KR102114845B1 - Topical Formulation Composed of Cell Permeable Vascular Endothelial Growth Factor (LMWP-VEGF) fusion protein with Skin Physiological Activity - Google Patents
Topical Formulation Composed of Cell Permeable Vascular Endothelial Growth Factor (LMWP-VEGF) fusion protein with Skin Physiological Activity Download PDFInfo
- Publication number
- KR102114845B1 KR102114845B1 KR1020170120420A KR20170120420A KR102114845B1 KR 102114845 B1 KR102114845 B1 KR 102114845B1 KR 1020170120420 A KR1020170120420 A KR 1020170120420A KR 20170120420 A KR20170120420 A KR 20170120420A KR 102114845 B1 KR102114845 B1 KR 102114845B1
- Authority
- KR
- South Korea
- Prior art keywords
- cell
- growth factor
- skin
- vascular endothelial
- vegf
- Prior art date
Links
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/64—Proteins; Peptides; Derivatives or degradation products thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/18—Growth factors; Growth regulators
- A61K38/1858—Platelet-derived growth factor [PDGF]
- A61K38/1866—Vascular endothelial growth factor [VEGF]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q19/00—Preparations for care of the skin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q19/00—Preparations for care of the skin
- A61Q19/08—Anti-ageing preparations
Abstract
본 발명은 세포 투과형 혈관내피세포성장인자 융합 단백질을 함유하는 피부외용제 조성물에 관한 것으로, 세포 투과형세포 투과형상기 세포 투과형 혈관내피세포성장인자 융합 단백질을 포함하는 피부 외용제 조성물은 피부 세포에 독성이 없으면서도 상기 단백질에 함유된 바이오 활성소재의 세포 투과능이 우수하여 피부 개선(회복), 항노화 또는 상처 치유에 특히 효과적으로 사용될 수 있다. 또한, 본 발명에 따른 상기 세포 투과형 혈관내피세포성장인자 융합 단백질은 1,2-헥산디올(Hexanediol)을 추가로 더 포함함으로써, 콜라겐 생성 촉진에 현저한 시너지 효과를 발휘하여 항 노화 또는 상처 치유에 더욱 효과적으로 사용될 수 있다.The present invention relates to a composition for external application for skin containing a cell-permeable vascular endothelial cell growth factor fusion protein, and a cell external composition for cell-permeable cell permeation-containing vascular endothelial cell growth factor fusion protein is non-toxic to skin cells. Since the bio-active material contained in the protein has excellent cell permeability, it can be particularly effectively used for skin improvement (recovery), anti-aging or wound healing. In addition, the cell-permeable vascular endothelial cell growth factor fusion protein according to the present invention further comprises 1,2-hexanediol (Hexanediol), thereby exhibiting a remarkable synergistic effect in promoting collagen production, further anti-aging or wound healing. Can be used effectively.
Description
본 발명은 세포 투과형 혈관내피세포성장인자(Vascular Endothelial Growth Factor; VEGF) 융합 단백질을 함유하는 피부외용제 조성물에 관한 것이다.The present invention relates to a composition for external application for skin containing a cell-permeable vascular endothelial growth factor (VEGF) fusion protein.
급속한 산업화가 진행되고 고령화 현상이 심화 됨에 따라, 이러한 환경변화에 기인한 각종 피부 질환이 증가하고 있어 의료 및 생명공학 업계에서는 피부질환 및 피부재생을 통한 항노화 연구가 활발하게 진행되고 있다. With the rapid industrialization and aging phenomenon, various skin diseases caused by such environmental changes are increasing, and the medical and biotechnology industry is actively conducting anti-aging research through skin diseases and skin regeneration.
생명공학 기술개발이 고도화됨에 따라, 화장품 산업분야에도 생명공학 첨단 기술이 도입되었으며, 준 치료제 개념의 코스메슈티컬(Cosmeceuticals, 화장품을 뜻하는 코스메틱과 치료제를 뜻하는 파마슈티컬의 신조 합성어) 개발이 화장품 시장의 새로운 트렌드로 떠오르고 있다. 이에 피부 질환 개선 및 재생, 항노화 기능을 보유한 단백질 소재 개발 필요성이 늘어나고 있으며, 화장품 제조자들은 이러한 필요성에 맞는 차별화된 소개 개발을 통한 시장 확대 전략을 추진하고 있다. As the development of biotechnology has advanced, the advanced technology of biotechnology has also been introduced into the cosmetics industry, and the development of cosmeceuticals (cosmetics for cosmetics and new synthetic compound words for pharmaceutics for cosmetics) has been developed. It is emerging as a new trend in the market. Accordingly, there is an increasing need to develop protein materials that have skin disease improvement, regeneration, and anti-aging functions, and cosmetics manufacturers are pursuing a market expansion strategy through differentiated introduction and development suitable for these needs.
재조합 단백질 기술은 유전공학기술을 이용하여 고등생물에서 유래한 단백질을 미생물 및 동물세포에서 대량 발현시키는 기술이다. 단백질의 기능적 특성에 따라 미생물 및 동물세포에서 생산하는 공정기술이 응용되고 있으며, 이렇게 생산된 단백질은 제약, 화장품, 식품, 분석 및 진단 산업분야에 널리 사용되고 있다. 재조합 단백질 기반의 화장품 신소재의 경우, 주로 트러블성 피부질환을 대상으로 연구개발이 활발하다. 예를 들어, 재조합 단백질은 단백질의 물리적 특성에 기인된 낮은 피부 투과능과 물리적 안정성을 개선할 경우 글로벌 시장을 선도할 수 있는 원료개발 및 상용화가 가능하다.Recombinant protein technology is a technology for mass-expressing proteins derived from higher organisms in microorganisms and animal cells using genetic engineering technology. Depending on the functional properties of the protein, process technology produced by microorganisms and animal cells is applied, and the protein thus produced is widely used in the pharmaceutical, cosmetic, food, analysis and diagnostic industries. In the case of new cosmetics based on recombinant proteins, research and development are actively targeting mainly troubled skin diseases. For example, recombinant protein can be developed and commercialized as a raw material that can lead the global market when improving the skin permeability and physical stability due to the physical properties of the protein.
하지만, 이러한 재조합 단백질들은 일반적으로 친수성이고 거대한 분자들은 세포막이라는 장벽에 의해 세포 안으로 들어가는 것이 매우 어렵다. 세포막은 펩타이드나 단백질, 핵산과 같은 거대 분자가 세포 내로 들어가지 못하게 막으며 세포막 수용체의 의한 엔도사이토시스(Endocytosis)라는 생리적 기작을 통해 세포 내로 들어가더라도 세포의 리소좀(Lysosomal compartment)과 융합되어 결국 분해되므로 이들 거대분자 바이오 활성소재를 세포 외에서 전달하는 데 많은 제약이 따른다.However, these recombinant proteins are generally hydrophilic and large molecules are very difficult to enter into the cell by the cell membrane barrier. The cell membrane prevents large molecules such as peptides, proteins, and nucleic acids from entering the cell, and even if it enters the cell through a physiological mechanism called endocytosis by the cell membrane receptor, it fuses with the cell's lysosomal compartment and eventually breaks down. Therefore, many limitations are imposed on the delivery of these macromolecular bioactive materials outside the cell.
또한, 성장인자(Growth factor)와 같은 거대분자 바이오 활성성분 역시 친수성이며 분자량이 커서 세포막을 투과하여 피부에 흡수되는데 한계가 있기 때문에 실질적인 활성효과를 기대하기는 어렵다. 이러한 분자량이 큰 단백질의 피부흡수를 증가시키기 위해 통상적으로 레이저나 메조룰러와 같은 물리적으로 피부에 구멍을 내는 방법 또는 계면활성제 및 나노구조체 등의 전달체(Carrier)를 이용하는 방법이 적용되고 있으나, 이러한 방법은 피부 장벽의 손상 위험이 있고 거대분자를 흡수시키기에는 여전히 한계가 있으며 별도의 디바이스 시술이 요구되는 단점이 있다.In addition, since the macromolecular bio-active ingredient such as a growth factor is also hydrophilic and has a large molecular weight, it is difficult to expect a substantial active effect because it has a limitation in penetrating the cell membrane and absorbing it into the skin. In order to increase the skin absorption of a protein having a large molecular weight, a method of physically drilling a skin such as a laser or mesoular or a method using a carrier such as a surfactant and a nanostructure is applied. There is a risk of damage to the skin barrier, there are still limitations to absorb macromolecules, and there is a disadvantage that a separate device procedure is required.
이러한 한계를 극복하기 위해 최근 새로운 대안들이 제시 되었는데 그 중 세포 투과형 펩타이드(Cell penetrating peptide, CPP)들은 현재까지 낮은 세포막 투과성 및 빠른 생체 내 반감기로 인해 약물로 사용하기 어려웠던 치료용 단백질 및 유전자와 같은 거대 분자들의 의약학적 이용가치를 높일 수 있어 상기 펩타이드를 이용해 살아있는 세포의 질이나 핵 안으로 바이오 활성소재를 보다 안전하고 효과적으로 전달할 수 있는 방법이 연구되고 있다.In order to overcome these limitations, new alternatives have recently been proposed, among which cell penetrating peptides (CPPs) are large, such as therapeutic proteins and genes, which have been difficult to use as drugs due to low cell membrane permeability and fast in vivo half-life. A method for safely and effectively delivering a bioactive material into the quality or nucleus of a living cell using the peptide is being studied because the medicinal use value of molecules can be increased.
이렇듯 CPP를 이용하여 세포 내 효율적 수송을 위한 다양한 응용이 시도되었으나(특허문헌 0001), 아직까지 세포 투과형 펩타이드와 성장인자들을 결합시켜 화장료 조성물의 핵심소재로 활용하는 연구는 드물었다.As described above, various applications for efficient transport in cells using CPP have been attempted (Patent Document 0001), but there have been few studies that combine cell-penetrating peptides and growth factors as core materials for cosmetic compositions.
본 발명의 목적은 세포 독성이 없으면서도 세포 투과능이 우수한 세포 투과형 펩타이드와 성장인자인 혈관내피세포성장인자(Vascular endothelial growth factor; VEGF)가 융합된 융합 단백질을 포함하는 피부 외용제 조성물을 제공하는 것이다.An object of the present invention is to provide a composition for external application for skin comprising a fusion protein fused with a cell-permeable peptide having excellent cell permeability without cell toxicity and a vascular endothelial growth factor (VEGF), a growth factor.
본 발명의 다른 목적은 세포 투과형 펩타이드와 성장인자인 혈관내피세포성장인자(Vascular endothelial growth factor; VEGF)가 융합된 융합 단백질에 1,2-헥산디올을 더 포함하는 피부 외용제 조성물을 제공하는 것이다.Another object of the present invention is to provide a composition for external application for skin further comprising 1,2-hexanediol to a fusion protein fused with a cell-permeable peptide and a growth factor, a vascular endothelial growth factor (VEGF).
본 발명은 인체에 부작용이 없으면서 콜라겐 생성 촉진, 피부 재생 또는 상처 치유의 효과를 갖는 피부 외용제 조성물에 관한 것으로, 세포 투과성이 크게 증가되고, 이로 인해 피부 생리활성이 증대된 융합 단백질인, 세포 투과형 성장인자 융합 단백질을 포함하는 것을 특징으로 한다.The present invention relates to a composition for external application for skin having an effect of promoting collagen production, skin regeneration, or wound healing without side effects to the human body, which is a fusion protein that is a fusion protein in which cell permeability is greatly increased and skin physiological activity is increased thereby. Characterized in that it comprises a factor fusion protein.
