells infected with the recombined adenovirus according to the present invention and the antibody of a cured patient.
18 is a graph showing the humoral immunity of the vaccine according to the present invention to SARS-CoV-2 D614G mutant virus.

본 발명의 구체적인 일 실시예로서, 본 발명은 코로나바이러스(SARS-CoV-2)의 스파이크(spike) 단백질이 복제불능 아데노바이러스의 E1영역에 삽입되고, PgsA 및 코로나바이러스(SARS-CoV-2)의 뉴클레오캡시드(nucleocapsid) 단백질이 복제불능 아데노바이러스의 E3영역에 삽입된 형태로 발현되는 재조합 아데노바이러스를 제공한다.As a specific embodiment of the present invention, in the present invention, the spike protein of the coronavirus (SARS-CoV-2) is inserted into the E1 region of the replication-deficient adenovirus, PgsA and the coronavirus (SARS-CoV-2) It provides a recombinant adenovirus in which the nucleocapsid protein is expressed in a form inserted into the E3 region of the replication-deficient adenovirus.

스파이크 단백질은 막-원위 S1 서브유닛과 막-근위 S2 서브유닛으로 구성되며 바이러스 외피에 동종 삼량체로 존재하는데, S1 서브유닛은 수용체결합 도메인을 통해 수용체를 인식하고, S2 서브유닛은 바이러스 진입에 필요한 막 융합을 담당하는 바, 이러한 스파이크 단백질은 숙주세포 수용체와 결합시 필수적으로 작용하며, 감염시키는 숙주의 범위를 결정하는 요소로 알려져 있다. 뉴클레오캡시드는 바이러스 RNA와 결합된 뉴클레오캡시드 단백질로 구성되며, 뉴클레오캡시드 단백질은 바이러스 RNA 유전체에 결합하여 바이러스 입자 조립, 외피 형성, RNA합성 과정에서 유전체를 안정화하고 포장하는데 중요한 역할을 수행하는데, 뉴클레오캡시드 단백질은 돌연변이율이 낮다는 점에서 뉴클레오캡시드 단백질을 항원으로 사용시 SARS-CoV-2 변이바이러스에도 효과적으로 작용될 수 있다. The spike protein consists of a membrane-distal S1 subunit and a membrane-proximal S2 subunit and exists as a homotrimer in the viral envelope, where the S1 subunit recognizes receptors through its receptor binding domain and the S2 subunit is required for viral entry. This spike protein, which is responsible for membrane fusion, essentially acts upon binding to a host cell receptor, and is known as a factor determining the range of a host to infect. Nucleocapsid is composed of nucleocapsid protein bound to viral RNA. Nucleocapsid protein binds to viral RNA genome and plays an important role in stabilizing and packaging the genome during viral particle assembly, envelope formation, and RNA synthesis. , Since the nucleocapsid protein has a low mutation rate, when the nucleocapsid protein is used as an antigen, it can effectively act on SARS-CoV-2 mutant virus.

본 발명의 다른 일 실시예로서, 본 발명은 E1영역은 서열번호 1의 아미노산서열을 포함하고, E3영역은 서열변호 2의 아미노산서열을 포함하는 재조합 아데노바이러스를 제공한다. As another embodiment of the present invention, the present invention provides a recombinant adenovirus comprising the E1 region comprising the amino acid sequence of SEQ ID NO: 1 and the E3 region comprising the amino acid sequence of SEQ ID NO: 2.

또한 본 발명의 또 다른 일 실시예로서 재조합 아데노바이러스에 의하여 제조되는 SARS-CoV-2 백신을 제공한다. Also, as another embodiment of the present invention, there is provided a SARS-CoV-2 vaccine prepared by recombinant adenovirus.

본 발명에서 단백질은 서열번호 1, 2의 아미노산 서열을 갖는 폴리펩타이드일 수 있다. 상기 단백질은 서열번호 1, 2와 동일한 폴리펩타이드 뿐만 아니라 이의 아미노산이 보존적 치환에 의하여 치환된 폴리펩타이드, 이와 80 내지 99%, 85 내지 99%, 바람직하게는 90 내지 99%의 서열 상동성을 갖는 폴리펩타이드를 모두 포함할 수 있다.In the present invention, the protein may be a polypeptide having the amino acid sequence of SEQ ID NOs: 1 and 2. The protein has 80 to 99%, 85 to 99%, preferably 90 to 99% sequence homology therewith, not only of the polypeptide identical to SEQ ID NOs: 1 and 2, but also of a polypeptide in which amino acids are substituted by conservative substitution. It may include all polypeptides having

또한 본 발명의 또 다른 일 실시예로서 본 발명은 SARS-CoV-2 변이 바이러스에 작용하는 것을 특징으로 하는 코로나바이러스 백신을 제공하며, 상기 SARS-CoV-2 변이 바이러스는 D614G 변이 바이러스일 수 있다. Also, as another embodiment of the present invention, the present invention provides a coronavirus vaccine characterized in that it acts on a SARS-CoV-2 mutant virus, wherein the SARS-CoV-2 mutant virus may be a D614G mutant virus.

본 발명에서 사용한 용어 "백신 조성물"은 동물에서 면역학적 반응을 유도하는 적어도 하나 이상의 면역학적으로 활성인 성분을 함유하는 조성물을 의미한다.As used herein, the term “vaccine composition” refers to a composition containing at least one or more immunologically active ingredients that induce an immunological response in an animal.

본 발명에서 사용한 용어 "항원"은 바이러스의 구성성분 중 면역반응을 유도할 수 있는 성분으로서 바이러스가 발현하는 단백질을 의미한다.As used herein, the term “antigen” refers to a protein expressed by the virus as a component capable of inducing an immune response among the components of the virus.

본 발명에서 사용한 용어 "항체"는 면역계 내에서 항원의 자극에 의하여 만들어지는 성분으로서 특정한 항원과 특이적으로 결합하여 림프와 혈액을 떠돌며 항원-항체반응을 일으키는 단백질이다. 항원-항체 반응은 각 항원에 대하여 높은 특이성을 갖으며, 림프구의 B세포에서 항체가 만들어질 때 특정항원에 의해 생성된 항체는 원칙적으로 다른 항원과 반응하지 않는다. 이러한 높은 특이성은 면역, 알레르기, 각종 병 및 감염의 종류·형의 결정 등의 검사에 사용된다.The term "antibody" used in the present invention is a component produced by antigen stimulation in the immune system, and is a protein that specifically binds to a specific antigen and circulates in the lymph and blood and causes an antigen-antibody reaction. Antigen-antibody reaction has high specificity for each antigen, and when antibodies are made by B cells of lymphocytes, antibodies produced by specific antigens do not react with other antigens in principle. This high specificity is used for tests such as immunity, allergy, and determination of the type and type of various diseases and infections.

상기 백신 조성물은 당업계에 알려진 임의의 형태, 예를 들면, 액제 및 주사제의 형태 또는 현탁액에 적합한 고체 형태일 수 있으나, 이에 한정되는 것은 아니다. 이러한 제제는 또한 리포좀이나 가용 유리 내로 유화 또는 캡슐화되거나 에어로졸이나 스프레이 형태로도 제조될 수 있다. 이들은 경피(transdermal) 패치에 함유시킬 수도 있다. 액제 또는 주사제의 경우, 필요시 프로필렌글리콜 및 용혈 현상을 방지하는데 충분한 양의 염화나트륨을 함유할 수 있다.The vaccine composition may be in any form known in the art, for example, in the form of solutions and injections, or in solid form suitable for suspension, but is not limited thereto. Such formulations may also be emulsified or encapsulated in liposomes or soluble glass, or may be prepared in the form of an aerosol or spray. They may also be incorporated into transdermal patches. In the case of liquid or injection, if necessary, it may contain propylene glycol and sodium chloride in an amount sufficient to prevent hemolysis.

본 발명의 백신 조성물은 약제학적으로 허용가능한 담체 또는 희석제를 포함할 수 있다. 백신에 적합한 담체는 기술분야의 당업자에게 공지되어 있으며, 단백질, 당 등을 포함할 수 있지만, 이에 한정되는 것은 아니다. 상기의 담체는 수용액 또는 비-수용액, 현탁액, 및 에멀전일 수 있다. 비-수용액 담체의 예는 프로필렌글리콜, 폴리에틸렌 글리콜, 식용유 예컨대 올리브 오일, 및 주사 가능한 유기 에스테르 예컨대 에틸 올리에이트일 수 있다.The vaccine composition of the present invention may include a pharmaceutically acceptable carrier or diluent. Suitable carriers for vaccines are known to those skilled in the art and may include, but are not limited to, proteins, sugars, and the like. Such carriers may be aqueous or non-aqueous solutions, suspensions, and emulsions. Examples of non-aqueous carriers may be propylene glycol, polyethylene glycol, edible oils such as olive oil, and injectable organic esters such as ethyl oleate.

또한, 상기 백신 조성물은 어주번트(adjuvant, 면역조성제, 면역증강제)를 추가로 포함할 수 있다. 상기 어주번트는 면역반응의 향상 및/또는 접종 후 흡수 속도를 촉진하는 화합물 또는 혼합물을 칭하는 것으로 임의의 흡수-촉진제를 포함할 수 있다. 허용 가능한 어주번트로는 프로인트 완전 어주번트, 프로인트 불완전 어주번트, 사포닌, 미네랄 젤 예컨대 수산화 알루미늄, 계면활성제 예컨대 리소레시틴, 플루론 폴리올, 다중음이온, 펩타이드, 오일 또는 탄화수소 에멀전, 키홀림펫 헤모시아닌, 디니트로페놀 등을 포함할 수 있으나, 이에 한정되는 것은 아니다.In addition, the vaccine composition may further include an adjuvant (adjuvant, immune-enhancing agent, immune-enhancing agent). The adjuvant refers to a compound or mixture that enhances the immune response and/or promotes the rate of absorption after inoculation, and may include any absorption-promoting agent. Acceptable adjuvants include Freund's complete adjuvant, Freund's incomplete adjuvant, saponins, mineral gels such as aluminum hydroxide, surfactants such as lysolecithin, plurone polyols, polyanions, peptides, oil or hydrocarbon emulsions, keyholimpet he It may include, but is not limited to, mocyanine, dinitrophenol, and the like.

본 발명의 백신 조성물은 경구, 경피, 근육내, 복막내, 정맥내, 피하내 또는 비강으로 이루어진 군으로부터 선택되는 어느 하나의 투여경로를 통해 투여될 수 있으며, 바람직하게는 주사로 투여되는 것이 바람직하다.The vaccine composition of the present invention may be administered via any one administration route selected from the group consisting of oral, transdermal, intramuscular, intraperitoneal, intravenous, subcutaneous or nasal, preferably administered by injection. Do.

본 발명에서 용어 "SARS-CoV-2 감염 질환"이란 SARS-CoV-2 바이러스의 감염으로 유발되는 질환으로서, 부비강염, 발작적 천식, 중이염, 낭성 섬유종, 기관지염, 폐렴, 설사 등을 유발할 수 있으나, 이에 한정되지 않는다.As used herein, the term "SARS-CoV-2 infection disease" is a disease caused by infection with SARS-CoV-2 virus, which may cause sinusitis, paroxysmal asthma, otitis media, cystic fibrosis, bronchitis, pneumonia, diarrhea, etc. not limited

본 발명의 백신 조성물은 약제학적으로 유효한 양으로 투여한다. 본 발명의 용어 "약제학적으로 유효한 양"이란, 백신효과를 나타낼 수 있을 정도의 충분한 양으로, 부작용 또는 심각하거나 과도한 면역반응을 일으키지 않을 정도의 양을 의미하며, 유효 용량의 수준은 치료하려는 장애, 장애의 중증도, 특정 화합물의 활성, 투여 경로, 단백질의 제거 속도, 치료 지속 기간, 단백질과 조합되거나 동시에 사용되는 약물, 개체의 연령,체중, 성별, 식습관, 일반적인 건강 상태 및 의학 분야에 공지된 인자를 비롯한 다양한 인자들에 따라 달라질 수 있다.The vaccine composition of the present invention is administered in a pharmaceutically effective amount. As used herein, the term "pharmaceutically effective amount" refers to an amount sufficient to exhibit a vaccine effect, and not to cause side effects or serious or excessive immune response, and the level of effective dose is determined by the disorder to be treated. , the severity of the disorder, the activity of the particular compound, the route of administration, the rate of removal of the protein, the duration of treatment, the drug used in combination with or concurrently with the protein, the age, weight, sex, diet, general health condition of the subject, and known in the medical arts. It may depend on a variety of factors, including factors.

