KR20200011135A - Cell transfection of nucleic acid using nano-assembly by fusion peptide and calcium ion and its application - Google Patents
Cell transfection of nucleic acid using nano-assembly by fusion peptide and calcium ion and its application Download PDFInfo
- Publication number
- KR20200011135A KR20200011135A KR1020180085867A KR20180085867A KR20200011135A KR 20200011135 A KR20200011135 A KR 20200011135A KR 1020180085867 A KR1020180085867 A KR 1020180085867A KR 20180085867 A KR20180085867 A KR 20180085867A KR 20200011135 A KR20200011135 A KR 20200011135A
- Authority
- KR
- South Korea
- Prior art keywords
- cell
- nuclear
- seq
- nuclear membrane
- peptide
- Prior art date
Links
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/65—Peptidic linkers, binders or spacers, e.g. peptidic enzyme-labile linkers
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/09—Fusion polypeptide containing a localisation/targetting motif containing a nuclear localisation signal
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/10—Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22
Abstract
Description
본 발명은 세포 및 핵막 투과 융합 펩타이드와 핵산의 나노 어셈블리와 칼슘 이온의 시너지 효과를 기반으로 하는 비바이러스성 유전자 전달시스템을 이용한 세포 유전자 형질도입에 관한 것으로서, 기존의 상업적인 핵산 전달소재보다 유전자 전달 효율과 생체적합성이 우수한 핵산 세포형질도입기술에 관한 것이다.The present invention relates to cellular gene transduction using a non-viral gene delivery system based on the synergistic effect of calcium ions and nano-assemblies of cellular and nuclear membrane permeation fusion peptides and nucleic acids. The present invention relates to a nucleic acid cell transduction technology with excellent biocompatibility.
유전자 치료란 비정상 유전자를 정상 유전자로 대체시켜 유전적 결함을 치료하거나 유전자의 형질전환을 통해 새로운 기능을 추가할 수 있는 획기적인 치료법이다. 이는 기존 치료법으로는 치료할 수 없었던 유전질환의 유전적인 결함을 교정하여 근본적인 치료를 가능하게 할 수 있기 때문에 앞으로 수많은 난치성 유전병을 치료할 수 있을 것으로 기대되는 기술이다. 이러한 유전자 치료법을 효과적으로 적용하기 위해서는 유전자를 효율적으로 전달할 수 있는 기술을 개발하는 것이 매우 중요하며, 현재 널리 사용되고 있는 유전자 전달체로는 크게 바이러스성 전달체와 비바이러스성 전달체로 나뉜다. Gene therapy is a breakthrough treatment that can replace abnormal genes with normal genes to treat genetic defects or add new functions through gene transformation. This technology is expected to be able to cure a number of refractory genetic diseases in the future because it is possible to correct the genetic defect of the genetic disease that could not be cured by conventional treatments. In order to effectively apply such gene therapy, it is very important to develop a technology that can efficiently transfer genes. Currently, widely used gene carriers are classified into viral carriers and non-viral carriers.
바이러스성 전달체는 레트로 바이러스나, 아데노 바이러스 등의 바이러스를 기반으로 하여 핵산을 전달하는 기술을 의미한다. 이 방법은 유전자 전달체로 바이러스를 이용하기 때문에 매우 뛰어난 유전자 전달효율을 보인다. 하지만 동시에 바이러스를 사용하기 때문에 발생하는 레트로 바이러스의 암 유발 가능성, 아데노 바이러스의 짧은 발현시간, 돌연변이로 인한 병원성 회복 가능성 및 심한 염증 등의 부작용 그리고 굉장히 비싼 가격은 바이러스를 전달체로 이용하는 유전자 치료법이 널리 활용되는데 많은 제약이 되고 있다.Viral delivery means a technology for delivering nucleic acids based on viruses such as retroviruses or adenoviruses. This method uses the virus as a gene carrier and shows very good gene transfer efficiency. At the same time, however, the side effects of retrovirus cancer caused by the use of the virus, the short duration of the adenovirus, the possibility of recovery from pathogenicity due to mutations, and severe inflammation, and the extremely high price are widely used by gene therapy using the virus as a carrier. There are many restrictions.
그에 비해서 비바이러스성 전달체는 생체분자에서 유래되었거나 화학적으로 합성한 지질, 폴리머, 펩타이드를 이용한다. 따라서 바이러스성 전달체보다는 가격이 저렴하며 생체분자에서 유래된 경우 생체적합성도 우수한 편이지만 유전자의 전달효율이 상대적으로 낮아서 아직까지 상용화를 위해서는 더 많은 연구를 필요로 한다.In contrast, non-viral carriers utilize lipids, polymers, or peptides derived from biomolecules or chemically synthesized. Therefore, it is cheaper than viral carriers and biocompatibility is excellent when derived from biomolecules, but the gene transfer efficiency is relatively low, so more research is still required for commercialization.
이 중 본 발명과 관련이 있는 펩타이드를 이용한 유전자 전달을 예로 들어 설명하면 현재까지 크게 세포투과 펩타이드(Cell Penetrating Peptide)와 핵이행신호(Nuclear Localization Signal)를 이용한 많은 연구결과들이 보고되었다. 세포투과 펩타이드는 주로 염기성 아미노산 서열이 많고 전체적으로 양전하를 띠는 펩타이드로써 내포작용을 통해 세포 내부로 함입될 수 있는 능력을 가지고 있다. 또한, DNA와 정전기적 상호작용을 통해 커다란 DNA를 작은 복합체로 만들어주어, DNA의 세포 내 이입의 가능성을 증가시켜준다. 핵이행신호는 핵으로 수송되는 단백질과 결합하여, 핵으로 전달하는 기능을 가지며, 양전하를 띠는 아미노산이 서열에 많은 편이어서, DNA와의 상호작용에 도움을 줄 수 있다. 하지만 각각의 아미노산 서열을 이용한 실험결과들을 살펴보면 상용화된 비바이러스성 유전자 전달체인 polyethylenimine (PEI)나 lipofectamine에 비해 유전자 전달효율이 낮은 결과를 보인다.When the gene transfer using the peptides related to the present invention is described as an example, many studies using cell penetration peptides (Cell Penetrating Peptide) and Nuclear Localization Signal have been reported. Cell-penetrating peptides are peptides with a large number of basic amino acid sequences and are generally positively charged, and have the ability to be incorporated into cells through inclusion. Electrostatic interactions with DNA also make large DNA into small complexes, increasing the likelihood of DNA migration into cells. Nuclear transduction signals bind to proteins that are transported to the nucleus, have a function of delivering to the nucleus, and positively charged amino acids are present in the sequence, which may help interact with DNA. However, the results of experiments using amino acid sequences show lower gene transfer efficiency compared to commercialized non-viral gene carriers such as polyethylenimine (PEI) or lipofectamine.
따라서 비바이러스성 전달체의 유전자 전달효율을 현저히 향상시킬 수 있는 기술이 개발된다면 위험성을 내포하고 있는 바이러스성 전달체 대신 비바이러스 전달체를 통해 안전하고 저렴한 유전자 치료를 가능하게 할 것이다. 그러므로 비바이러스성 전달체의 유전자 전달효율을 향상시킬 수 있는 새로운 전달기술의 개발이 필요하다.Therefore, if a technology is developed that can significantly improve the gene transfer efficiency of non-viral carriers, it will enable safe and inexpensive gene therapy through non-viral carriers instead of viral carriers containing risks. Therefore, the development of a new delivery technology that can improve the gene transfer efficiency of non-viral carriers.
상기한 배경기술로서 설명된 사항들은 본 발명의 배경에 대한 이해 증진을 위한 것일 뿐, 이 기술분야에서 통상의 지식을 가진 자에게 이미 알려진 종래기술에 해당함을 인정하는 것으로 받아들여져서는 안 될 것이다.The matters described as the background art are only for the purpose of improving the understanding of the background of the present invention, and should not be taken as acknowledging that they correspond to the related arts already known to those skilled in the art.
본 발명자들은 기존 바이러스를 이용한 약물 전달체의 문제점을 해결하고자, 비바이러스성 약물 전달체를 개발하고자 예의 노력을 하였다. 그 결과, TAT(HIV 1 trans-activating protein), 폴리-아르기닌 및 SPACE(skin permeating and cell entering peptide)로 구성된 군으로부터 선택되는 펩타이드와 Simian virus에서 유래한 가장 효율적인 핵 이행 신호인 SV40를 융합한 후 칼슘 이온을 처리하는 경우 핵산의 세포 형질도입 효율이 획기적으로 향상됨을 발견함으로써 본 발명을 완성하였다.The present inventors made diligent efforts to develop a non-viral drug carrier to solve the problem of the drug carrier using the existing virus. As a result, after fusion of a peptide selected from the group consisting of HIV 1 trans-activating protein (TAT), poly-arginine and skin permeating and cell entering peptide (SPAT) and SV40, the most efficient nuclear transfer signal derived from Simian virus, The present invention was completed by discovering that the cell transduction efficiency of nucleic acids is greatly improved when calcium ions are treated.
따라서, 본 발명의 목적은 세포투과 펩타이드(cell penetrating peptide, CPP) 및 핵 이행 신호(nuclear localization signal, NLS)를 포함하는 세포 및 핵막-투과 펩타이드(cell and nuclear-penetrating peptide)를 제공하는데 있다.Accordingly, an object of the present invention is to provide a cell and nuclear-penetrating peptide including a cell penetrating peptide (CPP) and a nuclear localization signal (NLS).
본 발명의 다른 목적은 상기 세포 및 핵막-투과 융합 펩타이드를 포함하는 핵산 형질도입용 약물 전달체를 제공하는데 있다.Another object of the present invention to provide a drug carrier for transduction of nucleic acid comprising the cell and the nuclear membrane-penetrating fusion peptide.
본 발명의 또 다른 목적은 상기 세포 및 핵막-투과 융합 펩타이드 및 칼슘이온을 포함하는 핵산 형질도입용 키트를 제공하는데 있다.Still another object of the present invention is to provide a kit for transducing nucleic acids comprising the cell and nuclear membrane-permeable fusion peptides and calcium ions.
본 발명의 또 다른 목적은 상기 세포 및 핵막-투과 융합 펩타이드에 칼슘이온(Ca2 +) 또는 칼슘염(calcium salt)을 처리하는 단계를 포함하는 핵산의 형질도입 방법을 제공하는데 있다.It is another object of the present invention the cell nuclear membrane and - there is provided a transduction method of nucleic acid comprising the step of treating the calcium ions (Ca 2 +) or calcium salts (calcium salt) for transmitting the fusion polypeptide.