본 발명의 목적을 달성하기 위해, 본 발명은 세포 투과형 펩타이드에 성장인자가 융합된, 세포 투과형 성장인자 융합 단백질을 포함하는 피부 외용제 조성물을 제공한다.In order to achieve the object of the present invention, the present invention provides a composition for external application for skin comprising a cell permeable growth factor fusion protein in which growth factors are fused to a cell permeable peptide.
본 발명에 있어서, 상기 세포 투과형 펩타이드는 TAT, 페너트라틴(penetratin), Antp(antennapedia protein), 또는 저분자 프로타민(Low molecular weight protamine)으로 이루어진 군에서 하나 이상인 것일 수 있고, 바람직하게는 저분자 프로타민(Low molecular weight protamine, LMWP)인 것일 수 있으나 이에 한정하는 것은 아니다. 보다 바람직하게는 상기 저분자 프로타민은 서열번호 1로 표시된 아미노산 서열로 표시된 펩타이드일 수 있으나, 이에 한정하는 것은 아니다.In the present invention, the cell-penetrating peptide may be one or more from the group consisting of TAT, penetratin, Antp (antennapedia protein), or low molecular weight protamine, preferably low molecular protamine ( Low molecular weight protamine, LMWP) may be, but is not limited thereto. More preferably, the low molecular protamine may be a peptide represented by an amino acid sequence represented by SEQ ID NO: 1, but is not limited thereto.
본 발명에 있어서, 상기 성장인자는 혈관내피세포성장인자(Vascular endothelial growth factor; VEGF), 상피세포성장인자(EGF), 및 신경성장인자(NGF)로 이루어진 군에서 하나 이상인 것을 특징으로 한다. 보다 바람직하게는 상기 성장인자는 혈관내피세포성장인자(VEGF)인 것일 수 있으나 이에 한정하는 것은 아니다.In the present invention, the growth factor is characterized in that at least one of the group consisting of Vascular endothelial growth factor (VEGF), epithelial cell growth factor (EGF), and nerve growth factor (NGF). More preferably, the growth factor may be vascular endothelial cell growth factor (VEGF), but is not limited thereto.
본 발명에 있어서, 상기 세포 투과형 성장인자는, 성장인자의 N-말단, C-말단 또는 N-말단 및 C-말단에 세포 투과형 펩타이드의 아미노산 서열이 결합되어 있는 융합 단백질의 형태인, 세포 투과형 성장인자 융합 단백질인 것을 특징으로 한다.In the present invention, the cell permeable growth factor is in the form of a fusion protein in which the amino acid sequence of the cell permeable peptide is coupled to the N-terminal, C-terminal or N-terminal and C-terminal of the growth factor, cell permeable growth factor It is characterized by being a factor fusion protein.
보다 구체적으로는, 본 발명은 세포 투과형 펩타이드에 혈관내피세포성장인자(VEGF)가 융합된, 세포 투과형 혈관내피세포성장인자 융합 단백질을 포함하는 피부 외용제 조성물을 제공할 수 있다. More specifically, the present invention can provide a composition for external application for skin comprising a cell permeable vascular endothelial growth factor fusion protein, in which a vascular endothelial cell growth factor (VEGF) is fused to a cell permeable peptide.
본 발명에 있어서, 상기 조성물은 1,2-헥산디올(1,2-Hexanediol)을 더 포함할 수 있다.In the present invention, the composition may further include 1,2-hexanediol (1,2-Hexanediol).
본 발명에 있어서, 상기 피부 외용제 조성물은 콜라겐 생성을 촉진용인 것을 특징으로 한다.In the present invention, the composition for external application for skin is characterized in that it promotes collagen production.
본 발명에 있어서, 상기 피부 외용제 조성물은 피부 재생용인 것을 특징으로 한다. In the present invention, the composition for external application for skin is characterized in that it is for skin regeneration.
또한, 본 발명에 따른 상기 조성물은 상처 치유용인 것을 특징으로 한다.In addition, the composition according to the invention is characterized in that it is for wound healing.
이하, 본 발명을 보다 구체적으로 설명한다.Hereinafter, the present invention will be described in more detail.
본 발명은 세포막 투과성이 우수하고 생체 친화적인 펩타이드인 PTD(protein transduction domain)을 이용하여 바이오 활성소재 자체의 피부 침투력을 증가시켜 바이오 활성소재의 효과를 극대화시키고자 하였다.The present invention was intended to maximize the effect of the bioactive material by increasing the skin permeability of the bioactive material itself by using a protein transduction domain (PTD), which is an excellent cell membrane permeability and a bio-friendly peptide.
PTD는 세포막 투과성이 우수하고 생체 친화적인 펩타이드로, PTD에 의한 세포 내 전달의 주요 기전 중 하나는 endocytosis의 한 종류인 mavropinocytosis에 의해 이루어진다. PTD가 세포 표면에 부착되면 세포막이 이를 감싸서 macropinosome을 형성하여 세포 속으로 uptake 되고 작용이 끝난 후에는 분해 및 배출되는 것으로 알려져 있다. 이러한 기전을 통한 세포 내 전달은 효율적이며 세포막을 교란시키거나 손상시키지 않고 수행될 수 있다. 또한 PTD에 의한 물질의 세포막 투과는 수용체 및 전달체에 의해 영향을 받지 않기 때문에 생물학적 활성 물질의 세포 내 전달을 위한 전달체(carrier)로 활용 가능하다. PTD는 바이러스성 PTD, 기존 PTD를 본 따 합성한 합성PTD, 생체에서 유래된 비 바이러스성 PTD으로 분류되며, 바이러스성 PTD로는 TAT, YARA 등이 있고, 비 바이러스성 PTD로는 LMWP 등이 있다. PTD is a peptide that has excellent cell membrane permeability and is bio-friendly, and one of the main mechanisms of intracellular delivery by PTD is by mavropinocytosis, a type of endocytosis. It is known that when PTD is attached to the cell surface, the cell membrane wraps around it to form a macropinosome, uptakes into the cell, and decomposes and discharges after action. Intracellular delivery through this mechanism is efficient and can be performed without disturbing or damaging the cell membrane. In addition, since the cell membrane permeation of the substance by PTD is not affected by the receptor and the carrier, it can be used as a carrier for intracellular delivery of the biologically active substance. PTD is classified as a viral PTD, a synthetic PTD synthesized from the existing PTD, and a non-viral PTD derived from a living body. Examples of the viral PTD include TAT and YARA, and LMWP as the non-viral PTD.
그리하여, 본 발명은 세포 투과형 펩타이드에 성장인자가 융합된 단백질인 ("세포 투과형펩타이드-성장인자 융합 단백질"), 세포 투과형 성장인자 융합 단백질을 포함하는 피부 외용제 조성물에 관한 것이다. Thus, the present invention relates to a composition for external application for skin comprising a cell permeable growth factor fusion protein, which is a protein having a growth factor fused to a cell permeable peptide (“cell permeable peptide-growth factor fusion protein”).
보다 구체적으로, 상기 세포 투과형 혈관내피세포성장인자는, 혈관내피세포성장인자(VEGF)의 N-말단, C-말단 또는 N-말단 및 C-말단에 세포 투과형 펩타이드의 아미노산 서열이 결합되어 있는 융합 단백질의 형태인, 세포 투과형 혈관내피세포성장인자일 수 있다. More specifically, the cell-permeable vascular endothelial growth factor is a fusion in which an amino acid sequence of a cell-permeable peptide is bound to the N-terminal, C-terminal or N-terminal and C-terminal of vascular endothelial cell growth factor (VEGF). It may be a cell permeable vascular endothelial cell growth factor in the form of protein.
본 발명에 있어서, "융합 단백질"이란 수송도메인 및 한 개 이상의 목적 단백질 부분을 포함하며, 수송도메인과 목적 단백질의 유전적 융합이나 화학 결합으로 형성된 복합체를 의미한다. 또한, 상기 "유전적 융합"이란 단백질을 코딩하는 DNA 서열의 유전적 발현을 통해서 형성된 선형, 공유결합으로 이루어진 연결을 의미한다. 따라서, 본 발명의 "세포 투과형 펩타이드-성장인자 융합 단백질"은, 세포 투과형 펩타이드와 성장인자 단백질을 포함하며, 세포 투과형 펩타이드와 성장인자의 유전적 융합이나 화학 결합으로 형성된 공유결합 복합체를 의미한다. In the present invention, "fusion protein" refers to a complex formed by genetic fusion or chemical bonding of a transport domain and a target protein, including a transport domain and one or more target protein moieties. In addition, the "genetic fusion" refers to a linkage composed of linear and covalent bonds formed through genetic expression of a DNA sequence encoding a protein. Accordingly, the term “cell permeable peptide-growth factor fusion protein” of the present invention includes a cell permeable peptide and a growth factor protein, and refers to a covalent complex formed by genetic fusion or chemical bonding of cell permeable peptide and growth factor.
본 발명에 있어서, 상기 융합 단백질의 제조는 유전자 재조합 방법으로 세포 투과형 성장인자 융합 단백질을 제조할 수 있다.In the present invention, the preparation of the fusion protein may be a cell permeable growth factor fusion protein by genetic recombination.
본 발명에서 특히 제시하고 있는 유전자 재조합 방법의 경우에는, 성장인자 고유의 생물학적 활성을 유지시킬 수 있고, 성장인자 내 세포 투과형 펩타이드의 결합 위치를 정확히 조절할 수 있으며, 합성에 의해 LMWP를 각 성장인자에 결합시키는 경우 합성 중 성장인자의 활성 감소 가능 및 합성 중간마다 별도의 분리 및 정제 과정이 필요하므로 생산성 및 경제성이 저하될 수 있으나, 유전자 재조합에 의한 결합 시스템은 제조 과정 중 성장인자의 활성이 저하될 우려가 없으며 제조 중간에 별도의 분리 및 정제 과정을 필요로 하지 않는다. 또한, 융합 성장인자 발현 및 정제 시스템 구축 후 대량 생산이 가능하여 생산성 또한 우수하다. In the case of the genetic recombination method presented in particular in the present invention, it is possible to maintain the biological activity inherent in the growth factor, to precisely control the binding position of the cell-penetrating peptide in the growth factor, and to synthesize the LMWP to each growth factor by synthesis. In the case of binding, it is possible to reduce the activity of growth factors during synthesis, and separate separation and purification processes are required for each synthesis, so productivity and economic efficiency may decrease, but the binding system by genetic recombination may decrease the activity of growth factors during manufacturing. There is no concern and there is no need for separate separation and purification processes in the middle of manufacturing. In addition, it is possible to mass produce after constructing a fusion growth factor expression and purification system, so productivity is also excellent.
본 발명에서 사용되는 유전자 재조합 방법은, 종래 본 기술분야에 사용되고 있는 유전공학적 기술을 활용한 것으로, 세포 투과형 펩타이드와 성장인자를 융합한 후, 발현 벡터에 삽입하여 융합 단백질 형태로 얻을 수 있으며, 여기에 사용될 수 있는 발현 벡터로는, 예컨대, 대장균(E.coli) 발현 벡터인 pBF-01(+), pET21 벡터 등이 가능하나, 종래 이용되는 발현 벡터라면 크게 제한됨이 없이 이용가능 하다. The genetic recombination method used in the present invention utilizes genetic engineering techniques that are conventionally used in the art, and can be obtained in the form of a fusion protein by fusion of a cell-penetrating peptide and a growth factor, and then inserted into an expression vector. Expression vectors that can be used as, for example, E. coli (E. coli) expression vectors pBF-01 (+), pET21 vector and the like can be used, but any expression vector used in the prior art can be used without much limitation.
