KR20180032187A - Topical Formulation Composed of Cell Permeable Vascular Endothelial Growth Factor (LMWP-VEGF) fusion protein with Skin Physiological Activity - Google Patents
Topical Formulation Composed of Cell Permeable Vascular Endothelial Growth Factor (LMWP-VEGF) fusion protein with Skin Physiological Activity Download PDFInfo
- Publication number
- KR20180032187A KR20180032187A KR1020170120420A KR20170120420A KR20180032187A KR 20180032187 A KR20180032187 A KR 20180032187A KR 1020170120420 A KR1020170120420 A KR 1020170120420A KR 20170120420 A KR20170120420 A KR 20170120420A KR 20180032187 A KR20180032187 A KR 20180032187A
- Authority
- KR
- South Korea
- Prior art keywords
- growth factor
- vegf
- cell
- fusion protein
- skin
- Prior art date
Links
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/64—Proteins; Peptides; Derivatives or degradation products thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/18—Growth factors; Growth regulators
- A61K38/1858—Platelet-derived growth factor [PDGF]
- A61K38/1866—Vascular endothelial growth factor [VEGF]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q19/00—Preparations for care of the skin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q19/00—Preparations for care of the skin
- A61Q19/08—Anti-ageing preparations
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Dermatology (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Immunology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Birds (AREA)
- Gerontology & Geriatric Medicine (AREA)
- Vascular Medicine (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Description
본 발명은 세포 투과형 혈관내피세포성장인자(Vascular Endothelial Growth Factor; VEGF) 융합 단백질을 함유하는 피부외용제 조성물에 관한 것이다.The present invention relates to a composition for external application for skin containing a cell-penetrating type Vascular Endothelial Growth Factor (VEGF) fusion protein.
급속한 산업화가 진행되고 고령화 현상이 심화 됨에 따라, 이러한 환경변화에 기인한 각종 피부 질환이 증가하고 있어 의료 및 생명공학 업계에서는 피부질환 및 피부재생을 통한 항노화 연구가 활발하게 진행되고 있다. As rapid industrialization progresses and aging phenomenon deepens, various kinds of skin diseases caused by such environmental changes are increasing, and in the medical and biotechnology industry, researches on anti-aging through skin diseases and skin regeneration are actively proceeding.
생명공학 기술개발이 고도화됨에 따라, 화장품 산업분야에도 생명공학 첨단 기술이 도입되었으며, 준 치료제 개념의 코스메슈티컬(Cosmeceuticals, 화장품을 뜻하는 코스메틱과 치료제를 뜻하는 파마슈티컬의 신조 합성어) 개발이 화장품 시장의 새로운 트렌드로 떠오르고 있다. 이에 피부 질환 개선 및 재생, 항노화 기능을 보유한 단백질 소재 개발 필요성이 늘어나고 있으며, 화장품 제조자들은 이러한 필요성에 맞는 차별화된 소개 개발을 통한 시장 확대 전략을 추진하고 있다. As biotechnology development has advanced, biotechnology advanced technology has been introduced into the cosmetics industry, and the development of cosmeceuticals (cosmeceuticals, which means cosmetics) and cosmetics (a synonym of cosmetics) It is emerging as a new trend in the market. Therefore, there is a growing need for the development of protein materials with skin disease improvement and regeneration and anti-aging functions, and cosmetics manufacturers are pursuing a market expansion strategy by developing differentiated introductions that meet these needs.
재조합 단백질 기술은 유전공학기술을 이용하여 고등생물에서 유래한 단백질을 미생물 및 동물세포에서 대량 발현시키는 기술이다. 단백질의 기능적 특성에 따라 미생물 및 동물세포에서 생산하는 공정기술이 응용되고 있으며, 이렇게 생산된 단백질은 제약, 화장품, 식품, 분석 및 진단 산업분야에 널리 사용되고 있다. 재조합 단백질 기반의 화장품 신소재의 경우, 주로 트러블성 피부질환을 대상으로 연구개발이 활발하다. 예를 들어, 재조합 단백질은 단백질의 물리적 특성에 기인된 낮은 피부 투과능과 물리적 안정성을 개선할 경우 글로벌 시장을 선도할 수 있는 원료개발 및 상용화가 가능하다.Recombinant protein technology is a technique that uses genetic engineering techniques to mass-express proteins derived from higher organisms in microorganisms and animal cells. Depending on the functional characteristics of the proteins, process technologies produced by microorganisms and animal cells have been applied, and the proteins thus produced are widely used in the pharmaceutical, cosmetic, food, analytical and diagnostic industries. In the case of cosmetic new materials based on recombinant proteins, research and development is actively conducted mainly on troublesome skin diseases. For example, recombinant proteins can develop and commercialize raw materials that can lead the global market if they improve the low skin permeability and physical stability attributed to the physical properties of proteins.
하지만, 이러한 재조합 단백질들은 일반적으로 친수성이고 거대한 분자들은 세포막이라는 장벽에 의해 세포 안으로 들어가는 것이 매우 어렵다. 세포막은 펩타이드나 단백질, 핵산과 같은 거대 분자가 세포 내로 들어가지 못하게 막으며 세포막 수용체의 의한 엔도사이토시스(Endocytosis)라는 생리적 기작을 통해 세포 내로 들어가더라도 세포의 리소좀(Lysosomal compartment)과 융합되어 결국 분해되므로 이들 거대분자 바이오 활성소재를 세포 외에서 전달하는 데 많은 제약이 따른다.However, these recombinant proteins are generally hydrophilic, and it is very difficult for large molecules to enter the cell by a barrier called a cell membrane. The cell membrane prevents macromolecules such as peptides, proteins, and nucleic acids from entering the cell, and even if it enters the cell through a physiological mechanism called Endocytosis by the cell membrane receptor, it fuses with the lysosomal compartment of the cell, Therefore, there are many limitations in transferring these macromolecular bioactive materials from outside the cell.
또한, 성장인자(Growth factor)와 같은 거대분자 바이오 활성성분 역시 친수성이며 분자량이 커서 세포막을 투과하여 피부에 흡수되는데 한계가 있기 때문에 실질적인 활성효과를 기대하기는 어렵다. 이러한 분자량이 큰 단백질의 피부흡수를 증가시키기 위해 통상적으로 레이저나 메조룰러와 같은 물리적으로 피부에 구멍을 내는 방법 또는 계면활성제 및 나노구조체 등의 전달체(Carrier)를 이용하는 방법이 적용되고 있으나, 이러한 방법은 피부 장벽의 손상 위험이 있고 거대분자를 흡수시키기에는 여전히 한계가 있으며 별도의 디바이스 시술이 요구되는 단점이 있다.In addition, macromolecular biologically active ingredients such as a growth factor are also hydrophilic and have a large molecular weight, so that they are not easily absorbed into the skin through the cell membrane. In order to increase the skin absorption of a protein having such a large molecular weight, a method of physically piercing the skin such as a laser or a mesorizer or a method using a carrier such as a surfactant and a nanostructure has been applied, There is a risk of damaging the skin barrier and there is still a limit to absorb the macromolecules and there is a disadvantage that a separate device operation is required.
이러한 한계를 극복하기 위해 최근 새로운 대안들이 제시 되었는데 그 중 세포 투과형 펩타이드(Cell penetrating peptide, CPP)들은 현재까지 낮은 세포막 투과성 및 빠른 생체 내 반감기로 인해 약물로 사용하기 어려웠던 치료용 단백질 및 유전자와 같은 거대 분자들의 의약학적 이용가치를 높일 수 있어 상기 펩타이드를 이용해 살아있는 세포의 질이나 핵 안으로 바이오 활성소재를 보다 안전하고 효과적으로 전달할 수 있는 방법이 연구되고 있다.Recently, new approaches have been proposed to overcome these limitations. Of these, cell penetrating peptides (CPPs) have been used as therapeutic proteins and genes that are difficult to use as drugs due to low cell membrane permeability and fast in vivo half- A method for safely and effectively delivering a bioactive material into the quality of living cells or nuclei using the peptide is being studied.
이렇듯 CPP를 이용하여 세포 내 효율적 수송을 위한 다양한 응용이 시도되었으나(특허문헌 0001), 아직까지 세포 투과형 펩타이드와 성장인자들을 결합시켜 화장료 조성물의 핵심소재로 활용하는 연구는 드물었다.Although a variety of applications have been attempted for efficiently transporting intracellular proteins using CPP (Patent Document 0001), there have been few studies to utilize cell permeable peptides and growth factors as core materials for cosmetic compositions.
본 발명의 목적은 세포 독성이 없으면서도 세포 투과능이 우수한 세포 투과형 펩타이드와 성장인자인 혈관내피세포성장인자(Vascular endothelial growth factor; VEGF)가 융합된 융합 단백질을 포함하는 피부 외용제 조성물을 제공하는 것이다.It is an object of the present invention to provide a composition for external application for skin comprising a fusion protein in which a cell permeable peptide having excellent cell permeability without cytotoxicity and a vascular endothelial growth factor (VEGF) as a growth factor is fused.
본 발명의 다른 목적은 세포 투과형 펩타이드와 성장인자인 혈관내피세포성장인자(Vascular endothelial growth factor; VEGF)가 융합된 융합 단백질에 1,2-헥산디올을 더 포함하는 피부 외용제 조성물을 제공하는 것이다.Another object of the present invention is to provide a composition for external application for skin, which further comprises 1,2-hexanediol in a fusion protein in which a cell permeable peptide and a vascular endothelial growth factor (VEGF) as a growth factor are fused.
본 발명은 인체에 부작용이 없으면서 콜라겐 생성 촉진, 피부 재생 또는 상처 치유의 효과를 갖는 피부 외용제 조성물에 관한 것으로, 세포 투과성이 크게 증가되고, 이로 인해 피부 생리활성이 증대된 융합 단백질인, 세포 투과형 성장인자 융합 단백질을 포함하는 것을 특징으로 한다.The present invention relates to a composition for external application for skin having the effect of promoting collagen production, skin regeneration or wound healing without adverse effects on the human body. The present invention relates to a composition for external application for skin, which is a fusion protein with increased cell permeability and thus increased skin physiological activity, Characterized by comprising a factor-fusion protein.
본 발명의 목적을 달성하기 위해, 본 발명은 세포 투과형 펩타이드에 성장인자가 융합된, 세포 투과형 성장인자 융합 단백질을 포함하는 피부 외용제 조성물을 제공한다.In order to accomplish the object of the present invention, the present invention provides an external preparation for skin comprising a cell-penetrating growth factor fusion protein, wherein a growth factor is fused to a cell-penetrating peptide.
본 발명에 있어서, 상기 세포 투과형 펩타이드는 TAT, 페너트라틴(penetratin), Antp(antennapedia protein), 또는 저분자 프로타민(Low molecular weight protamine)으로 이루어진 군에서 하나 이상인 것일 수 있고, 바람직하게는 저분자 프로타민(Low molecular weight protamine, LMWP)인 것일 수 있으나 이에 한정하는 것은 아니다. 보다 바람직하게는 상기 저분자 프로타민은 서열번호 1로 표시된 아미노산 서열로 표시된 펩타이드일 수 있으나, 이에 한정하는 것은 아니다.In the present invention, the cell-penetrating peptide may be at least one member selected from the group consisting of TAT, Penetratin, Antp (antennapedia protein), and Low molecular weight protamine, and preferably a low molecular protamine Low molecular weight protamine, LMWP). More preferably, the low molecular protamine may be a peptide represented by the amino acid sequence shown in SEQ ID NO: 1, but is not limited thereto.
본 발명에 있어서, 상기 성장인자는 혈관내피세포성장인자(Vascular endothelial growth factor; VEGF), 상피세포성장인자(EGF), 및 신경성장인자(NGF)로 이루어진 군에서 하나 이상인 것을 특징으로 한다. 보다 바람직하게는 상기 성장인자는 혈관내피세포성장인자(VEGF)인 것일 수 있으나 이에 한정하는 것은 아니다.In the present invention, the growth factor is at least one member selected from the group consisting of vascular endothelial growth factor (VEGF), epithelial growth factor (EGF), and nerve growth factor (NGF). More preferably, the growth factor may be a vascular endothelial growth factor (VEGF), but is not limited thereto.
본 발명에 있어서, 상기 세포 투과형 성장인자는, 성장인자의 N-말단, C-말단 또는 N-말단 및 C-말단에 세포 투과형 펩타이드의 아미노산 서열이 결합되어 있는 융합 단백질의 형태인, 세포 투과형 성장인자 융합 단백질인 것을 특징으로 한다.In the present invention, the cell-penetrating growth factor may be a cell penetration-type growth factor, which is a form of a fusion protein in which an amino acid sequence of a cell-penetrating peptide is bound to N-terminal, C-terminal or N-terminal and C- Is a factor-fusion protein.
보다 구체적으로는, 본 발명은 세포 투과형 펩타이드에 혈관내피세포성장인자(VEGF)가 융합된, 세포 투과형 혈관내피세포성장인자 융합 단백질을 포함하는 피부 외용제 조성물을 제공할 수 있다. More specifically, the present invention can provide a composition for external application for skin comprising a fusion protein of vascular endothelial cell growth factor (VEGF) fused to a cell-penetrating peptide.