이하, 구체적인 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 예시하기 위한 것으로서, 본 발명의 범위가 이들 실시예에 의해 제한되는 것으로 해석되지 않는 것은 당업계에서 통상의 지식을 가진 자에 있어서 자명할 것이다.Hereinafter, the present invention will be described in more detail through specific examples. These examples are only for illustrating the present invention, and it will be apparent to those of ordinary skill in the art that the scope of the present invention is not to be construed as being limited by these examples.

실시예 1. 재조합 아데노바이러스 벡터를 이용한 SARS-CoV-2 백신 제조Example 1. Preparation of SARS-CoV-2 vaccine using recombinant adenoviral vector

본 실시예에서는 SARS-CoV-2 바이러스에 대한 백신 후보군으로서 당단백질인 스파이크 단백질과 뉴클레오캡시드 단백질을 동시 발현하는 백신을 제조하기 위하여, 복제불능 아데노바이러스의 E1영역에 SARS-CoV-2 스파이크(spike, S) 단백질을 코딩하는 유전자를 삽입하고, 복제불능 아데노바이러스의 E3영역에 세포막 고정 능력이 있는 (membrane anchoring protein) 단백질인 PgsA 및 SARS-CoV-2 뉴클레오캡시드(nucleocapsid, N) 단백질을 코딩하는 유전자를 삽입하였는 바(도 3), PgsA는 뉴클레오캡시드 단백질을 세포막에 발현시킬 수 있도록 하는 역할을 하며, 삽입된 유전자들은 포유류 세포 발현에 대하여 최적화된 코돈으로서, 이에 의하여 발현되는 단백질은 체액성면역반응 및 세포매개성 반응을 유도하여 SARS-CoV-2 바이러스 감염 억제능을 가지게 된다.In this example, in order to prepare a vaccine that simultaneously expresses the glycoprotein spike protein and the nucleocapsid protein as a vaccine candidate for SARS-CoV-2 virus, the SARS-CoV-2 spike ( spike, S) protein-coding gene is inserted, and PgsA and SARS-CoV-2 nucleocapsid (N) proteins, which are proteins with membrane anchoring ability, are inserted in the E3 region of replication-defective adenovirus. As the coding gene was inserted (FIG. 3), PgsA serves to enable expression of the nucleocapsid protein in the cell membrane, and the inserted genes are codons optimized for mammalian cell expression, and the protein expressed thereby is It has the ability to inhibit SARS-CoV-2 virus infection by inducing a humoral immune response and a cell-mediated response.

실시예 2. 스파이크 단백질 및 뉴클레오캡시드 단백질 발현확인Example 2. Spike protein and nucleocapsid protein expression confirmation

Western blot을 통하여 스파이크 단백질 및 뉴클레오캡시드 단백질의 발현여부를 확인한 결과를 도 4에 나타내었다. 구체적으로, 각 단백질(항원)들의 발현 여부를 관찰하기 위해 제작된 후보군 1 내지 4(#1, #2, #3, #4)를 6well에 5x105 cells로 시딩(seeding)한 HEK293에 감염시킨 후 48시간 뒤에 스파이크 항체(anti spike) 및 PgsA 항체(anti PgsA)를 이용하여 western blot을 통해 발현 여부를 관찰하였고(도 4), 그 중 발현양이 가장 우수한 후보군 3(#3)을 이용하여 후속 실험을 진행하였으며, 후보군 3의 서열은 다음과 같다. The results of confirming the expression of the spike protein and the nucleocapsid protein through Western blot are shown in FIG. 4 . Specifically, candidate groups 1 to 4 (#1, #2, #3, #4) prepared to observe the expression of each protein (antigen) were infected with HEK293 seeded with 5x10 5 cells in 6well. After 48 hours, the expression was observed by western blot using the spike antibody and the PgsA antibody (anti PgsA) (Fig. 4). Among them, the candidate group 3 (#3) with the best expression was used A follow-up experiment was conducted, and the sequence of candidate group 3 is as follows.

먼저, SARS-CoV-2 스파이크 단백질을 코딩하는 유전자가 삽입된 아데노바이러스 E1의 아미노산 서열은 하기 서열번호 1과 같다. First, the amino acid sequence of adenovirus E1 into which the gene encoding the SARS-CoV-2 spike protein is inserted is shown in SEQ ID NO: 1 below.

서열번호 1SEQ ID NO: 1

5`MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGSKPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPSRAGSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT 3` 5`MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGSKPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPSRAGSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLIT GRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT 3`

다음으로, PgsA 및 SARS-CoV-2 뉴클레오캡시드(nucleocapsid) 단백질을 코딩하는 유전자가 삽입된 아데노바이러스 E3의 아미노산 서열은 하기 서열번호 2와 같다.Next, the amino acid sequence of adenovirus E3 into which genes encoding PgsA and SARS-CoV-2 nucleocapsid proteins are inserted is shown in SEQ ID NO: 2 below.

서열번호 2SEQ ID NO: 2

5`MKKELSFHEKLLKLTKQQKKKTNKHVFIAIPIVFVLMFAFMWAGKAETPKVKTYSDDVLSASFVGDIMMGRYVEKVTEQKGADSIFQYVEPIFRASDYVAGNFENPVTYQKNYKQADKEIHLQTNKESVKVLKDMNFTVLNSANNHAMDYGVQGMKDTLGEFAKQNLDIVGAGYSLSDAKKKISYQKVNGVTIATLGFTDVSGKGFAAKKNTPGVLPADPEIFIPMISEAKKHADIVVVQSHWGQEYDNDPNDRQRQLARAMSDAGADIIVGHHPHVLEPIEVYNGTVIFYSLGNFVFDQGWTRTRDSALVQYHLKKNGTGRFEVTPIDIHEATPAPVKKDSLKQKTIIRELTKDSNFAWKVEDGKLTFDIDHSDKLKSKGGSGGSGGSGGSGGSIGYYRRATRRIRGGPAPAPIIWVATEGAPAPAPLLLLDRLNQLPAPAPRTATKAYNVPAPAPFAPSASAFFGMSRIGMEVPAPAPTWLTYTGAIKLDDKDPNFKDQVILLPAPAPKHIDAYKTFPPTEPKK 3` 5`MKKELSFHEKLLKLTKQQKKKTNKHVFIAIPIVFVLMFAFMWAGKAETPKVKTYSDDVLSASFVGDIMMGRYVEKVTEQKGADSIFQYVEPIFRASDYVAGNFENPVTYQKNYKQADKEIHLQTNKESVKVLKDMNFTVLNSANNHAMDYGVQGMKDTLGEFAKQNLDIVGAGYSLSDAKKKISYQKVNGVTIATLGFTDVSGKGFAAKKNTPGVLPADPEIFIPMISEAKKHADIVVVQSHWGQEYDNDPNDRQRQLARAMSDAGADIIVGHHPHVLEPIEVYNGTVIFYSLGNFVFDQGWTRTRDSALVQYHLKKNGTGRFEVTPIDIHEATPAPVKKDSLKQKTIIRELTKDSNFAWKVEDGKLTFDIDHSDKLKSKGGSGGSGGSGGSGGSIGYYRRATRRIRGGPAPAPIIWVATEGAPAPAPLLLLDRLNQLPAPAPRTATKAYNVPAPAPFAPSASAFFGMSRIGMEVPAPAPTWLTYTGAIKLDDKDPNFKDQVILLPAPAPKHIDAYKTFPPTEPKK 3`

상기 후보군 3의 스파이크 단백질 및 뉴클레오캡시드 단백질의 발현정도를 확인하기 위하여, 본 발명에 의한 바이러스를 면역 세포인 Raw264.7 세포에 처리하였을 때 Co-자극성 분자 (CD80, CD86) 및 II군 주요 조직 적합 유전자 복합체(Major histocompatibility complex II, MHCII) 발현정도를 각각 확인하여 도 5에 나타내었다. In order to confirm the expression level of the spike protein and nucleocapsid protein of candidate group 3, when the virus according to the present invention was treated with immune cells, Raw264.7 cells, Co-stimulatory molecules (CD80, CD86) and group II major tissues The expression level of the suitable gene complex (Major histocompatibility complex II, MHCII) was confirmed and shown in FIG. 5 .

B7 단백질은 활성화된 면역세포에서 나타나는 주변부 막 단백질로, T 세포의 표면 단백질인 CD28이나 CD152와의 상호작용으로 면역 세포와 T 세포 사이의 MHC-TCR 신호전달을 증가시키거나 감소시키는 공동자극 신호를 만들 수 있는데, B7 단백질에는 B7-1(CD80)와 B7-2(CD86) 두 가지 주요 타입이 있고, CD28과 CTLA-4는 각각 CD80과 CD86 모두와 상호작용한다. 또한, II 군 주요 조직 적합 유전자 복합체(Major histocompatibility complex II; MHCII) 분자들은 외부 항원이 면역 세포에 도입되었을때 세포내에서 단편으로 분해 후 외부에 항원 노출 및 발현을 시키는 역할을 하는 바, 이러한 CD80, CD86 및 MHCII는 항원 전달능의 평가 지표가 될 수 있다. B7 protein is a peripheral membrane protein that appears in activated immune cells. It interacts with T-cell surface proteins, CD28 or CD152, to produce a costimulatory signal that increases or decreases MHC-TCR signaling between immune cells and T cells. There are two main types of B7 proteins, B7-1 (CD80) and B7-2 (CD86), and CD28 and CTLA-4 interact with both CD80 and CD86, respectively. In addition, group II major histocompatibility complex II (MHCII) molecules play a role in exposing and expressing antigens to the outside after decomposition into fragments within the cells when foreign antigens are introduced into immune cells. , CD86 and MHCII can be evaluation indicators of antigen delivery ability.

구체적으로 Raw264.7 세포에 본 발명에 의한 바이러스를 20moi로 감염시킨 후 48시간 뒤 세포를 각각 Co-자극성 분자 (CD80, CD86), MHCII를 이용하여 염색하고, navios flow cytometer(Beckman Coulter사)를 이용하여 발현도를 검출하였으며, 데이터는 MFI (평균 형광강도; mean fluorescence intensity)로 표현하였는 바, 항원이 도입되지 않은 Mock과 비교하여 스파이크 단백질 및 뉴틀레오캡티드 단백질이 도입된 백신에서 CD80, CD86, MHCII 분자들의 발현양이 현저하게 증가하였음을 확인할 수 있다(도 5).Specifically, after infecting Raw264.7 cells with 20 moi of the virus according to the present invention, 48 hours later, the cells were stained with Co-stimulatory molecules (CD80, CD86) and MHCII, respectively, and a navios flow cytometer (Beckman Coulter) was used. The expression level was detected using MFI (mean fluorescence intensity), and the data were expressed as MFI, CD80, CD86, It can be seen that the expression level of MHCII molecules was significantly increased (FIG. 5).

실시예 3. 스파이크 항원에 대한 면역원성 확인Example 3. Confirmation of Immunogenicity to Spike Antigen

실시예 3-1. 체액성 면역 확인Example 3-1. Confirmation of humoral immunity

먼저 본 발명에 의한 백신의 면역원성을 평가하기 위해 스파이크 단백질(항원)에 대한 항체가(antibody titer) 검증을 실시하였다. 여기서 항체가는 특정 항원에 대해서 대응하는 항체의 역가로서 항체의 양을 나타내는 단위이고 항체를 포함한 용액을 희석해 동일량의 항원을 가한 경우에 반응이 생기는 최대희석 농도의 역수로 표시한다. First, in order to evaluate the immunogenicity of the vaccine according to the present invention, antibody titer against the spike protein (antigen) was verified. Here, the antibody titer is the titer of the antibody corresponding to a specific antigen, a unit indicating the amount of antibody, and is expressed as the reciprocal of the maximum dilution concentration at which a reaction occurs when the same amount of antigen is added after diluting a solution containing the antibody.