본 발명에 있어서, 상기 세포 투과형 펩타이드는, 그 종류에 크게 제한됨이 없으나, 바람직하게는, TAT, 페너트라틴(penetratin), Antp(antennapedia protein), 또는 저분자 프로타민(Low molecular weight protamine, LMWP)으로 이루어진 군에서 하나 이상일 수 있다. 보다 바람직하게는 상기 세포 투과형 펩타이드는 저분자 프로타민(Low molecular weight protamine, LMWP)인 것일 수 있으나 이에 한정하는 것은 아니다.In the present invention, the cell-penetrating peptide is not greatly limited in its kind, but is preferably TAT, penetratin (penetratin), Antp (antennapedia protein), or low molecular weight protamine (LMWP). It may be one or more in the group consisting of. More preferably, the cell-penetrating peptide may be low molecular weight protamine (LMWP), but is not limited thereto.
본 발명에 있어서, 상기 LMWP는 프로타민의 일 부분으로써, 일 예시로, 서열번호 1의 아미노산 서열로 구성된 펩타이드일 수 있다.In the present invention, the LMWP is a part of protamine, and as an example, may be a peptide composed of the amino acid sequence of SEQ ID NO: 1.
서열번호 1: N-VSRRRRRRGGRRRR - CSEQ ID NO: N-VSRRRRRRGGRRRR-C
본 발명에 있어서, 상기 성장인자는, 그 종류에 크게 제한됨이 없으나, 혈관내피세포성장인자(VEGF), 상피세포성장인자(EGF), 및 신경성장인자(NGF)로 이루어진 군에서 하나 이상일 수 있다. 보다 바람직하게는 상기 성장인자는 혈관내피세포(VEGF)일 수 있으나 이에 한정하는 것은 아니다. In the present invention, the growth factor is not greatly limited in its kind, but may be one or more in the group consisting of vascular endothelial cell growth factor (VEGF), epithelial cell growth factor (EGF), and nerve growth factor (NGF). . More preferably, the growth factor may be vascular endothelial cells (VEGF), but is not limited thereto.
본 발명에 있어서, 상기 세포 투과형 펩타이드-성장인자 융합 단백질의 일 예시로, LMWP-VEGF 융합 단백질일 수 있으며, 일 예시로 서열번호 2의 서열로 구성된 융합 단백질 (밑줄 친 서열부분은 상기 'LMWP'를 의미함)인 것을 특징으로 할 수 있으나, 이에 한정하는 것은 아니다.In the present invention, as an example of the cell-penetrating peptide-growth factor fusion protein, it may be an LMWP-VEGF fusion protein, and as an example, a fusion protein consisting of the sequence of SEQ ID NO: 2 (underlined sequence part is the 'LMWP' Means), but is not limited thereto.
서열번호 2: N - VSRRRRRRGGRRRR APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRAR - CSEQ ID NO: N- VSRRRRRRGGRRRR APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRAR-C
보다 바람직하게는 상기 세포 투과형 혈관내피세포성장인자는 상기 피부 외용제 조성물 중 0.01 내지 100 ppm 농도로 포함될 수 있다. 0.01 ppm 미만으로 포함되는 경우에는 목적하는 콜라겐 생성 촉진 등의 효과를 충분히 발휘 할 수 없고, 100 ppm 초과로 포함되는 경우에는 목적하는 개체에 독성으로 인한 부작용을 유발할 수 있다.More preferably, the cell permeable vascular endothelial cell growth factor may be included at a concentration of 0.01 to 100 ppm in the composition for external application for skin. When it is contained in less than 0.01 ppm, effects such as promoting the desired collagen production cannot be sufficiently exhibited, and when it is included in more than 100 ppm, it may cause side effects due to toxicity to the target individual.
본 발명에 있어서, 상기 피부 외용제 조성물은 1,2-헥산디올(Hexanediol)을 더 포함할 수 있고, 바람직하게는 상기 피부 외용제 조성물 100 중량부 기준으로 0.1 중량부 내지 2.5 중량부를 포함할 수 있다. 0.1 중량부 미만 또는 2.5 중량부 초과로 1,2-헥산디올을 포함하는 경우에는 콜라겐 생성 촉진의 효과를 충분히 발휘할 수 없다.In the present invention, the composition for external application for skin may further include 1,2-hexanediol (Hexanediol), and preferably may contain 0.1 parts by weight to 2.5 parts by weight based on 100 parts by weight of the composition for external application for skin. When less than 0.1 parts by weight or more than 2.5 parts by weight of 1,2-hexanediol is included, the effect of promoting collagen production cannot be sufficiently exhibited.
본 발명에서 사용되는 상기 1,2-헥산디올(Hexanediol)은 화장품 원료, 생활용품 등 인체에 접촉하는 제품의 방부제, 항균 및 보습 역할을 하는 인체에 무해한 필수 원료로, 항균성은 존재하지만 살균력은 가지고 있지 않아 보존제의 보조역할을 수행하는 것으로 알려져 있다.The 1,2-hexanediol (Hexanediol) used in the present invention is an essential material harmless to the human body that acts as a preservative, antibacterial and moisturizing product, such as cosmetic raw materials, household goods, etc. It is not known to play a secondary role in preservatives.
보다 구체적으로는, 세포 투과형 펩타이드로 비 바이러스성 PTD인 저분자 프로타민(Low molecular weight protamine, LMWP)을 포함하는 피부 재생용 조성물을 제공할 수 있다. More specifically, it is possible to provide a composition for skin regeneration comprising a low molecular weight protamine (LMWP), which is a non-viral PTD, as a cell-penetrating peptide.
본 발명에 있어서, 상기 세포 투과형 성장인자 융합 단백질은 콜라겐 생성 촉진용 조성물을 제공할 수 있다.In the present invention, the cell permeable growth factor fusion protein may provide a composition for promoting collagen production.
본 발명에서 상기 콜라겐 생성 촉진용은 섬유아세포의 콜라겐 합성을 촉진하는 것으로, 상기 콜라겐은 세포 외 기질(Matrix)의 주요 구성 성분에 해당하며, 견고한 3중 나선 구조를 갖고 있다. 피부의 진피에 그 포함량이 매우 높아 피부의 기계적 견고성, 결합 조직의 저항력과 조직의 결합력, 세포 접착의 지탱, 세포 분할과 분화의 유도 능력이 존재한다. 본 발명의 목적상 상기 세포 투과형 성장인자 융합 단백질은 콜라겐 생성 촉진으로 인하여 피부에 발생될 수 있는 주름, 탄력 저하 등의 피부 노화를 현저하게 개선할 수 있다.In the present invention, the use for promoting collagen production promotes collagen synthesis of fibroblasts, and the collagen corresponds to a major component of the extracellular matrix and has a solid triple helix structure. The dermis of the skin has a very high content, and thus there are mechanical firmness of the skin, resistance to connective tissue and tissue, ability to support cell adhesion, and to induce cell division and differentiation. For the purpose of the present invention, the cell permeable growth factor fusion protein can significantly improve skin aging such as wrinkles and elasticity, which may occur on the skin due to the promotion of collagen production.
본 발명에 있어서, 이러한 세포 투과형 성장인자는 피부 재생 및 상처 치유 효과를 가지고 있어, 피부 재생용 피부 외용제 조성물, 상처 치유용 피부 외용제 조성물인 것을 특징으로 할 수 있다. In the present invention, such a cell-permeable growth factor has a skin regeneration and wound healing effect, and thus may be characterized as a composition for external application for skin regeneration and a composition for external application for wound healing.
본 발명에 따른 세포 투과형 성장인자융합 단백질은 포유류, 바람직하게는 인간의 몸에 적용되는 다양한 종류의 외용 조성물의 일부를 구성할 수 있다. 이러한 관점에서, 본 발명은 적어도 하나의 세포 투과형 성장인자 융합 단백질을 포함하는 화장료 또는 피부약제 조성물을 제공한다. 상기 조성물은 본 기술 분야의 당업자에게 공지된 종래 방법으로 제조될 수 있다. 세포 투과형 성장인자 융합 단백질은 종래의 미용상 또는 피부 약제학 상 허용 가능한 용매, 이를테면, 에탄올, 프로판올 또는 이소프로판올, 프로필렌 글리콜, 글리세린, 부틸렌 글리콜 또는 폴리에틸렌 글리콜 또는 이들의 혼합물에 용해될 수 있다. 세포 투과형 성장인자 융합 단백질은 활성 성분의 침투를 향상시키기 위한 미용상 또는 약제학상 전달 시스템 및/또는 서방형 시스템에 미리 혼입될 수 있고, 이러한 시스템의 비제한적인 예로는, 리포좀, 밀리파티클, 마이크로파티클 및 나노파티클뿐만 아니라, 스폰지, 소낭, 미셀, 밀리스피어, 마이크로스피어, 나노스피어, 리포스피어, 밀리캡슐, 마이크로캡슐 및 나노캡슐을 들 수 있다. 마찬가지로, 본 발명의 세포 투과형 성장인자 융합 단백질은 탈크, 벤토나이트, 전분 또는 말토덱스트린 등 고체 유기 고분자나 미네랄 지지체에 흡착될 수도 있다. 이러한 제제는 바른 후(leave on) 씻어내는(rinse-off) 제형을 포함하는 크림, 수중 오일과 실리콘의 에멀젼, 수중 오일의 에멀젼, 수중 실리콘의 에멀젼, 오일과 실리콘 중 물의 에멀젼, 오일 중 물의 에멀젼, 실리콘 중 물의 에멀젼, 오일, 밀크, 밤, 폼, 로션, 젤, 리너먼트(liniments), 세럼, 비누, 연고, 바, 펜슬 또는 스프레이 등 다른 형태의 제형에 이용될 수도 있고, 본 기술 분야에 공지된 기법으로 습윤 와이프(wet wipe), 하이드로겔, 접착성(또는, 비접착성) 패치 또는 페이스 마스크 등 다양한 종류의 고체 보조제에 혼입되거나, 컨실러, 메이크업 파운데이션, 메이크업 리무버 밀크 또는 로션, 아이섀도우, 립스틱 등 다양한 메이크업류 제품에 혼입될 수도 있다. 본 발명에 있어서, 피부 외용제 조성물은 화장료 조성물 또는 약제학적 조성물일 수 있다.The cell permeable growth factor fusion protein according to the present invention may constitute a part of various types of external composition applied to a mammal, preferably a human body. In this regard, the present invention provides a cosmetic or dermatological composition comprising at least one cell permeable growth factor fusion protein. The composition can be prepared by conventional methods known to those skilled in the art. Cell permeable growth factor fusion proteins can be dissolved in conventional cosmetic or dermatologically acceptable solvents such as ethanol, propanol or isopropanol, propylene glycol, glycerin, butylene glycol or polyethylene glycol or mixtures thereof. Cell permeable growth factor fusion proteins can be pre-incorporated into cosmetic or pharmaceutical delivery systems and / or sustained release systems to enhance the penetration of active ingredients, non-limiting examples of such systems are liposomes, milliparticles, microparticles And nanoparticles, as well as sponges, vesicles, micelles, millispeares, microspheres, nanospheres, rephospheres, millicapsules, microcapsules, and nanocapsules. Similarly, the cell permeable growth factor fusion protein of the present invention may be adsorbed on a solid organic polymer or mineral support such as talc, bentonite, starch or maltodextrin. These formulations include creams containing formulations that are left on and rinse-off, emulsions of oils and silicones in water, emulsions of oils in oil, emulsions of silicones in water, emulsions of water in oils and silicones, emulsions of water in oils It can be used in other types of formulations such as emulsions of water, oils, milk, balm, foams, lotions, gels, liniments, serums, soaps, ointments, bars, pencils or sprays in silicones, and in the art. It can be incorporated into various types of solid auxiliaries such as wet wipes, hydrogels, adhesive (or non-adhesive) patches or face masks by known techniques, concealer, makeup foundation, makeup remover milk or lotion, eye shadow , It can also be incorporated into various makeup products such as lipstick. In the present invention, the composition for external application for skin may be a cosmetic composition or a pharmaceutical composition.