본 발명에 있어서, 상기 조성물은 1,2-헥산디올(1,2-Hexanediol)을 더 포함할 수 있다.In the present invention, the composition may further include 1,2-hexanediol.
본 발명에 있어서, 상기 피부 외용제 조성물은 콜라겐 생성을 촉진용인 것을 특징으로 한다.In the present invention, the composition for external application for skin is characterized in that collagen production is promoted.
본 발명에 있어서, 상기 피부 외용제 조성물은 피부 재생용인 것을 특징으로 한다. In the present invention, the composition for external application for skin is characterized in that it is for skin regeneration.
또한, 본 발명에 따른 상기 조성물은 상처 치유용인 것을 특징으로 한다.Further, the composition according to the present invention is characterized in that it is for wound healing.
이하, 본 발명을 보다 구체적으로 설명한다.Hereinafter, the present invention will be described more specifically.
본 발명은 세포막 투과성이 우수하고 생체 친화적인 펩타이드인 PTD(protein transduction domain)을 이용하여 바이오 활성소재 자체의 피부 침투력을 증가시켜 바이오 활성소재의 효과를 극대화시키고자 하였다.The present invention aims to maximize the effect of the bioactive material by increasing the penetration of the bioactive material into the skin using PTD (protein transduction domain) which is a biocompatible peptide having excellent cell membrane permeability.
PTD는 세포막 투과성이 우수하고 생체 친화적인 펩타이드로, PTD에 의한 세포 내 전달의 주요 기전 중 하나는 endocytosis의 한 종류인 mavropinocytosis에 의해 이루어진다. PTD가 세포 표면에 부착되면 세포막이 이를 감싸서 macropinosome을 형성하여 세포 속으로 uptake 되고 작용이 끝난 후에는 분해 및 배출되는 것으로 알려져 있다. 이러한 기전을 통한 세포 내 전달은 효율적이며 세포막을 교란시키거나 손상시키지 않고 수행될 수 있다. 또한 PTD에 의한 물질의 세포막 투과는 수용체 및 전달체에 의해 영향을 받지 않기 때문에 생물학적 활성 물질의 세포 내 전달을 위한 전달체(carrier)로 활용 가능하다. PTD는 바이러스성 PTD, 기존 PTD를 본 따 합성한 합성PTD, 생체에서 유래된 비 바이러스성 PTD으로 분류되며, 바이러스성 PTD로는 TAT, YARA 등이 있고, 비 바이러스성 PTD로는 LMWP 등이 있다. PTD is a biocompatible peptide with excellent membrane permeability. One of the main mechanism of intracellular delivery by PTD is by mavropinocytosis, a kind of endocytosis. When the PTD is attached to the cell surface, the cell membrane encapsulates it and forms a macropinosome, which is uptake into the cell and is known to be decomposed and released after the action. Intracellular delivery through this mechanism is efficient and can be performed without disturbing or damaging the cell membrane. In addition, PTD-mediated cell membrane permeation is not affected by receptors and transporters, and thus can be used as a carrier for intracellular delivery of biologically active substances. PTD is classified as viral PTD, synthetic PTD based on existing PTD, nonviral PTD derived from living body, viral PTD as TAT, YARA, and nonviral PTD as LMWP.
그리하여, 본 발명은 세포 투과형 펩타이드에 성장인자가 융합된 단백질인 ("세포 투과형펩타이드-성장인자 융합 단백질"), 세포 투과형 성장인자 융합 단백질을 포함하는 피부 외용제 조성물에 관한 것이다. Thus, the present invention relates to a composition for external application to skin comprising a fusion protein with a cell-penetrating peptide (a "cell permeable peptide-growth factor fusion protein") and a cell-penetrating growth factor fusion protein.
보다 구체적으로, 상기 세포 투과형 혈관내피세포성장인자는, 혈관내피세포성장인자(VEGF)의 N-말단, C-말단 또는 N-말단 및 C-말단에 세포 투과형 펩타이드의 아미노산 서열이 결합되어 있는 융합 단백질의 형태인, 세포 투과형 혈관내피세포성장인자일 수 있다. More specifically, the cell-permeable vascular endothelial growth factor may be a fusion protein comprising an N-terminal, C-terminal or N-terminal and C-terminal amino acid sequence of a vascular endothelial growth factor (VEGF) Transmembrane vascular endothelial cell growth factor, in the form of a protein.
본 발명에 있어서, "융합 단백질"이란 수송도메인 및 한 개 이상의 목적 단백질 부분을 포함하며, 수송도메인과 목적 단백질의 유전적 융합이나 화학 결합으로 형성된 복합체를 의미한다. 또한, 상기 "유전적 융합"이란 단백질을 코딩하는 DNA 서열의 유전적 발현을 통해서 형성된 선형, 공유결합으로 이루어진 연결을 의미한다. 따라서, 본 발명의 "세포 투과형 펩타이드-성장인자 융합 단백질"은, 세포 투과형 펩타이드와 성장인자 단백질을 포함하며, 세포 투과형 펩타이드와 성장인자의 유전적 융합이나 화학 결합으로 형성된 공유결합 복합체를 의미한다. In the present invention, the term "fusion protein" means a complex formed by genetic fusion or chemical bonding between a transport domain and a target protein, including a transport domain and at least one target protein moiety. In addition, the term "genetic fusion" means a link consisting of a linear, covalent bond formed through genetic expression of a DNA sequence encoding a protein. Thus, the term "cell-penetrating peptide-growth factor fusion protein" of the present invention refers to a covalent complex comprising a cell-permeable peptide and a growth factor protein and formed by genetic fusion or chemical bonding of a cell-penetrating peptide and a growth factor.
본 발명에 있어서, 상기 융합 단백질의 제조는 유전자 재조합 방법으로 세포 투과형 성장인자 융합 단백질을 제조할 수 있다.In the present invention, the fusion protein may be prepared by preparing a cell penetrating growth factor fusion protein by a recombinant method.
본 발명에서 특히 제시하고 있는 유전자 재조합 방법의 경우에는, 성장인자 고유의 생물학적 활성을 유지시킬 수 있고, 성장인자 내 세포 투과형 펩타이드의 결합 위치를 정확히 조절할 수 있으며, 합성에 의해 LMWP를 각 성장인자에 결합시키는 경우 합성 중 성장인자의 활성 감소 가능 및 합성 중간마다 별도의 분리 및 정제 과정이 필요하므로 생산성 및 경제성이 저하될 수 있으나, 유전자 재조합에 의한 결합 시스템은 제조 과정 중 성장인자의 활성이 저하될 우려가 없으며 제조 중간에 별도의 분리 및 정제 과정을 필요로 하지 않는다. 또한, 융합 성장인자 발현 및 정제 시스템 구축 후 대량 생산이 가능하여 생산성 또한 우수하다. In the case of the recombinant methods specifically proposed in the present invention, it is possible to maintain the inherent biological activity of the growth factor, precisely control the binding position of the cell-penetrating peptide in the growth factor, and produce LMWP by each growth factor It is possible to reduce the activity of the growth factor during the synthesis and separate separation and purification processes are required for each synthesis intermediate. Therefore, the productivity and economical efficiency may be lowered. However, There is no concern and no separate separation and purification process is required in the middle of production. In addition, it is possible to mass-produce the fusion growth factor expression system and the purification system, and the productivity is also excellent.
본 발명에서 사용되는 유전자 재조합 방법은, 종래 본 기술분야에 사용되고 있는 유전공학적 기술을 활용한 것으로, 세포 투과형 펩타이드와 성장인자를 융합한 후, 발현 벡터에 삽입하여 융합 단백질 형태로 얻을 수 있으며, 여기에 사용될 수 있는 발현 벡터로는, 예컨대, 대장균(E.coli) 발현 벡터인 pBF-01(+), pET21 벡터 등이 가능하나, 종래 이용되는 발현 벡터라면 크게 제한됨이 없이 이용가능 하다. The gene recombination method used in the present invention utilizes the genetic engineering technique used in the related art. It can be obtained in the form of a fusion protein by fusing a cell-penetrating peptide and a growth factor and then inserting it into an expression vector. PBF-01 (+), pET21 vector, or the like can be used as the expression vector that can be used in the present invention, but the expression vector can be used without limitation as long as it is a conventionally used expression vector.
본 발명에 있어서, 상기 세포 투과형 펩타이드는, 그 종류에 크게 제한됨이 없으나, 바람직하게는, TAT, 페너트라틴(penetratin), Antp(antennapedia protein), 또는 저분자 프로타민(Low molecular weight protamine, LMWP)으로 이루어진 군에서 하나 이상일 수 있다. 보다 바람직하게는 상기 세포 투과형 펩타이드는 저분자 프로타민(Low molecular weight protamine, LMWP)인 것일 수 있으나 이에 한정하는 것은 아니다.In the present invention, the cell-permeable peptide is not limited to its type, but preferably is selected from the group consisting of TAT, penetratin, antennapedia protein, or low molecular weight protamine (LMWP) It may be more than one in the group. More preferably, the cell permeable peptide may be a low molecular weight protamine (LMWP), but the present invention is not limited thereto.
본 발명에 있어서, 상기 LMWP는 프로타민의 일 부분으로써, 일 예시로, 서열번호 1의 아미노산 서열로 구성된 펩타이드일 수 있다.In the present invention, the LMWP is a part of protamine, and may be, for example, a peptide consisting of the amino acid sequence of SEQ ID NO: 1.
서열번호 1: N-VSRRRRRRGGRRRR - CSEQ ID NO: 1: N-VSRRRRRRGGRRRR-C
본 발명에 있어서, 상기 성장인자는, 그 종류에 크게 제한됨이 없으나, 혈관내피세포성장인자(VEGF), 상피세포성장인자(EGF), 및 신경성장인자(NGF)로 이루어진 군에서 하나 이상일 수 있다. 보다 바람직하게는 상기 성장인자는 혈관내피세포(VEGF)일 수 있으나 이에 한정하는 것은 아니다. In the present invention, the growth factor is not limited to its kind but may be one or more of the group consisting of vascular endothelial growth factor (VEGF), epithelial growth factor (EGF), and nerve growth factor (NGF) . More preferably, the growth factor may be but is not limited to vascular endothelial cells (VEGF).
본 발명에 있어서, 상기 세포 투과형 펩타이드-성장인자 융합 단백질의 일 예시로, LMWP-VEGF 융합 단백질일 수 있으며, 일 예시로 서열번호 2의 서열로 구성된 융합 단백질 (밑줄 친 서열부분은 상기 'LMWP'를 의미함)인 것을 특징으로 할 수 있으나, 이에 한정하는 것은 아니다.In the present invention, the fusion protein may be an LMWP-VEGF fusion protein, for example, a fusion protein comprising the sequence of SEQ ID NO: 2 (the underlined sequence portion is the LMWP ' ), But the present invention is not limited thereto.
서열번호 2: N - VSRRRRRRGGRRRR APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRAR - CSEQ ID NO: 2: N - VSRRRRRRGGRRRR APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRAR - C
보다 바람직하게는 상기 세포 투과형 혈관내피세포성장인자는 상기 피부 외용제 조성물 중 0.01 내지 100 ppm 농도로 포함될 수 있다. 0.01 ppm 미만으로 포함되는 경우에는 목적하는 콜라겐 생성 촉진 등의 효과를 충분히 발휘 할 수 없고, 100 ppm 초과로 포함되는 경우에는 목적하는 개체에 독성으로 인한 부작용을 유발할 수 있다.More preferably, the cytotoxic vascular endothelial growth factor may be contained at a concentration of 0.01 to 100 ppm in the composition for external application for skin. If it is contained in an amount of less than 0.01 ppm, the effect of promoting the production of the desired collagen can not be sufficiently exhibited. If it is contained in an amount exceeding 100 ppm, adverse effects due to toxicity may be caused in the target individual.
본 발명에 있어서, 상기 피부 외용제 조성물은 1,2-헥산디올(Hexanediol)을 더 포함할 수 있고, 바람직하게는 상기 피부 외용제 조성물 100 중량부 기준으로 0.1 중량부 내지 2.5 중량부를 포함할 수 있다. 0.1 중량부 미만 또는 2.5 중량부 초과로 1,2-헥산디올을 포함하는 경우에는 콜라겐 생성 촉진의 효과를 충분히 발휘할 수 없다.In the present invention, the composition for external application for skin may further comprise 1,2-hexanediol, and preferably 0.1 to 2.5 parts by weight based on 100 parts by weight of the composition for external application for skin. If it contains less than 0.1 part by weight or more than 2.5 parts by weight of 1,2-hexanediol, the effect of promoting collagen production can not be sufficiently exhibited.
본 발명에서 사용되는 상기 1,2-헥산디올(Hexanediol)은 화장품 원료, 생활용품 등 인체에 접촉하는 제품의 방부제, 항균 및 보습 역할을 하는 인체에 무해한 필수 원료로, 항균성은 존재하지만 살균력은 가지고 있지 않아 보존제의 보조역할을 수행하는 것으로 알려져 있다.The 1,2-hexanediol used in the present invention is an essential raw material which is harmless to the human body which acts as a preservative, antibacterial and moisturizing agent of a product which comes into contact with human body such as raw materials for cosmetics and daily necessities, It is known that it plays a supporting role of preservative.