본 발명의 또 다른 목적은 상기 세포 및 핵막 투과용 약물 전달체의 제조방법을 제공하는데 있다.Still another object of the present invention is to provide a method for preparing a drug carrier for penetrating the cell and nuclear membrane.
본 발명의 다른 목적 및 이점은 하기의 발명의 상세한 설명, 청구범위 및 도면에 의해 보다 명확하게 된다.Other objects and advantages of the present invention will become apparent from the following detailed description, claims and drawings.
본 발명의 일 양태에 따르면, 본 발명은 세포투과 펩타이드(cell penetrating peptide, CPP) 및 핵 이행 신호(nuclear localization signal, NLS)를 포함하는 세포 및 핵막-투과 융합 펩타이드(cell and nuclear-penetrating fusion peptide)를 제공한다.According to an aspect of the present invention, the present invention provides a cell and nuclear-penetrating fusion peptide comprising a cell penetrating peptide (CPP) and a nuclear localization signal (NLS). ).
본 발명의 다른 양태에 따르면, 본 발명은 상기 세포 및 핵막-투과 융합 펩타이드를 포함하는 핵산 형질도입용 약물 전달체를 제공한다.According to another aspect of the present invention, the present invention provides a drug delivery agent for nucleic acid transduction comprising the cell and nuclear membrane-penetrating fusion peptide.
본 발명의 또 다른 양태에 따르면, 본 발명은 (a) 칼슘이온(Ca2 +) 또는 칼슘염(calcium salt); 및 (b) 상기 세포 및 핵막-투과 융합 펩타이드를 포함하는 핵산 형질도입용 키트를 제공한다.According to another aspect of the invention, the invention is (a) calcium ion (Ca 2 + ) or calcium salt (calcium salt); And (b) provides a kit for nucleic acid transduction comprising the cell and nuclear membrane-penetrating fusion peptide.
비바이러스성 전달체의 유전자 전달은 크게 유전자의 세포막 투과와 핵으로의 전달 즉, 핵막투과 과정을 거쳐야 한다. DNA를 이용한 유전자 치료의 경우, 대부분 DNA를 발현시키기 위해 세포 내로 전달하게 되는데, DNA가 발현되기 위해서는 DNA가 세포막을 투과하고 핵안으로 전달되어 mRNA로 전사되는 것이 가장 중요하다. 하지만 DNA는 음전하를 띤 친수성 거대분자이기 때문에 DNA가 표면에 음전하를 띤 소수성 세포막을 투과하는 효율이 바이러스에 비하여 낮은 편이다. 또한 세포막을 투과한 후, 핵 안에 전달되기 위해서는 핵막을 투과하여야 하는데, 핵막을 투과하는 효율 또한 매우 낮은 편이다. 따라서 DNA의 세포막 투과와 핵막 투과 효율을 획기적으로 증가시켜 기존의 상용화된 제품을 능가할 수 있는 핵산의 세포 형질도입 기술개발이 필요하다.Gene transfer of non-viral carriers must largely go through cell membrane permeation and delivery to the nucleus, ie nuclear membrane permeation. In the case of gene therapy using DNA, most of them are delivered into cells to express DNA. In order to express DNA, it is most important that the DNA penetrates the cell membrane, is transferred into the nucleus, and transcribed into mRNA. However, since DNA is a negatively charged hydrophilic macromolecule, the efficiency of DNA penetrating negatively charged hydrophobic cell membranes on the surface is lower than that of viruses. In addition, after passing through the cell membrane, the nuclear membrane must pass through to be delivered into the nucleus, and the efficiency of penetrating the nuclear membrane is also very low. Therefore, it is necessary to develop a cell transduction technology of nucleic acid that can dramatically increase the cell membrane permeation and nuclear membrane permeation efficiency of DNA to surpass existing commercial products.
이에 본 발명자들은 전술한 바와 같은 종래 기술의 문제점을 해결하기 위하여, 세포 및 핵막 투과 융합 펩타이드와 핵산의 나노어셈블리와 칼슘 이온과의 시너지 효과를 사용하여 유전자의 효율적인 형질도입을 확인함으로써 본 발명을 완성하게 되었다. In order to solve the problems of the prior art as described above, the present inventors have completed the present invention by confirming efficient transduction of genes using synergistic effects of nanoassembly and calcium ions of cell and nuclear membrane permeation fusion peptides and nucleic acids. Was done.
융합 펩타이드의 디자인 전략과 구성은 다음과 같다. 세포막의 투과효율을 증가시키는 세포투과 펩타이드와 핵투과 효율을 증가시키는 핵이행신호를 융합한 펩타이드를 디자인하였다. 보다 구체적으로, 세포투과 펩타이드의 양전하를 이용하여 DNA와의 정전기적 상호작용으로 나노어셈블리를 만들어 세포투과 효율을 향상시킨 후 핵이행신호로 핵수송 단백질과의 상호작용으로 핵전달 기능을 향상시키는 시너지 효과를 활용하는 융합 펩타이드 소재를 구성하였다. The design strategy and configuration of the fusion peptide is as follows. We designed peptides that fuse cell transmembrane peptides that increase cell membrane permeation efficiency and nuclear transduction signals that increase nuclear permeability. More specifically, the synergy effect of improving the nuclear transfer function by interacting with the nuclear transport protein by making the nanoassembly by electrostatic interaction with DNA using the positive charge of the cell permeation peptide to improve cell permeability efficiency To construct a fusion peptide material utilizing.
본 명세서에서 용어 “핵 이행 신호” 또는 “nuclear localization signal”은 핵 수송(nuclear transport)에 의해 세포 내의 핵막을 투과할 수 있는 아미노산 서열을 의미하며, 바람직하게는 SV40(simian virus 40) T 항원(PKKRKV, Kalderon et al., Cell 39:499-509 (1984)); 인간 레티노산 수용체 β- 핵 이행 신호 서열(ARRRRP); NF.kappa-β p50 연관 서열(EEVQRKRQKL, Ghosh et al., Cell 62:1019 (1990)); NF.kappa-β p65 연관 서열(EEKRKRTYE, Nolan et al., Cell 64:961 (1991)); M9 연관서열(NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ); Nucleoplasm 연관서열(KRPAATKKAGQAKKKK); 및 c-Myc 연관서열(PAAKRVKLD) 등이 있으나 이에 제한되지 않는다. 두 부분으로 구성된(Bipartite) 핵 이행 신호는 Boulikas, J. Cell. Biochem. 55(1):32-58 (1994) 및 Dingwall, et al., J. Cell Biol. 107:641-849 (1988) 등에 기술되어 있다(예를 들어, KRPMTKKAGQAKKKK 등).As used herein, the term "nuclear transition signal" or "nuclear localization signal" refers to an amino acid sequence capable of penetrating the nuclear membrane in a cell by nuclear transport, preferably SV40 (simian virus 40) T antigen ( PKKRKV, Kalderon et al., Cell 39: 499-509 (1984)); Human retinoic acid receptor β-nuclear transition signal sequence (ARRRRP); NF.kappa-β p50 association sequence (EEVQRKRQKL, Ghosh et al., Cell 62: 1019 (1990)); NF.kappa-β p65 associated sequence (EEKRKRTYE, Nolan et al., Cell 64: 961 (1991)); M9 association sequence (NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ); Nucleoplasm association sequence (KRPAATKKAGQAKKKK); And c-Myc association sequence (PAAKRVKLD) and the like, but is not limited thereto. Bipartite nuclear transition signals are described in Boulikas, J. Cell. Biochem. 55 (1): 32-58 (1994) and Dingwall, et al., J. Cell Biol. 107: 641-849 (1988) et al. (Eg KRPMTKKAGQAKKKK, etc.).
본 명세서에서 용어 “세포투과 펩타이드” 또는 “cell penetrating peptide”는 핵산과 상호작용하여 나노어셈블리를 이루며 세포막을 투과할 수 있는 아미노산 서열을 의미하며, TAT, 폴리-아르기닌, SPACE 등을 포함하나 이에 제한되지 않는다.As used herein, the term “cell penetrating peptide” or “cell penetrating peptide” refers to an amino acid sequence capable of interacting with a nucleic acid to form a nanoassembly and penetrate cell membranes, including but not limited to TAT, poly-arginine, SPACE, etc. It doesn't work.
“TAT” 또는 “HIV 1 trans-activating protein”은 인간면역결핍바이러스(Human immunodeficiency virus)의 transactivator of transcription (TAT)으로부터 유래한 펩타이드(Fawell et al., PNAS 91:664-668 (1994))를 의미하며, 바람직하게는 서열목록 제2서열의 아미노산 서열을 포함한다.“TAT” or “HIV 1 trans-activating protein” refers to a peptide derived from the transactivator of transcription (TAT) of the human immunodeficiency virus (Fawell et al., PNAS 91: 664-668 (1994)). It preferably comprises the amino acid sequence of the second sequence of the sequence listing.
“폴리-아르기닌” 또는 “poly-arginine”은 5 내지 15개의 아르기닌(arginine)이 결합된 폴리펩타이드(Wender et al., PNAS 97:13003-13008 (2000))로 바람직하게는 서열목록 제3서열(R7)(RRRRRRR), 서열목록 제4서열(R8)(RRRRRRRR), 서열목록 제5서열(R9)(RRRRRRRRR), 서열목록 제6서열(R10)(RRRRRRRRRR), 서열목록 제7서열(R11)(RRRRRRRRRRR), 서열목록 제8서열(R12)(RRRRRRRRRRRR) 및 서열목록 제9서열(R13)(RRRRRRRRRRRRR)로 구성된 군으로부터 선택된다. “Poly-arginine” or “poly-arginine” is a polypeptide to which 5 to 15 arginine is bound (Wender et al., PNAS 97: 13003-13008 (2000)), preferably SEQ ID NO: 3 (R7) (RRRRRRR), SEQ ID NO: 4 (R8) (RRRRRRRR), SEQ ID NO: 5 (R9) (RRRRRRRRR), SEQ ID NO: 6 (R10) (RRRRRRRRRR), SEQ ID NO: 7 (R11) ) (RRRRRRRRRRR), SEQ ID NO: 8 (R12) (RRRRRRRRRRRR) and SEQ ID NO: 9 (R13) (RRRRRRRRRRRRR).
“SPACE” 또는 “Skin penetrating and cell entering peptide”는 바람직하게는 ACTGSTQHQCG 서열(서열목록 제10서열)을 포함한다(Hsu et al., PNAS 108:15816-15821 (2011)).“SPACE” or “Skin penetrating and cell entering peptide” preferably comprises the ACTGSTQHQCG sequence (SEQ ID NO: 10) (Hsu et al., PNAS 108: 15816-15821 (2011)).