본 실시예에서는 그룹당 다섯 마리의 암컷 BALB/c 마우스(Orient, Korea) 6 내지 8주령 마우스를 이용하여, 0 및 14일 째에 5x108, 5x109, 1x1010, 5x1010VP(viral particles)로 mock 및 SARS-CoV-2 백신을 근육 접종을 통해 각각 면역화시킨 후 28일째에 마우스의 혈청을 분리하였다. 이 후, 효소 면역 측정법(enzyme-linked immunosorbent assay; ELISA)을 통하여 SARS-CoV-2 스파이크 단백질 특이적 항체반응을 측정하였다. 마이크로타이터플레이트(Microtiter plate, Nunc, Denmark)에 50mM 중탄산나트륨 완충액(pH 9.6)중에서 100ng/well로 스파이크 단백질100 μL를 코팅하고, 4℃에서 밤새 배양하였다. 그 후 플레이트를 PBST(PBS+0.05% tween20)로 세척하고, 실온에서 1시간 동안 PBS 중에서 1% BSA(Bovine Serum Albumin, 우태아혈청알부민)로 블록킹시킨 후, 혈청을 상기 블록킹완충액을 이용하여 1/800, 1/3200, 1/12800, 1/51200으로 희석하였다. 그 후, 시료 100μL를 각 웰에 도말한 후 상온에서 1시간 동안 배양하고, PBST 400 μL로 4회 세척 후 mouse IgG-HRP를 1:1000 비율로 희석 후 플레이트에 100 μL로 도말하고 상온에서 1시간 동안 배양하였다. 그 후 PBST 400 μL로 4회 세척 후 TMB기질 용액100 μL로 암중에서 20분 동안 색상을 발현시켰다. 그 후 2N 황산 용액으로 반응을 정지시킨 후 마이크로플레이트 리더기(Thermoscientific사의 multiskansky)에서 450nm에서의 흡수능을 측정하였는 바, 항체가는 Cutoff value: the mean optical density values at 450nm (OD450)+3×standard derivations (SD) from the sera of non-vaccinated animals (Nat Commun. 2020; 11: 4207) 문헌을 참조하여 결정하였고, 1x1010VP 이상에서 안정적인 항체가를 나타내는 것을 확인할 수 있었다(도 6).In this example, using 5 female BALB/c mice per group (Orient, Korea) 6 to 8 weeks old mice, 5x10 8 , on days 0 and 14, 5x10 9 , After immunization with 1x10 10 , 5x10 10 VP (viral particles) mock and SARS-CoV-2 vaccine through intramuscular inoculation, respectively, mouse serum was isolated on the 28th day. Thereafter, the SARS-CoV-2 spike protein-specific antibody response was measured through an enzyme-linked immunosorbent assay (ELISA). A microtiter plate (Nunc, Denmark) was coated with 100 µL of the spike protein at 100 ng/well in 50 mM sodium bicarbonate buffer (pH 9.6), and incubated at 4°C overnight. Thereafter, the plate was washed with PBST (PBS+0.05% tween20), blocked with 1% BSA (Bovine Serum Albumin, fetal bovine serum albumin) in PBS for 1 hour at room temperature, and then serum was treated with the blocking buffer 1 It was diluted to /800, 1/3200, 1/12800, 1/51200. After that, 100 μL of the sample was smeared on each well, incubated for 1 hour at room temperature, washed 4 times with 400 μL of PBST, diluted with mouse IgG-HRP at a 1:1000 ratio, spread on a plate in 100 μL, and 1 at room temperature incubated for hours. After washing 4 times with 400 μL of PBST, 100 μL of TMB substrate solution was used to develop color for 20 minutes in the dark. After stopping the reaction with 2N sulfuric acid solution, the absorption capacity at 450 nm was measured in a microplate reader (multiskansky, manufactured by Thermoscientific). SD) from the sera of non-vaccinated animals (Nat Commun. 2020; 11: 4207) was determined with reference to the literature, and it was confirmed that the antibody titer was stable at 1x10 10 VP or more ( FIG. 6 ).

본 발명에 의한 SARS-CoV-2 백신 접종 후 항체형성 기간을 확인하기 위하여, 그룹당 다섯 마리의 암컷BALB/c 마우스(Orient, Korea) 6 내지 8주령을 이용하였다. 마우스를 0 및 14일째에 1x1010VP로 mock 및 SARS-CoV-2 백신을 근육 접종을 통해 면역화시켰으며, 2주, 4주, 6주째에 마우스에서 혈청을 분리한 후, 효소 면역 측정법(enzyme-linked immunosorbent assay; ELISA)으로 SARS-CoV-2 스파이크 특이적 항체반응을 측정하였다. 마이크로타이터플레이트(Microtiter plate, Nunc, Denmark)에 50mM 중탄산나트륨 완충액(pH 9.6)중에서 100ng/well로 스파이크 단백질100 μL를 코팅하고, 4℃에서 밤새 배양하였다. 그 후 플레이트를 PBST(PBS+0.05% tween20)로 세척하고, 실온에서 1시간 동안 PBS 중에서 1% BSA(우태아혈청알부민)로 블록킹시켰다. 상기 블록킹완충액으로 혈청을 1/800, 1/3200, 1/12800, 1/51200로 희석한 후, 시료100μL를 각 웰에 도말하고 상온에서 1시간 동안 배양하였다. 다음으로 PBST 400μL로 4회 세척 후 mouse IgG-HRP를 1:1000 비율로 희석 후 플레이트에 100μL로 도말하고 상온에서 1시간 동안 배양하였고, PBST 400μL로 4회 세척 후 TMB기질 용액100 μL로 암중에서 20분 동안 색상을 발현시켰다. 그 후 2N 황산 용액으로 반응을 정지시킨 후 마이크로플레이트 리더기(Thermoscientific사의 multiskansky)에서 450nm에서의 흡수능을 측정하였다. 항체가는 Cutoff value: the mean optical density values at 450nm (OD450)+3×standard derivations (SD) from the sera of non-vaccinated animals (Nat Commun. 2020; 11: 4207) 문헌을 참조하여 결정하였는 바(도 7), 접종 후 2주 시점부터 안정적으로 SARS-CoV-2 스파이크 단백질 특이적 항체가 형성되는 것을 확인할 수 있다. In order to confirm the period of antibody formation after SARS-CoV-2 vaccination according to the present invention, five female BALB/c mice per group (Orient, Korea) 6 to 8 weeks old were used. Mice were immunized with mock and SARS-CoV-2 vaccines via intramuscular inoculation at 1x10 10 VP on days 0 and 14, and after sera was isolated from mice at 2 weeks, 4 weeks, and 6 weeks, enzyme immunoassay (enzyme -linked immunosorbent assay; ELISA) was used to measure the SARS-CoV-2 spike-specific antibody response. A microtiter plate (Nunc, Denmark) was coated with 100 µL of the spike protein at 100 ng/well in 50 mM sodium bicarbonate buffer (pH 9.6), and incubated at 4°C overnight. The plates were then washed with PBST (PBS+0.05% tween20) and blocked with 1% BSA (fetal bovine serum albumin) in PBS for 1 hour at room temperature. After diluting the serum to 1/800, 1/3200, 1/12800, and 1/51200 with the blocking buffer, 100 μL of the sample was spread on each well and incubated for 1 hour at room temperature. Next, after washing 4 times with 400 μL of PBST, dilute mouse IgG-HRP at a ratio of 1:1000, spread it on a plate at 100 μL, and incubate for 1 hour at room temperature. After washing 4 times with 400 μL of PBST, it was washed in the dark with 100 μL of TMB substrate solution. The color was developed for 20 minutes. After stopping the reaction with 2N sulfuric acid solution, the absorption capacity at 450 nm was measured in a microplate reader (multiskansky manufactured by Thermoscientific). Antibody titer Cutoff value: the mean optical density values at 450nm (OD450)+3×standard derivations (SD) from the sera of non-vaccinated animals (Nat Commun. 2020; 11: 4207) It was determined with reference to the literature (Fig. 7), it can be confirmed that the SARS-CoV-2 spike protein-specific antibody is stably formed from 2 weeks after inoculation.

다음으로 본 발명에 의한 백신의 면역원성을 평가하기 위해 스파이크 단백질(항원)에 대한 중화항체가(neutralizing antibody titer) 검증을 실시하였다. 여기서 중화항체는 항체가 병원체의 표면 구조에 결합하여 이들이 세포에 결합하는 것을 억제함으로써 감염 차단, 확산 억제, 독소의 병적인 효과를 제거하는 이른바 중화작용(neutralization)을 통해 면역을 매개하는 것을 의미한다. Next, in order to evaluate the immunogenicity of the vaccine according to the present invention, neutralizing antibody titer against the spike protein (antigen) was verified. Here, the neutralizing antibody means that the antibody binds to the surface structure of the pathogen and inhibits their binding to cells, thereby mediating immunity through so-called neutralization, which blocks infection, suppresses proliferation, and eliminates the pathological effects of toxins. .

본 발명에 의한 SARS-CoV-2 백신의 중화능을 평가하기 위하여 그룹당 다섯 마리의 암컷BALB/c 마우스(Orient, Korea) 6 내지 8주령을 이용하였다. 마우스를 0 및 14일째에 1x1010VP로 mock 및 SARS-CoV-2 백신을 근육 접종을 통해 면역화시켰으며, 최종 투여 3주 후 마우스의 혈청을 분리하였다. 중화능측정은 SARS-CoV-2의 viral glycoprotein S1 RBD와 세포 표면의 ACE2 수용체의 결합을 저해시키는 anti-SARS-CoV-2 중화항체를 검출하는 ELISA 키트를 이용하였다. 혈청을 1/2, 1/8, 1/32, 1/128, 1/512, 1/1024, 1/16384로 각각 희석 후 키트 내의 RBD-HRP 접합체와 반응시키고, 혈청 내에 RBD에 대한 중화항체가 존재할 경우, RBD-HRP 와 결합을 이루게 된다. 마이크로플레이트에는 human ACE2 재조합 항원이 코팅되어 있고, 사전에 반응된 혼합물을 플레이트에 로딩한다. 플레이트에 로딩된 혼합물에 중화항체가 없는 경우 RBD-HRP는 ACE2에 결합하지만, 중화항체가 존재하는 경우에는 RBD-hACE2의 결합을 저해하게 된다. 그 후 세척 단계를 통해 결합되지 않은 성분들을 제거한 후, HRP 기질 용액을 첨가하여 10분간 암흑에서 반응시키고, 반응 정지액을 넣고 플레이트리더기(Thermoscientific사의 multiskansky)로 450nm의 흡광도값을 측정하였다(도 8).In order to evaluate the neutralizing ability of the SARS-CoV-2 vaccine according to the present invention, five female BALB/c mice per group (Orient, Korea) 6 to 8 weeks old were used. Mice were immunized with mock and SARS-CoV-2 vaccines via intramuscular inoculation with 1x10 10 VP on days 0 and 14, and serum of mice was isolated 3 weeks after final administration. Neutralization capacity was measured using an ELISA kit that detects anti-SARS-CoV-2 neutralizing antibody that inhibits the binding of SARS-CoV-2 viral glycoprotein S1 RBD to cell surface ACE2 receptors. Serum was diluted to 1/2, 1/8, 1/32, 1/128, 1/512, 1/1024, 1/16384, respectively, and reacted with the RBD-HRP conjugate in the kit, and neutralizing antibody against RBD in the serum When present, it forms a bond with RBD-HRP. The microplate is coated with human ACE2 recombinant antigen, and the pre-reacted mixture is loaded onto the plate. In the absence of neutralizing antibody in the mixture loaded on the plate, RBD-HRP binds to ACE2, but in the presence of neutralizing antibody, binding of RBD-hACE2 is inhibited. After removing the unbound components through a washing step, the HRP substrate solution was added and reacted in the dark for 10 minutes, the reaction stop solution was added, and the absorbance value at 450 nm was measured with a plate reader (multiskansky, manufactured by Thermoscientific) (Fig. 8). ).

저해율계산은 키트내 있는 음성대조액을 사용하였으며, triple로 loading하여 3개의 흡광도의 평균값을 계산하였다.The inhibition rate was calculated using the negative control solution in the kit, and the average value of the three absorbances was calculated by loading in triple.

저해율(%)=1-((시료의 흡광도/음성대조액흡광도평균값)*100)%Inhibition rate (%) = 1-((Average absorbance of sample / absorbance of negative control solution) * 100)%

도 8에 따르면, 저해율(Inhibition %) 50%에 해당하는 혈청의 중화항체가는 약 400정도로서 본 발명에 의한 SARS-CoV-2 백신의 중화능을 확인하였다. According to FIG. 8 , the neutralizing antibody titer of the serum corresponding to 50% of the inhibition rate was about 400, confirming the neutralizing ability of the SARS-CoV-2 vaccine according to the present invention.

실시예 3-2. 세포성 면역 확인Example 3-2. Cellular Immunity Confirmation

본 발명에 의한 백신의 스파이크 단백질에 대한 세포 매개성 면역반응을 확인하기 위하여 6 내지 8주령 암컷BALB/c 마우스(Orient, Korea)의 비장에서 단일 세포를 분리한 후 유세포분석기를 통해 T세포에서 면역반응을 유도하는데 있어서 중요한 여러 가지 사이토카인의 분비 정도를 측정하였다. In order to confirm the cell-mediated immune response to the spike protein of the vaccine according to the present invention, single cells were isolated from the spleen of 6 to 8-week-old female BALB/c mice (Orient, Korea) and then immunized from T cells through flow cytometry. The secretion levels of various cytokines important in inducing a response were measured.