보다 구체적으로는, 세포 투과형 펩타이드로 비 바이러스성 PTD인 저분자 프로타민(Low molecular weight protamine, LMWP)을 포함하는 피부 재생용 조성물을 제공할 수 있다. More specifically, it is possible to provide a skin regeneration composition containing a low molecular weight protamine (LMWP), which is a non-viral PTD, as a cell-penetrating peptide.
본 발명에 있어서, 상기 세포 투과형 성장인자 융합 단백질은 콜라겐 생성 촉진용 조성물을 제공할 수 있다.In the present invention, the cell-penetrating growth factor fusion protein can provide a composition for promoting collagen production.
본 발명에서 상기 콜라겐 생성 촉진용은 섬유아세포의 콜라겐 합성을 촉진하는 것으로, 상기 콜라겐은 세포 외 기질(Matrix)의 주요 구성 성분에 해당하며, 견고한 3중 나선 구조를 갖고 있다. 피부의 진피에 그 포함량이 매우 높아 피부의 기계적 견고성, 결합 조직의 저항력과 조직의 결합력, 세포 접착의 지탱, 세포 분할과 분화의 유도 능력이 존재한다. 본 발명의 목적상 상기 세포 투과형 성장인자 융합 단백질은 콜라겐 생성 촉진으로 인하여 피부에 발생될 수 있는 주름, 탄력 저하 등의 피부 노화를 현저하게 개선할 수 있다.In the present invention, the collagen for promoting collagen production promotes collagen synthesis of fibroblasts. The collagen corresponds to a major component of the extracellular matrix and has a rigid triple helix structure. There is a very high content in the dermis of the skin, and there exists the mechanical rigidity of the skin, the resistance of the connective tissue and the binding force of the tissue, the support of cell adhesion, and the ability to induce cell division and differentiation. For the purpose of the present invention, the cell permeable growth factor fusion protein can remarkably improve skin aging such as wrinkles and elasticity degradation that may occur on the skin due to promotion of collagen production.
본 발명에 있어서, 이러한 세포 투과형 성장인자는 피부 재생 및 상처 치유 효과를 가지고 있어, 피부 재생용 피부 외용제 조성물, 상처 치유용 피부 외용제 조성물인 것을 특징으로 할 수 있다. In the present invention, such a cell-penetrating growth factor has skin regeneration and wound healing effects, and can be characterized as a skin external composition for skin regeneration and a skin external application composition for wound healing.
본 발명에 따른 세포 투과형 성장인자융합 단백질은 포유류, 바람직하게는 인간의 몸에 적용되는 다양한 종류의 외용 조성물의 일부를 구성할 수 있다. 이러한 관점에서, 본 발명은 적어도 하나의 세포 투과형 성장인자 융합 단백질을 포함하는 화장료 또는 피부약제 조성물을 제공한다. 상기 조성물은 본 기술 분야의 당업자에게 공지된 종래 방법으로 제조될 수 있다. 세포 투과형 성장인자 융합 단백질은 종래의 미용상 또는 피부 약제학 상 허용 가능한 용매, 이를테면, 에탄올, 프로판올 또는 이소프로판올, 프로필렌 글리콜, 글리세린, 부틸렌 글리콜 또는 폴리에틸렌 글리콜 또는 이들의 혼합물에 용해될 수 있다. 세포 투과형 성장인자 융합 단백질은 활성 성분의 침투를 향상시키기 위한 미용상 또는 약제학상 전달 시스템 및/또는 서방형 시스템에 미리 혼입될 수 있고, 이러한 시스템의 비제한적인 예로는, 리포좀, 밀리파티클, 마이크로파티클 및 나노파티클뿐만 아니라, 스폰지, 소낭, 미셀, 밀리스피어, 마이크로스피어, 나노스피어, 리포스피어, 밀리캡슐, 마이크로캡슐 및 나노캡슐을 들 수 있다. 마찬가지로, 본 발명의 세포 투과형 성장인자 융합 단백질은 탈크, 벤토나이트, 전분 또는 말토덱스트린 등 고체 유기 고분자나 미네랄 지지체에 흡착될 수도 있다. 이러한 제제는 바른 후(leave on) 씻어내는(rinse-off) 제형을 포함하는 크림, 수중 오일과 실리콘의 에멀젼, 수중 오일의 에멀젼, 수중 실리콘의 에멀젼, 오일과 실리콘 중 물의 에멀젼, 오일 중 물의 에멀젼, 실리콘 중 물의 에멀젼, 오일, 밀크, 밤, 폼, 로션, 젤, 리너먼트(liniments), 세럼, 비누, 연고, 바, 펜슬 또는 스프레이 등 다른 형태의 제형에 이용될 수도 있고, 본 기술 분야에 공지된 기법으로 습윤 와이프(wet wipe), 하이드로겔, 접착성(또는, 비접착성) 패치 또는 페이스 마스크 등 다양한 종류의 고체 보조제에 혼입되거나, 컨실러, 메이크업 파운데이션, 메이크업 리무버 밀크 또는 로션, 아이섀도우, 립스틱 등 다양한 메이크업류 제품에 혼입될 수도 있다. 본 발명에 있어서, 피부 외용제 조성물은 화장료 조성물 또는 약제학적 조성물일 수 있다.The cell-penetrating growth factor fusion protein according to the present invention may constitute a part of various types of external-use compositions applied to a mammal, preferably a human body. In this regard, the present invention provides a cosmetic or dermatological composition comprising at least one cytotoxic growth factor fusion protein. The composition can be prepared by conventional methods known to those skilled in the art. The transmembrane growth factor fusion protein can be dissolved in a conventional cosmetic or dermatologically acceptable solvent, such as ethanol, propanol or isopropanol, propylene glycol, glycerin, butylene glycol or polyethylene glycol or mixtures thereof. The transmembrane growth factor fusion protein can be pre-incorporated into a cosmetic or pharmaceutical delivery system and / or a sustained release system to enhance penetration of the active ingredient, and non-limiting examples of such systems include liposomes, milliparticles, And nanoparticles, as well as sponges, follicles, micelles, millispheres, microspheres, nanospheres, lipospheres, millicaps, microcapsules and nanocapsules. Similarly, the cell-penetrating growth factor fusion protein of the present invention may be adsorbed on a solid organic polymer such as talc, bentonite, starch or maltodextrin, or a mineral support. Such formulations may include creams, including rinse-off formulations, emulsions of water and silicone, emulsions of water in oil, emulsions in water, emulsions of oil and silicone in water, emulsions of water in oil, , Emulsions of water in silicone, oils, milks, nights, foams, lotions, gels, liniments, serums, soaps, ointments, bars, pencils or sprays, Known techniques may be incorporated into a wide variety of solid adjuvants such as wet wipes, hydrogels, adhesive (or non-stick) patches or face masks, or may be incorporated into a wide variety of solid adjuvants such as concealers, makeup foundation, makeup remover milks or lotions, , Lipstick, and so on. In the present invention, the composition for external application for skin may be a cosmetic composition or a pharmaceutical composition.
상기 화장료 조성물에 있어서는, 화장품 제제에 있어서 수용가능한 담체를 포함할 수 있다. 여기서, "화장품 제제에 있어서 수용 가능한 담체"란 화장품 제제에 포함될 수 있는 이미 공지되어 사용되고 있는 화합물 또는 조성물이거나 앞으로 개발될 화합물 또는 조성물로서 피부와의 접촉 시 인체가 적응 가능한 이상의 독성, 불안정성 또는 자극성이 없는 것을 말한다.The cosmetic composition of the present invention may contain an acceptable carrier in cosmetic preparations. Herein, "an acceptable carrier for a cosmetic preparation" is a known or used compound or composition that can be contained in a cosmetic preparation, or a compound or composition to be developed in the future, which is toxic, instable or irritating It says nothing.
상기 담체는 본 발명의 피부 외용제 조성물에 그것의 전체 중량에 대하여 약 1 중량 % 내지 약 99.99 중량 %, 바람직하게는 조성물의 중량의 약 90 중량% 내지 약 99.99 중량 %로 포함될 수 있다. 그러나 상기 비율은 본 발명의 피부 외용제 조성물이 제조되는 후술한 바의 제형에 따라 또 그것의 구체적인 적용 부위(얼굴, 목 등)나 그것의 바람직한 적용량 등에 따라 달라지는 것이기 때문에, 상기 비율은 어떠한 측면으로든 본 발명의 범위를 제한하는 것으로 이해되어서는 안 된다.The carrier may be included in the skin topical composition of the present invention in an amount of from about 1% by weight to about 99.99% by weight, preferably from about 90% by weight to about 99.99% by weight of the composition, based on the total weight thereof. However, since the ratio varies depending on the formulations described below in which the composition for external application for skin of the present invention is prepared, and its specific application site (face, neck, etc.) or its preferable application amount and the like, And should not be construed as limiting the scope of the invention.
상기 담체로서는 알코올, 오일, 계면활성제, 지방산, 실리콘 오일, 습윤제, 보습제, 점성 변형제, 유제, 안정제, 자외선 산란제, 자외선흡수제, 발색제, 향료 등이 예시될 수 있다. 상기 알코올, 오일, 계면활성제, 지방산, 실리콘 오일, 습윤제, 보습제, 점성 변형제, 유제, 안정제, 자외선 산란제, 자외선흡수제, 발색제, 향료로 사용될 수 있는 화합물/조성물 등은 이미 당업계에 공지되어 있기 때문에 당업자라면 적절한 해당 물질/조성물을 선택하여 사용할 수 있다.Examples of the carrier include an alcohol, an oil, a surfactant, a fatty acid, a silicone oil, a wetting agent, a moisturizer, a viscous modifier, an emulsifier, a stabilizer, an ultraviolet scattering agent, an ultraviolet absorber, a coloring agent and a perfume. The compounds / compositions which can be used as the above-mentioned alcohol, oil, surfactant, fatty acid, silicone oil, humectant, humectant, viscous modifier, emulsifier, stabilizer, ultraviolet scattering agent, ultraviolet absorber, The person skilled in the art can select and use the appropriate substance / composition.
본 발명의 일 구현예로써, 본 발명에 따른 피부 외용제 조성물은 상기 세포 투과형 성장인자 융합 단백질이외에 글리세린, 부틸렌글리콜, 프로필렌글키롤, 폴리옥시에틸렌 경화피마자유, 에탄올, 트리에탄올아민 등을 포함할 수 있으며, 방부제, 항료, 착색료, 정제수 등을 필요에 따라 미량 포함할 수 있다. As an embodiment of the present invention, the composition for external application for skin according to the present invention may contain glycerin, butylene glycol, propylene glycol, polyoxyethylene hardened castor oil, ethanol, triethanolamine and the like in addition to the cell permeable growth factor fusion protein Preservatives, antioxidants, coloring agents, purified water, etc. can be included as needed.
본 발명에 따른 피부 외용제 조성물은, 다양한 형태로 제조될 수 있는데, 예컨대, 화장수, 에센스, 젤, 에멀젼, 로션, 크림(수중 유적형, 유중 수적형, 다중상), 용액, 현탁액(무수 및 수계), 무수 생성물(오일 및 글리콜계), 젤, 마스크, 팩, 분말, 또는 젤라틴 등의 피막이 있는 캅셀 (소프트 캅셀, 하드 캅셀) 제형 등의 형태로 제조될 수 있다. The composition for external application for skin according to the present invention can be prepared in various forms such as lotion, essence, gel, emulsion, lotion, cream (underwater type, water type, multiphase), solution, suspension ), Capsules (soft capsules, hard capsules) having a coating such as anhydrous products (oil and glycol), gel, mask, pack, powder or gelatin.
본 발명에 있어서의 피부는 얼굴뿐만 아니라, 두피, 전신도 포함되는 개념으로, 이러한 두피에 적용될 수 있는 피부 외용제 조성물로써, 샴푸, 린스, 트리트먼트, 발모제 등이 있고, 전신에 적용될 수 있는 바디클렌져 등의 용도로써 다양한 형태로 제조될 수 있다. The skin of the present invention includes not only the face but also the scalp and whole body. The composition for external application for skin which can be applied to such scalp includes shampoo, rinse, treatment, hair removal agent, etc., and a body cleanser And the like can be manufactured in various forms.
본 발명에 따른 세포 투과형 성장인자 융합 단백질을 함유 피부 외용제 조성물의 제조방법은 전술한 제조방법에 한정되는 것은 아니며, 본 발명이 속하는 기술분야에서 통상의 지식을 가진 자라면 상기 제조방법을 일부 변형시킨 방법으로도 본 발명에 따른 세포 투과형 성장인자 융합 단백질을 함유 피부 외용제 조성물을 제조할 수 있다.The method for preparing a skin external application composition containing a cell penetrating growth factor fusion protein according to the present invention is not limited to the above-described manufacturing method, and any person skilled in the art may make modifications A skin external preparation composition containing the cell penetrating growth factor fusion protein according to the present invention can be prepared.
특히, 상기 피부 외용제 조성물은 본 발명에 특별히 개시된 제조방법 이외에도, 통상적으로 알려진 제조방법을 이용하여, 일반적인 유화 제형 및 가용화 제형의 형태로 제조될 수 있다. In particular, the composition for external application for skin may be prepared in the form of a general emulsified formulation and a solubilized formulation, by a known manufacturing method, in addition to the manufacturing method specifically disclosed in the present invention.