본 발명의 바람직한 구현 예에 따르면, 상기 세포투과 펩타이드 및 핵 이행 신호는 링커로 연결된다.According to a preferred embodiment of the present invention, the cell permeation peptide and the nuclear transduction signal are linked by a linker.
링커는 화학적 링커, 핵산 링커 또는 펩타이드 링커일 수 있으며, 바람직하게는 2 내지 10개의 아미노산으로 이루어진 펩타이드 링커가 사용된다. 상기 펩타이드 링커의 예는 글라이신 폴리머(glycine polymers, (G)n), 글라이신 및 시스테인을 포함하는 폴리머(glycine-cysteine polymers, (GC)n, (GCG)n 및 (CGC)n 등), 글라이신 및 세린을 포함하는 폴리머(glycine-serine polymers, (GS)n, (GSGGS)n 및 (GGGS)n 등), 글라이신 및 알라닌을 포함하는 폴리머(glycine-alanine polymers), 알라닌 및 세린을 포함하는 폴리머(alanine-serine polymers) 등을 사용할 수 있으며(n은 1 이상의 정수), 보다 바람직하게는 서열목록 제9서열의 GCG 서열을 포함할 수 있다. The linker may be a chemical linker, a nucleic acid linker or a peptide linker, preferably a peptide linker consisting of 2 to 10 amino acids. Examples of such peptide linkers include glycine polymers (G) n, glycine and cysteine polymers (GC) n, (GCG) n and (CGC) n, etc.), glycine and Polymers including serine (glycine-serine polymers, (GS) n, (GSGGS) n and (GGGS) n, etc.), polymers including glycine and alanine, polymers containing alanine and serine ( alanine-serine polymers) and the like (n is an integer of 1 or more), and more preferably may include the GCG sequence of SEQ ID NO: 9.
또한, 상기 융합 펩타이드는 칼슘 이온과 함께 하는 경우 세포 전달 효율이 극대화 된다. 칼슘 이온은 양이온이기 때문에 DNA의 음전하 부분과 정전기적 상호작용을 통해 DNA의 양전화화를 유도한다. 또한 음전하를 띠는 세포막과도 상호작용하여 DNA와 세포막의 전하적인 반발력을 상쇄시켜 전체적인 세포투과 효율을 향상시키는 시너지 효과를 보일 수 있다.In addition, the fusion peptide is maximized cell delivery efficiency when combined with calcium ions. Because calcium ions are cations, they induce positive conversion of DNA through electrostatic interactions with the negatively charged portion of DNA. In addition, it interacts with the negatively charged cell membranes to counteract the charge repulsion of the DNA and the cell membranes can exhibit a synergistic effect to improve the overall cell permeation efficiency.
상기 칼슘 이온은 이온 형태(Ca2 +) 또는 칼슘염(calcium salt) 형태로 제공될 수 있으며, 바람직하게는 염화칼슘(CaCl2), 탄산칼슘(CaCO3), 인산칼슘(Ca3(PO4)2, CaHPO4, Ca(H2PO4)2 등), 황산칼슘(CaSO4), 질산칼슘(Ca(NO3)2) 등의 형태로 제공될 수 있다.The calcium ions may be provided in the form of ions (Ca 2 + ) or calcium salt (calcium salt), preferably calcium chloride (CaCl 2 ), calcium carbonate (CaCO 3 ), calcium phosphate (Ca 3 (PO 4 ) 2 , CaHPO 4 , Ca (H 2 PO 4 ) 2, etc.), calcium sulfate (CaSO 4 ), calcium nitrate (Ca (NO 3 ) 2 ), and the like.
상기 칼슘염(calcium salt)의 농도는 바람직하게는 0.5배 내지 2배, 보다 바람직하게는 1배인 것을 사용할 수 있다. 여기서 칼슘이온의 농도는 1배일 때 최종 농도 8.56 mM 이 제공된다. 이를 기준으로 0.1배, 0.5배, 1배, 2배, 4배의 칼슘이온의 농도를 사용할 수 있다.The concentration of the calcium salt (calcium salt) is preferably 0.5 times to 2 times, more preferably 1 times may be used. Wherein the concentration of calcium ions is 1 times the final concentration of 8.56 mM is provided. Based on this, 0.1 times, 0.5 times, 1 times, 2 times, 4 times the concentration of calcium ions can be used.
본 발명의 세포 및 핵막-투과 융합 펩타이드, 약물 전달체 또는 키트를 이용하여 전달하고자 하는 핵산은 특별히 제한되지 않으며, 바람직하게는 뉴클레오타이드, 올리고뉴클레오타이드, 폴리뉴클레오타이드, DNA, RNA, snRNA(small nuclear RNA), rRNA(ribosomal RNA), siRNA(short interfering RNA), shRNA(short hairpin RNA), 안티센스 RNA, miRNA(micro RNA), 유전자 가위 등을 포함한다. 상기 핵산은 그 자체로 또는 플라스미드나 벡터, 트랜스포존 등에 삽입되어 본 발명의 세포 및 핵막-투과 융합 펩타이드와 어셈블리(assembly)를 형성할 수 있다.Nucleic acid to be delivered using the cell and nuclear membrane-penetrating fusion peptide, drug carrier or kit of the present invention is not particularly limited, preferably nucleotides, oligonucleotides, polynucleotides, DNA, RNA, small nuclear RNA (snaRNA), Ribosomal RNA (rRNA), short interfering RNA (siRNA), short hairpin RNA (shRNA), antisense RNA, miRNA (micro RNA), gene shears, and the like. The nucleic acid may be incorporated by itself or inserted into a plasmid, vector, transposon, or the like to form an assembly with the cells and nuclear membrane-permeable fusion peptides of the invention.
상기 세포 및 핵막-투과 융합 펩타이드의 아민기(amine group):플라스미드 인산기(phosphate group)의 N:P비는 바람직하게는 SV40-TAT 펩타이드는 5:1 내지 20:1, SV40-Poly R 펩타이드는 0.5:1 내지 2.5:1, SV40-SPACE 펩타이드는 5:1 내지 20:1, 보다 바람직하게는 SV40-TAT 펩타이드는 10:1 내지 15:1, SV40-Poly R 펩타이드는 1:1 내지 2.5:1, SV40-SPACE 펩타이드는 5:1 내지 10:1인 것을 사용할 수 있다. The N: P ratio of the amine group: plasmid phosphate group of the cell and nuclear membrane-permeable fusion peptides is preferably in the SV40-TAT peptide from 5: 1 to 20: 1 and the SV40-Poly R peptide is 0.5: 1 to 2.5: 1, the SV40-SPACE peptide is 5: 1 to 20: 1, more preferably the SV40-TAT peptide is 10: 1 to 15: 1, and the SV40-Poly R peptide is 1: 1 to 2.5: 1, SV40-SPACE peptide may be used that is 5: 1 to 10: 1.
본 발명의 또 다른 양태에 따르면, 본 발명은 상기 세포 및 핵막-투과 융합 펩타이드에 칼슘이온(Ca2+) 또는 칼슘염(calcium salt)을 처리하는 단계를 포함하는 핵산의 전달 방법을 제공한다.According to another aspect of the present invention, the present invention provides a nucleic acid delivery method comprising the step of treating calcium and calcium ions (Ca 2+ ) or calcium salt (calcium salt) to the cell and nuclear membrane-permeable fusion peptide.
본 발명의 일 실시예에 따르면, 상기 칼슘이온(Ca2 +) 또는 칼슘염(calcium salt)이 처리되지 않거나, 너무 적은 양으로 처리된 경우(0.5 미만) 또는 너무 많은 양으로 처리된 경우(2 초과)와 비교하여, 칼슘 이온이 기준이 되는 1Ca의 최종 농도인 8.56 mM의 0.5 내지 2배 처리된 경우 전달 효율이 획기적으로 높았다.According to one embodiment of the present invention, the calcium ion (Ca 2 + ) or calcium salt (calcium salt) is not treated, or treated in too small amount (less than 0.5) or treated in too much amount (2 Greater than that when calcium ions were treated with 0.5 to 2 fold of 8.56 mM, the final concentration of 1Ca on which the reference was based.
본 발명의 또 다른 양태에 따르면, 본 발명은 하기의 단계를 포함하는 세포 투과용 약물 전달체의 제조방법을 제공한다:According to another aspect of the invention, the present invention provides a method for producing a drug delivery for cell permeation comprising the following steps:
(a) 제 1항의 세포 및 핵막-투과 융합 펩타이드를 제조하는 단계; 및(a) preparing the cell and nuclear membrane-permeable fusion peptide of
(b) 상기 세포 및 핵막-투과 융합 펩타이드에 전달하고자 하는 핵산 및 칼슘 이온을 혼합하는 단계.(b) mixing the nucleic acid and calcium ions to be delivered to the cell and nuclear membrane-penetrating fusion peptides.
본 발명의 특징 및 이점을 요약하면 다음과 같다: The features and advantages of the present invention are summarized as follows:
(ⅰ) 본 발명은 세포투과 펩타이드(cell penetrating peptide, CPP) 및 핵 이행 신호(nuclear localization signal, NLS)를 포함하는 세포 및 핵막-투과 융합 펩타이드, 약물 전달체 및 키트를 제공한다.(Iii) The present invention provides cell and nuclear membrane-permeable fusion peptides, drug carriers and kits including cell penetrating peptides (CPPs) and nuclear localization signals (NLS).
(ⅱ) 본 발명에 따른 융합 펩타이드와 핵산의 나노 어셈블리와 칼슘 이온의 시너지 효과는 플라스미드와 같은 거대 핵산분자의 전달의 경우 기존에 상업화된 리포펙타민과 같은 값비싼 전달체나 PEI에 비하여 전달효율이 더 우수하며 PEI에 비하여 세포독성은 거의 없어서 생체적합성이 매우 뛰어날 뿐 아니라 화학적 대량생산이 가능하여 단가를 획기적으로 낮출 수 있다. 따라서, 플라스미드와 같은 거대 핵산분자 전달체로써 기존 세포 유전자 세포 형질도입법을 대체할 수 있는 기술로 널리 활용될 수 있을 것으로 기대된다.(Ii) The synergistic effect of the nano-assembly and calcium ion of the fusion peptide and nucleic acid according to the present invention is that the delivery efficiency of the large nucleic acid molecules such as the plasmid is higher than that of the expensive commercially available carriers such as lipofectamine or PEI. It is more excellent and has less cytotoxicity than PEI, so it is very biocompatible and can be produced in large quantities, thereby significantly lowering the unit cost. Therefore, it is expected to be widely used as a technology that can replace the existing cell gene cell transduction method as a large nucleic acid molecule carrier such as a plasmid.