상기 화장료 조성물에 있어서는, 화장품 제제에 있어서 수용가능한 담체를 포함할 수 있다. 여기서, "화장품 제제에 있어서 수용 가능한 담체"란 화장품 제제에 포함될 수 있는 이미 공지되어 사용되고 있는 화합물 또는 조성물이거나 앞으로 개발될 화합물 또는 조성물로서 피부와의 접촉 시 인체가 적응 가능한 이상의 독성, 불안정성 또는 자극성이 없는 것을 말한다.In the cosmetic composition, it may include a carrier that is acceptable in cosmetic preparations. Here, the "acceptable carrier in cosmetic preparations" is a compound or composition that is already known and used that may be included in cosmetic preparations, or is a compound or composition to be developed in the future. Say nothing.
상기 담체는 본 발명의 피부 외용제 조성물에 그것의 전체 중량에 대하여 약 1 중량 % 내지 약 99.99 중량 %, 바람직하게는 조성물의 중량의 약 90 중량% 내지 약 99.99 중량 %로 포함될 수 있다. 그러나 상기 비율은 본 발명의 피부 외용제 조성물이 제조되는 후술한 바의 제형에 따라 또 그것의 구체적인 적용 부위(얼굴, 목 등)나 그것의 바람직한 적용량 등에 따라 달라지는 것이기 때문에, 상기 비율은 어떠한 측면으로든 본 발명의 범위를 제한하는 것으로 이해되어서는 안 된다.The carrier may be included in the composition for external application for skin of the present invention in an amount of about 1% to about 99.99% by weight, preferably about 90% to about 99.99% by weight of the composition. However, since the ratio varies depending on the formulation as described below, in which the composition for external application for skin of the present invention is prepared, and its specific application site (face, neck, etc.) or its preferred application amount, the ratio can be viewed in any aspect. It should not be understood as limiting the scope of the invention.
상기 담체로서는 알코올, 오일, 계면활성제, 지방산, 실리콘 오일, 습윤제, 보습제, 점성 변형제, 유제, 안정제, 자외선 산란제, 자외선흡수제, 발색제, 향료 등이 예시될 수 있다. 상기 알코올, 오일, 계면활성제, 지방산, 실리콘 오일, 습윤제, 보습제, 점성 변형제, 유제, 안정제, 자외선 산란제, 자외선흡수제, 발색제, 향료로 사용될 수 있는 화합물/조성물 등은 이미 당업계에 공지되어 있기 때문에 당업자라면 적절한 해당 물질/조성물을 선택하여 사용할 수 있다.Examples of the carrier include alcohols, oils, surfactants, fatty acids, silicone oils, wetting agents, moisturizing agents, viscous modifiers, emulsions, stabilizers, ultraviolet scattering agents, ultraviolet absorbers, colorants, fragrances, and the like. The alcohols, oils, surfactants, fatty acids, silicone oils, wetting agents, moisturizing agents, viscous modifiers, emulsions, stabilizers, UV scattering agents, UV absorbers, colorants, compounds / compositions that can be used as fragrances, etc., are already known in the art. Therefore, those skilled in the art can select and use an appropriate material / composition.
본 발명의 일 구현예로써, 본 발명에 따른 피부 외용제 조성물은 상기 세포 투과형 성장인자 융합 단백질이외에 글리세린, 부틸렌글리콜, 프로필렌글키롤, 폴리옥시에틸렌 경화피마자유, 에탄올, 트리에탄올아민 등을 포함할 수 있으며, 방부제, 항료, 착색료, 정제수 등을 필요에 따라 미량 포함할 수 있다. As an embodiment of the present invention, the composition for external application for skin according to the present invention may include glycerin, butylene glycol, propylene glycol, polyoxyethylene cured castor oil, ethanol, triethanolamine, etc. in addition to the cell permeable growth factor fusion protein. In addition, a preservative, a colorant, a colorant, and purified water may be included in trace amounts as necessary.
본 발명에 따른 피부 외용제 조성물은, 다양한 형태로 제조될 수 있는데, 예컨대, 화장수, 에센스, 젤, 에멀젼, 로션, 크림(수중 유적형, 유중 수적형, 다중상), 용액, 현탁액(무수 및 수계), 무수 생성물(오일 및 글리콜계), 젤, 마스크, 팩, 분말, 또는 젤라틴 등의 피막이 있는 캅셀 (소프트 캅셀, 하드 캅셀) 제형 등의 형태로 제조될 수 있다. The composition for external application for skin according to the present invention may be prepared in various forms, for example, lotion, essence, gel, emulsion, lotion, cream (water-in-oil type, oil-in-water type, multi-phase), solution, suspension (anhydrous and water-based) ), Anhydrous products (oil and glycol based), gels, masks, packs, powders, or capsules with soft coatings such as gelatin (soft capsules, hard capsules).
본 발명에 있어서의 피부는 얼굴뿐만 아니라, 두피, 전신도 포함되는 개념으로, 이러한 두피에 적용될 수 있는 피부 외용제 조성물로써, 샴푸, 린스, 트리트먼트, 발모제 등이 있고, 전신에 적용될 수 있는 바디클렌져 등의 용도로써 다양한 형태로 제조될 수 있다. The skin in the present invention is a concept that includes not only the face, but also the scalp and the whole body. As a composition for external application for skin that can be applied to such scalp, there is a shampoo, conditioner, treatment, hair repellent, etc., and a body cleanser that can be applied to the whole body It can be manufactured in various forms for the purpose of, for example.
본 발명에 따른 세포 투과형 성장인자 융합 단백질을 함유 피부 외용제 조성물의 제조방법은 전술한 제조방법에 한정되는 것은 아니며, 본 발명이 속하는 기술분야에서 통상의 지식을 가진 자라면 상기 제조방법을 일부 변형시킨 방법으로도 본 발명에 따른 세포 투과형 성장인자 융합 단백질을 함유 피부 외용제 조성물을 제조할 수 있다.The method for preparing a composition for external application for skin containing a cell-permeable growth factor fusion protein according to the present invention is not limited to the above-described manufacturing method, and a person who has ordinary knowledge in the art to which the present invention pertains may have partially modified the manufacturing method. It is also possible to prepare a composition for external application for skin containing a cell-permeable growth factor fusion protein according to the present invention.
특히, 상기 피부 외용제 조성물은 본 발명에 특별히 개시된 제조방법 이외에도, 통상적으로 알려진 제조방법을 이용하여, 일반적인 유화 제형 및 가용화 제형의 형태로 제조될 수 있다. In particular, the composition for external application for skin may be prepared in the form of a general emulsifying formulation and a solubilizing formulation using a conventionally known manufacturing method in addition to the manufacturing method specifically disclosed in the present invention.
화장료 조성물로 제조될 경우, 유화 제형의 화장품으로는 영양화장수, 크림, 에센스 등이 있으며, 가용화 제형의 화장품으로는 유연화장수가 있다. 또한, 피부과학적으로 허용 가능한 매질 또는 기제를 함유함으로써 피부과학 분야에서 통상적으로 사용되는 국소적용 또는 전신 적용할 수 있는 보조제 형태로 제조될 수 있다. When prepared as a cosmetic composition, the cosmetics of the emulsifying formulation include nutrient makeup, cream, essence, etc., and the cosmetics of the solubilizing formulation include softening makeup. In addition, by containing a dermatologically acceptable medium or base, it can be prepared in the form of a supplement that can be applied topically or systemically, which is commonly used in the field of dermatology.
또한, 적합한 화장품의 제형으로는, 예를 들면 용액, 겔, 고체 또는 반죽 무수 생성물, 수상에 유상을 분산시켜 얻은 에멀젼, 현탁액, 마이크로에멀젼, 마이크로캡슐, 미세과립구 또는 이온형(리포좀), 비이온형의 소낭 분산제의 형태, 크림, 스킨, 로션, 파우더, 연고, 스프레이 또는 콘실스틱의 형태로 제공될 수 있다. 또한, 포말(foam)의 형태 또는 압축된 추진제를 더 함유한 에어로졸 조성물의 형태로도 제조될 수 있다. In addition, suitable cosmetic formulations include, for example, emulsions, suspensions, microemulsions, microcapsules, microgranules or ionic forms (liposomes), nonionics obtained by dispersing an oil phase in a solution, gel, solid or dough anhydrous product, or water phase. It can be provided in the form of a vesicle dispersant in the form, in the form of a cream, skin, lotion, powder, ointment, spray or consylstick. It can also be prepared in the form of a foam or aerosol composition further containing a compressed propellant.
또한, 본 발명의 피부 외용제 조성물은 추가로 지방 물질, 유기 용매, 용해제, 농축제 및 겔화제, 연화제, 항산화제, 현탁화제, 안정화제, 발포제(foaming agent), 방향제, 계면활성제, 물, 이온형 또는 비이온형 유화제, 충전제, 금속이온봉쇄제 및 킬레이트화제, 보존제, 비타민, 차단제, 습윤화제, 필수 오일,염료, 안료, 친수성 또는 친유성 활성제, 지질 소낭 또는 화장품에 통상적으로 사용되는 임의의 다른 성분과 같은 화장품학 또는 피부과학 분야에서 통상적으로 사용되는 보조제를 함유할 수 있다. 그리고, 상기의 성분들은 피부과학 분야에서 일반적으로 사용되는 양으로 도입될 수 있다.In addition, the composition for external application for skin of the present invention may further include fatty substances, organic solvents, solubilizers, thickeners and gelling agents, emollients, antioxidants, suspending agents, stabilizers, foaming agents, fragrances, surfactants, water, and ions. Mold or nonionic emulsifiers, fillers, metal ion blockers and chelating agents, preservatives, vitamins, blockers, wetting agents, essential oils, dyes, pigments, hydrophilic or lipophilic actives, lipid vesicles or any commonly used in cosmetics It may contain adjuvants commonly used in cosmetic or dermatological fields such as other ingredients. In addition, the above ingredients may be introduced in an amount generally used in the field of dermatology.
이러한, 본 발명에 따른 피부 외용제 조성물은 피부 노화 방지, 피부 재생, 상처치유 등 항노화 기능을 할 수 있는 기능성 화장품의 형태를 포함한다.The composition for external application for skin according to the present invention includes a form of functional cosmetics capable of anti-aging functions such as skin aging prevention, skin regeneration, and wound healing.
본 발명에 있어서, 약제학적 조성물의 경우, 하기 실시예에서 제시하는 상처(창상) 치유를 위한 약제학적 조성물로써 기능할 수 있다. In the present invention, in the case of a pharmaceutical composition, it can function as a pharmaceutical composition for wound (wound) healing presented in the following Examples.