본 실시예에서는 그룹 당 다섯 마리의 마우스를 0 및 14일 째에 1x1010VP로 mock 및 SARS-CoV-2 백신을 근육 접종을 통해 면역화시킨 후 3주 뒤 마우스의 비장을 적출하여 비장세포(splenocyte)를 분리한 후 24웰플레이트에 웰당 1 x 106세포로 시딩(seeding)하고, SARS-CoV-2 스파이크 20 μg/mL로 24시간 동안 재자극하였다. 그 후 단백질 운반 저해제인 GolgiPlug(BD Biosciences)를 가하여 세포질에 사이토카인을 집적시키고, 6시간 동안 배양하였다. 이 후 PBS로 세척한 후, 세포를 BD Cytofix/cytoperm키트(BD Biosciences)에 통과시키고, 항-CD4, CD8, CD45, IFN-gamma 및 GranzymeB(BD Biosciences)로 염색하였다. CD4는 항-CD4, CD45로 gating한 후 gating안에 있는 세포에서 IFN-gamma, 및 GranzymeB를 동시 발현하는 세포를 Beckman Coulter사의 naviosflow cytometer를 이용하여 세포 관련 형광도의 수준을 측정하였다. CD8은 항-CD8, CD45로 gating한 후 gating안에 있는 세포에서 IFN-gamma, 및 GranzymeB를 동시 발현하는 세포를 Beckman Coulter사의 naviosflow cytometer를 이용하여 세포 관련 형광도의 수준을 측정하였다(도 9, 10). 도 9, 도 10에 따르면, 대조군에 비해 본 발명에 의한 백신으로 면역화시킨 마우스에서 IFN-gamma, 및 GranzymeB 사이토카인을 분비하는 세포가 유의적으로 증가된 것을 확인할 수 있다. 이는 백신이 접종된 마우스에 SARS-CoV-2 바이러스로 감염되었을 때 체내의 T-cell들이 활성화되어 외래 인자를 사멸 시킬 수 있는 IFN-gamma, 및 GranzymeB를 분비하는 것을 의미한다.In this example, five mice per group were immunized with mock and SARS-CoV-2 vaccines at 1x10 10 VP on days 0 and 14 through intramuscular inoculation, and 3 weeks later, the spleens of mice were extracted and splenocytes (splenocytes) were used. ), seeded at 1 x 10 6 cells per well in a 24-well plate, and restimulated with 20 μg/mL of SARS-CoV-2 spikes for 24 hours. After that, a protein transport inhibitor, GolgiPlug (BD Biosciences) was added to accumulate cytokines in the cytoplasm, and cultured for 6 hours. After washing with PBS, the cells were passed through a BD Cytofix/cytoperm kit (BD Biosciences) and stained with anti-CD4, CD8, CD45, IFN-gamma and GranzymeB (BD Biosciences). After gating with anti-CD4 and CD45 for CD4, cells co-expressing IFN-gamma and GranzymeB in the gating were measured for cell-related fluorescence levels using a Beckman Coulter naviosflow cytometer. After gating with CD8 anti-CD8 and CD45, cells co-expressing IFN-gamma and GranzymeB in the cells in the gating were measured for cell-related fluorescence levels using a naviosflow cytometer manufactured by Beckman Coulter (Figs. 9 and 10). ). 9 and 10 , it can be confirmed that cells secreting IFN-gamma and GranzymeB cytokines in mice immunized with the vaccine according to the present invention were significantly increased compared to the control group. This means that when vaccinated mice are infected with SARS-CoV-2 virus, T-cells in the body are activated to secrete IFN-gamma and GranzymeB that can kill foreign factors.

또 다른 실시예에서는 본 발명에 의한 SARS-CoV-2 백신이 유도하는 스파이크 항원에 특이적인 IFN-gamma ELISPOT 반응을 도 11에 나타내었으며, SARS-CoV-2 백신의 면역화만으로도 특이적 세포성 면역반응이 유도되었음을 확인할 수 있다. 구체적으로, 그룹 당 다섯 마리의 마우스를 0 및 14일째에 1x1010VP로 mock 및 SARS-CoV-2 백신을 근육 접종을 통해 면역화시킨 후 3주 뒤 마우의 비장을 적출하여 비장세포(splenocyte)를 분리하여 24웰플레이트에 웰당 1 x 106세포로 시딩(seeding)하고, SARS-CoV-2 스파이크 20μg/mL로 48 시간 동안 재자극하였다. 그 후 IFN-gamma ELISPOT assay 키트를 이용하여 스파이크 특이적 IFN-gamma ELISPOT 반응을 확인하였다. 도 11에 따르면, Mock으로 면역화된 마우스보다 백신 접종된 마우스의 비장에서 항원 특이적으로 IFN gamma를 생성하는 세포수(spot number)가 유의적으로 증가하는 것을 관찰할 수 있는데, 이는 본 발명에 의한 백신을 접종한 마우스에서는 백신 항원에 대한 기억능에 의하여 T-cell이 생성되어, 이차적 자극에 대해서도 항원 특이적 세포성 면역반응을 한다고 해석될 수 있다. In another embodiment, the IFN-gamma ELISPOT response specific to the spike antigen induced by the SARS-CoV-2 vaccine according to the present invention is shown in FIG. 11, and the specific cellular immune response only by immunization with the SARS-CoV-2 vaccine It can be confirmed that this has been induced. Specifically, five mice per group were immunized with mock and SARS-CoV-2 vaccines at 1x10 10 VP on days 0 and 14 through intramuscular inoculation, and then 3 weeks later, the spleens of mice were harvested to obtain splenocytes. It was separated and seeded at 1 x 10 6 cells per well in a 24-well plate, and restimulated with 20 μg/mL of SARS-CoV-2 spikes for 48 hours. Thereafter, the spike-specific IFN-gamma ELISPOT response was confirmed using an IFN-gamma ELISPOT assay kit. According to FIG. 11, it can be observed that the number of cells (spot number) producing antigen-specific IFN gamma in the spleen of the vaccinated mouse than in the mouse immunized with the mock increases significantly, which is according to the present invention. In the vaccinated mouse, T-cell is generated by the memory for the vaccine antigen, which can be interpreted as an antigen-specific cellular immune response to the secondary stimulus.

실시예 4. 뉴클레오캡시드 항원에 대한 면역원성 확인Example 4. Confirmation of Immunogenicity to Nucleocapsid Antigen

실시예 4-1. 체액성 면역 확인Example 4-1. Confirmation of humoral immunity

먼저 본 발명에 의한 백신의 면역원성을 평가하기 위해 뉴클레오캡시드(항원)에 대한 항체가(antibody titer) 검증을 실시하였다. 본 실시예에서는 그룹당 다섯 마리의 암컷 BALB/c 마우스(Orient, Korea) 6 내지 8주령 마우스를 이용하여, 0 및 14일째에 1x1010VP로 mock 및 SARS-CoV-2 백신을 근육 접종을 통해 면역화시킨 후 28일째에 마우스의 혈청을 분리하여 효소 면역 측정법(enzyme-linked immunosorbent assay; ELISA)으로 뉴클레오캡시드 특이적 항체 반응을 측정하였다. 마이크로타이터플레이트(Microtiter plate, Nunc, Denmark)에 50mM 중탄산나트륨 완충액(pH 9.6)중에서 100ng/well로 스파이크 단백질100 μL를 코팅하고, 4℃에서 밤새 배양하였다. 플레이트를 PBST(PBS+0.05% tween20)로 세척하고, 실온에서 1시간 동안 PBS 중에서 1%BSA(우태아혈청알부민)로 블록킹시키고, 혈청 1/800, 1/3200, 1/12800, 1/51200를 상기 블록킹완충액으로 희석한 후, 시료 100μL를 각 웰에 도말하고 상온에서 1시간 동안 배양하였다. 이 후 PBST 400μL로 4회 세척 후 mouse IgG-HRP를 1:1000 비율로 희석 후 플레이트에 100μL로 도말하고 상온에서 1시간 동안 배양하였고, PBST 400μL로 4회 세척 후 TMB기질 용액100 μL로 암중에서 20분 동안 색상을 발현시켰다. 그 후 2N 황산 용액으로 반응을 정지시킨 후 450nm에서의 흡수능을 마이크로플레이트 리더기(Thermoscientific사의 multiskansky)에서 측정하였다. 항체가는 Cutoff value: the mean optical density values at 450nm (OD450)+3×standard derivations (SD) from the sera of non-vaccinated animals (Nat Commun. 2020; 11: 4207) 문헌을 참조하여 결정하였는 바, 1x1010VP에서 안정적인 항체가를 나타내는 것을 확인할 수 있었다(도 12).First, in order to evaluate the immunogenicity of the vaccine according to the present invention, the antibody titer against the nucleocapsid (antigen) was verified. In this example, 5 female BALB/c mice per group (Orient, Korea) 6 to 8 weeks old mice were immunized with mock and SARS-CoV-2 vaccines by intramuscular inoculation with 1x10 10 VP on days 0 and 14. On the 28th day after incubation, the mouse serum was isolated and the nucleocapsid-specific antibody response was measured by enzyme-linked immunosorbent assay (ELISA). A microtiter plate (Nunc, Denmark) was coated with 100 µL of the spike protein at 100 ng/well in 50 mM sodium bicarbonate buffer (pH 9.6), and incubated at 4°C overnight. Plates were washed with PBST (PBS+0.05% tween20), blocked with 1% BSA (fetal bovine serum albumin) in PBS for 1 h at room temperature, and serum 1/800, 1/3200, 1/12800, 1/51200 After dilution with the blocking buffer, 100 μL of the sample was spread on each well and incubated for 1 hour at room temperature. After washing 4 times with 400μL of PBST, dilute mouse IgG-HRP at a ratio of 1:1000, plated in 100μL on a plate, incubated for 1 hour at room temperature, washed 4 times with 400μL of PBST, and then incubated in the dark with 100μL of TMB substrate solution The color was developed for 20 minutes. After stopping the reaction with a 2N sulfuric acid solution, the absorption capacity at 450 nm was measured using a microplate reader (Multiskansky manufactured by Thermoscientific). Antibody titer Cutoff value: the mean optical density values at 450nm (OD450)+3×standard derivations (SD) from the sera of non-vaccinated animals (Nat Commun. 2020; 11: 4207) As determined with reference to the literature, 1×10 It was confirmed that a stable antibody titer was exhibited at 10 VP (FIG. 12).

실시예 4-2. 세포성 면역 확인Example 4-2. Cellular Immunity Confirmation

본 발명에 의한 백신의 뉴클레오캡시드 단백질에 대한 세포 매개성 면역반응을 확인하기 위하여 6 내지 8주령 암컷BALB/c 마우스(Orient, Korea)의 비장에서 단일 세포를 분리한 후 유세포분석기를 통해 T세포에서 면역반응을 유도하는데 있어서 중요한 여러 가지 사이토카인의 분비 정도를 측정하였다. 그룹 당 다섯 마리의 마우스를 0 및 14일째에 1x1010VP로 mock 및 SARS-CoV-2 백신을 근육 접종을 통해 면역화시킨 후 3주 뒤 마우스의 비장을 적출하여 비장세포(splenocyte)를 분리한 후 24웰플레이트에 웰당 1 x 106세포로 시딩(seeding)하고, 뉴클레오캡시드 단백질 20μg/mL로 24 시간 동안 재자극하였다. 그 후 단백질 운반 저해제인 GolgiPlug(BD Biosciences)를 가하여 세포질에 사이토카인을 집적시키고, 6 시간 동안 배양하였다. 이 후 PBS로 세척한 후, 세포를 BD Cytofix/cytoperm키트(BD Biosciences)에 통과시시키고, 항-CD4, CD8, CD45, IFN-gamma, 및 GranzymeB(BD Biosciences)로 염색하였다. CD4는 항-CD4, CD45로 gating한 후 gating안에 있는 세포에서 IFN-gamma, 및 GranzymeB를 동시 발현하는 세포를 Beckman Coulter사의 naviosflow cytometer를 이용하여 세포 관련 형광도의 수준을 측정하였다. CD8는 항-CD8, CD45로 gating한 후 gating안에 있는 세포에서 IFN-gamma, 및 GranzymeB를 동시 발현하는 세포를 Beckman Coulter사의naviosflow cytometer를 이용하여 세포 관련 형광도의 수준을 측정하였다 도 13, 14에 나타낸 바와 같이, 대조군과 비교하여 본 발명에 의한 SARS-CoV-2백신으로 면역화시킨 마우스에서 IFN-gamma, 및 GranzymeB 사이토카인을 분비하는 세포가 유의적으로 증가된 것을 확인할 수 있다. 이는 백신이 접종된 마우스에 SARS-CoV-2 바이러스로 감염되었을 때 체내의 T-cell들이 활성화되어 외래 인자를 사멸 시킬 수 있는 IFN-gamma, 및 GranzymeB를 분비하는 것을 의미한다.In order to confirm the cell-mediated immune response to the nucleocapsid protein of the vaccine according to the present invention, single cells were isolated from the spleen of 6 to 8-week-old female BALB/c mice (Orient, Korea), and then T cells through flow cytometry. The secretion levels of various cytokines important in inducing an immune response were measured. Five mice per group were immunized with 1x10 10 VP at 0 and 14 days through intramuscular inoculation with mock and SARS-CoV-2 vaccines. After 3 weeks, the spleens of mice were harvested and splenocytes were isolated. A 24-well plate was seeded at 1 x 10 6 cells per well, and restimulated with 20 μg/mL of nucleocapsid protein for 24 hours. Then, a protein transport inhibitor, GolgiPlug (BD Biosciences) was added to accumulate cytokines in the cytoplasm, and cultured for 6 hours. After washing with PBS, the cells were passed through a BD Cytofix/cytoperm kit (BD Biosciences) and stained with anti-CD4, CD8, CD45, IFN-gamma, and GranzymeB (BD Biosciences). After gating with anti-CD4 and CD45 for CD4, cells co-expressing IFN-gamma and GranzymeB in the gating were measured for cell-related fluorescence levels using a Beckman Coulter naviosflow cytometer. After gating with anti-CD8 and CD45 for CD8, cells co-expressing IFN-gamma and GranzymeB in the gating were measured for cell-related fluorescence levels using a navios flow cytometer manufactured by Beckman Coulter. As shown, it can be confirmed that cells secreting IFN-gamma and GranzymeB cytokines in mice immunized with the SARS-CoV-2 vaccine according to the present invention are significantly increased compared to the control group. This means that when vaccinated mice are infected with SARS-CoV-2 virus, T-cells in the body are activated to secrete IFN-gamma and GranzymeB that can kill foreign factors.