도 1은 본 발명에 따른 플라스미드와 단일 펩타이드의 복합체 형성 정도를 아가로스겔 지연반응을 이용하여 확인한 결과를 나타낸 것이다.
도 2는 본 발명에 따른 플라스미드와 융합 펩타이드의 복합체 형성 정도를 아가로스겔 지연반응을 이용하여 확인한 결과를 나타낸 것이다.
도 3은 본 발명에 따른 SV40 단일 펩타이드 아민기 : 핵산 플라스미드 인산기 비율별로 칼슘이온과 시너지 효과에 의한 플라스미드 전달효율을 발광효소로 측정한 결과를 나타낸 것이다.
도 4는 본 발명에 따른 TAT 단일 펩타이드 아민기 : 핵산 플라스미드 인산기 비율별로 칼슘이온과 시너지 효과에 의한 플라스미드 전달효율을 발광효소로 측정한 결과를 나타낸 것이다.
도 5는 본 발명에 따른 Poly R 단일 펩타이드 아민기 : 핵산 플라스미드 인산기 비율별로 칼슘이온과 시너지 효과에 의한 플라스미드 전달효율을 발광효소로 측정한 결과를 나타낸 것이다.
도 6은 본 발명에 따른 SPACE 단일 펩타이드 아민기 : 핵산 플라스미드 인산기 비율별로 칼슘이온과 시너지 효과에 의한 플라스미드 전달효율을 발광효소로 측정한 결과를 나타낸 것이다.
도 7은 본 발명에 따른 SV40-TAT 융합 펩타이드 아민기 : 핵산 플라스미드 인산기 비율별로 칼슘이온과 시너지 효과에 의한 플라스미드 전달효율을 발광효소로 측정한 결과를 나타낸 것이다.
도 8은 본 발명에 따른 SV40-Poly R 융합 펩타이드 아민기 : 핵산 플라스미드 인산기 비율별로 칼슘이온과 시너지 효과에 의한 플라스미드 전달효율을 발광효소로 측정한 결과를 나타낸 것이다.
도 9는 본 발명에 따른 SV40-SPACE 융합 펩타이드 아민기 : 핵산 플라스미드 인산기 비율별로 칼슘이온과 시너지 효과에 의한 플라스미드 전달효율을 발광효소로 측정한 결과를 나타낸 것이다.
도 10은 본 발명에 따른 배율 농도별 칼슘 이온의 SV40-TAT 융합 펩타이드와 시너지 효과에 의한 플라스미드 전달 효율을 발광효소로 측정한 결과를 나타낸 것이다.
도 11은 본 발명에 따른 배율 농도별 칼슘 이온의 SV40-Poly R 융합 펩타이드와 시너지 효과에 의한 플라스미드 전달 효율을 발광효소로 측정한 결과를 나타낸 것이다.
도 12는 본 발명에 따른 배율 농도별 칼슘 이온의 SV40-SPACE 융합 펩타이드와 시너지 효과에 의한 플라스미드 전달 효율을 발광효소로 측정한 결과를 나타낸 것이다.
도 13은 본 발명에 따른 여러 펩타이드들과 칼슘이온과 시너지 효과에 의한 플라스미드 전달효율 중 최적 비율만을 비교한 결과를 나타낸 것이다.
도 14는 본 발명에 따른 융합 펩타이드와 칼슘 이온의 시너지 효과에 의한 eGFP 플라스미드 전달효율을 형광현미경으로 관찰한 결과를 나타낸 것이다.
도 15는 본 발명에 따른 칼슘 이온과 농도별 융합 펩타이드의 세포독성을 확인한 결과를 나타낸 것이다.Figure 1 shows the result of confirming the degree of complex formation of the plasmid and the single peptide according to the present invention using an agarose gel delay reaction.
Figure 2 shows the result of confirming the degree of complex formation of the plasmid and the fusion peptide according to the present invention using an agarose gel delay reaction.
Figure 3 shows the results of measuring the plasmid delivery efficiency by the synergistic effect of calcium ions and synergistic effect of the SV40 single peptide amine group: nucleic acid plasmid phosphate group according to the present invention.
Figure 4 shows the result of measuring the plasmid delivery efficiency by the synergistic effect of calcium ions and synergistic effect of the TAT single peptide amine group: nucleic acid plasmid phosphate group according to the present invention by a light emitting enzyme.
Figure 5 shows the results of measuring the plasmid delivery efficiency by the synergistic effect of calcium ions and synergistic effect of the poly R single peptide amine group: nucleic acid plasmid phosphate group according to the present invention.
Figure 6 shows the SPACE single peptide amine group: nucleic acid plasmid phosphate group according to the present invention shows the result of measuring the plasmid delivery efficiency by the synergistic effect of calcium ions with light emitting enzyme.
Figure 7 shows the results of measuring the plasmid delivery efficiency by the synergistic effect of calcium ions and synergistic effect of the SV40-TAT fusion peptide amine group: nucleic acid plasmid phosphate group according to the present invention.
Figure 8 shows the results of measuring the plasmid transfer efficiency by the synergistic effect of calcium ions and synergistic effect of the SV40-Poly R fusion peptide amine group: nucleic acid plasmid phosphate group according to the present invention.
Figure 9 shows the result of measuring the plasmid delivery efficiency by the synergistic effect of calcium ions and synergistic effect of the SV40-SPACE fusion peptide amine group: nucleic acid plasmid phosphate group according to the present invention.
Figure 10 shows the results of measuring the plasmid delivery efficiency by the synergistic effect of the SV40-TAT fusion peptide of calcium ions at different magnification concentrations according to the present invention with a light emitting enzyme.
Figure 11 shows the results of measuring the plasmid delivery efficiency by synergistic effect of the SV40-Poly R fusion peptide of calcium ions at different magnification concentrations according to the present invention by a light emitting enzyme.
Figure 12 shows the results of measuring the plasmid delivery efficiency by the synergistic effect of the SV40-SPACE fusion peptide of calcium ions at different magnification concentrations according to the present invention with a light emitting enzyme.
Figure 13 shows the results of comparing only the optimal ratio of the plasmid delivery efficiency of the various peptides and calcium ions and synergistic effects according to the present invention.
Figure 14 shows the results of observing the eGFP plasmid transfer efficiency by the synergistic effect of the fusion peptide and calcium ions according to the present invention with a fluorescence microscope.
Figure 15 shows the results confirming the cytotoxicity of calcium ions and fusion peptides by concentration according to the present invention.
이하, 실시 예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시 예는 오로지 본 발명을 보다 구체적으로 설명하기 위한 것으로, 본 발명의 요지에 따라 본 발명의 범위가 이들 실시 예에 의해 제한되지 않는다는 것은 당업계에서 통상의 지식을 가진 자에 있어서 자명할 것이다.Hereinafter, the present invention will be described in more detail with reference to the following examples. These examples are only for illustrating the present invention in more detail, it will be apparent to those skilled in the art that the scope of the present invention is not limited by these examples in accordance with the gist of the present invention. .
실시예 1. 융합 펩타이드의 특성 분석Example 1 Characterization of the Fusion Peptides
특성 분석 결과에 따르면, 핵 이행 신호인 SV40는 서열목록 제1서열의 아미노산 서열로 표시되며 등전점 11.79, 분자량 883.14 및 pH 7에서 6의 순전하를 가진다. 또한 함께 어셈블리로 형성된 플라스미드의 핵 이행을 도와준다. According to the characterization results, the nuclear transition signal SV40 is represented by the amino acid sequence of SEQ ID NO: 1 sequence and has a net charge of 6 at isoelectric point 11.79, molecular weight 883.14 and pH 7. It also aids in nuclear transfer of the plasmids formed as an assembly together.
특성 분석 결과에 따르면, 세포 투과 펩타이드인 TAT은 서열목록 제2서열의 아미노산 서열로 표시되며 등전점 12.7, 분자량 1339.62 및 pH 7에서 9의 순전하를 가진다. 또한 플라스미드와 어셈블리를 형성하고 이 어셈블리의 세포 투과 능력의 향상에 도움이 된다.According to the characterization results, the cell penetrating peptide TAT is represented by the amino acid sequence of SEQ ID NO: 2 sequence and has a net charge of 9 at isoelectric point 12.7, molecular weight 1339.62 and pH 7. It also forms an assembly with the plasmid and helps improve the cell permeability of the assembly.
특성 분석 결과에 따르면, 세포 투과 펩타이드인 Poly R은 서열목록 제3서열 내지 서열목록 제9서열의 아미노산 서열로 표시되며 등전점 13.1, 분자량 1736.06 및 pH 7에서 11의 순전하를 가진다. 또한 플라스미드와 어셈블리를 형성하고 이 어셈블리의 세포 투과 능력의 향상에 도움이 된다.According to the characterization results, the cell penetrating peptide, Poly R, is represented by the amino acid sequence of SEQ ID NO: 3 to SEQ ID NO: 9 and has a net charge of 11 at isoelectric point 13.1, molecular weight 1736.06 and pH 7. It also forms an assembly with the plasmid and helps improve the cell permeability of the assembly.
특성 분석 결과에 따르면, 세포 투과 펩타이드인 SPACE는 서열목록 제10서열의 아미노산 서열로 표시되며 등전점 6.76, 분자량 1092.17 및 pH 7에서 1의 순전하를 가진다. 또한 플라스미드와 어셈블리를 형성하고 이 어셈블리의 세포 및 피부 투과 능력의 향상에 도움이 된다.According to the characterization results, the cell permeation peptide SPACE is represented by the amino acid sequence of SEQ ID NO: 10 sequence and has a net charge of 1 at isoelectric point 6.76, molecular weight 1092.17 and pH 7. It also forms an assembly with the plasmid and helps to enhance the cell and skin permeability of the assembly.
특성 분석 결과에 따르면, 세포 투과 융합 펩타이드인 SV40-TAT은 서열목록 제12서열의 아미노산 서열로 표시되며 등전점 12.41, 분자량 24.21.99 및 pH 7에서 14의 순전하를 가진다. 또한 서열목록 제1서열 및 제2서열의 기능을 조합하기 위해 합성한 융합 펩타이드이다.According to the characterization results, the cell permeation fusion peptide SV40-TAT is represented by the amino acid sequence of SEQ ID NO: 12 sequence has a net charge of 14 at isoelectric point 12.41, molecular weight 24.21.99 and pH 7. It is also a fusion peptide synthesized to combine the functions of SEQ ID NO: 1 and 2 sequences.