이러한 약제학적 조성물은 유효성분인 세포 투과형 성장인자 외에, "약학적으로 허용 가능한 담체"를 포함할 수 있으며, 이러한 담체는 희석제, 활택제, 결합제, 붕해제, 감미제, 안정제 및 방부제로 이루어진 군으로부터 선택될 수 있다. 상기 약학 조성물은 첨가제를 더 포함할 수 있다. 상기 첨가제로 향료, 비타민, 및 항산화제가 포함될 수 있다. 상기 담체로 약제학적으로 허용 가능한 담체는 모두 가능하며, 예를 들면, 희석제로는 유당, 덱스트린, 타피오카(tapioca) 녹말, 옥수수 전분, 대두유, 미정질 셀룰로오스, 또는 만니톨, 활택제로는 스테아린산 마그네슘 또는 탈크, 결합제로는 폴리비닐피롤리돈 또는 히드록시프로필셀룰로오스일 수 있다. 또한, 붕해제로는 카르복시메틸셀룰로오스 칼슘, 전분글리콜산나트륨, 폴라크릴린칼륨, 또는 크로스포비돈, 감미제로는 백당, 과당, 솔비톨, 또는 아스파탐, 안정제로는 카르복시메틸셀룰로오스나트륨, 베타-사이클로덱스트린, 또는 잔탄검, 방부제로는 파라옥시안식향산메틸, 파라옥시안식향산프로필, 또는 솔빈산칼륨일 수 있다.In addition to the cell-permeable growth factor, which is an active ingredient, the pharmaceutical composition may include a "pharmaceutically acceptable carrier", and the carrier may be selected from the group consisting of diluents, lubricants, binders, disintegrants, sweeteners, stabilizers and preservatives. Can be selected. The pharmaceutical composition may further include an additive. Flavors, vitamins, and antioxidants may be included as the additive. Any carrier that is pharmaceutically acceptable as the carrier is possible, for example, as a diluent, lactose, dextrin, tapioca starch, corn starch, soybean oil, microcrystalline cellulose, or mannitol, magnesium stearate or talc as a lubricant , The binder may be polyvinylpyrrolidone or hydroxypropyl cellulose. In addition, as the disintegrant, carboxymethylcellulose calcium, sodium starch glycolate, potassium polyacrylin, or crospovidone, as a sweetener, saccharides, fructose, sorbitol, or aspartame, as stabilizers, carboxymethylcellulose sodium, beta-cyclodextrin, Alternatively, the xanthan gum or preservative may be methyl paraoxybenzoate, propyl paraoxybenzoate, or potassium sorbate.
상기 약제학적 조성물은 당해 기술분야에 공지되어 있는 통상적인 약제학적 제형으로 제제화될 수 있다. 상기 약제학적 조성물은 경구 투여제제, 주사제, 좌제, 경피 투여제제, 및 경비 투여제제의 제형으로 제제화되어 투여될 수 있다. 예를 들면, 상기 제형은 액제, 현탁제, 산제, 과립제, 정제, 캡슐제, 환제, 또는 엑스제와 같은 경구 투여용 제형일 수 있다. The pharmaceutical composition can be formulated into conventional pharmaceutical formulations known in the art. The pharmaceutical composition may be formulated and administered in the form of oral dosage forms, injections, suppositories, transdermal dosage forms, and nasal dosage forms. For example, the formulation may be a formulation for oral administration such as liquid, suspension, powder, granule, tablet, capsule, pill, or ex.
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 예시하기 위한 것으로, 본 발명의 범위가 이들 실시예에 의해 제한되는 것으로 해석되지 않는 것은 당업계에서 통상의 지식을 가진 자에게 있어서 자명할 것이다. Hereinafter, the present invention will be described in more detail through examples. These examples are only for illustrating the present invention, it will be apparent to those skilled in the art that the scope of the present invention is not to be construed as limited by these examples.
본 발명에 따른 세포 투과형 융합 단백질을 포함하는 피부 외용제 조성물은 피부 세포에 독성이 없으면서도 상기 단백질에 함유된 바이오 활성소재의 세포 투과능이 우수하여 피부 개선(회복), 항노화 또는 상처 치유에 특히 효과적으로 사용될 수 있다. The composition for external application for skin comprising a cell-permeable fusion protein according to the present invention is particularly effective in skin improvement (recovery), anti-aging or wound healing by being excellent in cell permeability of the bio-active material contained in the protein without being toxic to skin cells Can be used.
또한, 본 발명에 따른 상기 세포 투과형 융합 단백질은 1,2-헥산디올(Hexanediol)을 추가로 더 포함함으로써, 콜라겐 생성 촉진에 현저한 시너지 효과를 발휘하여 항 노화 또는 상처 치유에 더욱 효과적으로 사용될 수 있다. In addition, the cell-permeable fusion protein according to the present invention further comprises 1,2-hexanediol (Hexanediol), thereby exhibiting a remarkable synergistic effect in promoting collagen production, and thus can be more effectively used for anti-aging or wound healing.
도 1은 LMWP-VEGF을 제조하여 SDS-PAGE 정제한 결과이다. 도 1-(A)은 affinity chromatography를 활용하여 LMWP-VEGF를 제조한 SDS-PAGF 정제 결과이다(Lane 1: LMWP-VEGF 발현클론의 세포파쇄와 원심분리 후 상등액(전체 단백질), Lane 2: Affinity chromatography에 결합하지 않은 발현클론의 오염 단백질, Lane 3: 60mM imidazole을 함유하는 washing buffer로 세척된 단백질, Lane 4: 100mM imidazole을 함유하는 elution buffer 1로 용출된 단백질, Lane 5: 200mM imidazole을 함유하는 elution buffer 2로 용출된 단백질).
도 1-(B)는 표준생산공정을 통해 생산된 LMWP-VEGF의 SDS-PAGE 정제 결과이다.
도 2는 LMWP-VEGF의 인간피부구성세포에 대한 세포독성 실험(MTT assay) 결과이다. (A) 인간각질형성세포(HaCaT cell)에 대한 LMWP-VEGF의 MTT assay 결과이며, (B)는 인간피부섬유아세포(CCD 986sk cell)에 대한 LMWP-VEGF의 MTT assay 결과이다.
도 3은 LMWP-VEGF의 농도별 혈관내피세포의 세포 증식 생물학적 활성도에 대한 결과이다.
도 4는 LMWP-VEGF의 농도별 인간피부세포(CCD 986-sk cell)의 세포 생존율 결과이다.
도 5는 LMWP-VEGF의 인간피부세포 투과도 평가 결과이다(scale bar=20,000nm).
도 6은 LMWP-VEGF의 인공피부막(Skin PAMPA) 투과도 평가 결과이다.
도 7은 LMWP-VEGF의 인간피부세포 증식 활성에 의한 피부재생 효능을 실험한 결과이다.
도 8은 1 ng/mL의 LMWP-VEGF 처리 후, 마우스 피부섬유아세포(NIH 3T3T cell) 증식 활성에 의한 상처 회복율을 실험한 결과이다(A: 상처회복률, B: 상처회복 이미지(검은색영역: NIH 3T3T cell monolayer, 회색영역: scratch 상처영역)).
도 9는 50 ng/mL의 LMWP-VEGF 처리 후, 인간피부섬유아세포(CCD-986sk cell) 증식 활성에 의한 상처 회복율을 실험한 결과이다(A: 상처회복률, B: 상처회복 이미지(검은색영역: NIH 3T3T cell monolayer, 회색영역: scratch 상처영역)).
도 10은 LMWP-VEGF의 콜라겐 생성 촉진 효과 평가 결과이다. 1은 아무것도 처리하지 않은 음성 대조군에 해당하고, 2는 LMWP-VEGF을 10ppm 농도로 단독하여 처리한 군, 3은 LMWP-VEGF 10ppm 및 0.1%의 1,2-Hexanediol 병용 처리군, 및 4는 LMWP-VEGF 10ppm 및 2.5% 1,2-Hexanediol 병용 처리군에 해당한다.
도 11은 도 10에서 나타낸 LMWP-VEGF의 콜라겐 생성 촉진 효과 평가 결과의 수치값을 그래프로 나타낸 것이다.1 shows the results of SDS-PAGE purification by preparing LMWP-VEGF. 1- (A) shows the results of SDS-PAGF purification by manufacturing LMWP-VEGF using affinity chromatography (Lane 1: supernatant (whole protein) after cell disruption and centrifugation of LMWP-VEGF expression clone, Lane 2: Affinity) Contamination protein of expression clone not bound to chromatography, protein washed with washing buffer containing Lane 3: 60 mM imidazole, protein eluted with
1- (B) shows the results of SDS-PAGE purification of LMWP-VEGF produced through a standard production process.
2 is a result of cytotoxicity test (MTT assay) for human skin cells of LMWP-VEGF. (A) MTT assay result of LMWP-VEGF for human keratinocytes (HaCaT cell), (B) is MTT assay result of LMWP-VEGF for human skin fibroblasts (CCD 986sk cell).
3 is a result of the cell proliferation biological activity of vascular endothelial cells by concentration of LMWP-VEGF.
4 is a result of cell viability of human skin cells (CCD 986-sk cell) by concentration of LMWP-VEGF.
5 is a result of evaluating the permeability of human skin cells of LMWP-VEGF (scale bar = 20,000nm).
6 is a result of evaluating the permeability of LMWP-VEGF artificial skin membrane (Skin PAMPA).
7 is a result of testing the skin regeneration efficacy of LMWP-VEGF by human skin cell proliferative activity.
8 is a result of experimenting the wound recovery rate by proliferation activity of mouse skin fibroblasts (NIH 3T3T cell) after LMWP-VEGF treatment of 1 ng / mL (A: wound recovery rate, B: wound recovery image (black area: NIH 3T3T cell monolayer, gray area: scratch area)).
9 is a result of testing the wound recovery rate by proliferation activity of human skin fibroblasts (CCD-986sk cell) after treatment of LMWP-VEGF at 50 ng / mL (A: wound recovery rate, B: wound recovery image (black area) : NIH 3T3T cell monolayer, gray area: scratch area)).
10 is a result of evaluation of the effect of promoting the production of collagen LMWP-VEGF. 1 corresponds to a negative control with no treatment, 2 is a group treated with LMWP-VEGF alone at a concentration of 10 ppm, 3 is a group treated with 10 ppm of LMWP-VEGF and 0.1% 1,2-Hexanediol, and 4 is LMWP -Corresponds to VEGF 10ppm and 2.5% 1,2-Hexanediol combination treatment group.
FIG. 11 is a graph showing the numerical value of the result of evaluation of the effect of promoting LMWP-VEGF collagen production shown in FIG. 10.
실시예Example
실시예 1. 세포 투과형 혈관내피성장인자(LMWP-VEGF) 융합 단백질의 제조Example 1. Preparation of cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein
(1) cDNA 및 발현벡터 제조(1) cDNA and expression vector preparation
저분자 프로타민 융합을 통해 원형의 혈관내피세포성장인자(VEGF)를 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질로 제조하였다. 저분자 프로타민을 암호화하는 유전자(표 1의 서열번호1)를 혈관내피세포성장인자(VEGF) cDNA의 N-말단부에 융합하고 발현벡터로의 클로닝을 위하여 제한효소 NdeI와 XhoI의 제한부위(restriction sites)를 양 말단에 갖는 세포 투과형 혈관내피세포성장인자(LMWP-VEGF)의 cDNA를 확보하였다(표 1의 서열번호2). 이렇게 수득된 삽입 cDNA(insert cDNA)를 발현 벡터에 삽입하였다. 대장균(E.coli) 발현 벡터인 pBF-01(+)를 NdeI와 XhoI으로 이중 절단(double digestion) 처리하여 클로닝 부위를 개방하고, NdeI와 XhoI이 이중 절단한 후 삽입 cDNA(insert cDNA)를 정제하여 발현벡터와 목적 단백질의 삽입 cDNA(insert cDNA)를 라이게이션(ligation)하여 융합하였다. 이렇게 제조된 발현 벡터 pBF-01(+)-LMWP-VEGF 유전자 수준에서 융합한 후, 외래 재조합단백질의 발현에 사용하는 BL21계열의 대장균에 형질 전환하여 발현 클론을 제조하였다. 하기 표 1은 세포 투과형 펩타이드(LMWP)와 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 아미노산 조성을 나타낸 것이다.A circular vascular endothelial growth factor (VEGF) was prepared as a cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein through low molecular protamine fusion. A gene encoding low molecular protamine (SEQ ID NO: 1 in Table 1) is fused to the N-terminal end of vascular endothelial growth factor (VEGF) cDNA and restriction sites of restriction enzymes NdeI and XhoI for cloning into an expression vector. CDNA of the cell-permeable vascular endothelial growth factor (LMWP-VEGF) having both ends was obtained (SEQ ID NO: 2 in Table 1). The inserted cDNA thus obtained was inserted into the expression vector. E. coli expression vector pBF-01 (+) was double digested with NdeI and XhoI to open the cloning site, and NdeI and XhoI were double-divided and purified inserted cDNA (insert cDNA) Then, the expression vector and the target protein's insertion cDNA (insert cDNA) were ligated and fused. After fusion at the expression vector pBF-01 (+)-LMWP-VEGF gene level thus prepared, an expression clone was prepared by transforming into BL21-type E. coli used for expression of a foreign recombinant protein. Table 1 below shows the amino acid composition of a cell permeable peptide (LMWP) and a cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein.