또 다른 실시예에서는 본 발명에 의한 SARS-CoV-2 백신이 유도하는 뉴클레오캡시드 항원에 특이적인 IFN-gamma ELISPOT 반응을 도 15에 나타내었으며, SARS-CoV-2 백신의 면역화만으로도 특이적 세포성 면역반응이 유도되었음을 확인할 수 있다. 구체적으로, 그룹 당 다섯 마리의 마우스를 0 및 14일째에 1x1010VP로 mock 및 SARS-CoV-2 백신을 근육 접종을 통해 면역화시킨 후 3주 뒤 마우의 비장을 적출하여 비장세포(splenocyte)를 분리하여 24웰플레이트에 웰당 1 x 106세포로 시딩(seeding)하고, SARS-CoV-2 뉴클레오캡시드 20μg/mL로 48 시간 동안 재자극하였다. 그 후 IFN-gamma ELISPOT assay 키트를 이용하여 뉴클레오캡시드 특이적 IFN-gamma ELISPOT 반응을 확인하였다. 도 15에 따르면, Mock으로 면역화된 마우스보다 백신 접종된 마우스의 비장에서 항원 특이적으로 IFN gamma를 생성하는 세포수(spot number)가 유의적으로 증가하는 것을 관찰할 수 있는데, 이는 본 발명에 의한 백신을 접종한 마우스에서는 백신 항원에 대한 기억능에 의하여 T-cell이 생성되어, 이차적 자극에 대해서도 항원 특이적 세포성 면역반응을 한다고 해석될 수 있다. (도 15).In another embodiment, the IFN-gamma ELISPOT response specific to the nucleocapsid antigen induced by the SARS-CoV-2 vaccine according to the present invention is shown in FIG. 15, and specific cellularity only by immunization with the SARS-CoV-2 vaccine It can be confirmed that an immune response is induced. Specifically, five mice per group were immunized with mock and SARS-CoV-2 vaccines at 1x10 10 VP on days 0 and 14 through intramuscular inoculation, and then 3 weeks later, the spleens of mice were harvested to obtain splenocytes. It was separated and seeded at 1 x 10 6 cells per well in a 24-well plate, and restimulated with 20 μg/mL of SARS-CoV-2 nucleocapsid for 48 hours. Thereafter, the nucleocapsid-specific IFN-gamma ELISPOT reaction was confirmed using an IFN-gamma ELISPOT assay kit. According to FIG. 15 , it can be observed that the number of cells (spot number) producing antigen-specific IFN gamma in the spleen of the vaccinated mouse than in the mouse immunized with the mock increases significantly, which is according to the present invention. In the vaccinated mouse, T-cell is generated by the memory for the vaccine antigen, which can be interpreted as an antigen-specific cellular immune response to the secondary stimulus. (Fig. 15).

실시예 5. SARS-CoV-2 완치환자의 혈청을 이용한 항원항체반응 확인Example 5. Confirmation of antigen-antibody reaction using serum from SARS-CoV-2 cured patients

A549 세포에 Ad/spike(Ad/S), Ad/spike+nucleocapsid(Ad/S+N)를 100moi 처리 후 total protein lysate를 추출하여 5ug/ml 농도로 plate에 코팅하고 SARS-CoV-2 감염 후 완치된 환자의 혈청(1/100, 1/1000, 1/10000 희석)과 ELISA기법을 이용하여 반응을 확인한 결과 S+N 항원을 발현하는 단백질이 SARS-CoV-2에 대한 항체를 보유한 환자혈청과 강하게 반응하는 것을 확인할 수 있다(도 16, 도 17).After 100 moi treatment of A549 cells with Ad/spike (Ad/S) and Ad/spike+nucleocapsid (Ad/S+N), total protein lysate was extracted, coated on a plate at a concentration of 5ug/ml, and infected with SARS-CoV-2 As a result of confirming the reaction using the ELISA technique with the sera of a cured patient (1/100, 1/1000, 1/10000 dilution), the S+N antigen-expressing protein is the patient's serum with an antibody against SARS-CoV-2. It can be seen that a strong reaction with

실시예 6. SARS-CoV-2 변이바이러스에 대한 면역원성 확인Example 6. Confirmation of immunogenicity against SARS-CoV-2 mutant virus

본 발명에 의한 백신의 SARS-CoV-2 변이바이러스에 대한 면역원성을 평가하기 위하여 6 내지 8주령 암컷 BALB/c 마우스(Orient, Korea)를 이용하였다. 그룹 당 다섯 마리의 마우스를 0 및 14일째에 1x1010VP로 mock 및 SARS-CoV-2 백신을 근육 접종을 통해 면역화시킨 후 28일째에 마우스의 혈청을 분리하였고, 효소 면역 측정법(enzyme-linked immunosorbent assay; ELISA)으로 스파이크 D614G 특이적 항체 반응을 측정하였다. 마이크로타이터플레이트(Microtiter plate, Nunc, Denmark)에 50mM 중탄산나트륨 완충액(pH 9.6)중에서 100ng/well로 스파이크 단백질100 μL를 코팅하고, 4℃에서 밤새 배양하였다. 플레이트를 PBST(PBS+0.05% tween20)로 세척하고, 실온에서 1시간 동안 PBS 중에서 1%BSA(우태아혈청알부민)로 블록킹시키고, 혈청 1/800, 1/3200, 1/12800, 1/51200를 상기 블록킹완충액으로 희석한 후, 시료 100μL를 각 웰에 도말하고 상온에서 1시간 동안 배양하였다. 이 후 PBST 400μL로 4회 세척 후 mouse IgG-HRP를 1:1000 비율로 희석 후 플레이트에 100μL로 도말하고 상온에서 1시간 동안 배양하였고, PBST 400μL로 4회 세척 후 TMB기질 용액100 μL로 암중에서 20분 동안 색상을 발현시켰다. 그 후 2N 황산 용액으로 반응을 정지 시킨 후 450 nm에서의 흡수능을 마이크로플레이트 리더기 (Thermoscientific사의 multiskansky)에서 측정 하였다. 항체가는 Cutoff value: the mean optical density values at 450nm (OD450)+3×standard derivations (SD) from the sera of non-vaccinated animals (Nat Commun. 2020; 11: 4207) 문헌을 참조하여 결정하였으며 그 결과를 도 18에 나타내었는 바, 본 발명에 의한 백신은 스파이크 D614G 변이바이러스에도 안정적인 항체가를 나타내는 것을 확인할 수 있었다.To evaluate the immunogenicity of the vaccine according to the present invention against SARS-CoV-2 mutant virus, 6 to 8 week old female BALB/c mice (Orient, Korea) were used. Five mice per group were immunized via intramuscular inoculation with mock and SARS-CoV-2 vaccines at 1x10 10 VP on days 0 and 14, then serum from mice was isolated on day 28, followed by enzyme-linked immunosorbent assay (enzyme-linked immunosorbent). assay; ELISA) to measure the spike D614G-specific antibody response. A microtiter plate (Nunc, Denmark) was coated with 100 µL of the spike protein at 100 ng/well in 50 mM sodium bicarbonate buffer (pH 9.6), and incubated at 4°C overnight. Plates were washed with PBST (PBS+0.05% tween20), blocked with 1% BSA (fetal bovine serum albumin) in PBS for 1 h at room temperature, and serum 1/800, 1/3200, 1/12800, 1/51200 After dilution with the blocking buffer, 100 μL of the sample was spread on each well and incubated for 1 hour at room temperature. After washing 4 times with 400μL of PBST, dilute mouse IgG-HRP at a ratio of 1:1000, plated in 100μL on a plate, incubated for 1 hour at room temperature, washed 4 times with 400μL of PBST, and then incubated in the dark with 100μL of TMB substrate solution The color was developed for 20 minutes. After that, the reaction was stopped with 2N sulfuric acid solution, and the absorption capacity at 450 nm was measured using a microplate reader (Multiskansky manufactured by Thermoscientific). The antibody titer was determined with reference to Cutoff value: the mean optical density values at 450nm (OD450)+3×standard derivations (SD) from the sera of non-vaccinated animals (Nat Commun. 2020; 11: 4207), and the results were As shown in FIG. 18 , it was confirmed that the vaccine according to the present invention exhibited a stable antibody titer to the Spike D614G mutant virus.