특성 분석 결과에 따르면, 융합 펩타이드 중 하나인 SV40-Poly R은 서열목록 제13서열의 아미노산 서열로 표시되며 등전점 12.81, 분자량 2818.43 및 pH 7에서 17의 순전하를 가진다. 또한 서열목록 제1서열 및 제7서열의 기능을 조합하기 위해 합성한 융합 펩타이드이다.According to the characterization results, one of the fusion peptides, SV40-Poly R is represented by the amino acid sequence of SEQ ID NO: 13 sequence and has a net charge of 17 at isoelectric point 12.81, molecular weight 2818.43 and pH 7. It is also a fusion peptide synthesized to combine the functions of the first and seventh sequences.
특성 분석 결과에 따르면, 세포 투과 융합 펩타이드인 SV40-SPACE는 서열목록 제14서열의 아미노산 서열로 표시되며 등전점 9.77, 분자량 2174.54 및 pH 7에서 7의 순전하를 가진다. 또한 서열목록 제1서열 및 제10서열의 기능을 조합하기 위해 합성한 융합 펩타이드이다.According to the characterization results, the cell permeation fusion peptide SV40-SPACE is represented by the amino acid sequence of SEQ ID NO: 14 sequence and has a net charge of 7 at isoelectric point 9.77, molecular weight 2174.54 and pH 7. It is also a fusion peptide synthesized to combine the functions of SEQ ID NO: 1 and 10.
실시예 2. 단일 및 융합 펩타이드와 플라스미드의 어셈블리 형성 확인Example 2. Confirmation of Assembly Formation of Single and Fusion Peptides and Plasmids
각각의 펩타이드와 플라스미드가 어셈블리를 잘 형성하는지 확인하기 위해, 아가로스 젤 전기영동을 수행하였다. 실험 원리는 다음과 같다. 아가로스 젤 전기영동은 DNA를 크기에 따라 분류해줄 수 있는 실험법이다. 하지만 DNA가 펩타이드와 거대 어셈블리를 형성할 경우, 크기가 매우 커서 전기영동을 해도 아가로스 젤을 투과하지 못하여 이동하지 않는 현상을 관찰할 수 있다. 따라서 쉽게 거대 어셈블리 형성 여부를 알 수 있다. To confirm that each peptide and plasmid formed an assembly well, agarose gel electrophoresis was performed. The experimental principle is as follows. Agarose gel electrophoresis is an experimental method that can classify DNA according to its size. However, when the DNA forms a large assembly with the peptide, it can be observed that the size of the DNA does not penetrate the agarose gel even if the electrophoresis is so large. Therefore, it is easy to know whether a large assembly is formed.
실험 방법은 다음과 같다. 아가로스 젤을 1%(w/v) 비율로 1X TAE 버퍼에 녹여 젤을 만든다. 한 웰당 들어가는 플라스미드는 pEGFP-N1(Clontech, Fremont, CA, USA)을 사용하였다. 그 양은 0.5 μg으로 맞추었고, N:P 비율에 따라 펩타이드를 각각의 비율별(0.5:1, 1:1, 2.5:1, 5:1, 10:1, 20:1)로 섞어주고 증류수를 넣어 총량을 20 μL로 맞추었다. 여기서 N:P 비율이란, DNA의 인산기(phosphate group) 개수(P)에 대한 펩타이드의 아민기(amine group) 개수(N)의 비율이다. 그리고 상온에 20분간 두면 어셈블리 형성이 완료된다. 그 후에 로딩다이로 DNA를 염색하고, 40분간 전기영동 해준다. 그 결과는 도 1 및 2에 나타내었다. The experimental method is as follows. Agarose gel is dissolved in 1X TAE buffer at 1% (w / v) to make a gel. The plasmid per well was used pEGFP-N1 (Clontech, Fremont, CA, USA). The amount was adjusted to 0.5 μg, and the peptides were mixed in each ratio (0.5: 1, 1: 1, 2.5: 1, 5: 1, 10: 1, 20: 1) according to the N: P ratio and distilled water was added. Put the total amount to 20 μL. Here, N: P ratio is the ratio of the number (N) of amine groups of a peptide with respect to the number (P) of phosphate groups of DNA. And 20 minutes at room temperature, the assembly is completed. Thereafter, the DNA is stained with a loading die and electrophoresed for 40 minutes. The results are shown in FIGS. 1 and 2.
도 1 및 2를 보면 SV40는 비율이 높아져도 거대 어셈블리를 거의 형성하지 않은 것을 확인할 수 있다. 그러나 펩타이드 비율이 높아질수록 크기가 더 커지는 것을 보면 SV40가 플라스미드와 미미하게 상호작용한다는 것을 확인할 수 있다. TAT은 2.5:1 이상에서부터 거대 어셈블리를 형성하였다. Poly R은 5:1 이상에서부터 거대 어셈블리를 형성하였다. SPACE는 비율이 높아져도 거대 어셈블리를 형성하지 않은 것을 확인할 수 있다. SV40-TAT은 5:1 이상에서부터 거대 어셈블리를 형성하였다. SV40-Poly R은 5:1 이상에서부터 거대 어셈블리를 형성하였다. SV40-SPACE는 10:1 이상에서부터 거대 어셈블리를 형성하였다. SV40는 길이가 짧기 때문에 거대한 플라스미드와 거대 어셈블리를 형성하지는 못하고, 핵산과 상호작용만 하는 것으로 추정된다. SPACE는 양전하를 띨 수 있는 염기성 아미노산이 매우 적기 때문에 플라스미드와 상호작용을 잘 하지 못하는 것으로 추정된다. 그에 반해, TAT, Poly R, SV40-TAT, SV40-Poly R, SV40-SPACE는 높은 어셈블리 형성 능력을 확인하였다. 종합적으로 거대 어셈블리 형성에서 TAT, Poly R이 주요한 역할을 하며 SV40 서열이 큰 방해를 하지 않는다는 것을 확인할 수 있었다.1 and 2, it can be seen that SV40 hardly forms a large assembly even at a high ratio. However, as the peptide ratio increases, the size increases, indicating that SV40 interacts slightly with the plasmid. TAT formed large assemblies from 2.5: 1 and above. Poly R formed large assemblies from 5: 1 and above. It can be seen that SPACE did not form a large assembly even at a high ratio. SV40-TAT formed large assemblies from 5: 1 and above. SV40-Poly R formed large assemblies from 5: 1 and above. The SV40-SPACE formed large assemblies from 10: 1 and above. Because of its short length, SV40 does not form large assemblies with large plasmids, but only interacts with nucleic acids. SPACE is thought to be poorly interacting with the plasmid because it contains very few basic amino acids that can be positively charged. In contrast, TAT, Poly R, SV40-TAT, SV40-Poly R, and SV40-SPACE confirmed high assembly formation capability. Overall, it was confirmed that TAT and Poly R play a major role in the formation of large assemblies, and that the SV40 sequence does not interfere significantly.
실시예 3. 단일 및 융합 펩타이드와 칼슘 이온의 플라스미드 세포 형질도입능력 측정Example 3. Determination of Plasmid Cell Transduction Capability of Single and Fusion Peptides with Calcium Ions
단일 및 융합 펩타이드와 칼슘 이온의 플라스미드 세포 형질도입 능력을 측정하였으며 그 원리는 다음과 같다. Luciferase 발현 벡터 (pGL3, Promega, Madison, WI, USA)의 경우 민감한 검출이 가능하기 때문에 발광측정을 통해 정량적인 결과를 얻었다. 그리고, eGFP 발현 벡터 (pEGFP-N1)의 경우 eGFP 발현을 형광현미경을 통해 정성적으로 확인하였다. 실험 방법은 다음과 같다.Plasmid cell transduction ability of single and fusion peptides and calcium ions was measured and the principle is as follows. Luciferase expression vector (pGL3, Promega, Madison, WI, USA) was able to detect sensitively, so quantitative results were obtained through luminescence measurement. In the case of the eGFP expression vector (pEGFP-N1), eGFP expression was qualitatively confirmed through a fluorescence microscope. The experimental method is as follows.