서열번호 2
SEQ ID NO: 2
(2) 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 발현, 및 정제(2) Expression and purification of cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein
상기에서 제조한 발현 벡터, pBF-01(+)-LMWP-VEGF를 재조합 단백질 발현용 E.coli 균주로 형질 전환시킴으로써 발현 균주를 구축하였다. 이렇게 확보된 발현 균주를 발현용 글리세롤 스톡(glycerol stock)을 이용하여 다음과 같이 발현 및 정제하였다. 발현용 글리세롤 스톡을 L-broth(LB) 배양액에 1/200 비율로 접종하여 37℃, 150rpm 조건에서 광학 밀도(O.D)가 약 0.8에 도달할 때까지 배양하였다. 배양의 광학 밀도가 0.8에 도달하면 본 배양은 발현용 글리세롤 스톡을 L-broth(LB) 배양액에 1/100 비율로 접종하여 37℃, 100rpm 조건에서 광학 밀도가 0.6 내지 0.8 가 될 때까지 배양하였다. 발현을 위해 이소프로필-β-D-티오갈락토피라노사이드(Isopropyl-β-D-thiogalactopyranoside, IPTG)를 배양액 내 최종 농도가 0.5mM으로 처리하여 목적 단백질을 유도(induction)한 후, 25℃, 100rpm 조건에서 하루 동안 배양하였다. 다음날 원심 분리(6,000rpm, 4℃, 10분)하여 배양 균체를 획득하고, 획득한 균체 펠렛 1g 당 용균 버퍼(Lysis buffer, sodium phosphate buffer, pH7.8, 10mM NaCl, 5mM imidazole) 20ml씩 첨가하여 현탁 하였다. 완전히 현탁되면 초음파 처리(sonication)을 통해 균체를 파쇄하였다(10분간 sonication 10초/holding 10초 반복, Amplitude 50%, 4℃). 파쇄된 균체액은 원심 분리(12,000rpm, 4℃, 10분)하여 비 파쇄 균체 및 불용성 분획을 제거하고 상등액만 취한 후, 0.45㎛ 실린지(syringe)로 여과하였다. 여과한 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질을 함유하는 원심 분리 상등액을 동일한 용균 버퍼(Lysis buffer, sodium phosphate buffer, pH 7.8, 10mM NaCl, 5mM imidazole)로 미리 평형화 시킨 affinity column에 30분간 회전시켜 레진 결합을 유도한 후, 결합되지 않은 오염 단백질들은 용출로 제거하였다. 세척 버퍼1(washing buffer 1, sodium phosphate buffer, pH7.5, 10mM NaCl, 60mM imidazole)로 30분씩 1회, 다시 용출 버퍼 1(Elution buffer 1, sodium phosphate buffer, pH7.5, 10mM NaCl, 100mM imidazole)로 30분간 1회 컬럼을 씻어주고 용출 버퍼 2(Elution buffer 2, sodium phosphate buffer, pH7.5, 10mM NaCl, 200mM imidazole)로 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질을 컬럼으로부터 용출시킨 뒤 초미세 여과(Ultra-filtration)(Amicon, cutting membrane 3000Da)로 용적 대비 20배 농축하였다. 농축된 용액을 겔 여과(gel filtration)(Sephadez G-100, Buffer GF(20mM sodium phosphate buffer, pH7.5, NaCl 500mM))을 이용하여 목적단백질인 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질 분획만을 회수하였다. 회수된 분획은 Affinity chromatograpy에서 분리된 목적단백질 LMWP-VEGF을 cutting kDa이 20kDa인 초미세 여과를 통해 오염 단백질을 추가 정제한 후, 200배 분량의 NaCl이 포함되지 않은 버퍼로 dialysis를 수행하였다. 15% SDS-PAGE 정제도는 200mM imidazole을 함유하는 용출버퍼(elution buffer)의 용출(elution) 분획에서 가장 효과적으로 분리되었으며, 약 90 내지 93%의 정제도를 확보하였다(도 1-(A), lane5). 상기 방법으로 수득된 126개 아미노산으로 구성된 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질은 SDS-PAGE 분석결과 약 15Dka의 크기로 확인되어 목적단백질이 발현 및 정제되었음을 확인하였다. SDS-PAGE 분석결과는 도 1-(A)에 나타내었다. An expression strain was constructed by transforming the expression vector, pBF-01 (+)-LMWP-VEGF prepared above, into an E.coli strain for recombinant protein expression. The thus obtained expression strain was expressed and purified as follows using glycerol stock for expression. The expression glycerol stock was inoculated into the L-broth (LB) culture solution at a ratio of 1/200, and cultured at 37 ° C and 150 rpm until the optical density (O.D) reached about 0.8. When the optical density of the culture reached 0.8, this culture was inoculated with the glycerol stock for expression at a ratio of 1/100 into the L-broth (LB) culture medium and cultured until the optical density reached 0.6 to 0.8 at 37 ° C and 100 rpm. . Isopropyl-β-D-thiogalactopyranoside (IPTG) for expression was treated with a final concentration of 0.5 mM in the culture medium to induce the target protein, followed by 25 ° C. , Cultured at 100 rpm for one day. Next day centrifugation (6,000rpm, 4 ℃, 10 minutes) to obtain cultured cells, and 20 ml of lysis buffer (Lysis buffer, sodium phosphate buffer, pH7.8, 10mM NaCl, 5mM imidazole) per 1 g of the obtained cell pellet is added. Suspended. When completely suspended, the cells were crushed through sonication (10 minutes sonication 10 seconds / holding 10 seconds repeated,
또한, 반복적인 정제를 통해 수립한 표준생산공정을 통해서도 일정한 순도의 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질이 높은 순도로 발현 정제됨을 확인하였다(도1-(B)). In addition, it was confirmed through a standard production process established through repeated purification that the cell-purifying vascular endothelial cell growth factor (LMWP-VEGF) fusion protein of constant purity was expressed and purified with high purity (FIG. 1- (B)).
표준생산공정은 정제 전 샘플처리 프로토콜과 affinity chromatography를 기본으로 한 정제 프로토콜, 및 컬럼으로 용출(elution)된 샘플분획의 dialysis와 초미세 여과 등의 후처리 공정으로 구성되었다.The standard production process consisted of a pre-purification sample processing protocol, an affinity chromatography-based purification protocol, and a post-treatment process such as dialysis of column elution and ultrafine filtration.
실시예 2. 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 in vitro 인간피부구성세포 안전성(safety) 평가(MMT assay)Example 2. Evaluation of cell permeable vascular endothelial cell growth factor (LMWP-VEGF) fusion protein in vitro human skin cell safety (MMT assay)
실시예 1에서 제조된 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 인간 피부 안전성에 대한 평가를 위하여 인간 피부구성세포들을 이용하여 세포 안전성(safety) 시험을 수행하였다. 인간 피부구성세포로는 인간각질형성세포(keratinocyte)의 세포주인 HaCaT cell과 인간섬유아세포(fibroblast)의 세포주인 CCD-986sk cell을 이용하였다. In order to evaluate the human skin safety of the cell permeable vascular endothelial cell growth factor (LMWP-VEGF) fusion protein prepared in Example 1, a cell safety test was performed using human skin cells. As human skin cells, HaCaT cell, a cell line of human keratinocytes, and CCD-986sk cell, a cell line of human fibroblasts, were used.
HaCaT cell과 CCD-986sk cell을 24well plate에 5 x 103 cells/well과 5 x 104 cells/well씩 동일하게 heamacytometer를 이용하여 계수한 후 분주하여 배양하였다. 10% FBS를 함유하는 DMEM에서 48시간 배양하여 배양용기 표면적의 ~50%만큼 배양되면, 실시예 1에서 제조된 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질을 배지 내 최종농도가 0.1ppm~10.0ppm의 농도가 되도록 처리하여 48시간 더 배양하였다. 배양 후, 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyl tetrazolium bromide(MTT, Sigma M5655, USA) 용액(2.5 mg/mL)을 50㎕ 첨가하고 3시간 추가로 배양하였다 그 후, 세포 배양액을 전부 버리고, 200㎕의 dimethyl sulfoxide (DMSO, Sigma D2650, USA)를 각 well 당 200μL 처리하여 교반한 후, 100 ㎕ 씩을 96 well로 취하여 Enzyme-Linked Immunosorbent Assay(ELISA)로 570 nm에서 흡광도를 측정하였다. 세포에 대한 독성 혹은 증식을 촉진하는 정도는 순수한 물을 사용한 대조군의 흡광 강도를 기준으로 백분율로 표시하였다.HaCaT cells and CCD-986sk cells were counted using a heamacytometer in the same manner at 5 x 10 3 cells / well and 5 x 10 4 cells / well in 24 well plates, and cultured by dispensing. When cultured for 48 hours in DMEM containing 10% FBS and cultured for ~ 50% of the surface area of the culture vessel, the final concentration in the cell permeable vascular endothelial cell growth factor (LMWP-VEGF) fusion protein prepared in Example 1 was 0.1. Treatment was performed to a concentration of ppm to 10.0 ppm and further cultured for 48 hours. After the culture, 50 µl of a solution of 3- (4,5-dimethylthiazol-2-yl) -2,5-diphenyl tetrazolium bromide (MTT, Sigma M5655, USA) (2.5 mg / mL) was added and incubated for an additional 3 hours. After that, the cell culture solution was completely discarded, 200 μl of dimethyl sulfoxide (DMSO, Sigma D2650, USA) was treated and stirred for 200 μL per well, and 100 μl of each was taken as 96 wells and 570 with Enzyme-Linked Immunosorbent Assay (ELISA). Absorbance was measured at nm. The degree of promoting toxicity or proliferation to cells was expressed as a percentage based on the absorbance intensity of the control group using pure water.
그 결과, 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질은 0.1 ppm 내지 10.0 ppm의 농도에서는 세포 독성이 전혀 관찰되지 않았으며, 처리 농도가 증가할수록 농도에 의존되어 세포 생육이 증대되는 결과를 확인하였다(도 2). As a result, the cell permeable vascular endothelial cell growth factor (LMWP-VEGF) fusion protein was not observed to have any cytotoxicity at a concentration of 0.1 ppm to 10.0 ppm, and the cell growth was increased depending on the concentration as the treatment concentration increased. It was confirmed (Fig. 2).