화장료 조성물로 제조될 경우, 유화 제형의 화장품으로는 영양화장수, 크림, 에센스 등이 있으며, 가용화 제형의 화장품으로는 유연화장수가 있다. 또한, 피부과학적으로 허용 가능한 매질 또는 기제를 함유함으로써 피부과학 분야에서 통상적으로 사용되는 국소적용 또는 전신 적용할 수 있는 보조제 형태로 제조될 수 있다. When the cosmetic composition is manufactured from a cosmetic composition, the cosmetic composition of the emulsified formulation includes nutritional lotion, cream, essence and the like. It can also be prepared in the form of adjuvants which can be applied topically or systemically, which are conventionally used in the field of dermatology by containing a dermatologically acceptable medium or base.
또한, 적합한 화장품의 제형으로는, 예를 들면 용액, 겔, 고체 또는 반죽 무수 생성물, 수상에 유상을 분산시켜 얻은 에멀젼, 현탁액, 마이크로에멀젼, 마이크로캡슐, 미세과립구 또는 이온형(리포좀), 비이온형의 소낭 분산제의 형태, 크림, 스킨, 로션, 파우더, 연고, 스프레이 또는 콘실스틱의 형태로 제공될 수 있다. 또한, 포말(foam)의 형태 또는 압축된 추진제를 더 함유한 에어로졸 조성물의 형태로도 제조될 수 있다. In addition, suitable cosmetic formulations include, for example, solutions, gels, solid or kneaded anhydrous products, emulsions obtained by dispersing an oil phase in water, suspensions, microemulsions, microcapsules, microgranules or ionic forms (liposomes) May be provided in the form of a follicular dispersing agent of the type, cream, skin, lotion, powder, ointment, spray or conical stick. It can also be prepared in the form of a foam or an aerosol composition further containing a compressed propellant.
또한, 본 발명의 피부 외용제 조성물은 추가로 지방 물질, 유기 용매, 용해제, 농축제 및 겔화제, 연화제, 항산화제, 현탁화제, 안정화제, 발포제(foaming agent), 방향제, 계면활성제, 물, 이온형 또는 비이온형 유화제, 충전제, 금속이온봉쇄제 및 킬레이트화제, 보존제, 비타민, 차단제, 습윤화제, 필수 오일,염료, 안료, 친수성 또는 친유성 활성제, 지질 소낭 또는 화장품에 통상적으로 사용되는 임의의 다른 성분과 같은 화장품학 또는 피부과학 분야에서 통상적으로 사용되는 보조제를 함유할 수 있다. 그리고, 상기의 성분들은 피부과학 분야에서 일반적으로 사용되는 양으로 도입될 수 있다.In addition, the composition for external application for skin of the present invention may further comprise at least one selected from the group consisting of fatty substances, organic solvents, solubilizers, thickeners and gelling agents, softening agents, antioxidants, suspending agents, stabilizers, foaming agents, As used herein means any emulsion or emulsion which is commonly used in emulsifying or emulsifying agents, fillers, sequestering and chelating agents, preservatives, vitamins, blockers, wetting agents, essential oils, dyes, pigments, hydrophilic or lipophilic active agents, lipid vesicles or cosmetics Adjuvants commonly used in the cosmetics or dermatological fields, such as other ingredients. And, the above ingredients can be introduced in amounts commonly used in the field of dermatology.
이러한, 본 발명에 따른 피부 외용제 조성물은 피부 노화 방지, 피부 재생, 상처치유 등 항노화 기능을 할 수 있는 기능성 화장품의 형태를 포함한다.The composition for external application for skin according to the present invention includes functional cosmetics capable of anti-aging function such as skin aging prevention, skin regeneration, wound healing, and the like.
본 발명에 있어서, 약제학적 조성물의 경우, 하기 실시예에서 제시하는 상처(창상) 치유를 위한 약제학적 조성물로써 기능할 수 있다. In the present invention, in the case of a pharmaceutical composition, it can function as a pharmaceutical composition for wound healing as shown in the following examples.
이러한 약제학적 조성물은 유효성분인 세포 투과형 성장인자 외에, "약학적으로 허용 가능한 담체"를 포함할 수 있으며, 이러한 담체는 희석제, 활택제, 결합제, 붕해제, 감미제, 안정제 및 방부제로 이루어진 군으로부터 선택될 수 있다. 상기 약학 조성물은 첨가제를 더 포함할 수 있다. 상기 첨가제로 향료, 비타민, 및 항산화제가 포함될 수 있다. 상기 담체로 약제학적으로 허용 가능한 담체는 모두 가능하며, 예를 들면, 희석제로는 유당, 덱스트린, 타피오카(tapioca) 녹말, 옥수수 전분, 대두유, 미정질 셀룰로오스, 또는 만니톨, 활택제로는 스테아린산 마그네슘 또는 탈크, 결합제로는 폴리비닐피롤리돈 또는 히드록시프로필셀룰로오스일 수 있다. 또한, 붕해제로는 카르복시메틸셀룰로오스 칼슘, 전분글리콜산나트륨, 폴라크릴린칼륨, 또는 크로스포비돈, 감미제로는 백당, 과당, 솔비톨, 또는 아스파탐, 안정제로는 카르복시메틸셀룰로오스나트륨, 베타-사이클로덱스트린, 또는 잔탄검, 방부제로는 파라옥시안식향산메틸, 파라옥시안식향산프로필, 또는 솔빈산칼륨일 수 있다.Such pharmaceutical compositions may comprise, in addition to the cell permeable growth factor, the active ingredient, a "pharmaceutically acceptable carrier ", which carrier is selected from the group consisting of diluents, lubricants, binders, disintegrants, sweeteners, stabilizers, Can be selected. The pharmaceutical composition may further comprise an additive. The additives may include flavoring agents, vitamins, and antioxidants. Examples of the diluent include lactose, dextrin, tapioca starch, corn starch, soybean oil, microcrystalline cellulose or mannitol as a carrier, magnesium stearate or talc as a lubricant, , And the binding agent may be polyvinylpyrrolidone or hydroxypropylcellulose. Examples of the disintegrant include carboxymethylcellulose calcium, sodium starch glycolate, polacrilin potassium, or crospovidone; examples of sweeteners include white sugar, fructose, sorbitol, or aspartame; stabilizers include sodium carboxymethylcellulose, Or xanthan gum, and the preservative may be methyl paraoxybenzoate, propyl p-hydroxybenzoate, or potassium sorbate.
상기 약제학적 조성물은 당해 기술분야에 공지되어 있는 통상적인 약제학적 제형으로 제제화될 수 있다. 상기 약제학적 조성물은 경구 투여제제, 주사제, 좌제, 경피 투여제제, 및 경비 투여제제의 제형으로 제제화되어 투여될 수 있다. 예를 들면, 상기 제형은 액제, 현탁제, 산제, 과립제, 정제, 캡슐제, 환제, 또는 엑스제와 같은 경구 투여용 제형일 수 있다. The pharmaceutical composition may be formulated into conventional pharmaceutical formulations known in the art. The pharmaceutical composition may be formulated and administered in the form of an oral administration preparation, an injection preparation, a suppository, a transdermal preparation, and a dosage form. For example, the formulations may be formulated for oral administration, such as solutions, suspensions, powders, granules, tablets, capsules, pills, or expanses.
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 예시하기 위한 것으로, 본 발명의 범위가 이들 실시예에 의해 제한되는 것으로 해석되지 않는 것은 당업계에서 통상의 지식을 가진 자에게 있어서 자명할 것이다. Hereinafter, the present invention will be described in more detail with reference to Examples. It is to be understood by those skilled in the art that these embodiments are only for illustrating the present invention and that the scope of the present invention is not construed as being limited by these embodiments.
본 발명에 따른 세포 투과형 융합 단백질을 포함하는 피부 외용제 조성물은 피부 세포에 독성이 없으면서도 상기 단백질에 함유된 바이오 활성소재의 세포 투과능이 우수하여 피부 개선(회복), 항노화 또는 상처 치유에 특히 효과적으로 사용될 수 있다. The composition for external application for skin comprising a cell-penetrating fusion protein according to the present invention is excellent in cell permeability (recovery), anti-aging or wound healing due to its excellent cell permeability of the bioactive material contained in the protein, Can be used.
또한, 본 발명에 따른 상기 세포 투과형 융합 단백질은 1,2-헥산디올(Hexanediol)을 추가로 더 포함함으로써, 콜라겐 생성 촉진에 현저한 시너지 효과를 발휘하여 항 노화 또는 상처 치유에 더욱 효과적으로 사용될 수 있다. In addition, the cell-permeable fusion protein according to the present invention further includes 1,2-hexanediol, thereby exhibiting a remarkable synergistic effect in promoting collagen production, and thus being more effectively used for anti-aging or wound healing.
도 1은 LMWP-VEGF을 제조하여 SDS-PAGE 정제한 결과이다. 도 1-(A)은 affinity chromatography를 활용하여 LMWP-VEGF를 제조한 SDS-PAGF 정제 결과이다(Lane 1: LMWP-VEGF 발현클론의 세포파쇄와 원심분리 후 상등액(전체 단백질), Lane 2: Affinity chromatography에 결합하지 않은 발현클론의 오염 단백질, Lane 3: 60mM imidazole을 함유하는 washing buffer로 세척된 단백질, Lane 4: 100mM imidazole을 함유하는 elution buffer 1로 용출된 단백질, Lane 5: 200mM imidazole을 함유하는 elution buffer 2로 용출된 단백질).
도 1-(B)는 표준생산공정을 통해 생산된 LMWP-VEGF의 SDS-PAGE 정제 결과이다.
도 2는 LMWP-VEGF의 인간피부구성세포에 대한 세포독성 실험(MTT assay) 결과이다. (A) 인간각질형성세포(HaCaT cell)에 대한 LMWP-VEGF의 MTT assay 결과이며, (B)는 인간피부섬유아세포(CCD 986sk cell)에 대한 LMWP-VEGF의 MTT assay 결과이다.
도 3은 LMWP-VEGF의 농도별 혈관내피세포의 세포 증식 생물학적 활성도에 대한 결과이다.
도 4는 LMWP-VEGF의 농도별 인간피부세포(CCD 986-sk cell)의 세포 생존율 결과이다.
도 5는 LMWP-VEGF의 인간피부세포 투과도 평가 결과이다(scale bar=20,000nm).
도 6은 LMWP-VEGF의 인공피부막(Skin PAMPA) 투과도 평가 결과이다.
도 7은 LMWP-VEGF의 인간피부세포 증식 활성에 의한 피부재생 효능을 실험한 결과이다.
도 8은 1 ng/mL의 LMWP-VEGF 처리 후, 마우스 피부섬유아세포(NIH 3T3T cell) 증식 활성에 의한 상처 회복율을 실험한 결과이다(A: 상처회복률, B: 상처회복 이미지(검은색영역: NIH 3T3T cell monolayer, 회색영역: scratch 상처영역)).
도 9는 50 ng/mL의 LMWP-VEGF 처리 후, 인간피부섬유아세포(CCD-986sk cell) 증식 활성에 의한 상처 회복율을 실험한 결과이다(A: 상처회복률, B: 상처회복 이미지(검은색영역: NIH 3T3T cell monolayer, 회색영역: scratch 상처영역)).
도 10은 LMWP-VEGF의 콜라겐 생성 촉진 효과 평가 결과이다. 1은 아무것도 처리하지 않은 음성 대조군에 해당하고, 2는 LMWP-VEGF을 10ppm 농도로 단독하여 처리한 군, 3은 LMWP-VEGF 10ppm 및 0.1%의 1,2-Hexanediol 병용 처리군, 및 4는 LMWP-VEGF 10ppm 및 2.5% 1,2-Hexanediol 병용 처리군에 해당한다.
도 11은 도 10에서 나타낸 LMWP-VEGF의 콜라겐 생성 촉진 효과 평가 결과의 수치값을 그래프로 나타낸 것이다.Figure 1 shows the results of SDS-PAGE purification of LMWP-VEGF. Figure 1 (A) is the result of SDS-PAGF purification using LMWP-VEGF using affinity chromatography (Lane 1: Lane 2: Affinity Lane 3: Protein washed with washing buffer containing 60 mM imidazole, Lane 4: Protein eluted with
1- (B) shows the result of SDS-PAGE purification of LMWP-VEGF produced through the standard production process.
2 is a cytotoxicity test (MTT assay) result of LMWP-VEGF on human skin constituent cells. (A) MTT assay result of LMWP-VEGF against human keratinocyte (HaCaT cell) and (B) MTT assay result of LMWP-VEGF against human skin fibroblast (CCD 986sk cell).
FIG. 3 shows the results of cell proliferation and biological activity of vascular endothelial cells by the concentration of LMWP-VEGF.
FIG. 4 shows the cell survival rate of human skin cells (CCD 986-sk cells) by concentration of LMWP-VEGF.
5 is a result of evaluation of human skin cell permeability of LMWP-VEGF (scale bar = 20,000 nm).
FIG. 6 shows the results of permeability evaluation of LMWP-VEGF skin patch (Skin PAMPA).