24웰 플레이트에 HEK293T 세포(American Type Culture Collection, Manassas, VA, USA)의 세포수를 hemocytometer(Paul Marienfeld GmbH & Co. KG, Lauda-Konigshofen, Germany)를 이용하여 80,000 세포씩 깔아주고, 37℃, 5% 이산화탄소 조건에서 하루 동안 배양하였다. 배지는 10% FBS가 있는 DMEM(Thermo Fisher Scientific, Waltham, Massachusetts, USA)을 사용하였다. 세포의 용적률이 60% 이상 되었을 때, 동일한 배지로 갈아주고 DNA 세포투과 실험을 진행하였다. 여기에 쓰일 복합체는 다음과 같이 만든다.Cell number of HEK293T cells (American Type Culture Collection, Manassas, VA, USA) in a 24-well plate was plated by 80,000 cells using a hemocytometer (Paul Marienfeld GmbH & Co. KG, Lauda-Konigshofen, Germany), 37 ℃, Incubated for one day at 5% carbon dioxide conditions. Medium was used with DMEM (Thermo Fisher Scientific, Waltham, Massachusetts, USA) with 10% FBS. When the cell volume ratio reached 60% or more, the cells were changed to the same medium and subjected to DNA cell permeation experiments. The complex to be used is made as follows:
한 웰당 플라스미드의 양은 1 μg으로 고정하고, 각각의 비율에 맞게 펩타이드들을 함께 섞어준다. 그리고 1X HEPES Buffered Saline(HBS, 1L 증류수에 HEPES 5 g, NaCl 8 g, KCl 3.7 g, Na2HPO4(7H2O) 0.188 g을 녹여서 제작한다. HEPES 구입처: Alfa Aesar, Haverhill, Massachusetts, USA; NaCl 구입처: Genomicbase, Seoul, Korea, KCl; Na2HPO4 구입처: Sigma-Aldrich, St. Louis, Missouri, USA)를 18 μL만큼 넣어주고 1M CaCl2를 2.75 μL 넣어준다. 그리고 30-40분간 상온에 둔다. 음성대조군의 경우엔 플라스미드와 1X HBS만 섞어주고, 양성대조군의 경우엔 플라스미드 1 μg과 PEI를 5:1(w/w) 비율로 섞어주고, 20분간 상온에 둔다. 또 다른 양성 대조군인 리포펙타민(Thermo Fisher Scientific, Waltham, Massachusetts, USA)의 어셈블리 형성방법은 다음과 같다. Opti-MEM(Thermo Fisher Scientific, Waltham, Massachusetts, USA) 98 μL와 리포펙타민 2 μL를 섞어주고, Opti-MEM 100 μL에 플라스미드 1 μg을 섞어주고 5분 뒤 두 용액을 합쳐준다. 그리고 20분간 상온에 두면 어셈블리가 형성된다. 복합체 형성이 완료되면, 위에서 준비한 세포들에 복합체를 넣어준다. 그리고 5시간동안 37℃, 5% 이산화탄소 조건에서 배양한다. 5시간이 지나면, 복합체가 들어있는 배지를 제거하고 동일한 배지 1 mL로 교체해준다. 그리고 2일간 더 37℃, 5% 이산화탄소 조건에서 배양해준다. 2일이 지나고 유전자 발현을 확인한다.The amount of plasmid per well is fixed at 1 μg and the peptides are mixed together for each ratio. In addition, 1X HEPES Buffered Saline (HBS, 1L distilled water, HEPES 5g, NaCl 8g, KCl 3.7g, Na 2 HPO 4 (7H2O) 0.188g is prepared by purchasing HEPES: Alfa Aesar, Haverhill, Massachusetts, USA; NaCl Where to buy: Genomicbase, Seoul, Korea, KCl; Na 2 HPO 4 Where to buy: Sigma-Aldrich, St. Louis, Missouri, USA) Add 18 μL and 2.75 μL of 1M CaCl 2 . And leave at room temperature for 30-40 minutes. In the negative control group, only the plasmid and 1X HBS are mixed. In the positive control group, 1 μg of the plasmid and PEI are mixed at a 5: 1 (w / w) ratio and left at room temperature for 20 minutes. Another positive control lipofectamine (Thermo Fisher Scientific, Waltham, Massachusetts, USA) assembly method is as follows. Mix 98 μL of Opti-MEM (Thermo Fisher Scientific, Waltham, Massachusetts, USA) with 2 μL of lipofectamine, mix 1 μg of plasmid with 100 μL of Opti-MEM, and combine the two solutions after 5 minutes. And 20 minutes at room temperature to form an assembly. When the complex formation is complete, add the complex to the cells prepared above. And incubated at 37
Luciferase를 확인하는 경우, 배지를 제거하고 1X Lysis buffer(Promega, Madison, WI, USA)를 각 웰에 100 μL씩 넣어 세포를 파쇄해주고, 파쇄물 20 μL를 96웰 흰색 플레이트에 넣어주었다. 그리고 Luciferin이 들어있는 Luciferase 분석 시료를 100 μL 넣어주고 전체 파장대의 발광을 확인하였다. 그리고 각 세포 파쇄물의 전체 단백질 농도를 BCA 분석을 통해 분석하여 발광값에서 나누어주어 각 세포 양의 차이를 보정해주었다. eGFP 발현을 확인하는 경우, 2일 배양이 끝난 후 배지를 Opti-MEM(Thermo Fisher Scientific, Waltham, Massachusetts, USA) 500 μL로 교체해주고 형광현미경을 통해 eGFP 발현을 확인하였다.When confirming Luciferase, the medium was removed, 1X Lysis buffer (Promega, Madison, WI, USA) was added to 100 μL of each well to disrupt the cells, and 20 μL of the lysate was put into a 96-well white plate. In addition, 100 μL of Luciferase assay sample containing Luciferin was added, and luminescence of the entire wavelength band was confirmed. The total protein concentration of each cell lysate was analyzed by BCA analysis and divided by the luminescence value to correct the difference in the amount of each cell. When confirming eGFP expression, the medium was replaced with 500 μL of Opti-MEM (Thermo Fisher Scientific, Waltham, Massachusetts, USA) after 2 days of culture and confirmed eGFP expression through a fluorescence microscope.
도 3은 칼슘이온이 첨가된 SV40와 플라스미드를 비율별로 사용하였을 때의 결과이다. 펩타이드의 최적 비율을 확인하기 위한 실험 결과이다. 펩타이드와 플라스미드의 N:P 비율이 1:1일 때 가장 높은 효율을 보여주었다. Figure 3 shows the results of using SV40 and plasmid to which calcium ions are added by ratio. Experimental results to determine the optimal ratio of peptides. The highest efficiency was obtained when the N: P ratio of peptide and plasmid was 1: 1.
도 4는 칼슘이온이 첨가된 TAT과 플라스미드를 비율별로 사용하였을 때의 결과이다. 펩타이드의 최적 비율을 확인하기 위한 실험 결과이다. 펩타이드와 플라스미드의 N:P 비율이 15:1일 때 가장 높은 효율을 보여주었다. Figure 4 is the result of using the TAT and the plasmid to which calcium ion is added by ratio. Experimental results to determine the optimal ratio of peptides. The highest efficiency was obtained when the N: P ratio of peptide and plasmid was 15: 1.
도 5는 칼슘이온이 첨가된 Poly R과 플라스미드를 비율별로 사용하였을 때의 결과이다. 펩타이드의 최적 비율을 확인하기 위한 실험 결과이다. 펩타이드와 플라스미드의 N:P 비율이 10:1일 때 가장 높은 효율을 보여주었다.Figure 5 is the result of using Poly ions and plasmids added with calcium ion by ratio. Experimental results to determine the optimal ratio of peptides. The highest efficiency was achieved when the N: P ratio of peptide and plasmid was 10: 1.
도 6은 칼슘이온이 첨가된 SPACE와 플라스미드를 비율별로 사용하였을 때의 결과이다. 펩타이드의 최적 비율을 확인하기 위한 실험 결과이다. 펩타이드와 플라스미드의 N:P 비율이 2.5:1일 때 가장 높은 효율을 보여주었다.Figure 6 is the result of using the SPACE and the plasmid added with calcium ions by ratio. Experimental results to determine the optimal ratio of peptides. The highest efficiency was obtained when the N: P ratio of peptide and plasmid was 2.5: 1.
도 7은 칼슘이온이 첨가된 SV40-TAT과 플라스미드를 비율별로 사용하였을 때의 결과이다. 펩타이드의 최적 비율을 확인하기 위한 실험 결과이다. 펩타이드와 플라스미드의 N:P 비율이 10:1일 때 가장 높은 효율을 보여주었다.Figure 7 shows the results of using the calcium ions added SV40-TAT and plasmid by ratio. Experimental results to determine the optimal ratio of peptides. The highest efficiency was achieved when the N: P ratio of peptide and plasmid was 10: 1.
도 8은 칼슘이온이 첨가된 SV40-Poly R과 플라스미드를 비율별로 사용하였을 때의 결과이다. 펩타이드의 최적 비율을 확인하기 위한 실험 결과이다. 펩타이드와 플라스미드의 N:P 비율이 2.5:1일 때 가장 높은 효율을 보여주었다.8 shows the results of using SV40-Poly R and plasmid to which calcium ions were added in proportion. Experimental results to determine the optimal ratio of peptides. The highest efficiency was obtained when the N: P ratio of peptide and plasmid was 2.5: 1.
도 9는 칼슘이온이 첨가된 SV40-SPACE와 플라스미드를 비율별로 사용하였을 때의 결과이다. 펩타이드의 최적 비율을 확인하기 위한 실험 결과이다. 펩타이드와 플라스미드의 N:P 비율이 10:1일 때 가장 높은 효율을 보여주었다.Figure 9 shows the results of using the calcium ions added SV40-SPACE and plasmid by ratio. Experimental results to determine the optimal ratio of peptides. The highest efficiency was achieved when the N: P ratio of peptide and plasmid was 10: 1.
도 10은 최적 비율의 SV40-TAT 조건에서 칼슘 이온의 농도를 최적화하기 위해 실험한 결과이다. 1Ca는 플라스미드 1 μg당 칼슘 이온 2.75 μmol이 적용될 때의 농도이다. 칼슘의 농도가 1Ca일 때 가장 높은 효율을 보여주었다.10 shows the results of experiments to optimize the concentration of calcium ions under the optimum ratio of SV40-TAT. 1Ca is the concentration when 2.75 μmol of calcium ions are applied per μg of plasmid. The highest efficiency was shown when the calcium concentration was 1Ca.
도 11은 최적 비율의 SV40-Poly R 조건에서 칼슘 이온의 농도를 최적화하기 위해 실험한 결과이다. 1Ca는 플라스미드 1 μg당 칼슘 이온 2.75 μmol이 적용될 때의 농도이다. 칼슘의 농도가 1Ca일 때 가장 높은 효율을 보여주었다.11 shows the results of experiments to optimize the concentration of calcium ions under the optimum ratio of SV40-Poly R. 1Ca is the concentration when 2.75 μmol of calcium ions are applied per μg of plasmid. The highest efficiency was shown when the calcium concentration was 1Ca.
도 12는 최적 비율의 SV40-SPACE 조건에서 칼슘 이온의 농도를 최적화하기 위해 실험한 결과이다. 1Ca는 플라스미드 1 μg당 칼슘 이온 2.75 μmol이 적용될 때의 농도이다. 칼슘의 농도가 0.5Ca일 때 가장 높은 효율을 보여주었지만 1Ca와 통계적으로 유효한 차이가 없기 때문에 1Ca 농도로 사용하였다.12 shows the results of experiments to optimize the concentration of calcium ions under the optimum ratio of SV40-SPACE. 1Ca is the concentration when 2.75 μmol of calcium ions are applied per μg of plasmid. When calcium concentration was 0.5Ca, it showed the highest efficiency, but it was used as 1Ca concentration because there is no statistically valid difference with 1Ca.