<110> Bioleaders Corporation <120> Coronavirus vaccine using replication-deficient adenovirus that simultaneously expresses coronavirus spike protein and nucleocapsid protein <130> O/PAPCT-QQ0293 <150> KR 10-2020-0149492 <151> 2020-11-10 <150> KR 10-2021-0136107 <151> 2021-10-13 <160> 2 <170> KoPatentIn 3.0 <210> 1 <211> 1273 <212> PRT <213> Artificial Sequence <220> <223> adenovirus <400> 1 Met Phe Val Phe Leu Val Leu Leu Pro Leu Val Ser Ser Gln Cys Val 1 5 10 15 Asn Leu Thr Thr Arg Thr Gln Leu Pro Pro Ala Tyr Thr Asn Ser Phe 20 25 30 Thr Arg Gly Val Tyr Tyr Pro Asp Lys Val Phe Arg Ser Ser Val Leu 35 40 45 His Ser Thr Gln Asp Leu Phe Leu Pro Phe Phe Ser Asn Val Thr Trp 50 55 60 Phe His Ala Ile His Val Ser Gly Thr Asn Gly Thr Lys Arg Phe Asp 65 70 75 80 Asn Pro Val Leu Pro Phe Asn Asp Gly Val Tyr Phe Ala Ser Thr Glu 85 90 95 Lys Ser Asn Ile Ile Arg Gly Trp Ile Phe Gly Thr Thr Leu Asp Ser 100 105 110 Lys Thr Gln Ser Leu Leu Ile Val Asn Asn Ala Thr Asn Val Val Ile 115 120 125 Lys Val Cys Glu Phe Gln Phe Cys Asn Asp Pro Phe Leu Gly Val Tyr 130 135 140 Tyr His Lys Asn Asn Lys Ser Trp Met Glu Ser Glu Phe Arg Val Tyr 145 150 155 160 Ser Ser Ala Asn Asn Cys Thr Phe Glu Tyr Val Ser Gln Pro Phe Leu 165 170 175 Met Asp Leu Glu Gly Lys Gln Gly Asn Phe Lys Asn Leu Arg Glu Phe 180 185 190 Val Phe Lys Asn Ile Asp Gly Tyr Phe Lys Ile Tyr Ser Lys His Thr 195 200 205 Pro Ile Asn Leu Val Arg Asp Leu Pro Gln Gly Phe Ser Ala Leu Glu 210 215 220 Pro Leu Val Asp Leu Pro Ile Gly Ile Asn Ile Thr Arg Phe Gln Thr 225 230 235 240 Leu Leu Ala Leu His Arg Ser Tyr Leu Thr Pro Gly Asp Ser Ser Ser 245 250 255 Gly Trp Thr Ala Gly Ala Ala Ala Tyr Tyr Val Gly Tyr Leu Gln Pro 260 265 270 Arg Thr Phe Leu Leu Lys Tyr Asn Glu Asn Gly Thr Ile Thr Asp Ala 275 280 285 Val Asp Cys Ala Leu Asp Pro Leu Ser Glu Thr Lys Cys Thr Leu Lys 290 295 300 Ser Phe Thr Val Glu Lys Gly Ile Tyr Gln Thr Ser Asn Phe Arg Val 305 310 315 320 Gln Pro Thr Glu Ser Ile Val Arg Phe Pro Asn Ile Thr Asn Leu Cys 325 330 335 Pro Phe Gly Glu Val Phe Asn Ala Thr Arg Phe Ala Ser Val Tyr Ala 340 345 350 Trp Asn Arg Lys Arg Ile Ser Asn Cys Val Ala Asp Tyr Ser Val Leu 355 360 365 Tyr Asn Ser Ala Ser Phe Ser Thr Phe Lys Cys Tyr Gly Val Ser Pro 370 375 380 Thr Lys Leu Asn Asp Leu Cys Phe Thr Asn Val Tyr Ala Asp Ser Phe 385 390 395 400 Val Ile Arg Gly Asp Glu Val Arg Gln Ile Ala Pro Gly Gln Thr Gly 405 410 415 Lys Ile Ala Asp Tyr Asn Tyr Lys Leu Pro Asp Asp Phe Thr Gly Cys 420 425 430 Val Ile Ala Trp Asn Ser Asn Asn Leu Asp Ser Lys Val Gly Gly Asn 435 440 445 Tyr Asn Tyr Arg Tyr Arg Leu Phe Arg Lys Ser Asn Leu Lys Pro Phe 450 455 460 Glu Arg Asp Ile Ser Thr Glu Ile Tyr Gln Ala Gly Ser Lys Pro Cys 465 470 475 480 Asn Gly Val Glu Gly Phe Asn Cys Tyr Phe Pro Leu Gln Ser Tyr Gly 485 490 495 Phe Gln Pro Thr Asn Gly Val Gly Tyr Gln Pro Tyr Arg Val Val Val 500 505 510 Leu Ser Phe Glu Leu Leu His Ala Pro Ala Thr Val Cys Gly Pro Lys 515 520 525 Lys Ser Thr Asn Leu Val Lys Asn Lys Cys Val Asn Phe Asn Phe Asn 530 535 540 Gly Leu Thr Gly Thr Gly Val Leu Thr Glu Ser Asn Lys Lys Phe Leu 545 550 555 560 Pro Phe Gln Gln Phe Gly Arg Asp Ile Ala Asp Thr Thr Asp Ala Val 565 570 575 Arg Asp Pro Gln Thr Leu Glu Ile Leu Asp Ile Thr Pro Cys Ser Phe 580 585 590 Gly Gly Val Ser Val Ile Thr Pro Gly Thr Asn Thr Ser Asn Gln Val 595 600 605 Ala Val Leu Tyr Gln Gly Val Asn Cys Thr Glu Val Pro Val Ala Ile 610 615 620 His Ala Asp Gln Leu Thr Pro Thr Trp Arg Val Tyr Ser Thr Gly Ser 625 630 635 640 Asn Val Phe Gln Thr Arg Ala Gly Cys Leu Ile Gly Ala Glu His Val 645 650 655 Asn Asn Ser Tyr Glu Cys Asp Ile Pro Ile Gly Ala Gly Ile Cys Ala 660 665 670 Ser Tyr Gln Thr Gln Thr Asn Ser Pro Ser Arg Ala Gly Ser Val Ala 675 680 685 Ser Gln Ser Ile Ile Ala Tyr Thr Met Ser Leu Gly Ala Glu Asn Ser 690 695 700 Val Ala Tyr Ser Asn Asn Ser Ile Ala Ile Pro Thr Asn Phe Thr Ile 705 710 715 720 Ser Val Thr Thr Glu Ile Leu Pro Val Ser Met Thr Lys Thr Ser Val 725 730 735 Asp Cys Thr Met Tyr Ile Cys Gly Asp Ser Thr Glu Cys Ser Asn Leu 740 745 750 Leu Leu Gln Tyr Gly Ser Phe Cys Thr Gln Leu Asn Arg Ala Leu Thr 755 760 765 Gly Ile Ala Val Glu Gln Asp Lys Asn Thr Gln Glu Val Phe Ala Gln 770 775 780 Val Lys Gln Ile Tyr Lys Thr Pro Pro Ile Lys Asp Phe Gly Gly Phe 785 790 795 800 Asn Phe Ser Gln Ile Leu Pro Asp Pro Ser Lys Pro Ser Lys Arg Ser 805 810 815 Phe Ile Glu Asp Leu Leu Phe Asn Lys Val Thr Leu Ala Asp Ala Gly 820 825 830 Phe Ile Lys Gln Tyr Gly Asp Cys Leu Gly Asp Ile Ala Ala Arg Asp 835 840 845 Leu Ile Cys Ala Gln Lys Phe Asn Gly Leu Thr Val Leu Pro Pro Leu 850 855 860 Leu Thr Asp Glu Met Ile Ala Gln Tyr Thr Ser Ala Leu Leu Ala Gly 865 870 875 880 Thr Ile Thr Ser Gly Trp Thr Phe Gly Ala Gly Ala Ala Leu Gln Ile 885 890 895 Pro Phe Ala Met Gln Met Ala Tyr Arg Phe Asn Gly Ile Gly Val Thr 900 905 910 Gln Asn Val Leu Tyr Glu Asn Gln Lys Leu Ile Ala Asn Gln Phe Asn 915 920 925 Ser Ala Ile Gly Lys Ile Gln Asp Ser Leu Ser Ser Thr Ala Ser Ala 930 935 940 Leu Gly Lys Leu Gln Asp Val Val Asn Gln Asn Ala Gln Ala Leu Asn 945 950 955 960 Thr Leu Val Lys Gln Leu Ser Ser Asn Phe Gly Ala Ile Ser Ser Val 965 970 975 Leu Asn Asp Ile Leu Ser Arg Leu Asp Pro Pro Glu Ala Glu Val Gln 980 985 990 Ile Asp Arg Leu Ile Thr Gly Arg Leu Gln Ser Leu Gln Thr Tyr Val 995 1000 1005 Thr Gln Gln Leu Ile Arg Ala Ala Glu Ile Arg Ala Ser Ala Asn Leu 1010 1015 1020 Ala Ala Thr Lys Met Ser Glu Cys Val Leu Gly Gln Ser Lys Arg Val 1025 1030 1035 1040 Asp Phe Cys Gly Lys Gly Tyr His Leu Met Ser Phe Pro Gln Ser Ala 1045 1050 1055 Pro His Gly Val Val Phe Leu His Val Thr Tyr Val Pro Ala Gln Glu 1060 1065 1070 Lys Asn Phe Thr Thr Ala Pro Ala Ile Cys His Asp Gly Lys Ala His 1075 1080 1085 Phe Pro Arg Glu Gly Val Phe Val Ser Asn Gly Thr His Trp Phe Val 1090 1095 1100 Thr Gln Arg Asn Phe Tyr Glu Pro Gln Ile Ile Thr Thr Asp Asn Thr 1105 1110 1115 1120 Phe Val Ser Gly Asn Cys Asp Val Val Ile Gly Ile Val Asn Asn Thr 1125 1130 1135 Val Tyr Asp Pro Leu Gln Pro Glu Leu Asp Ser Phe Lys Glu Glu Leu 1140 1145 1150 Asp Lys Tyr Phe Lys Asn His Thr Ser Pro Asp Val Asp Leu Gly Asp 1155 1160 1165 Ile Ser Gly Ile Asn Ala Ser Val Val Asn Ile Gln Lys Glu Ile Asp 1170 1175 1180 Arg Leu Asn Glu Val Ala Lys Asn Leu Asn Glu Ser Leu Ile Asp Leu 1185 1190 1195 1200 Gln Glu Leu Gly Lys Tyr Glu Gln Tyr Ile Lys Trp Pro Trp Tyr Ile 1205 1210 1215 Trp Leu Gly Phe Ile Ala Gly Leu Ile Ala Ile Val Met Val Thr Ile 1220 1225 1230 Met Leu Cys Cys Met Thr Ser Cys Cys Ser Cys Leu Lys Gly Cys Cys 1235 1240 1245 Ser Cys Gly Ser Cys Cys Lys Phe Asp Glu Asp Asp Ser Glu Pro Val 1250 1255 1260 Leu Lys Gly Val Lys Leu His Tyr Thr 1265 1270 <210> 2 <211> 526 <212> PRT <213> Artificial Sequence <220> <223> adenovirus <400> 2 Met Lys Lys Glu Leu Ser Phe His Glu Lys Leu Leu Lys Leu Thr Lys 1 5 10 15 Gln Gln Lys Lys Lys Thr Asn Lys His Val Phe Ile Ala Ile Pro Ile 20 25 30 Val Phe Val Leu Met Phe Ala Phe Met Trp Ala Gly Lys Ala Glu Thr 35 40 45 Pro Lys Val Lys Thr Tyr Ser Asp Asp Val Leu Ser Ala Ser Phe Val 50 55 60 Gly Asp Ile Met Met Gly Arg Tyr Val Glu Lys Val Thr Glu Gln Lys 65 70 75 80 Gly Ala Asp Ser Ile Phe Gln Tyr Val Glu Pro Ile Phe Arg Ala Ser 85 90 95 Asp Tyr Val Ala Gly Asn Phe Glu Asn Pro Val Thr Tyr Gln Lys Asn 100 105 110 Tyr Lys Gln Ala Asp Lys Glu Ile His Leu Gln Thr Asn Lys Glu Ser 115 120 125 Val Lys Val Leu Lys Asp Met Asn Phe Thr Val Leu Asn Ser Ala Asn 130 135 140 Asn His Ala Met Asp Tyr Gly Val Gln Gly Met Lys Asp Thr Leu Gly 145 150 155 160 Glu Phe Ala Lys Gln Asn Leu Asp Ile Val Gly Ala Gly Tyr Ser Leu 165 170 175 Ser Asp Ala Lys Lys Lys Ile Ser Tyr Gln Lys Val Asn Gly Val Thr 180 185 190 Ile Ala Thr Leu Gly Phe Thr Asp Val Ser Gly Lys Gly Phe Ala Ala 195 200 205 Lys Lys Asn Thr Pro Gly Val Leu Pro Ala Asp Pro Glu Ile Phe Ile 210 215 220 Pro Met Ile Ser Glu Ala Lys Lys His Ala Asp Ile Val Val Val Gln 225 230 235 240 Ser His Trp Gly Gln Glu Tyr Asp Asn Asp Pro Asn Asp Arg Gln Arg 245 250 255 Gln Leu Ala Arg Ala Met Ser Asp Ala Gly Ala Asp Ile Ile Val Gly 260 265 270 His His Pro His Val Leu Glu Pro Ile Glu Val Tyr Asn Gly Thr Val 275 280 285 Ile Phe Tyr Ser Leu Gly Asn Phe Val Phe Asp Gln Gly Trp Thr Arg 290 295 300 Thr Arg Asp Ser Ala Leu Val Gln Tyr His Leu Lys Lys Asn Gly Thr 305 310 315 320 Gly Arg Phe Glu Val Thr Pro Ile Asp Ile His Glu Ala Thr Pro Ala 325 330 335 Pro Val Lys Lys Asp Ser Leu Lys Gln Lys Thr Ile Ile Arg Glu Leu 340 345 350 Thr Lys Asp Ser Asn Phe Ala Trp Lys Val Glu Asp Gly Lys Leu Thr 355 360 365 Phe Asp Ile Asp His Ser Asp Lys Leu Lys Ser Lys Gly Gly Ser Gly 370 375 380 Gly Ser Gly Gly Ser Gly Gly Ser Gly Gly Ser Ile Gly Tyr Tyr Arg 385 390 395 400 Arg Ala Thr Arg Arg Ile Arg Gly Gly Pro Ala Pro Ala Pro Ile Ile 405 410 415 Trp Val Ala Thr Glu Gly Ala Pro Ala Pro Ala Pro Leu Leu Leu Leu 420 425 430 Asp Arg Leu Asn Gln Leu Pro Ala Pro Ala Pro Arg Thr Ala Thr Lys 435 440 445 Ala Tyr Asn Val Pro Ala Pro Ala Pro Phe Ala Pro Ser Ala Ser Ala 450 455 460 Phe Phe Gly Met Ser Arg Ile Gly Met Glu Val Pro Ala Pro Ala Pro 465 470 475 480 Thr Trp Leu Thr Tyr Thr Gly Ala Ile Lys Leu Asp Asp Lys Asp Pro 485 490 495 Asn Phe Lys Asp Gln Val Ile Leu Leu Pro Ala Pro Ala Pro Lys His 500 505 510 Ile Asp Ala Tyr Lys Thr Phe Pro Pro Thr Glu Pro Lys Lys 515 520 525 <110> Bioleaders Corporation <120> Coronavirus vaccine using replication-deficient adenovirus that simultaneously expresses coronavirus spike protein and nucleocapsid protein <130> O/PAPCT-QQ0293 <150> KR 10-2020-0149492 <151> 2020-11-10 <150> KR 10-2021-0136107 <151> 2021-10-13 <160> 2 <170> KoPatentIn 3.0 <210> 1 <211> 1273 <212> PRT <213> Artificial Sequence <220> <223> adenovirus <400> 1 Met Phe Val Phe Leu Val Leu Leu Pro Leu Val Ser Ser Gln Cys Val 1 5 10 15 Asn Leu Thr Thr Arg Thr Gln Leu Pro Pro Ala Tyr Thr Asn Ser Phe 20 25 30 Thr Arg Gly Val Tyr Tyr Pro Asp Lys Val Phe Arg Ser Ser Val Leu 35 40 45 His Ser Thr Gln Asp Leu Phe Leu Pro Phe Phe Ser Asn Val Thr Trp 50 55 60 Phe His Ala Ile His Val Ser Gly Thr Asn Gly Thr Lys Arg Phe Asp 65 70 75 80 Asn Pro Val Leu Pro Phe Asn Asp Gly Val Tyr Phe Ala Ser Thr Glu 85 90 95 Lys Ser Asn Ile Ile Arg Gly Trp Ile Phe Gly Thr Thr Leu Asp Ser 100 105 110 Lys Thr Gln Ser Leu Leu Ile Val Asn Asn Ala Thr Asn Val Val Ile 115 120 125 Lys Val Cys Glu Phe Gln Phe Cys Asn Asp Pro Phe Leu Gly Val Tyr 130 135 140 Tyr His Lys Asn Asn Lys Ser Trp Met Glu Ser Glu Phe Arg Val Tyr 145 150 155 160 Ser Ser Ala Asn Asn Cys Thr Phe Glu Tyr Val Ser Gln Pro Phe Leu 165 170 175 Met Asp Leu Glu Gly Lys Gln Gly Asn Phe Lys Asn Leu Arg Glu Phe 180 185 190 Val Phe Lys Asn Ile Asp Gly Tyr Phe Lys Ile Tyr Ser Lys His Thr 195 200 205 Pro Ile Asn Leu Val Arg Asp Leu Pro Gln Gly Phe Ser Ala Leu Glu 210 215 220 Pro Leu Val Asp Leu Pro Ile Gly Ile Asn Ile Thr Arg Phe Gln Thr 225 230 235 240 Leu Leu Ala Leu His Arg Ser Tyr Leu Thr Pro Gly Asp Ser Ser Ser 245 250 255 Gly Trp Thr Ala Gly Ala Ala Ala Tyr Tyr Val Gly Tyr Leu Gln Pro 260 265 270 Arg Thr Phe Leu Leu Lys Tyr Asn Glu Asn Gly Thr Ile Thr Asp Ala 275 280 285 Val Asp Cys Ala Leu Asp Pro Leu Ser Glu Thr Lys Cys Thr Leu Lys 290 295 300 Ser Phe Thr Val Glu Lys Gly Ile Tyr Gln Thr Ser Asn Phe Arg Val 305 310 315 320 Gln Pro Thr Glu Ser Ile Val Arg Phe Pro Asn Ile Thr Asn Leu Cys 325 330 335 Pro Phe Gly Glu Val Phe Asn Ala Thr Arg Phe Ala Ser Val Tyr Ala 340 345 350 Trp Asn Arg Lys Arg Ile Ser Asn Cys Val Ala Asp Tyr Ser Val Leu 355 360 365 Tyr Asn Ser Ala Ser Phe Ser Thr Phe Lys Cys Tyr Gly Val Ser Pro 370 375 380 Thr Lys Leu Asn Asp Leu Cys Phe Thr Asn Val Tyr Ala Asp Ser Phe 385 390 395 400 Val Ile Arg Gly Asp Glu Val Arg Gln Ile Ala Pro Gly Gln Thr Gly 405 410 415 Lys Ile Ala Asp Tyr Asn Tyr Lys Leu Pro Asp Asp Phe Thr Gly Cys 420 425 430 Val Ile Ala Trp Asn Ser Asn Asn Leu Asp Ser Lys Val Gly Gly Asn 435 440 445 Tyr Asn Tyr Arg Tyr Arg Leu Phe Arg Lys Ser Asn Leu Lys Pro Phe 450 455 460 Glu Arg Asp Ile Ser Thr Glu Ile Tyr Gln Ala Gly Ser Lys Pro Cys 465 470 475 480 Asn Gly Val Glu Gly Phe Asn Cys Tyr Phe Pro Leu Gln Ser Tyr Gly 485 490 495 Phe Gln Pro Thr Asn Gly Val Gly Tyr Gln Pro Tyr Arg Val Val Val 500 505 510 Leu Ser Phe Glu Leu Leu His Ala Pro Ala Thr Val Cys Gly Pro Lys 515 520 525 Lys Ser Thr Asn Leu Val Lys Asn Lys Cys Val Asn Phe Asn Phe Asn 530 535 540 Gly Leu Thr Gly Thr Gly Val Leu Thr Glu Ser Asn Lys Lys Phe Leu 545 550 555 560 Pro Phe Gln Gln Phe Gly Arg Asp Ile Ala Asp Thr Thr Asp Ala Val 565 570 575 Arg Asp Pro Gln Thr Leu Glu Ile Leu Asp Ile Thr Pro Cys Ser Phe 580 585 590 Gly Gly Val Ser Val Ile Thr Pro Gly Thr Asn Thr Ser Asn Gln Val 595 600 605 Ala Val Leu Tyr Gln Gly Val Asn Cys Thr Glu Val Pro Val Ala Ile 610 615 620 His Ala Asp Gln Leu Thr Pro Thr Trp Arg Val Tyr Ser Thr Gly Ser 625 630 635 640 Asn Val Phe Gln Thr Arg Ala Gly Cys Leu Ile Gly Ala Glu His Val 645 650 655 Asn Asn Ser Tyr Glu Cys Asp Ile Pro Ile Gly Ala Gly Ile Cys Ala 660 665 670 Ser Tyr Gln Thr Gln Thr Asn Ser Pro Ser Arg Ala Gly Ser Val Ala 675 680 685 Ser Gln Ser Ile Ile Ala Tyr Thr Met Ser Leu Gly Ala Glu Asn Ser 690 695 700 Val Ala Tyr Ser Asn Asn Ser Ile Ala Ile Pro Thr Asn Phe Thr Ile 705 710 715 720 Ser Val Thr Thr Glu Ile Leu Pro Val Ser Met Thr Lys Thr Ser Val 725 730 735 Asp Cys Thr Met Tyr Ile Cys Gly Asp Ser Thr Glu Cys Ser Asn Leu 740 745 750 Leu Leu Gln Tyr Gly Ser Phe Cys Thr Gln Leu Asn Arg Ala Leu Thr 755 760 765 Gly Ile Ala Val Glu Gln Asp Lys Asn Thr Gln Glu Val Phe Ala Gln 770 775 780 Val Lys Gln Ile Tyr Lys Thr Pro Pro Ile Lys Asp Phe Gly Gly Phe 785 790 795 800 Asn Phe Ser Gln Ile Leu Pro Asp Pro Ser Lys Pro Ser Lys Arg Ser 805 810 815 Phe Ile Glu Asp Leu Leu Phe Asn Lys Val Thr Leu Ala Asp Ala Gly 820 825 830 Phe Ile Lys Gln Tyr Gly Asp Cys Leu Gly Asp Ile Ala Ala Arg Asp 835 840 845 Leu Ile Cys Ala Gln Lys Phe Asn Gly Leu Thr Val Leu Pro Pro Leu 850 855 860 Leu Thr Asp Glu Met Ile Ala Gln Tyr Thr Ser Ala Leu Leu Ala Gly 865 870 875 880 Thr Ile Thr Ser Gly Trp Thr Phe Gly Ala Gly Ala Ala Leu Gln Ile 885 890 895 Pro Phe Ala Met Gln Met Ala Tyr Arg Phe Asn Gly Ile Gly Val Thr 900 905 910 Gln Asn Val Leu Tyr Glu Asn Gln Lys Leu Ile Ala Asn Gln Phe Asn 915 920 925 Ser Ala Ile Gly Lys Ile Gln Asp Ser Leu Ser Ser Thr Ala Ser Ala 930 935 940 Leu Gly Lys Leu Gln Asp Val Val Asn Gln Asn Ala Gln Ala Leu Asn 945 950 955 960 Thr Leu Val Lys Gln Leu Ser Ser Asn Phe Gly Ala Ile Ser Ser Val 965 970 975 Leu Asn Asp Ile Leu Ser Arg Leu Asp Pro Pro Glu Ala Glu Val Gln 980 985 990 Ile Asp Arg Leu Ile Thr Gly Arg Leu Gln Ser Leu Gln Thr Tyr Val 995 1000 1005 Thr Gln Gln Leu Ile Arg Ala Ala Glu Ile Arg Ala Ser Ala Asn Leu 1010 1015 1020 Ala Ala Thr Lys Met Ser Glu Cys Val Leu Gly Gln Ser Lys Arg Val 1025 1030 1035 1040 Asp Phe Cys Gly Lys Gly Tyr His Leu Met Ser Phe Pro Gln Ser Ala 1045 1050 1055 Pro His Gly Val Val Phe Leu His Val Thr Tyr Val Pro Ala Gln Glu 1060 1065 1070 Lys Asn Phe Thr Thr Ala Pro Ala Ile Cys His Asp Gly Lys Ala His 1075 1080 1085 Phe Pro Arg Glu Gly Val Phe Val Ser Asn Gly Thr His Trp Phe Val 1090 1095 1100 Thr Gln Arg Asn Phe Tyr Glu Pro Gln Ile Ile Thr Thr Asp Asn Thr 1105 1110 1115 1120 Phe Val Ser Gly Asn Cys Asp Val Val Ile Gly Ile Val Asn Asn Thr 1125 1130 1135 Val Tyr Asp Pro Leu Gln Pro Glu Leu Asp Ser Phe Lys Glu Glu Leu 1140 1145 1150 Asp Lys Tyr Phe Lys Asn His Thr Ser Pro Asp Val Asp Leu Gly Asp 1155 1160 1165 Ile Ser Gly Ile Asn Ala Ser Val Val Asn Ile Gln Lys Glu Ile Asp 1170 1175 1180 Arg Leu Asn Glu Val Ala Lys Asn Leu Asn Glu Ser Leu Ile Asp Leu 1185 1190 1195 1200 Gln Glu Leu Gly Lys Tyr Glu Gln Tyr Ile Lys Trp Pro Trp Tyr Ile 1205 1210 1215 Trp Leu Gly Phe Ile Ala Gly Leu Ile Ala Ile Val Met Val Thr Ile 1220 1225 1230 Met Leu Cys Cys Met Thr Ser Cys Cys Ser Cys Leu Lys Gly Cys Cys 1235 1240 1245 Ser Cys Gly Ser Cys Cys Lys Phe Asp Glu Asp Asp Ser Glu Pro Val 1250 1255 1260 Leu Lys Gly Val Lys Leu His Tyr Thr 1265 1270 <210> 2 <211> 526 <212> PRT <213> Artificial Sequence <220> <223> adenovirus <400> 2 Met Lys Lys Glu Leu Ser Phe His Glu Lys Leu Leu Lys Leu Thr Lys 1 5 10 15 Gln Gln Lys Lys Lys Thr Asn Lys His Val Phe Ile Ala Ile Pro Ile 20 25 30 Val Phe Val Leu Met Phe Ala Phe Met Trp Ala Gly Lys Ala Glu Thr 35 40 45 Pro Lys Val Lys Thr Tyr Ser Asp Asp Val Leu Ser Ala Ser Phe Val 50 55 60 Gly Asp Ile Met Met Gly Arg Tyr Val Glu Lys Val Thr Glu Gln Lys 65 70 75 80 Gly Ala Asp Ser Ile Phe Gln Tyr Val Glu Pro Ile Phe Arg Ala Ser 85 90 95 Asp Tyr Val Ala Gly Asn Phe Glu Asn Pro Val Thr Tyr Gln Lys Asn 100 105 110 Tyr Lys Gln Ala Asp Lys Glu Ile His Leu Gln Thr Asn Lys Glu Ser 115 120 125 Val Lys Val Leu Lys Asp Met Asn Phe Thr Val Leu Asn Ser Ala Asn 130 135 140 Asn His Ala Met Asp Tyr Gly Val Gln Gly Met Lys Asp Thr Leu Gly 145 150 155 160 Glu Phe Ala Lys Gln Asn Leu Asp Ile Val Gly Ala Gly Tyr Ser Leu 165 170 175 Ser Asp Ala Lys Lys Lys Ile Ser Tyr Gln Lys Val Asn Gly Val Thr 180 185 190 Ile Ala Thr Leu Gly Phe Thr Asp Val Ser Gly Lys Gly Phe Ala Ala 195 200 205 Lys Lys Asn Thr Pro Gly Val Leu Pro Ala Asp Pro Glu Ile Phe Ile 210 215 220 Pro Met Ile Ser Glu Ala Lys Lys His Ala Asp Ile Val Val Val Gln 225 230 235 240 Ser His Trp Gly Gln Glu Tyr Asp Asn Asp Pro Asn Asp Arg Gln Arg 245 250 255 Gln Leu Ala Arg Ala Met Ser Asp Ala Gly Ala Asp Ile Ile Val Gly 260 265 270 His His Pro His Val Leu Glu Pro Ile Glu Val Tyr Asn Gly Thr Val 275 280 285 Ile Phe Tyr Ser Leu Gly Asn Phe Val Phe Asp Gin Gly Trp Thr Arg 290 295 300 Thr Arg Asp Ser Ala Leu Val Gln Tyr His Leu Lys Lys Asn Gly Thr 305 310 315 320 Gly Arg Phe Glu Val Thr Pro Ile Asp Ile His Glu Ala Thr Pro Ala 325 330 335 Pro Val Lys Lys Asp Ser Leu Lys Gln Lys Thr Ile Ile Arg Glu Leu 340 345 350 Thr Lys Asp Ser Asn Phe Ala Trp Lys Val Glu Asp Gly Lys Leu Thr 355 360 365 Phe Asp Ile Asp His Ser Asp Lys Leu Lys Ser Lys Gly Gly Ser Gly 370 375 380 Gly Ser Gly Gly Ser Gly Gly Ser Gly Gly Ser Ile Gly Tyr Tyr Arg 385 390 395 400 Arg Ala Thr Arg Arg Ile Arg Gly Gly Pro Ala Pro Ala Pro Ile Ile 405 410 415 Trp Val Ala Thr Glu Gly Ala Pro Ala Pro Ala Pro Leu Leu Leu Leu 420 425 430 Asp Arg Leu Asn Gln Leu Pro Ala Pro Ala Pro Arg Thr Ala Thr Lys 435 440 445 Ala Tyr Asn Val Pro Ala Pro Ala Pro Phe Ala Pro Ser Ala Ser Ala 450 455 460 Phe Phe Gly Met Ser Arg Ile Gly Met Glu Val Pro Ala Pro Ala Pro 465 470 475 480 Thr Trp Leu Thr Tyr Thr Gly Ala Ile Lys Leu Asp Asp Lys Asp Pro 485 490 495 Asn Phe Lys Asp Gln Val Ile Leu Leu Pro Ala Pro Ala Pro Lys His 500 505 510 Ile Asp Ala Tyr Lys Thr Phe Pro Pro Thr Glu Pro Lys Lys 515 520 525