FIG. 7 shows the results of experiments on the skin regeneration activity of LMWP-VEGF by human skin cell proliferative activity.
FIG. 8 shows the results of an experiment on wound recovery rate by mouse fibroblast (NIH 3T3T cell) proliferation activity after treatment with 1 ng / mL of LMWP-VEGF (A: wound recovery rate, B: wound recovery image NIH 3T3T cell monolayer, gray area: scratch wound area).
FIG. 9 shows the results of an experiment on the wound recovery rate by the proliferation activity of human skin fibroblast (CCD-986sk cell) after treatment with 50 ng / mL LMWP-VEGF (A: wound recovery rate, B: wound recovery image : NIH 3T3T cell monolayer, gray area: scratch wound area)).
Fig. 10 shows the evaluation results of promoting collagen production of LMWP-VEGF. 1 was treated with no treatment, 2 was treated with LMWP-VEGF alone at a concentration of 10 ppm, 3 was treated with 10 ppm of LMWP-VEGF and 0.1% of 1,2-hexanediol, and 4 was treated with LMWP -
FIG. 11 is a graph showing numerical values of evaluation results of promoting collagen production of LMWP-VEGF shown in FIG.
실시예Example
실시예 1. 세포 투과형 혈관내피성장인자(LMWP-VEGF) 융합 단백질의 제조Example 1. Preparation of a cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein
(1) cDNA 및 발현벡터 제조(1) Preparation of cDNA and expression vector
저분자 프로타민 융합을 통해 원형의 혈관내피세포성장인자(VEGF)를 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질로 제조하였다. 저분자 프로타민을 암호화하는 유전자(표 1의 서열번호1)를 혈관내피세포성장인자(VEGF) cDNA의 N-말단부에 융합하고 발현벡터로의 클로닝을 위하여 제한효소 NdeI와 XhoI의 제한부위(restriction sites)를 양 말단에 갖는 세포 투과형 혈관내피세포성장인자(LMWP-VEGF)의 cDNA를 확보하였다(표 1의 서열번호2). 이렇게 수득된 삽입 cDNA(insert cDNA)를 발현 벡터에 삽입하였다. 대장균(E.coli) 발현 벡터인 pBF-01(+)를 NdeI와 XhoI으로 이중 절단(double digestion) 처리하여 클로닝 부위를 개방하고, NdeI와 XhoI이 이중 절단한 후 삽입 cDNA(insert cDNA)를 정제하여 발현벡터와 목적 단백질의 삽입 cDNA(insert cDNA)를 라이게이션(ligation)하여 융합하였다. 이렇게 제조된 발현 벡터 pBF-01(+)-LMWP-VEGF 유전자 수준에서 융합한 후, 외래 재조합단백질의 발현에 사용하는 BL21계열의 대장균에 형질 전환하여 발현 클론을 제조하였다. 하기 표 1은 세포 투과형 펩타이드(LMWP)와 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 아미노산 조성을 나타낸 것이다.Circular vascular endothelial growth factor (VEGF) was prepared as a transmembrane vascular endothelial growth factor (LMWP-VEGF) fusion protein through low molecular protease fusion. The gene coding for low molecular protamine (SEQ ID NO: 1 in Table 1) was fused to the N-terminus of VEGF cDNA and restriction sites of restriction enzymes NdeI and XhoI were cloned into the expression vector. (LMWP-VEGF) cDNA was obtained (SEQ ID NO: 2 in Table 1). The thus obtained inserted cDNA (insert cDNA) was inserted into the expression vector. The E. coli expression vector pBF-01 (+) was double-digested with NdeI and XhoI to open the cloning site, double-digested with NdeI and XhoI, and then the inserted cDNA was purified And the expression vector and the inserted cDNA of the target protein (insert cDNA) were ligated and fused. After fusion at the pBF-01 (+) - LMWP-VEGF gene level of the expression vector thus prepared, the expression clone was transformed into BL21 strain of Escherichia coli, which is used for the expression of the foreign recombinant protein. Table 1 below shows the amino acid composition of the cell permeable peptide (LMWP) and the cell permeable vascular endothelial cell growth factor (LMWP-VEGF) fusion protein.
서열번호 2
SEQ ID NO: 2
(2) 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 발현, 및 정제(2) expression of a cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein, and purification
상기에서 제조한 발현 벡터, pBF-01(+)-LMWP-VEGF를 재조합 단백질 발현용 E.coli 균주로 형질 전환시킴으로써 발현 균주를 구축하였다. 이렇게 확보된 발현 균주를 발현용 글리세롤 스톡(glycerol stock)을 이용하여 다음과 같이 발현 및 정제하였다. 발현용 글리세롤 스톡을 L-broth(LB) 배양액에 1/200 비율로 접종하여 37℃, 150rpm 조건에서 광학 밀도(O.D)가 약 0.8에 도달할 때까지 배양하였다. 배양의 광학 밀도가 0.8에 도달하면 본 배양은 발현용 글리세롤 스톡을 L-broth(LB) 배양액에 1/100 비율로 접종하여 37℃, 100rpm 조건에서 광학 밀도가 0.6 내지 0.8 가 될 때까지 배양하였다. 발현을 위해 이소프로필-β-D-티오갈락토피라노사이드(Isopropyl-β-D-thiogalactopyranoside, IPTG)를 배양액 내 최종 농도가 0.5mM으로 처리하여 목적 단백질을 유도(induction)한 후, 25℃, 100rpm 조건에서 하루 동안 배양하였다. 다음날 원심 분리(6,000rpm, 4℃, 10분)하여 배양 균체를 획득하고, 획득한 균체 펠렛 1g 당 용균 버퍼(Lysis buffer, sodium phosphate buffer, pH7.8, 10mM NaCl, 5mM imidazole) 20ml씩 첨가하여 현탁 하였다. 완전히 현탁되면 초음파 처리(sonication)을 통해 균체를 파쇄하였다(10분간 sonication 10초/holding 10초 반복, Amplitude 50%, 4℃). 파쇄된 균체액은 원심 분리(12,000rpm, 4℃, 10분)하여 비 파쇄 균체 및 불용성 분획을 제거하고 상등액만 취한 후, 0.45㎛ 실린지(syringe)로 여과하였다. 여과한 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질을 함유하는 원심 분리 상등액을 동일한 용균 버퍼(Lysis buffer, sodium phosphate buffer, pH 7.8, 10mM NaCl, 5mM imidazole)로 미리 평형화 시킨 affinity column에 30분간 회전시켜 레진 결합을 유도한 후, 결합되지 않은 오염 단백질들은 용출로 제거하였다. 세척 버퍼1(washing buffer 1, sodium phosphate buffer, pH7.5, 10mM NaCl, 60mM imidazole)로 30분씩 1회, 다시 용출 버퍼 1(Elution buffer 1, sodium phosphate buffer, pH7.5, 10mM NaCl, 100mM imidazole)로 30분간 1회 컬럼을 씻어주고 용출 버퍼 2(Elution buffer 2, sodium phosphate buffer, pH7.5, 10mM NaCl, 200mM imidazole)로 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질을 컬럼으로부터 용출시킨 뒤 초미세 여과(Ultra-filtration)(Amicon, cutting membrane 3000Da)로 용적 대비 20배 농축하였다. 농축된 용액을 겔 여과(gel filtration)(Sephadez G-100, Buffer GF(20mM sodium phosphate buffer, pH7.5, NaCl 500mM))을 이용하여 목적단백질인 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질 분획만을 회수하였다. 회수된 분획은 Affinity chromatograpy에서 분리된 목적단백질 LMWP-VEGF을 cutting kDa이 20kDa인 초미세 여과를 통해 오염 단백질을 추가 정제한 후, 200배 분량의 NaCl이 포함되지 않은 버퍼로 dialysis를 수행하였다. 15% SDS-PAGE 정제도는 200mM imidazole을 함유하는 용출버퍼(elution buffer)의 용출(elution) 분획에서 가장 효과적으로 분리되었으며, 약 90 내지 93%의 정제도를 확보하였다(도 1-(A), lane5). 상기 방법으로 수득된 126개 아미노산으로 구성된 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질은 SDS-PAGE 분석결과 약 15Dka의 크기로 확인되어 목적단백질이 발현 및 정제되었음을 확인하였다. SDS-PAGE 분석결과는 도 1-(A)에 나타내었다. The expression vector pBF-01 (+) - LMWP-VEGF prepared above was transformed into an E. coli strain for expression of recombinant proteins to construct an expression strain. The thus obtained expression strain was expressed and purified as follows using glycerol stock for expression. Glycerol stock for expression was inoculated into the L-broth (LB) culture at a ratio of 1/200 and cultured at 37 DEG C under 150 rpm until optical density (OD) reached about 0.8. When the optical density of the culture reached 0.8, the present culture was inoculated into the L-broth (LB) culture broth at a ratio of 1/100 for expression, and cultured at 37 ° C and 100 rpm until the optical density reached 0.6 to 0.8 . D-thiogalactopyranoside (IPTG) was induced to a final concentration of 0.5 mM in the culture medium to induce the target protein, followed by incubation at 25 < 0 > C , And cultured at 100 rpm for one day. Next, 20 ml of a lysis buffer (sodium phosphate buffer, pH 7.8, 10 mM NaCl, 5 mM imidazole) was added to 1 g of the obtained cell pellet by centrifugation (6,000 rpm, 4 ° C, Lt; / RTI > Once completely suspended, the cells were disrupted by sonication (10
또한, 반복적인 정제를 통해 수립한 표준생산공정을 통해서도 일정한 순도의 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질이 높은 순도로 발현 정제됨을 확인하였다(도1-(B)). In addition, it was confirmed that the cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein of constant purity was expressed and purified at high purity through the standard production process established through repetitive purification (Fig. 1- (B)).
표준생산공정은 정제 전 샘플처리 프로토콜과 affinity chromatography를 기본으로 한 정제 프로토콜, 및 컬럼으로 용출(elution)된 샘플분획의 dialysis와 초미세 여과 등의 후처리 공정으로 구성되었다.The standard production process consisted of pre-purification protocol, affinity chromatography-based purification protocol, and post-treatment such as dialysis and ultrafiltration of the eluted sample fractions.
실시예 2. 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 in vitro 인간피부구성세포 안전성(safety) 평가(MMT assay)Example 2. In vitro human skin composition cell safety evaluation (MMT assay) of a cell permeable vascular endothelial growth factor (LMWP-VEGF)
실시예 1에서 제조된 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 인간 피부 안전성에 대한 평가를 위하여 인간 피부구성세포들을 이용하여 세포 안전성(safety) 시험을 수행하였다. 인간 피부구성세포로는 인간각질형성세포(keratinocyte)의 세포주인 HaCaT cell과 인간섬유아세포(fibroblast)의 세포주인 CCD-986sk cell을 이용하였다. A cell safety test was carried out using human skin constituent cells for the evaluation of human skin safety of the cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein prepared in Example 1. HaCaT cell, which is a cell line of human keratinocyte, and CCD-986sk cell, which is a cell line of human fibroblast, were used as human skin constituent cells.
HaCaT cell과 CCD-986sk cell을 24well plate에 5 x 103 cells/well과 5 x 104 cells/well씩 동일하게 heamacytometer를 이용하여 계수한 후 분주하여 배양하였다. 10% FBS를 함유하는 DMEM에서 48시간 배양하여 배양용기 표면적의 ~50%만큼 배양되면, 실시예 1에서 제조된 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질을 배지 내 최종농도가 0.1ppm~10.0ppm의 농도가 되도록 처리하여 48시간 더 배양하였다. 배양 후, 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyl tetrazolium bromide(MTT, Sigma M5655, USA) 용액(2.5 mg/mL)을 50㎕ 첨가하고 3시간 추가로 배양하였다 그 후, 세포 배양액을 전부 버리고, 200㎕의 dimethyl sulfoxide (DMSO, Sigma D2650, USA)를 각 well 당 200μL 처리하여 교반한 후, 100 ㎕ 씩을 96 well로 취하여 Enzyme-Linked Immunosorbent Assay(ELISA)로 570 nm에서 흡광도를 측정하였다. 세포에 대한 독성 혹은 증식을 촉진하는 정도는 순수한 물을 사용한 대조군의 흡광 강도를 기준으로 백분율로 표시하였다.HaCaT cells and CCD-986sk cells were counted on a 24-well plate using 5 × 10 3 cells / well and 5 × 10 4 cells / well using a heamacytometer. (LMWP-VEGF) fusion protein prepared in Example 1 was cultured for 48 hours in DMEM containing 10% FBS to a final concentration of 0.1 < RTI ID = 0.0 > ppm to 10.0 ppm, and further cultured for 48 hours. After incubation, 50 μl of 3- (4,5-dimethylthiazol-2-yl) -2,5-diphenyl tetrazolium bromide (MTT, Sigma M5655, USA) solution (2.5 mg / ml) was added and the cells were further cultured for 3
그 결과, 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질은 0.1 ppm 내지 10.0 ppm의 농도에서는 세포 독성이 전혀 관찰되지 않았으며, 처리 농도가 증가할수록 농도에 의존되어 세포 생육이 증대되는 결과를 확인하였다(도 2). As a result, cytotoxicity was not observed at a concentration of 0.1 ppm to 10.0 ppm in the cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein, and the cell growth was dependent on the concentration as the treatment concentration was increased (Fig. 2).