도 13은 양성 대조군인 PEI, 리포펙타민과 비교하여 칼슘이온이 첨가된 단일 및 융합 펩타이드와 플라스미드를 최적 비율만 종합하여 나타낸 결과이다. 먼저, TAT 단일 펩타이드는 SV40와 융합되었을 때 약 32배 정도의 효율 증가를 보여주었고, Poly R 단일 펩타이드는 SV40와 융합되었을 때 약 1.8배 정도의 효율 증가를 보여주었고, SPACE 단일 펩타이드는 SV40와 융합되었을 때 약 564배 정도의 효율 증가를 보여주었다. SPACE 단일 펩타이드는 플라스미드와 거대 어셈블리를 거의 형성하지 못하기 때문에 단일 펩타이드로 사용하였을 때 효율이 거의 나타나지 않았다. 하지만 SV40와 융합하였을 때엔 거대 어셈블리를 형성할 수 있기 때문에 가장 큰 효율 증가를 보여주었다. 기존에 널리 사용되던 PEI에 비하여 칼슘이온과 융합 펩타이드의 시너지 효과는 SV40-Poly R, SV40-TAT과 SV40-SPACE 모두 거의 7배에 달하는 효율을 보여주었다. 또한 효율이 매우 좋다고 알려진 리포펙타민과 비교하였을 때에는 칼슘 이온과 융합 펩타이드의 시너지 효과는 SV40-TAT과 SV40-Poly R과 SV40-SPACE 모두 거의 2배에 달하는 효율을 보여주었다. 그에 반해 Poly R을 제외한 다른 단일 펩타이드들은 효과를 거의 보이지 못한 것을 보아 핵 이행신호와 세포투과 펩타이드와 칼슘이온의 시너지 효과가 상당함을 알 수 있다.FIG. 13 shows the results obtained by combining only optimal ratios of single and fused peptides with calcium ions and plasmids compared to PEI and lipofectamine, which are positive controls. First, TAT single peptide showed about 32-fold increase in efficiency when fused with SV40, Poly R single peptide showed about 1.8-fold increase in efficiency when fused with SV40, and SPACE single peptide fused with SV40. It showed an increase of about 564 times. Since SPACE single peptides rarely form large assemblies with plasmids, they showed little efficiency when used as a single peptide. However, when fused with SV40, it showed the greatest efficiency increase because it can form a large assembly. The synergistic effect of calcium ions and fusion peptides was nearly seven times higher than those of PEI, which was widely used in the past, in SV40-Poly R, SV40-TAT and SV40-SPACE. In addition, the synergistic effect of calcium ion and fusion peptide showed almost double the efficiency of both SV40-TAT, SV40-Poly R, and SV40-SPACE when compared with lipofectamine, which is known to be very efficient. On the other hand, other single peptides except Poly R showed little effect, indicating that the synergistic effect of nuclear transduction signal and cell permeation peptide and calcium ion is significant.
도 14는 플라스미드만 처리한 음성 대조군, PEI 및 리포펙타민을 처리한 양성 대조군, 그리고 최적 비율의 칼슘 이온과 융합 펩타이드를 처리하여 eGFP의 발현을 형광현미경으로 관찰한 결과이다. 이 결과를 토대로 다른 종류의 플라스미드 또한 양성 대조군들에 비하여 효율적으로 전달할 수 있다는 사실을 보여주었다.FIG. 14 shows the results of fluorescence microscopy of expression of eGFP by treatment with plasmid-only negative control, PEI and lipofectamine-treated positive control, and treatment with calcium ions and fusion peptides in optimal proportions. Based on these results, it was shown that other types of plasmids can also be delivered more efficiently than the positive controls.
실시예 4. 각각 사용된 전달체들의 세포 독성 결과 확인Example 4. Confirmation of the cytotoxicity results of each of the used carriers
도 15에서는 각 조건별 세포독성을 확인한 결과이다. 유산탈수소효소 분석법을 통해 세포독성을 측정하였다. 유산탈수소효소 분석법은 세포가 죽어 세포막이 파괴될 때, 세포 내부에 있던 유산탈수소효소가 방출되는 양을 효소 반응으로 측정하여 세포독성을 측정하는 실험법이다. 실험 방법은 다음과 같다.15 shows the results of confirming the cytotoxicity of each condition. Cytotoxicity was measured by the lactic acid dehydrogenase assay. Lactic acid dehydrogenase assay is an experimental method to measure the cytotoxicity by measuring the amount of lactic acid dehydrogenase released inside the cell by the enzyme reaction when the cell membrane is destroyed. The experimental method is as follows.
96웰 플레이트에 HEK293T 세포를 30,000 마리씩 깔아주고, 37℃, 5% 이산화탄소 조건에서 하루 동안 배양해준다. 배지는 10% FBS가 있는 DMEM을 사용한다. 다음 날, 각 세포들의 배지를 동일한 배지 100 μL로 교체해준다. 그리고 융합 펩타이드를 다양한 농도별로 준비한 뒤 칼슘이온과 함께 각 세포의 배지에 넣어주고 5시간동안 37℃, 5% 이산화탄소 조건에서 배양한다. 4시간 15분 후에 양성 대조군에 Lysis 버퍼를 10 μL 넣어주고 5시간째에 각 세포의 배지 50 μL를 96웰 플레이트의 비어있는 웰에 옮겨준다. 옮겨준 각 웰에 CytoTox 96®(Promega, Madison, WI, USA) 시료를 50 μL씩 넣어주고, 플레이트를 호일로 감싸 빛을 차단한 채로 30분간 상온에 둔다. 그 후 각 웰에 중단 시료(stop solution) 50 μL를 넣어주고 1시간 이내에 490 nm에서 흡광도를 측정한다. 결과는 도 15에 나타내었다.30,000 HEK293T cells are placed in 96-well plates and incubated at 37 ° C. and 5% carbon dioxide for one day. The medium uses DMEM with 10% FBS. The following day, the medium of each cell is replaced with 100 μL of the same medium. The fusion peptides were prepared at various concentrations, and then put into calcium medium with calcium ions and incubated at 37 ° C. and 5% carbon dioxide for 5 hours. After 4 hours and 15 minutes, 10 μL of Lysis buffer was added to the positive control, and at 5 hours, 50 μL of each cell medium was transferred to an empty well of a 96-well plate. 50 μL of CytoTox 96 ® (Promega, Madison, WI, USA) samples are added to each of the transferred wells, and the plate is wrapped in foil and kept at room temperature for 30 minutes while blocking light. Then 50 μL of stop solution is added to each well and the absorbance is measured at 490 nm within 1 hour. The results are shown in FIG.
양성 대조군을 100으로 잡았을 때, PEI는 상대적으로 높은 세포독성을 보인 반면 리포펙타민 및 융합 펩타이드와 칼슘이온을 처리한 세포들은 아무것도 처리하지 않은 세포들과 비교하여도 세포독성을 보이지 않았다. When the positive control was set at 100, PEI showed relatively high cytotoxicity, whereas cells treated with lipofectamine and fusion peptides and calcium ions showed no cytotoxicity compared to cells that had not received any treatment.
결론적으로 세포투과효율은 상업적으로 판매되는 PEI와 리포펙타민보다 뛰어나지만 세포독성은 거의 없는 융합펩타이드를 이용한 유전자 전달기술을 개발하였다.In conclusion, we have developed a gene transfer technology using a fusion peptide which is superior to commercially available PEI and lipofectamine but has little cytotoxicity.
이상으로 본 발명의 특정한 부분을 상세히 기술하였는바, 당업계의 통상의 지식을 가진 자에게 있어서 이러한 구체적인 기술은 단지 바람직한 구현 예일 뿐이며, 이에 본 발명의 범위가 제한되는 것이 아닌 점은 명백하다. 따라서, 본 발명의 실질적인 범위는 첨부된 청구항과 그의 등가물에 의하여 정의된다고 할 것이다.Having described the specific part of the present invention in detail, it is apparent to those skilled in the art that the specific technology is merely a preferred embodiment, which is not intended to limit the scope of the present invention. Therefore, the substantial scope of the present invention will be defined by the appended claims and equivalents thereof.
<110> INCHEON UNIVERSITY INDUSTRY ACADEMIC COOPERATION FOUNDATION <120> Cell transfection of nucleic acid using nano-assembly by fusion peptide and calcium ion and its application <130> HP7999 <160> 14 <170> KoPatentIn 3.0 <210> 1 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> SV40 <400> 1 Pro Lys Lys Lys Arg Lys Val 1 5 <210> 2 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> TAT <400> 2 Arg Lys Lys Arg Arg Gln Arg Arg Arg 1 5 <210> 3 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> R7 <400> 3 Arg Arg Arg Arg Arg Arg Arg 1 5 <210> 4 <211> 8 <212> PRT <213> Artificial Sequence <220> <223> R8 <400> 4 Arg Arg Arg Arg Arg Arg Arg Arg 1 5 <210> 5 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> R9 <400> 5 Arg Arg Arg Arg Arg Arg Arg Arg Arg 1 5 <210> 6 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> R10 <400> 6 Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg 1 5 10 <210> 7 <211> 11 <212> PRT <213> Artificial Sequence <220> <223> R11 <400> 7 Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg 1 5 10 <210> 8 <211> 12 <212> PRT <213> Artificial Sequence <220> <223> R12 <400> 8 Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg 1 5 10 <210> 9 <211> 13 <212> PRT <213> Artificial Sequence <220> <223> R13 <400> 9 Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg 1 5 10 <210> 10 <211> 11 <212> PRT <213> Artificial Sequence <220> <223> SPACE <400> 10 Ala Cys Thr Gly Ser Thr Gln His Gln Cys Gly 1 5 10 <210> 11 <211> 3 <212> PRT <213> Artificial Sequence <220> <223> Linker <400> 11 Gly Cys Gly 1 <210> 12 <211> 19 <212> PRT <213> Artificial Sequence <220> <223> SV40-TAT <400> 12 Pro Lys Lys Lys Arg Lys Val Gly Cys Gly Arg Lys Lys Arg Arg Gln 1 5 10 15 Arg Arg Arg <210> 13 <211> 21 <212> PRT <213> Artificial Sequence <220> <223> SV40-Poly R <400> 13 Pro Lys Lys Lys Arg Lys Val Gly Cys Gly Arg Arg Arg Arg Arg Arg 1 5 10 15 Arg Arg Arg Arg Arg 20 <210> 14 <211> 21 <212> PRT <213> Artificial Sequence <220> <223> SV40-SPACE <400> 14 Pro Lys Lys Lys Arg Lys Val Gly Cys Gly Ala Cys Thr Gly Ser Thr 1 5 10 15 Gln His Gln Cys Gly 20 <110> INCHEON UNIVERSITY INDUSTRY ACADEMIC COOPERATION FOUNDATION <120> Cell transfection of nucleic acid using nano-assembly by fusion peptide and calcium ion and its application <130> HP7999 <160> 14 <170> KoPatentIn 3.0 <210> 1 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> SV40 <400> 1 Pro Lys Lys Lys Arg Lys Val 1 5 <210> 2 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> TAT <400> 2 Arg Lys Lys Arg Arg Gln Arg Arg Arg 1 5 <210> 3 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> R7 <400> 3 Arg Arg Arg Arg Arg Arg Arg 1 5 <210> 4 <211> 8 <212> PRT <213> Artificial Sequence <220> <223> R8 <400> 4 Arg Arg Arg Arg Arg Arg Arg Arg Arg 1 5 <210> 5 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> R9 <400> 5 Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg 1 5 <210> 6 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> R10 <400> 6 Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg 1 5 10 <210> 7 <211> 11 <212> PRT <213> Artificial Sequence <220> <223> R11 <400> 7 Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg 1 5 10 <210> 8 <211> 12 <212> PRT <213> Artificial Sequence <220> <223> R12 <400> 8 Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg 1 5 10 <210> 9 <211> 13 <212> PRT <213> Artificial Sequence <220> <223> R13 <400> 9 Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg Arg 1 5 10 <210> 10 <211> 11 <212> PRT <213> Artificial Sequence <220> <223> SPACE <400> 10 Ala Cys Thr Gly Ser Thr Gln His Gln Cys Gly 1 5 10 <210> 11 <211> 3 <212> PRT <213> Artificial Sequence <220> <223> Linker <400> 11 Gly Cys Gly One <210> 12 <211> 19 <212> PRT <213> Artificial Sequence <220> <223> SV40-TAT <400> 12 Pro Lys Lys Lys Arg Lys Val Gly Cys Gly Arg Lys Lys Arg Arg Gln 1 5 10 15 Arg Arg Arg <210> 13 <211> 21 <212> PRT <213> Artificial Sequence <220> <223> SV40-Poly R <400> 13 Pro Lys Lys Lys Arg Lys Val Gly Cys Gly Arg Arg Arg Arg Arg Arg 1 5 10 15 Arg Arg Arg Arg Arg 20 <210> 14 <211> 21 <212> PRT <213> Artificial Sequence <220> <223> SV40-SPACE <400> 14 Pro Lys Lys Lys Arg Lys Val Gly Cys Gly Ala Cys Thr Gly Ser Thr 1 5 10 15 Gln His Gln Cys Gly 20
Claims (17)
Cell and nuclear-penetrating fusion peptides, including cell penetrating peptides (CPP) and nuclear localization signals (NLS).