실시예 3. 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 생물학적 활성 평가: 혈관내피세포(endothelial cell) 증식 활성도Example 3. Evaluation of biological activity of cell permeable vascular endothelial cell growth factor (LMWP-VEGF) fusion protein: endothelial cell proliferation activity
혈관내피세포(endothelial cell) 배양 시 실시예 1에서 제조한 세포 투과형 혈관내피세포(LMWP-VEGF) 융합 단백질 및 일반 혈관내피세포성장인자(VEGF)를 농도별로 처리하여 혈관내피세포 증식 정도를 평가함으로써 실시예 1에서 제조한 세포 투과형 혈관내피세포(LMWP-VEGF) 융합 단백질의 생물학적 활성을 비교 및 평가하였다.In endothelial cell culture, the cell permeable vascular endothelial cell (LMWP-VEGF) fusion protein prepared in Example 1 and general vascular endothelial cell growth factor (VEGF) were treated by concentration to evaluate the degree of vascular endothelial cell proliferation. The biological activity of the cell-permeable vascular endothelial cell (LMWP-VEGF) fusion protein prepared in Example 1 was compared and evaluated.
혈관내피세포 (endothelial cell)를 96 well plate에 5x103 cell/well씩 분주하여 10% FBS/DMEM 배지로 24시간 배양한 후 배양액을 제거하고 0.05% FBS가 포함된 DMEM 배양액에서 다시 24시간 배양하였다. 이후, 0.5% FBS가 포함된 DMEM 배지로 단계적으로 희석한 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질 및 일반 혈관내피세포성장인자(VEGF)를 각 well에 100 ㎕씩 가한 후 다시 24시간 동안 CO2 incubator에서 배양하였다. 이후, 5 mg/mL 농도의 WST-1(Roche Diagnostics) 용액을 각 well에 10 ㎕씩 처리한 후 37℃에서 4시간 동안 반응시킨 뒤 450nm에서 흡광도 측정하여 아무것도 처리하지 않은 음성 대조군 대비 혈관내피세포의 증식 정도를 평가하였다. 피부세포 증식 활성에 대한 양성 대조군으로는 유전자 재조합 인간 혈관내피세포성장인자(VEGF-AA)를 사용하였다.The endothelial cells were divided into 96 well plates at 5x10 3 cells / well, and incubated with 10% FBS / DMEM medium for 24 hours, the culture was removed, and cultured again in DMEM culture containing 0.05% FBS for 24 hours. . Subsequently, 100 μl of cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein and normal vascular endothelial cell growth factor (VEGF) diluted stepwise with DMEM medium containing 0.5% FBS was added to each well, followed by 24 again. Incubated for 2 hours in a CO 2 incubator. Subsequently, 10 μl of each WST-1 (Roche Diagnostics) solution at a concentration of 5 mg / mL was treated at 37 ° C. for 4 hours, and then absorbance was measured at 450 nm to measure vascular endothelial cells compared to the negative control that did not process anything. The proliferation degree of was evaluated. Genetic recombinant human vascular endothelial cell growth factor (VEGF-AA) was used as a positive control for skin cell proliferation activity.
그 결과, 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질은 50 ng/mL 농도에서 상기 음성 대조군 대비 최대 활성을 나타냈으며 혈관내피세포의 증식이 155% 증가하였다(***p < 0.001, 무처치 음성대조군 대비) (도 3).As a result, the cell-permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein showed the maximum activity compared to the negative control at a concentration of 50 ng / mL, and the proliferation of vascular endothelial cells increased by 155% (*** p <0.001 , Compared to the untreated voice control group (Fig. 3).
모든 농도에서 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질은 일반 혈관내피세포성장인자(VEGF) 대비 동등한 혈관내피세포 증식 생리학적 활성을 나타냈다. 이는 세포 투과형 아미노산 서열인 저분자량 프로타민(LMWP)을 기존 성장인자 말단에 연결해도 기존 성장인자의 생물학적 활성이 유지됨을 의미한다(도 3).At all concentrations, the cell-permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein exhibited equivalent vascular endothelial cell proliferation physiological activity compared to normal vascular endothelial growth factor (VEGF). This means that even if the low molecular weight protamine (LMWP), which is a cell-permeable amino acid sequence, is connected to the end of the existing growth factor, the biological activity of the existing growth factor is maintained (FIG. 3).
실시예 4. 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 인간피부세포 안전성(독성) 평가Example 4. Evaluation of human skin cell safety (toxicity) of cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein
인간섬유아세포 (CCD986-sk cell) 배양 시 실시예 1에서 제조된 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질과 일반 혈관내피세포성장인자(VEGF)를 농도별로 처리하여 인간섬유아세포의 사멸 정도를 평가함으로써 실시예 1에서 제조된 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 피부세포 안전성을 비교, 평가하였다. 피부세포 증식 활성에 대한 양성 대조군으로 유전자 재조합 인간 형질전환성장인자(recombinant human transforming growth factor-beta, rhTGF-β)를 사용하였다. 인간섬유아세포(human fibroblast cell, CCD-986sk cell)를 96 well plate에 5x103 cell/well씩 분주하여 10% FBS/DMEM 배지로 24시간 배양한 후 DMEM 배지로 단계적으로 희석한 인간 형질전환성장인자(rhTGF-β), 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질 및 일반 혈관내피세포성장인자(VEGF)를 각 well에 100㎕씩 가한 후 다시 24시간 동안 CO2 incubator에서 배양하였다. WST-8[2-(2-methoxy-4-nitrophenyl)-3-(4-nitrophenyl)-5-(2,4-disulfophenyl)- 2H-tetrazolium monosodium salt] 용액을 각 well에 10 ㎕씩 처리한 후 37℃에서 2시간 동안 반응시킨 뒤 450 nm에서 흡광도 측정하여 무처치 음성 대조군 대비 인간피부섬유아세포의 세포 사멸 정도를 평가하였다.When culturing human fibroblasts (CCD986-sk cell), the cell-permeable vascular endothelial cell growth factor (LMWP-VEGF) fusion protein prepared in Example 1 and the general vascular endothelial cell growth factor (VEGF) were treated according to concentrations. By evaluating the degree of death, the skin cell safety of the cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein prepared in Example 1 was compared and evaluated. Recombinant human transforming growth factor-beta (rhTGF-β) was used as a positive control for skin cell proliferative activity. Human fibroblast cells (CCD-986sk cells) were divided into 5 wells of 3 cells / well in 96 well plates, cultured for 24 hours with 10% FBS / DMEM medium, and then human transformed growth factor diluted stepwise with DMEM medium. (rhTGF-β), cell permeable vascular endothelial cell growth factor (LMWP-VEGF) fusion protein and normal vascular endothelial cell growth factor (VEGF) were added to each well by 100 µl and incubated in CO2 incubator for 24 hours. WST-8 [2- (2-methoxy-4-nitrophenyl) -3- (4-nitrophenyl) -5- (2,4-disulfophenyl) -2H-tetrazolium monosodium salt] solution was treated with 10 μl of each well After reacting at 37 ° C for 2 hours, absorbance was measured at 450 nm to evaluate the degree of cell death of human skin fibroblasts compared to the untreated negative control group.
그 결과, 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질은 모든 농도범위에서 무처치 음성대조군 대비 100% 이상의 세포 생존율을 나타냈으며 오히려 1,000 ng/mL 농도에서는 무처치 음성 대조군 대비 인간피부섬유아세포 증식이 최대 124% 증가하였다(***p < 0.001, 무처치 음성대조군 대비) (도 4).As a result, the cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein showed a cell survival rate of 100% or more compared to the untreated negative control group in all concentration ranges, but rather, human skin fibers compared to the untreated negative control group at the concentration of 1,000 ng / mL. Subcellular proliferation increased up to 124% (*** p <0.001, compared to the untreated negative control) (FIG. 4).
또한, 모든 농도에서 세포 투과형 혈관내피세포장인자(LMWP-VEGF) 융합 단백질은 일반 혈관내피세포성인자(VEGF) 및 형질전환성장인자(rhTGF-β)와 마찬가지로 피부세포에 대한 독성을 나타내지 않았다. 이는 세포 투과형 아미노산 서열인 저분자량 프로타민(LMWP)을 기존 성장인자 말단에 연결해도 추가적인 피부세포독성을 유발하지 않음을 의미한다(도 4).In addition, at all concentrations, the cell-permeable vascular endothelial cell factor (LMWP-VEGF) fusion protein did not show toxicity to skin cells, like normal vascular endothelial factor (VEGF) and transformed growth factor (rhTGF-β). This means that even if the low molecular weight protamine (LMWP), which is a cell-permeable amino acid sequence, is connected to the end of the existing growth factor, it does not cause additional skin cytotoxicity (FIG. 4).
실시예 5. 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 피부세포 투과도 증진 평가: 피부세포 투과 증진 이미지Example 5. Evaluation of skin cell permeability enhancement of cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein: skin cell permeation enhancement image
인간섬유아세포 (CCD986-sk cell)를 이용하여 실시예 1로 제조된 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 피부구성 세포의 세포막 투과도를 평가하였다.The cell membrane permeability of the skin-forming cells of the cell-permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein prepared in Example 1 was evaluated using human fibroblasts (CCD986-sk cell).
Cell Tak sodlution으로 20분 동안 코팅한 10mm coverslip에 인간섬유아세포(human fibroblast cell, CCD-986sk cell)를 각 coverslip에 5x103 cell씩 분주하여 10% FBS/DMEM 배지로 48시간 배양하였다. Alexa 647(형광물질)로 표지한 혈관내피세포성장인자(VEGF-A), 세포 투과형 혈관내피세포성장인자(LMWP-VEGF-A) 융합 단백질을 DMEM 배지로 희석한 후 각 coverslip에 도포하고 6시간 동안 CO2 incubator에서 추가 배양하였다. 이후 각 coverslip을 인산염완충액(pH7.4)으로 세척한 후 4% paraformaldehyde 용액으로 5분간 상온에서 고정하였다. 각 coverslip을 인산염완충액(pH7.4)으로 2회 세척한 후, 1㎍/mL 4'6-diamido-2-phenylindole(DAPI; Roche, Basel, Switzerland)로 상온에서 5분간 세포핵을 염색하였다. 형광물질로 표지된 각 성장인자의 섬유아세포 세포막 투과 정도를 형광현미경(Carl Zeiss MicroImaging GmbH, 07740 Jena, Germany)으로 측정하였다.Human fibroblast cells (CCD-986sk cells) were dispensed on each coverslip by 5x10 3 cells on 10 mm coverslip coated with Cell Tak sodlution for 20 minutes, and cultured with 10% FBS / DMEM medium for 48 hours. After diluting the vascular endothelial cell growth factor (VEGF-A) and cell permeable vascular endothelial cell growth factor (LMWP-VEGF-A) fusion proteins labeled with Alexa 647 (fluorescent material) with DMEM medium, apply to each coverslip for 6 hours. While incubating in a CO 2 incubator. Then, each coverslip was washed with a phosphate buffer solution (pH7.4) and then fixed at room temperature for 5 minutes with a 4% paraformaldehyde solution. After washing each coverslip twice with phosphate buffer (pH7.4), cell nuclei were stained for 5 minutes at room temperature with 1 μg /
상기 형광 이미지를 측정한 결과, 혈관내피세포성장인자(VEGF-A)는 세포질 내에서 거의 측정되지 않은 반면, 세포 투과형 혈관내피세포성장인자(LMWP-VEGF-A) 융합 단백질의 경우 세포질 내에서 무처치 음성 대조군 대비 높은 형광 강도를 나타냈다(도 5).As a result of measuring the fluorescence image, the vascular endothelial cell growth factor (VEGF-A) was rarely measured in the cytoplasm, whereas the cell permeable vascular endothelial cell growth factor (LMWP-VEGF-A) fusion protein was not found in the cytoplasm. It showed higher fluorescence intensity compared to the treatment negative control (FIG. 5).