실시예 3. 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 생물학적 활성 평가: 혈관내피세포(endothelial cell) 증식 활성도Example 3. Assessment of biological activity of a cell permeable vascular endothelial cell growth factor (LMWP-VEGF) fusion protein: Endothelial cell proliferation activity
혈관내피세포(endothelial cell) 배양 시 실시예 1에서 제조한 세포 투과형 혈관내피세포(LMWP-VEGF) 융합 단백질 및 일반 혈관내피세포성장인자(VEGF)를 농도별로 처리하여 혈관내피세포 증식 정도를 평가함으로써 실시예 1에서 제조한 세포 투과형 혈관내피세포(LMWP-VEGF) 융합 단백질의 생물학적 활성을 비교 및 평가하였다.(LMWP-VEGF) fusion protein and the general vascular endothelial growth factor (VEGF) prepared in Example 1 were cultured at various concentrations to evaluate the degree of vascular endothelial cell proliferation when cultured in endothelial cells The biological activity of the cell permeable vascular endothelial cell (LMWP-VEGF) fusion protein prepared in Example 1 was compared and evaluated.
혈관내피세포 (endothelial cell)를 96 well plate에 5x103 cell/well씩 분주하여 10% FBS/DMEM 배지로 24시간 배양한 후 배양액을 제거하고 0.05% FBS가 포함된 DMEM 배양액에서 다시 24시간 배양하였다. 이후, 0.5% FBS가 포함된 DMEM 배지로 단계적으로 희석한 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질 및 일반 혈관내피세포성장인자(VEGF)를 각 well에 100 ㎕씩 가한 후 다시 24시간 동안 CO2 incubator에서 배양하였다. 이후, 5 mg/mL 농도의 WST-1(Roche Diagnostics) 용액을 각 well에 10 ㎕씩 처리한 후 37℃에서 4시간 동안 반응시킨 뒤 450nm에서 흡광도 측정하여 아무것도 처리하지 않은 음성 대조군 대비 혈관내피세포의 증식 정도를 평가하였다. 피부세포 증식 활성에 대한 양성 대조군으로는 유전자 재조합 인간 혈관내피세포성장인자(VEGF-AA)를 사용하였다.Endothelial cells were inoculated into 96-well plates at a density of 5 × 10 3 cells / well, cultured in 10% FBS / DMEM for 24 hours, and then cultured for 24 hours in DMEM supplemented with 0.05% FBS . Then, 100 μl of the cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein and the normal vascular endothelial growth factor (VEGF) were added to each well in a DMEM medium containing 0.5% FBS Incubated in a CO 2 incubator. Thereafter, 10 μl of WST-1 (Roche Diagnostics) solution at a concentration of 5 mg / mL was added to each well, followed by reaction at 37 ° C. for 4 hours. Absorbance was measured at 450 nm, Was evaluated. As a positive control for skin cell proliferative activity, a recombinant human vascular endothelial growth factor (VEGF-AA) was used.
그 결과, 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질은 50 ng/mL 농도에서 상기 음성 대조군 대비 최대 활성을 나타냈으며 혈관내피세포의 증식이 155% 증가하였다(***p < 0.001, 무처치 음성대조군 대비) (도 3).As a result, the cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein exhibited a maximum activity at a concentration of 50 ng / mL compared to the negative control, and the vascular endothelial cell proliferation was increased by 155% (*** p <0.001 , Vs. untreated negative control) (Figure 3).
모든 농도에서 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질은 일반 혈관내피세포성장인자(VEGF) 대비 동등한 혈관내피세포 증식 생리학적 활성을 나타냈다. 이는 세포 투과형 아미노산 서열인 저분자량 프로타민(LMWP)을 기존 성장인자 말단에 연결해도 기존 성장인자의 생물학적 활성이 유지됨을 의미한다(도 3).At all concentrations, the transmembrane vascular endothelial growth factor (LMWP-VEGF) fusion protein exhibited equivalent vascular endothelial cell proliferation physiological activity compared to the normal vascular endothelial growth factor (VEGF). This means that the biological activity of the existing growth factor is maintained even when the low-molecular weight protamine (LMWP), which is a transmembrane amino acid sequence, is connected to the end of the existing growth factor (FIG. 3).
실시예 4. 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 인간피부세포 안전성(독성) 평가Example 4. Human skin cell safety (toxicity) evaluation of cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein
인간섬유아세포 (CCD986-sk cell) 배양 시 실시예 1에서 제조된 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질과 일반 혈관내피세포성장인자(VEGF)를 농도별로 처리하여 인간섬유아세포의 사멸 정도를 평가함으로써 실시예 1에서 제조된 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 피부세포 안전성을 비교, 평가하였다. 피부세포 증식 활성에 대한 양성 대조군으로 유전자 재조합 인간 형질전환성장인자(recombinant human transforming growth factor-beta, rhTGF-β)를 사용하였다. 인간섬유아세포(human fibroblast cell, CCD-986sk cell)를 96 well plate에 5x103 cell/well씩 분주하여 10% FBS/DMEM 배지로 24시간 배양한 후 DMEM 배지로 단계적으로 희석한 인간 형질전환성장인자(rhTGF-β), 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질 및 일반 혈관내피세포성장인자(VEGF)를 각 well에 100㎕씩 가한 후 다시 24시간 동안 CO2 incubator에서 배양하였다. WST-8[2-(2-methoxy-4-nitrophenyl)-3-(4-nitrophenyl)-5-(2,4-disulfophenyl)- 2H-tetrazolium monosodium salt] 용액을 각 well에 10 ㎕씩 처리한 후 37℃에서 2시간 동안 반응시킨 뒤 450 nm에서 흡광도 측정하여 무처치 음성 대조군 대비 인간피부섬유아세포의 세포 사멸 정도를 평가하였다.The cell-permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein and the general vascular endothelial growth factor (VEGF) prepared in Example 1 were treated at different concentrations in human fibroblast (CCD986-sk cell) (LMWP-VEGF) fusion protein prepared in Example 1 was evaluated and evaluated by evaluating the degree of death of the cell-permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein. As a positive control for skin cell proliferation activity, recombinant human transforming growth factor-beta (rhTGF-β) was used. Human fibroblast cells (CCD-986sk cells) were seeded in 96-well plates at a density of 5 × 10 3 cells / well and cultured for 24 hours in 10% FBS / DMEM medium. Then, human fibroblast cells (LMWP-VEGF) fusion protein and normal vascular endothelial growth factor (VEGF) were added to each well and incubated in a CO2 incubator for 24 hours. A solution of WST-8 [2- (2-methoxy-4-nitrophenyl) -3- (4-nitrophenyl) -5- (2,4-disulfophenyl) 2H- tetrazolium monosodium salt] After incubation at 37 ° C for 2 hours, the absorbance at 450 nm was measured to evaluate the degree of apoptosis of human skin fibroblasts compared to the untreated negative control.
그 결과, 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질은 모든 농도범위에서 무처치 음성대조군 대비 100% 이상의 세포 생존율을 나타냈으며 오히려 1,000 ng/mL 농도에서는 무처치 음성 대조군 대비 인간피부섬유아세포 증식이 최대 124% 증가하였다(***p < 0.001, 무처치 음성대조군 대비) (도 4).As a result, the cell-permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein showed cell survival rate of 100% or more as compared to the untreated negative control at all concentration ranges. On the contrary, at the concentration of 1,000 ng / Cell proliferation increased up to 124% (*** p <0.001, compared to untreated negative control) (Fig. 4).
또한, 모든 농도에서 세포 투과형 혈관내피세포장인자(LMWP-VEGF) 융합 단백질은 일반 혈관내피세포성인자(VEGF) 및 형질전환성장인자(rhTGF-β)와 마찬가지로 피부세포에 대한 독성을 나타내지 않았다. 이는 세포 투과형 아미노산 서열인 저분자량 프로타민(LMWP)을 기존 성장인자 말단에 연결해도 추가적인 피부세포독성을 유발하지 않음을 의미한다(도 4).In addition, the cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein did not exhibit toxicity to skin cells at the same concentrations as those of normal vascular endothelial growth factor (VEGF) and transforming growth factor (rhTGF-β). This means that even when the low-molecular-weight protamine (LMWP), which is a transmembrane amino acid sequence, is ligated to the end of the existing growth factor, it does not cause additional skin cytotoxicity (FIG.
실시예 5. 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 피부세포 투과도 증진 평가: 피부세포 투과 증진 이미지Example 5. Assessment of skin cell permeability enhancement of cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein: skin cell permeation enhancement image
인간섬유아세포 (CCD986-sk cell)를 이용하여 실시예 1로 제조된 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 피부구성 세포의 세포막 투과도를 평가하였다.The cell membrane permeability of the cell-permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein prepared in Example 1 was evaluated using human fibroblast (CCD986-sk cell).
Cell Tak sodlution으로 20분 동안 코팅한 10mm coverslip에 인간섬유아세포(human fibroblast cell, CCD-986sk cell)를 각 coverslip에 5x103 cell씩 분주하여 10% FBS/DMEM 배지로 48시간 배양하였다. Alexa 647(형광물질)로 표지한 혈관내피세포성장인자(VEGF-A), 세포 투과형 혈관내피세포성장인자(LMWP-VEGF-A) 융합 단백질을 DMEM 배지로 희석한 후 각 coverslip에 도포하고 6시간 동안 CO2 incubator에서 추가 배양하였다. 이후 각 coverslip을 인산염완충액(pH7.4)으로 세척한 후 4% paraformaldehyde 용액으로 5분간 상온에서 고정하였다. 각 coverslip을 인산염완충액(pH7.4)으로 2회 세척한 후, 1㎍/mL 4'6-diamido-2-phenylindole(DAPI; Roche, Basel, Switzerland)로 상온에서 5분간 세포핵을 염색하였다. 형광물질로 표지된 각 성장인자의 섬유아세포 세포막 투과 정도를 형광현미경(Carl Zeiss MicroImaging GmbH, 07740 Jena, Germany)으로 측정하였다.Human fibroblast cells (CCD-986sk cell) were plated on each coverslip in 5x10 3 cells in a 10-mm coverslip coated with a cell plug sodilution for 20 minutes and cultured in 10% FBS / DMEM for 48 hours. The vascular endothelial growth factor (VEGF-A) and the transmembrane endothelial cell growth factor (LMWP-VEGF-A) fusion protein labeled with Alexa 647 (fluorescent substance) were diluted with DMEM medium and applied to each coverslip. and incubated for additional in CO 2 incubator. Each coverslip was then washed with phosphate buffer (pH 7.4) and fixed with 4% paraformaldehyde solution for 5 minutes at room temperature. Each coverslip was washed twice with phosphate buffered saline (pH 7.4) and stained with 1 μg / mL 4'6-diamido-2-phenylindole (DAPI; Roche, Basel, Switzerland) for 5 min at room temperature. The degree of permeability of fibroblast cell membrane of each growth factor labeled with a fluorescent substance was measured with a fluorescence microscope (Carl Zeiss MicroImaging GmbH, 07740 Jena, Germany).
상기 형광 이미지를 측정한 결과, 혈관내피세포성장인자(VEGF-A)는 세포질 내에서 거의 측정되지 않은 반면, 세포 투과형 혈관내피세포성장인자(LMWP-VEGF-A) 융합 단백질의 경우 세포질 내에서 무처치 음성 대조군 대비 높은 형광 강도를 나타냈다(도 5).As a result of the fluorescence image measurement, VEGF-A was almost not measured in the cytoplasm, whereas in the case of the cell permeable vascular endothelial growth factor (LMWP-VEGF-A) fusion protein, And showed a higher fluorescence intensity than the treated negative control group (Fig. 5).
따라서, 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질은 세포 투과형 아미노산 서열인 저분자량 프로타민(LMWP)이 기존 성장인자 N-말단에 추가로 결합되어 매우 우수한 피부세포 투과도를 나타냄을 알 수 있다(도 5).Therefore, it is known that the cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein has an excellent skin cell permeability due to the addition of low molecular weight protamine (LMWP), which is a cell permeable amino acid sequence, (Fig. 5).
실시예 6. 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 피부 투과능 증진 평가: 인공피부막(Skin PAMPA) 투과도 평가Example 6. Assessment of skin permeability enhancement of cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein: Evaluation of skin PAMPA permeability
Skin PAMPA Explorer Test System(Pion Inc., Billerica, MA, USA) 이용하여 인공피부막을 통한 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 피부 투과능 정도를 평가하였다.(LMWP-VEGF) fusion protein through the artificial skin membrane was evaluated using the Skin PAMPA Explorer Test System (Pion Inc., Billerica, MA, USA).