According to claim 1, The nuclear transfer signal is SV40 (simian virus 40) T-antigen, human retinoic acid receptor β- nuclear transfer signal sequence, NF.kappa-β p50 associated sequence, NF.kappa-β p65 associated sequence, Cell and nuclear membrane-permeable fusion peptides selected from the group consisting of M9 association sequence, Nucleoplasm association sequence, c-Myc association sequence.
3. The cell and nuclear membrane-penetrating fusion peptide according to claim 2, wherein the nuclear transfer signal comprises the amino acid sequence of SEQ ID NO: 1.
The cell and nuclear membrane-permeable fusion of claim 1, wherein the cell permeation peptide is selected from the group consisting of HIV 1 trans-activating protein (TAT), poly-arginine, and skin permeating and cell entering peptide (SPACE). Peptides.
The cell and nuclear membrane-penetrating fusion peptide according to claim 4, wherein the TAT comprises the amino acid sequence of SEQ ID NO: 2.
The method of claim 4, wherein the poly-arginine is SEQ ID NO: SEQ ID NO: 3 (R7), SEQ ID NO: 4 (R8), SEQ ID NO: 5 (R9), SEQ ID NO: 6 (R10), SEQ ID NO: A cell and nuclear membrane-penetrating fusion peptide comprising an amino acid sequence selected from the group consisting of 7 SEQ ID NO (R11), SEQ ID NO: 8, (R12), and SEQ ID NO: 9 (R13).
5. The cell and nuclear membrane-penetrating fusion peptide according to claim 4, wherein the SPACE comprises the amino acid sequence of SEQ ID NO: 10 sequence.
The cell and nuclear membrane-penetrating fusion peptide of claim 1, wherein the cell permeation peptide and the nuclear transduction signal are linked by a linker.
9. The cell and nuclear membrane-permeable fusion peptide of claim 8, wherein the linker consists of 2 to 10 amino acids.
10. The cell and nuclear membrane-permeable fusion peptide of claim 9, wherein the linker comprises cysteine and glycine.
The cell and nuclear membrane-penetrating fusion peptide of claim 10, wherein the linker comprises an amino acid sequence of SEQ ID NO: 11 (GCG).
A drug carrier for transducing a nucleic acid comprising the cell of claim 1 and a nuclear membrane-penetrating fusion peptide.
(a) the calcium ions (Ca 2 +) or calcium salts (calcium salt) and (b) of claim 1 to claim 11, wherein in any one of the cells and the nuclear membrane-kit for the transgene traits including a transmission fusion polypeptide.
14. The nucleic acid transduction kit according to claim 13, wherein the gene transduction is performed by a plasmid.
15. The nucleic acid transduction kit according to claim 14, wherein the N / P ratio of the cell and nuclear membrane-permeable fusion peptide amine group: the plasmid phosphate group is 0.5: 1 to 20: 1.
Claim 1 cells and the nuclear envelope-way transduction of nucleic acid comprising the step of treating the calcium ions (Ca 2 +) or calcium salts (calcium salt) for transmitting the fusion polypeptide.
(a) 제 1항의 세포 및 핵막-투과 융합 펩타이드를 제조하는 단계; 및
(b) 상기 세포 및 핵막-투과 융합 펩타이드에 형질도입하고자 하는 핵산 및 칼슘 이온을 혼합하는 단계.Method for producing a drug carrier for cell and nuclear membrane permeation comprising the following steps:
(a) preparing the cell and nuclear membrane-permeable fusion peptide of claim 1; And
(b) mixing the nucleic acid and calcium ions to be transduced into the cell and nuclear membrane-penetrating fusion peptides.
Priority Applications (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020180085867A KR102208919B1 (en) | 2018-07-24 | 2018-07-24 | Cell transfection of nucleic acid using nano-assembly by fusion peptide and calcium ion and its application |
| PCT/KR2018/012211 WO2020022560A1 (en) | 2018-07-24 | 2018-10-17 | Method for transfecting nucleic acid into cells by using fusion peptide nanoassemblies and calcium ions, and application thereof |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020180085867A KR102208919B1 (en) | 2018-07-24 | 2018-07-24 | Cell transfection of nucleic acid using nano-assembly by fusion peptide and calcium ion and its application |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| KR20200011135A true KR20200011135A (en) | 2020-02-03 |
| KR102208919B1 KR102208919B1 (en) | 2021-01-28 |
Family
ID=69181878
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| KR1020180085867A KR102208919B1 (en) | 2018-07-24 | 2018-07-24 | Cell transfection of nucleic acid using nano-assembly by fusion peptide and calcium ion and its application |
Country Status (2)
| Country | Link |
|---|---|
| KR (1) | KR102208919B1 (en) |
| WO (1) | WO2020022560A1 (en) |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR102301572B1 (en) * | 2020-02-06 | 2021-09-10 | 인천대학교 산학협력단 | A Novel Composition for Delivery of Nucleic Acid Molecules and Use Thereof |
| CN114288415B (en) * | 2021-12-30 | 2023-04-28 | 苏州大学 | Calcium phosphate nano drug-carrying system and preparation method and application thereof |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20050042603A1 (en) * | 2003-07-01 | 2005-02-24 | Allele Biotechnology & Pharmaceuticals, Inc. | Compositions and methods for peptide-assisted transfection |
| US20170035914A1 (en) * | 2015-08-05 | 2017-02-09 | General Electric Company | Functionalized peptide transporters for cellular uptake |
| CN107794280A (en) | 2017-09-26 | 2018-03-13 | 天津大学 | Target cell-penetrating peptide genophore and its application |
-
2018
- 2018-07-24 KR KR1020180085867A patent/KR102208919B1/en active IP Right Grant
- 2018-10-17 WO PCT/KR2018/012211 patent/WO2020022560A1/en active Application Filing
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20050042603A1 (en) * | 2003-07-01 | 2005-02-24 | Allele Biotechnology & Pharmaceuticals, Inc. | Compositions and methods for peptide-assisted transfection |
| US20170035914A1 (en) * | 2015-08-05 | 2017-02-09 | General Electric Company | Functionalized peptide transporters for cellular uptake |
| CN107794280A (en) | 2017-09-26 | 2018-03-13 | 天津大学 | Target cell-penetrating peptide genophore and its application |
Non-Patent Citations (2)
| Title |
|---|
| J. Gene Med., Vol. 10, pp. 1150-1159(2008) * |
| J. Med. Chem., Vol. 51, pp. 6014-6020(2008) * |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2020022560A1 (en) | 2020-01-30 |
| KR102208919B1 (en) | 2021-01-28 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| KR102455623B1 (en) | An engineered guide RNA for the optimized CRISPR/Cas12f1 system and use thereof | |
| EP3518981A1 (en) | Delivery of therapeutic rnas via arrdc1-mediated microvesicles | |
| KR20210091160A (en) | Compositions and methods for immunotherapy | |
| KR20220044811A (en) | Targeted trans-sequencing using CRISPR/CAS13 | |
| EP3752179A1 (en) | Gene editing using homology-independent universal genome engineering technology | |
| KR20180092989A (en) | Transposon systems, kits containing them, and uses thereof | |
| KR102208919B1 (en) | Cell transfection of nucleic acid using nano-assembly by fusion peptide and calcium ion and its application | |
| EP2914721B1 (en) | A rna trans-splicing molecule (rtm) for use in the treatment of cancer | |
| JP2020504090A (en) | Cell membrane penetrating peptide and intracellular media containing the same | |
| CN116113697A (en) | Methods and compositions for treating epilepsy | |
| CN107827970B (en) | Anti-tumor protein peptide for inhibiting FOXM1 | |
| WO2002099104A1 (en) | Polypeptide unstabilizing protein in cells under aerobic conditions and dna encoding the same | |
| EP2594638B1 (en) | Method for introducing nucleic acid to cell and nucleic acid complex | |
| CA3226284A1 (en) | Oligonucleotides and viral untranslated region (utr) for increasing expression of target genes and proteins | |
| US20180153819A1 (en) | Nanocapsule utilizing mutant chaperonin complex for system of local drug delivery into cell | |
| KR102138153B1 (en) | A Cell penetrating peptide and high throughput screening method thereof | |
| CN115279902A (en) | System for regulating gene expression | |
| Hirano et al. | Magainin 2-derived stapled peptides derived with the ability to deliver pDNA, mRNA, and siRNA into cells | |
| US20090253206A1 (en) | Nuclear transport agent and method for producing said agent | |
| KR20090122769A (en) | Method for delivering proteins into cells and peptide therefor | |
| KR101461750B1 (en) | Cell penetrating peptide derived from human LPIN3 protein and cargo delivery system using the same | |
| KR20230100212A (en) | A Composition for Nonviral-based high-efficiency Nucleic Acid Transfection and Use Thereof | |
| RU2775176C2 (en) | Nucleic acids encoding crispr-associated proteins, and their use | |
| WO2024078633A1 (en) | Trigger-inducible mrna circularization | |
| KR20170033559A (en) | Novel fusion peptides for gene delivery |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| A201 | Request for examination | ||
| E902 | Notification of reason for refusal | ||
| E701 | Decision to grant or registration of patent right |