Claims (6)

코로나바이러스(SARS-CoV-2)의 스파이크(spike) 단백질이 복제불능 아데노바이러스의 E1영역에 삽입되고, PgsA 및 코로나바이러스(SARS-CoV-2)의 뉴클레오캡시드(nucleocapsid) 단백질이 복제불능 아데노바이러스의 E3영역에 삽입된 형태로 발현되는 재조합 아데노바이러스.The spike protein of coronavirus (SARS-CoV-2) is inserted into the E1 region of replication-deficient adenovirus, and the nucleocapsid protein of PgsA and coronavirus (SARS-CoV-2) is replication-deficient adenovirus Recombinant adenovirus expressed in the form inserted into the E3 region of the virus. 제1항에 있어서, E1영역은 서열번호 1의 아미노산서열을 포함하고, E3영역은 서열변호 2의 아미노산서열을 포함하는 것을 특징으로 하는 재조합 아데노바이러스.The recombinant adenovirus according to claim 1, wherein the E1 region comprises the amino acid sequence of SEQ ID NO: 1, and the E3 region comprises the amino acid sequence of SEQ ID NO: 2. 제1항의 재조합 아데노바이러스에 의하여 제조되는 코로나바이러스(SARS-CoV-2) 백신.A coronavirus (SARS-CoV-2) vaccine produced by the recombinant adenovirus of claim 1. 제3항에 있어서, 상기 코로나바이러스 백신은 SARS-CoV-2 변이 바이러스에 작용하는 것을 특징으로 하는 코로나바이러스(SARS-CoV-2) 백신.The coronavirus (SARS-CoV-2) vaccine according to claim 3, wherein the coronavirus vaccine acts on a SARS-CoV-2 mutant virus. 제4항에 있어서, 상기 SARS-CoV-2 변이 바이러스는 D614G 변이 바이러스인 것을 특징으로 하는 코로나바이러스(SARS-CoV-2) 백신.The coronavirus (SARS-CoV-2) vaccine according to claim 4, wherein the SARS-CoV-2 mutant virus is a D614G mutant virus. 제3항에 있어서, 어주번트(adjuvant)를 추가로 포함하는 것을 특징으로 하는 코로나바이러스(SARS-CoV-2) 백신.


The coronavirus (SARS-CoV-2) vaccine according to claim 3, further comprising an adjuvant.
KR1020210152517A 2020-11-10 2021-11-08 Coronavirus vaccine using replication-deficient adenovirus that simultaneously expresses coronavirus spike protein and nucleocapsid protein KR102399308B1 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
PCT/KR2021/016258 WO2022103126A1 (en) 2020-11-10 2021-11-09 Coronavirus vaccine using replication-incompetent adenovirus that simultaneously expresses coronavirus spike protein and nucleocapsid protein
KR1020220015550A KR20220063760A (en) 2020-11-10 2022-02-07 Coronavirus vaccine using replication-deficient adenovirus that simultaneously expresses coronavirus spike protein and nucleocapsid protein

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
KR1020200149492 2020-11-10
KR1020200149492 2020-11-10
KR20210136107 2021-10-13
KR1020210136107 2021-10-13

Related Child Applications (1)

Application Number Title Priority Date Filing Date
KR1020220015550A Division KR20220063760A (en) 2020-11-10 2022-02-07 Coronavirus vaccine using replication-deficient adenovirus that simultaneously expresses coronavirus spike protein and nucleocapsid protein

Publications (2)

Publication Number Publication Date
KR20220063744A true KR20220063744A (en) 2022-05-17
KR102399308B1 KR102399308B1 (en) 2022-05-20

Family

ID=81798895

Family Applications (1)

Application Number Title Priority Date Filing Date
KR1020210152517A KR102399308B1 (en) 2020-11-10 2021-11-08 Coronavirus vaccine using replication-deficient adenovirus that simultaneously expresses coronavirus spike protein and nucleocapsid protein

Country Status (1)

Country Link
KR (1) KR102399308B1 (en)

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20080069836A1 (en) * 2004-09-01 2008-03-20 The Government Of The U.S.A., As Represented By The Secretary, Department Of Health And Human Ser Method of using adenoviral vectors with increased immunogenicity in vivo
US20080267992A1 (en) * 2004-06-04 2008-10-30 Cancer Center, Sun Yat-Sun University Sars Virus Vaccine with Adenovirus Carrier and Preparation Method Thereof, and Use of Sars Virus S Gene for Preparation of Vaccine
WO2019076882A1 (en) * 2017-10-16 2019-04-25 Glaxosmithkline Biologicals Sa Adenoviral vectors with two expression cassettes encoding rsv antigenic proteins or fragments thereof
KR20190119391A (en) * 2018-04-12 2019-10-22 한국생명공학연구원 WHOLE PROTEIN GENE OF MERS-CoV NUCLEOPROTEIN AND VACCINE COMPOSITION FOR PREVENTING INFECTION OF MERS-CoV COMPRISING THE SAME
WO2021164097A1 (en) * 2020-02-21 2021-08-26 赛诺（深圳）生物医药研究有限公司 Biological product for preventing novel coronavirus

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20080267992A1 (en) * 2004-06-04 2008-10-30 Cancer Center, Sun Yat-Sun University Sars Virus Vaccine with Adenovirus Carrier and Preparation Method Thereof, and Use of Sars Virus S Gene for Preparation of Vaccine
US20080069836A1 (en) * 2004-09-01 2008-03-20 The Government Of The U.S.A., As Represented By The Secretary, Department Of Health And Human Ser Method of using adenoviral vectors with increased immunogenicity in vivo
WO2019076882A1 (en) * 2017-10-16 2019-04-25 Glaxosmithkline Biologicals Sa Adenoviral vectors with two expression cassettes encoding rsv antigenic proteins or fragments thereof
KR20190119391A (en) * 2018-04-12 2019-10-22 한국생명공학연구원 WHOLE PROTEIN GENE OF MERS-CoV NUCLEOPROTEIN AND VACCINE COMPOSITION FOR PREVENTING INFECTION OF MERS-CoV COMPRISING THE SAME
WO2021164097A1 (en) * 2020-02-21 2021-08-26 赛诺（深圳）生物医药研究有限公司 Biological product for preventing novel coronavirus

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
BioRxiv,(2020.07.30) pp1-36 *
Cell 182, 812-827, August 20, 2020 *
medRxiv, https://doi.org/10.1101/2020.11.04.20225417; *
NATURE COMMUNICATIONS | https://doi.org/10.1038/s41467-020-18077-5 *

Also Published As

Publication number Publication date
KR102399308B1 (en) 2022-05-20

Similar Documents

Publication Publication Date Title
JP2023514249A (en) Coronavirus immunogenic compositions and uses thereof
KR20230005102A (en) Immunobiologicals for inducing specific immunity against severe acute respiratory syndrome virus SARS-CoV-2
KR102025488B1 (en) Novel baculovirus vectors and methods of use
Osterrieder et al. Protection against EHV-1 challenge infection in the murine model after vaccination with various formulations of recombinant glycoprotein gp14 (gB)
Vassilieva et al. Enhanced mucosal immune responses to HIV virus-like particles containing a membrane-anchored adjuvant
US20210283242A1 (en) Immune-mediated coronavirus treatments
WO2021201612A1 (en) Novel vaccine composition for prevention and treatment of coronavirus
KR102399308B1 (en) Coronavirus vaccine using replication-deficient adenovirus that simultaneously expresses coronavirus spike protein and nucleocapsid protein
WO2023160654A1 (en) Preparation and use of recombinant multicomponent sars-cov-2 trimeric protein vaccine capable of inducing broad-spectrum neutralizing activity
KR20220063760A (en) Coronavirus vaccine using replication-deficient adenovirus that simultaneously expresses coronavirus spike protein and nucleocapsid protein
JP7271794B2 (en) Fusion protein of cytomegalovirus gB and pentamer and vaccine containing said fusion protein
US20240016918A1 (en) Vaccines against sars-cov-2 infections
KR20230157180A (en) Coronavirus vaccine using replication-defective adenovirus that simultaneously expresses coronavirus spike protein, nucleocapsid protein, and PgsA protein
CN116568324A (en) Fusion proteins and vaccines
CN117730150A (en) Lyophilized form of a medicament (variant) for inducing specific immunity to SARS-CoV-2
KR20210122196A (en) A novel vaccine composition for preventing and treating coronavirus
US20240050551A1 (en) Herpes simplex virus type 1 derived influenza vaccine
JP7360544B2 (en) Pharmaceutical products for inducing specific immunity against SARS-COV-2
KR20220063720A (en) Coronavirus vaccine using replication-deficient adenovirus that simultaneously expresses coronavirus spike protein and nucleocapsid protein
WO2021178844A1 (en) Zika and flavivirus immunogenic compositions and their use
CN116528895A (en) Use of a medicament for inducing specific immunity against SARS-COV-2 in children
JP2023182231A (en) Sars-cov-2 s glycoprotein ectodomain-containing proteoliposomes and use thereof as vaccines
KR101695517B1 (en) Vaccine against influenza virus based on hemagglutinin displayed-baculovirus and method for producing the same
AU2022336142A1 (en) Viral-like particles for the treatment or prevention of an infection by a coronaviridae virus
JPH0698764A (en) Method for expression of glycoprotein i of simple herpesvirus type 1 and method for its use

Legal Events

Date Code Title Description
E701 Decision to grant or registration of patent right
GRNT Written decision to grant