90Skin PAMPA system의 각 well의 top(acceptor) compartment를 200㎕의 hydration buffer solution (pH 7.4)으로 overnight hydration 시켰다. Top(donor) plate에 Prisma-HT buffer solution(pH 7.4)를 이용하여 1,000ng/mL 농도로 용해시킨 혈관내피세포성장인자(VEGF), 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질 용액을 각 well에 200㎕씩 도포하였다. 별도로 acceptor plate(bottom)의 각 well에 200㎕의 Prisma-HT buffer solution(pH 7.4)를 넣은 후 top(donor) plate를 결합하고 상온에서 방치하였다. 6, 12, 18 및 24시간째 PAMPA sandwich를 분리하고 donor와 acceptor의 용액을 취해 인공 피부막을 투과한 각 성장인자의 농도를 상기 설정한 HPLC 분석법을 이용하여 정량하고 인공 피부막을 투과한 각 성장인자의 투과도(permeability)를 계산하였다.The top (acceptor) compartment of each well of 90Skin PAMPA system was subjected to overnight hydration with 200 μl of hydration buffer solution (pH 7.4). The vascular endothelial growth factor (VEGF), cytotoxic vascular endothelial growth factor (LMWP-VEGF) fusion protein solution dissolved at a concentration of 1,000 ng / mL in a donor plate using Prisma-HT buffer solution Was applied to each well. Separately, 200 μl of Prisma-HT buffer solution (pH 7.4) was added to each well of the acceptor plate (bottom), and then the top (donor) plate was bound and left at room temperature. PAMPA sandwich was isolated at 6, 12, 18, and 24 hours, and the concentration of each growth factor that passed through the artificial skin membrane was measured using the above-described HPLC method by taking the solution of donor and acceptor, Permeability was calculated.
모든 시간에서 세포 투과형 혈관내피세포성장인자(LMWP-VEGF-A) 융합 단백질은 일반 혈관내피세포성장인자(VEGF-A) 대비 유의적으로 매우 높은 인공 피부막 투과도를 나타냈으며 24시간째 인공 피부막을 통과한 세포 투과형 혈관내피세포성장인자(LMWP-VEGF-A) 융합 단백질의 농도는 혈관내피세포성장인자(VEGF-A) 대비 299% 증가하였다(***p < 0.001, 혈관내피세포성장인자(VEGF-A) 대비) (도 6).At all times, the transmembrane vascular endothelial growth factor (LMWP-VEGF-A) fusion protein showed significantly higher artificial skin permeability than the normal vascular endothelial growth factor (VEGF-A) The concentration of the transfected Vascular Endothelial Growth Factor (LMWP-VEGF-A) fusion protein was 299% higher than that of VEGF-A ( *** p <0.001, vascular endothelial growth factor VEGF-A) (Fig. 6).
결과적으로 인공피부막을 통한 세포 투과형 혈관내피세포성장인자(LMWP-VEGF-A) 융합 단백질의 피부 투과도(permeability)는 혈관내피세포성장인자(VEGF-A) 대비 165% 증가하였다 (###p < 0.001, 혈관내피세포성장인자(VEGF) 대비) (도 6).As a result were as artificial skin cells transmissive vascular endothelial growth factor (VEGF-A-LMWP) skin permeability (permeability) of the fusion protein increased 165% from the vascular endothelial growth factor (VEGF-A) through the membrane (### p < 0.001, versus vascular endothelial growth factor (VEGF)) (Fig. 6).
실시예 7. 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 안티-에이징 효능 평가: 섬유아세포 증식 활성에 의한 피부재생 효능Example 7. Evaluation of anti-aging efficacy of cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein: Effect of skin regeneration by fibroblast proliferation activity
인간섬유아세포 (CCD986-sk cell) 배양 시 실시예 1에서 제조된 세포 투과형 성장인자를 농도별로 처리하여 인간섬유아세포증식 정도를 평가함으로서 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 피부재생 활성을 평가하였다. 피부세포 증식 활성에 대한 양성 대조군으로 유전자 재조합 인간 형질전환성장인자(recombinant human Transforming growth factor-beta, rhTGF-β)를 사용하였다. 인간섬유아세포 (human fibroblast cell, CCD-986sk cell)를 96 well plate에 5x103 cell/well씩 분주하여 10% FBS/DMEM 배지로 24시간 배양한 후 배양액을 제거하고 0.05% FBS가 포함된 DMEM 배양액에서 다시 24시간 배양하였다. 이후 0.5% FBS가 포함된 DMEM 배지로 단계적으로 희석한 혈관내피세포성장인자(VEGF-A), 세포 투과형 혈관내피세포성장인자(LMWP-VEGF-A) 융합 단백질과 유전자 재조합 인간 형질전환성장인자 (recombinant human transforming growth factor-beta, rhTGF-β)를 각 well에 100㎕씩 가한 후 다시 24시간 동안 CO2 incubator에서 배양함하였다. 이후 5mg/mL 농도의 WST-1(Roche Diagnostics) 용액을 각 well에 10㎕씩 처리한 후 37℃에서 2시간 동안 반응시킨 뒤 450nm에서 흡광도 측정하고 무처치 음성 대조군 대비 피부섬유아세포의 증식 정도를 평가하였다. In the case of culturing human fibroblasts (CCD986-sk cells), the cell permeability type growth factor (LMWP-VEGF) fusion protein prepared in Example 1 was treated at different concentrations to evaluate the degree of human fibroblast proliferation, The regeneration activity was evaluated. Recombinant human transforming growth factor-beta (rhTGF-β) was used as a positive control for skin cell proliferative activity. Human fibroblast cells (CCD-986sk cells) were seeded in 96-well plates at a density of 5 × 10 3 cells / well and cultured for 24 hours in 10% FBS / DMEM medium. The culture medium was removed and DMEM medium containing 0.05% FBS Lt; / RTI > for 24 hours. (VEGF-A), a cell-permeable vascular endothelial growth factor (LMWP-VEGF-A) fusion protein and a recombinant human growth factor (VEGF-A) fusion protein were diluted in DMEM medium containing 0.5
그 결과, 모든 시험농도범위에서 양성대조군인 형질전환성장인자(rhTGF-β)은 무처치 음성 대조군 대비 인간 피부 섬유아세포의 증식이 유의적으로 증가하였으며 (***p < 0.001, 무처치 음성대조군 대비) 세포 투과형 혈관내피세포성장인자(LMWP-VEGF-A) 융합 단백질 역시 모든 시험 농도 범위에서 무처치 음성대조군 대비 100% 이상의 인간섬유아세포 증식 활성을 나타냈다. 특히, 100 ng/mL 농도에서 무처치 음성 대조군 대비 인간섬유아세포 증식이 최대 118% 증가하였다(***p < 0.001, 무처치 음성대조군 대비) (도 7).As a result, the positive control group, rhTGF-β, significantly increased the proliferation of human dermal fibroblasts compared to the untreated negative control group ( *** p <0.001, untreated negative control group Cell permeable vascular endothelial growth factor (LMWP-VEGF-A) fusion protein also showed over 100% human fibroblast proliferation activity over the untreated negative control group at all test concentration ranges. In particular, at a concentration of 100 ng / mL, human fibroblast proliferation increased up to 118% ( *** p < 0.001 versus untreated negative control) compared to the untreated negative control (Fig. 7).
실시예 8. 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 안티-에이징 효능 평가: 섬유아세포 증식 활성에 의한 상처치유 효능Example 8. Evaluation of anti-aging efficacy of cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein: wound healing efficacy by fibroblast proliferation activity
인간 섬유아세포(CCD986-sk) 및 마우스 섬유아세포(NIH 3T3)에 스크래치 상처(scratch wound)를 유발한 후 배양액에 실시예 1에서 제조된 세포 투과형 혈관내피성장인자(LMWP-VEGF) 융합 단백질을 농도별로 처리하여 세포증식 정도를 평가함으로서 세포 투과형 혈관내피성장인자(LMWP-VEGF) 융합 단백질의 피부세포 증식 활성에 의한 상처치유 효능을 평가하였다. 피부세포 증식 활성에 대한 양성 대조군으로 유전자 재조합 인간 형질전환성장인자(recombinant human Transforming growth factor-beta, rhTGF-β)를 사용하였다. Scratch wound was induced in human fibroblast (CCD986-sk) and mouse fibroblast (NIH 3T3), and the cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein prepared in Example 1 (LMWP-VEGF) fusion protein by evaluating the degree of cell proliferation by evaluating the cell proliferation activity of the cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein. Recombinant human transforming growth factor-beta (rhTGF-β) was used as a positive control for skin cell proliferative activity.
인간섬유아세포(CCD-986sk cell) 및 마우스 섬유아세포(NIH 3T3 cell)를 96 well plate에 3.5X104 cell/well씩 분주하고 10% FBS/DMEM 배지에서 72시간 배양하여 섬유아세포의 monolayer를 형성시켰다. 이후 배양액을 제거하고 wound maker를 이용하여 각 well에 cell-free zone(scratch wound, 회색영역)를 형성시킨 후 각 well을 인산염완충액 (pH 7.4) 100㎕로 4회 세척하고 serum free DMEM 배양액으로 단계적으로 희석한 혈관내피세포성장인자(VEGF-A), 세포 투과형 혈관내피세포성장인자(LMWP-VEGF-A) 융합 단백질과 형질전환성장인자(rhTGF-β)를 각 well에 100㎕씩 첨가하였다. CO2 incubator에서 Incucyte Zoom microscope (Essen Bioscience)로 4시간 간격, 72시간 동안 각 well의 상처면적(scratch wound area)의 회복(재생)율을 측정하였다.Human fibroblasts (CCD-986sk cells) and mouse fibroblasts (NIH 3T3 cells) were seeded in 96-well plates at 3.5 × 10 4 cells / well and cultured in 10% FBS / DMEM medium for 72 hours to form fibroblast monolayer . After removing the culture medium, the cell-free zone (scratch wound, gray area) was formed in each well using a wound maker, and each well was washed four times with 100 μl of phosphate buffer solution (pH 7.4) (VEGF-A), a cell-permeable vascular endothelial growth factor (LMWP-VEGF-A) fusion protein and a transforming growth factor (rhTGF-β) diluted in PBS were added to each well. The recovery (recovery) rate of scratch wound area of each well was measured with an Incucyte Zoom microscope (Essen Bioscience) in CO2 incubator at intervals of 4 hours and 72 hours.
마우스 섬유아세포 경우, 세포 투과형 혈관내피세포성장인자(LMWP-VEGF-A) 융합 단백질이 시험 농도 범위에서 무처치 음성대조군 대비 마우스 섬유아세포의 증식 활성으로 상처 회복율이 향상되었다. 특히, 1 ng/mL 농도로 처리 시 72시간째 상처 회복율은 무처치 음성 대조군 대비 최대 120% 증가하였다(**p < 0.01, 무처치 음성대조군 대비) (도 8).In the case of mouse fibroblasts, the proliferation rate of the cell permeable vascular endothelial growth factor (LMWP-VEGF-A) fusion protein was enhanced by the proliferative activity of mouse fibroblasts compared to the untreated negative control in the test concentration range. In particular, at 1 ng / mL concentration, the wound recovery rate increased up to 120% ( ** p <0.01, compared to the untreated negative control group) compared to the untreated negative control group at 72 hours (Fig. 8).
또한, 인간 섬유아세포의 경우, 세포 투과형 혈관내피세포성장인자(LMWP-VEGF-A) 융합 단백질이 시험 농도 범위에서 무처치 음성대조군 대비 인간 섬유아세포의 증식 활성으로 상처 회복율이 향상되었다. 특히, 50 ng/mL 농도로 처리 시 72시간째 상처 회복율은 무처치 음성 대조군 대비 최대 128% 증가하였다(**p < 0.01, 무처치 음성대조군 대비) (도 9).In addition, in the case of human fibroblasts, the cell permeability-type vascular endothelial growth factor (LMWP-VEGF-A) fusion protein enhanced the wound recovery rate by the proliferation activity of human fibroblasts compared to the untreated negative control group in the test concentration range. In particular, at 50 ng / mL concentration, the wound recovery rate increased up to 128% ( ** p <0.01, compared to the untreated negative control group) compared to the untreated negative control group (Fig. 9).
실시예 9. 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질 및 1,2-헥산디올(Hexandiol) 병용 투여의 콜라겐 생성 촉진 효능Example 9. Promoting Collagen Production Enhancement by Combined Treatment of Cellular Transmural Vascular Endothelial Growth Factor (LMWP-VEGF) Fusion Protein and 1,2-Hexanediol
인간섬유아세포 (CCD986-sk cell) 배양 시 실시예 1에서 제조된 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질 및 1,2-헥산디올(Hexanediol)을 농도별로 처리하여, 1,2-헥산디올과 세포 투과형 혈관내피세포성장인자 융합 단백질을 병용하여 투여하였을 때, 콜라겐 생성에 시너지 효과를 평가하였다.The cell-permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein and 1,2-hexanediol prepared in Example 1 were treated at different concentrations in human fibroblast (CCD986-sk cell) - Synergistic effect on collagen production was evaluated when hexane diol was administered in combination with a cell permeable vascular endothelial growth factor fusion protein.
인간섬유아세포(CCD-986sk cell)를 296 well plate에 3.5X104 cells/well 씩 동일하게 heamacytometer를 이용하여 계수한 후 분주하여 배양하였다. 10% FBS를 함유하는 DMEM에서 48시간 배양하여 배양용기 표면적의 ~50%만큼 배양되면, 실시예 1에서 제조된 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질을 배지 내 최종농도가 10.0 ppm의 농도로 투여하고, 1,2-헥산디올을 총 배지 볼륨 내에서 0.1% 및 2.5%가 되도록 각각 처리하여 48시간 더 배양하였다. 그 뒤, 프로콜라겐 타입 I C-펩티드(Procollagen type I C-peptide; PIP) ELSA 키트를 사용하여, 제조사에서 제시된 실험방법에 의해 콜라겐 생성 정도를 측정하였다.Human fibroblasts (CCD-986sk cells) were counted on a 296-well plate at 3.5 × 10 4 cells / well using a heamacytometer. (LMWP-VEGF) fusion protein prepared in Example 1 was cultured in DMEM containing 10% FBS for 48 hours to reach a final concentration of 10.0 ppm, and 1,2-hexanediol was treated at 0.1% and 2.5% in the total volume of the medium, respectively, and cultured for another 48 hours. After that, the degree of collagen production was measured by the test method presented by the manufacturer using a Procollagen type I C-peptide (PIP) ELSA kit.
세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질을 단독으로 처리한 군(2)에서는 약 150% 콜라겐 생성 촉진이 나타나는 반면, 1,2-헥산디올을 추가로 더 처리한 군(3 및 4)에서는 약 180% 및 222%의 콜라겐 생성 촉진 효과를 보였다. 특히, 2.5% 1,2-헥산디올을 더 포함하는 군(4)에서는 세포 투과형 혈관내피세포성장인자 융합 단백질 단독 처리군에 비하여 약 1.5 배 이상 콜라겐 생성 촉진의 현저한 상승 효과를 발휘하였다(도 10 및 도 11).In the group treated with the cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein alone (2), about 150% collagen production was promoted whereas in the group treated with 1,2-hexanediol 4) showed about 180% and 222% of promoting collagen production. In particular, the group (4) containing 2.5% 1,2-hexanediol exerted a remarkable synergistic effect of promoting collagen production more than about 1.5 times as compared with the group treated with the cytotoxic vascular endothelial growth factor fusion protein alone And Fig. 11).
상기 결과를 통해 본 발명에 따른 세포 투과형 혈관내피세포성장인자 융합 단백질은 단독으로 처리한 경우에 비하여, 1,2-헥산디올을 추가로 더 포함하는 경우에 콜라겐 생성 촉진에 현저한 시너지 효과가 존재함을 알 수 있다.The above results show that synergistic effect of promoting collagen production is present when 1,2-hexanediol is further contained in the fusion protein of the cytotoxic Vascular Endothelial Growth Factor according to the present invention, .
<110> BIO-FD&C <120> Topical Formulation Composed of Cell Permeable Vascular Endothelial Growth Factor (LMWP-VEGF) with Skin Physiological Activity <130> KPA01286 <150> KR 2016-0119277 <151> 2016-09-19 <160> 2 <170> KoPatentIn 3.0 <210> 1 <211> 14 <212> PRT <213> Artificial Sequence <220> <223> LMWP <400> 1 Val Ser Arg Arg Arg Arg Arg Arg Gly Gly Arg Arg Arg Arg 1 5 10 <210> 2 <211> 126 <212> PRT <213> Artificial Sequence <220> <223> LMWP-VEGF <400> 2 Val Ser Arg Arg Arg Arg Arg Arg Gly Gly Arg Arg Arg Arg Ala Pro 1 5 10 15 Met Ala Glu Gly Gly Gly Gln Asn His His Glu Val Val Lys Phe Met 20 25 30 Asp Val Tyr Gln Arg Ser Tyr Cys His Pro Ile Glu Thr Leu Val Asp 35 40 45 Ile Phe Gln Glu Tyr Pro Asp Glu Ile Glu Tyr Ile Phe Lys Pro Ser 50 55 60 Cys Val Pro Leu Met Arg Cys Gly Gly Cys Cys Asn Asp Glu Gly Leu 65 70 75 80 Glu Cys Val Pro Thr Glu Glu Ser Asn Ile Thr Met Gln Ile Met Arg 85 90 95 Ile Lys Pro His Gln Gly Gln His Ile Gly Glu Met Ser Phe Leu Gln 100 105 110 His Asn Lys Cys Glu Cys Arg Pro Lys Lys Asp Arg Ala Arg 115 120 125 <110> BIO-FD & C <120> Topical Formulation Composed of Cell Permeable Vascular Endothelial Growth Factor (LMWP-VEGF) with Skin Physiological Activity <130> KPA01286 <150> KR 2016-0119277 <151> 2016-09-19 <160> 2 <170> KoPatentin 3.0 <210> 1 <211> 14 <212> PRT <213> Artificial Sequence <220> <223> LMWP <400> 1 Val Ser Arg Arg Arg Arg Arg Arg Gly Gly Arg Arg Arg Arg 1 5 10 <210> 2 <211> 126 <212> PRT <213> Artificial Sequence <220> <223> LMWP-VEGF <400> 2 Val Ser Arg Arg Arg Arg Arg Gly Gly Arg Arg Arg Arg Ala Pro 1 5 10 15 Met Ala Glu Gly Gly Gly Gln Asn His His Glu Val Val Lys Phe Met 20 25 30 Asp Val Tyr Gln Arg Ser Tyr Cys His Pro Ile Glu Thr Leu Val Asp 35 40 45 Ile Phe Gln Glu Tyr Pro Asp Glu Ile Glu Tyr Ile Phe Lys Pro Ser 50 55 60 Cys Val Pro Leu Met Arg Cys Gly Gly Cys Cys Asn Asp Glu Gly Leu 65 70 75 80 Glu Cys Val Pro Thr Glu Glu Ser Asn Ile Thr Met Gln Ile Met Arg 85 90 95 Ile Lys Pro His Gln Gly Gln His Ile Gly Glu Met Ser Phe Leu Gln 100 105 110 His Asn Lys Cys Glu Cys Arg Pro Lys Lys Asp Arg Ala Arg 115 120 125
Claims (9)
상기 세포 투과형 펩타이드는 저분자 프로타민(Low molecular weight protamine, LMWP)인 것을 특징으로 하는, 피부 외용제 조성물.The method according to claim 1,
Wherein the cell permeable peptide is a low molecular weight protamine (LMWP).
상기 세포 투과형 혈관내피세포성장인자 융합 단백질은 상기 혈관내피세포성장인자(VEGF)의 N-말단, C-말단 또는 N-말단 및 C-말단에 세포 투과형 펩타이드의 아미노산 서열이 결합되는 것을 특징으로 하는, 피부 외용제 조성물.The method according to claim 1,
The fusion protein of the transmembrane endothelial cell growth factor is characterized in that an amino acid sequence of a cell-penetrating peptide is bound to the N-terminal, C-terminal or N-terminal and C-terminal of the vascular endothelial growth factor (VEGF) , ≪ / RTI >
상기 조성물은 1,2-헥산디올(1,2-Hexanediol)을 더 포함하는 것을 특징으로 하는, 피부 외용제 조성물.The method according to claim 1,
Wherein said composition further comprises 1,2-hexanediol. ≪ RTI ID = 0.0 > 11. < / RTI >
상기 세포 투과형 혈관내피세포성장인자 융합 단백질은 상기 피부 외용제 조성물 중 0.01 내지 100 ppm 농도로 포함되는 것인, 피부 외용제 조성물.The method according to claim 1,
Wherein the cytotoxic vascular endothelial growth factor fusion protein is contained at a concentration of 0.01 to 100 ppm in the composition for external application for skin.
상기 1,2-헥산디올은 상기 피부 외용제 조성물 100 중량부 기준으로 0.1 중량부 내지 2.5 중량부를 포함하는 것인, 피부 외용제 조성물.5. The method of claim 4,
Wherein the 1,2-hexanediol comprises 0.1 to 2.5 parts by weight based on 100 parts by weight of the composition for external application for skin.
상기 조성물은 콜라겐 생성 촉진용인 것인, 피부 외용제 조성물.The method according to claim 1,
Wherein the composition is for promoting collagen production.
상기 조성물은 피부 재생용인, 피부 외용제 조성물.The method according to claim 1,
Wherein said composition is for skin regeneration.
상기 조성물은 상처 치유용인, 피부 외용제 조성물.7. The method according to any one of claims 1 to 6,
Wherein said composition is for wound healing.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR20160119277 | 2016-09-19 | ||
KR1020160119277 | 2016-09-19 |
Publications (2)
Publication Number | Publication Date |
---|---|
KR20180032187A true KR20180032187A (en) | 2018-03-29 |
KR102114845B1 KR102114845B1 (en) | 2020-05-27 |
Family
ID=61906974
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020170120420A KR102114845B1 (en) | 2016-09-19 | 2017-09-19 | Topical Formulation Composed of Cell Permeable Vascular Endothelial Growth Factor (LMWP-VEGF) fusion protein with Skin Physiological Activity |
Country Status (1)
Country | Link |
---|---|
KR (1) | KR102114845B1 (en) |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20030062492A (en) * | 2002-01-17 | 2003-07-28 | 주식회사 태평양 | Preparation of botanical nano-particles having excellent percutaneous absorption properties, and cosmetic and medical composition comprising the nano-particles |
KR20100094622A (en) | 2009-02-19 | 2010-08-27 | 서울대학교산학협력단 | Target activated cells/tissue translocation peptide for impermeable compound strategy(tactics) and use thereof |
KR20130027078A (en) * | 2011-08-31 | 2013-03-14 | (주)아모레퍼시픽 | Biomembrane permeable composition |
-
2017
- 2017-09-19 KR KR1020170120420A patent/KR102114845B1/en active IP Right Grant
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20030062492A (en) * | 2002-01-17 | 2003-07-28 | 주식회사 태평양 | Preparation of botanical nano-particles having excellent percutaneous absorption properties, and cosmetic and medical composition comprising the nano-particles |
KR20100094622A (en) | 2009-02-19 | 2010-08-27 | 서울대학교산학협력단 | Target activated cells/tissue translocation peptide for impermeable compound strategy(tactics) and use thereof |
KR20130027078A (en) * | 2011-08-31 | 2013-03-14 | (주)아모레퍼시픽 | Biomembrane permeable composition |
Also Published As
Publication number | Publication date |
---|---|
KR102114845B1 (en) | 2020-05-27 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
KR101757946B1 (en) | Compounds which inhibit muscle contraction | |
KR101944388B1 (en) | Skin penetrating peptide and method of use thereof | |
KR102607079B1 (en) | Neuron cells penetrability enhanced peptide regulating neurotransmitter secretion | |
KR102127830B1 (en) | Fusion Protein Conjugated Cell Penetrating Peptide and Composition Comprising the Fusion Protein or Cell Penetrating Peptide and Epidermal Growth Factor | |
KR101393397B1 (en) | Transdermal delivery system of dermatological active ingredients using cellular transduction peptides | |
KR20120034927A (en) | Skin-transducing human epidermal growth factor and a producing method therof | |
KR101679310B1 (en) | Cosmetic composition for skin regeneration and skin soothing comprising novel peptide and growth factor complex | |
KR101813560B1 (en) | Topical formulation with Skin Physiological Activity Composed of Cell Permeable Growth Factors | |
KR20170055920A (en) | Multifunctional skin penetration peptide with whitening, skin elasticity and wrinkle improvement ability | |
KR102114842B1 (en) | Topical Formulation Composed of Cell Permeable basic Fibroblast Growth Factor (LMWP-bFGF) fusion protein with Skin Physiological Activity | |
KR20240004161A (en) | Peptide for accelerating delivery to nerve cells | |
KR102114845B1 (en) | Topical Formulation Composed of Cell Permeable Vascular Endothelial Growth Factor (LMWP-VEGF) fusion protein with Skin Physiological Activity | |
KR101797167B1 (en) | Novel protein transduction domain and the usage thereof | |
KR101620148B1 (en) | Development of long acting and cell permeable beta-defensin 3 and -3H by conjugating lauric acid and cell permeable peptide respectively and Cosmetic compostion comprising the Same | |
KR101417328B1 (en) | Biomembrane Permeable Composition | |
KR101841241B1 (en) | fusion peptides associated with inflammatory skin disease and phamaceutical composition comprising the same | |
KR102590533B1 (en) | Method for producing protein transduction domain-Sirtuin6 and cosmetic composition and pharmaceutical composition containing the same | |
KR102597686B1 (en) | Cosmetic composition containing polyphenols enhanced skin penetration | |
KR102120981B1 (en) | Gentisic acid derivative, method for production thereof and external skin composition containing the same | |
KR101626758B1 (en) | Development and production of basic fibroblast growth factor with skin permeation and cosmetic composition therefrom | |
US11951204B2 (en) | Cell-penetrating peptides and composition including the same | |
KR101945946B1 (en) | Gentisic acid derivative, method for production thereof and external skin composition containing the same | |
KR101945947B1 (en) | Protocatechuic acid derivative, method for production thereof and external skin composition containing the same | |
KR20070095617A (en) | Cell-transducing fusion protein of cyclophilin a | |
KR20070096561A (en) | Growth receptor factor bound protein 7 fusion protein |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
A201 | Request for examination | ||
E902 | Notification of reason for refusal | ||
E701 | Decision to grant or registration of patent right | ||
GRNT | Written decision to grant |