따라서, 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질은 세포 투과형 아미노산 서열인 저분자량 프로타민(LMWP)이 기존 성장인자 N-말단에 추가로 결합되어 매우 우수한 피부세포 투과도를 나타냄을 알 수 있다(도 5).Therefore, the cell permeable vascular endothelial cell growth factor (LMWP-VEGF) fusion protein shows that the cell permeable amino acid sequence, low molecular weight protamine (LMWP), is additionally bound to the existing growth factor N-terminus and shows very good skin cell permeability. Yes (Figure 5).
실시예 6. 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 피부 투과능 증진 평가: 인공피부막(Skin PAMPA) 투과도 평가Example 6. Evaluation of skin permeability enhancement of cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein: evaluation of permeability of artificial skin membrane (Skin PAMPA)
Skin PAMPA Explorer Test System(Pion Inc., Billerica, MA, USA) 이용하여 인공피부막을 통한 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 피부 투과능 정도를 평가하였다.Skin PAMPA Explorer Test System (Pion Inc., Billerica, MA, USA) was used to evaluate the degree of skin permeability of the cell-permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein through artificial skin.
90Skin PAMPA system의 각 well의 top(acceptor) compartment를 200㎕의 hydration buffer solution (pH 7.4)으로 overnight hydration 시켰다. Top(donor) plate에 Prisma-HT buffer solution(pH 7.4)를 이용하여 1,000ng/mL 농도로 용해시킨 혈관내피세포성장인자(VEGF), 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질 용액을 각 well에 200㎕씩 도포하였다. 별도로 acceptor plate(bottom)의 각 well에 200㎕의 Prisma-HT buffer solution(pH 7.4)를 넣은 후 top(donor) plate를 결합하고 상온에서 방치하였다. 6, 12, 18 및 24시간째 PAMPA sandwich를 분리하고 donor와 acceptor의 용액을 취해 인공 피부막을 투과한 각 성장인자의 농도를 상기 설정한 HPLC 분석법을 이용하여 정량하고 인공 피부막을 투과한 각 성장인자의 투과도(permeability)를 계산하였다.The top (acceptor) compartment of each well of the 90Skin PAMPA system was hydrated overnight with 200 μl of hydration buffer solution (pH 7.4). Vascular endothelial growth factor (VEGF), cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein solution dissolved at a concentration of 1,000 ng / mL using Prisma-HT buffer solution (pH 7.4) on a top (donor) plate. Was applied to each well 200 µl. Separately, 200 μl of Prisma-HT buffer solution (pH 7.4) was added to each well of the acceptor plate (bottom), and then the top (donor) plate was combined and left at room temperature. After separating the PAMPA sandwich at 6, 12, 18 and 24 hours, taking a solution of donor and acceptor, quantifying the concentration of each growth factor that has penetrated the artificial skin membrane using the above-described HPLC analysis method and each growth factor that has penetrated the artificial skin membrane. The permeability of was calculated.
모든 시간에서 세포 투과형 혈관내피세포성장인자(LMWP-VEGF-A) 융합 단백질은 일반 혈관내피세포성장인자(VEGF-A) 대비 유의적으로 매우 높은 인공 피부막 투과도를 나타냈으며 24시간째 인공 피부막을 통과한 세포 투과형 혈관내피세포성장인자(LMWP-VEGF-A) 융합 단백질의 농도는 혈관내피세포성장인자(VEGF-A) 대비 299% 증가하였다(***p < 0.001, 혈관내피세포성장인자(VEGF-A) 대비) (도 6).At all times, the cell-permeable vascular endothelial cell growth factor (LMWP-VEGF-A) fusion protein exhibited significantly higher artificial dermal membrane permeability compared to normal vascular endothelial cell growth factor (VEGF-A), and the artificial dermal membrane was maintained for 24 hours. The concentration of the transmembrane vascular endothelial cell growth factor (LMWP-VEGF-A) fusion protein increased by 299% compared to the vascular endothelial cell growth factor (VEGF-A) ( *** p <0.001, vascular endothelial cell growth factor ( VEGF-A)) (Figure 6).
결과적으로 인공피부막을 통한 세포 투과형 혈관내피세포성장인자(LMWP-VEGF-A) 융합 단백질의 피부 투과도(permeability)는 혈관내피세포성장인자(VEGF-A) 대비 165% 증가하였다 (###p < 0.001, 혈관내피세포성장인자(VEGF) 대비) (도 6).As a result, the permeability of the cell permeable vascular endothelial cell growth factor (LMWP-VEGF-A) fusion protein through the artificial skin membrane increased by 165% compared to the vascular endothelial cell growth factor (VEGF-A) ( ### p < 0.001, compared to vascular endothelial growth factor (VEGF)) (Figure 6).
실시예 7. 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 안티-에이징 효능 평가: 섬유아세포 증식 활성에 의한 피부재생 효능Example 7. Evaluation of anti-aging efficacy of cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein: skin regeneration effect by fibroblast proliferation activity
인간섬유아세포 (CCD986-sk cell) 배양 시 실시예 1에서 제조된 세포 투과형 성장인자를 농도별로 처리하여 인간섬유아세포증식 정도를 평가함으로서 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 피부재생 활성을 평가하였다. 피부세포 증식 활성에 대한 양성 대조군으로 유전자 재조합 인간 형질전환성장인자(recombinant human Transforming growth factor-beta, rhTGF-β)를 사용하였다. 인간섬유아세포 (human fibroblast cell, CCD-986sk cell)를 96 well plate에 5x103 cell/well씩 분주하여 10% FBS/DMEM 배지로 24시간 배양한 후 배양액을 제거하고 0.05% FBS가 포함된 DMEM 배양액에서 다시 24시간 배양하였다. 이후 0.5% FBS가 포함된 DMEM 배지로 단계적으로 희석한 혈관내피세포성장인자(VEGF-A), 세포 투과형 혈관내피세포성장인자(LMWP-VEGF-A) 융합 단백질과 유전자 재조합 인간 형질전환성장인자 (recombinant human transforming growth factor-beta, rhTGF-β)를 각 well에 100㎕씩 가한 후 다시 24시간 동안 CO2 incubator에서 배양함하였다. 이후 5mg/mL 농도의 WST-1(Roche Diagnostics) 용액을 각 well에 10㎕씩 처리한 후 37℃에서 2시간 동안 반응시킨 뒤 450nm에서 흡광도 측정하고 무처치 음성 대조군 대비 피부섬유아세포의 증식 정도를 평가하였다. When culturing human fibroblasts (CCD986-sk cell), the cell permeable growth factor prepared in Example 1 was treated by concentration to evaluate the degree of human fibroblast proliferation, and thus the skin of the cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein. Regenerative activity was evaluated. Recombinant human transforming growth factor-beta (rhTGF-β) was used as a positive control for skin cell proliferative activity. After dispensing human fibroblast cells (CCD-986sk cells) into 96 well plates at 5x10 3 cells / well for 24 hours with 10% FBS / DMEM medium, remove the culture medium and remove DMEM culture medium containing 0.05% FBS Incubated again for 24 hours. Thereafter, vascular endothelial growth factor (VEGF-A), cell permeable vascular endothelial growth factor (LMWP-VEGF-A) fusion protein and genetically recombined human transgenic growth factor diluted stepwise with DMEM medium containing 0.5% FBS ( Recombinant human transforming growth factor-beta, rhTGF-β) was added to each well 100 μl, and then cultured in a CO 2 incubator for 24 hours. Then, after treating 10 μl of each WST-1 (Roche Diagnostics) solution at a concentration of 5 mg / mL for 2 hours at 37 ° C., absorbance was measured at 450 nm and the degree of proliferation of skin fibroblasts compared to the untreated negative control group. Was evaluated.
그 결과, 모든 시험농도범위에서 양성대조군인 형질전환성장인자(rhTGF-β)은 무처치 음성 대조군 대비 인간 피부 섬유아세포의 증식이 유의적으로 증가하였으며 (***p < 0.001, 무처치 음성대조군 대비) 세포 투과형 혈관내피세포성장인자(LMWP-VEGF-A) 융합 단백질 역시 모든 시험 농도 범위에서 무처치 음성대조군 대비 100% 이상의 인간섬유아세포 증식 활성을 나타냈다. 특히, 100 ng/mL 농도에서 무처치 음성 대조군 대비 인간섬유아세포 증식이 최대 118% 증가하였다(***p < 0.001, 무처치 음성대조군 대비) (도 7).As a result, the proliferation of human skin fibroblasts was significantly increased in the test concentration range of the positive control group, the transformed growth factor (rhTGF-β), compared to the non-treated negative control group ( *** p <0.001, non-treated negative control group). Contrast) Cell permeable vascular endothelial cell growth factor (LMWP-VEGF-A) fusion protein also showed more than 100% human fibroblast proliferation activity compared to the untreated negative control in all test concentration ranges. In particular, at a concentration of 100 ng / mL, human fibroblast proliferation increased up to 118% compared to the untreated negative control ( *** p <0.001, compared to the untreated negative control) (FIG. 7).
실시예 8. 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질의 안티-에이징 효능 평가: 섬유아세포 증식 활성에 의한 상처치유 효능Example 8. Evaluation of anti-aging efficacy of cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein: wound healing efficacy by fibroblast proliferation activity
인간 섬유아세포(CCD986-sk) 및 마우스 섬유아세포(NIH 3T3)에 스크래치 상처(scratch wound)를 유발한 후 배양액에 실시예 1에서 제조된 세포 투과형 혈관내피성장인자(LMWP-VEGF) 융합 단백질을 농도별로 처리하여 세포증식 정도를 평가함으로서 세포 투과형 혈관내피성장인자(LMWP-VEGF) 융합 단백질의 피부세포 증식 활성에 의한 상처치유 효능을 평가하였다. 피부세포 증식 활성에 대한 양성 대조군으로 유전자 재조합 인간 형질전환성장인자(recombinant human Transforming growth factor-beta, rhTGF-β)를 사용하였다. After inducing a scratch wound on human fibroblasts (CCD986-sk) and mouse fibroblasts (NIH 3T3), the concentration of the cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein prepared in Example 1 in the culture medium was concentrated. By treating each cell to evaluate the degree of cell proliferation, the wound healing efficacy of the cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein was evaluated by skin cell proliferation activity. Recombinant human transforming growth factor-beta (rhTGF-β) was used as a positive control for skin cell proliferative activity.
인간섬유아세포(CCD-986sk cell) 및 마우스 섬유아세포(NIH 3T3 cell)를 96 well plate에 3.5X104 cell/well씩 분주하고 10% FBS/DMEM 배지에서 72시간 배양하여 섬유아세포의 monolayer를 형성시켰다. 이후 배양액을 제거하고 wound maker를 이용하여 각 well에 cell-free zone(scratch wound, 회색영역)를 형성시킨 후 각 well을 인산염완충액 (pH 7.4) 100㎕로 4회 세척하고 serum free DMEM 배양액으로 단계적으로 희석한 혈관내피세포성장인자(VEGF-A), 세포 투과형 혈관내피세포성장인자(LMWP-VEGF-A) 융합 단백질과 형질전환성장인자(rhTGF-β)를 각 well에 100㎕씩 첨가하였다. CO2 incubator에서 Incucyte Zoom microscope (Essen Bioscience)로 4시간 간격, 72시간 동안 각 well의 상처면적(scratch wound area)의 회복(재생)율을 측정하였다.Human fibroblasts (CCD-986sk cell) and mouse fibroblasts (NIH 3T3 cells) were dispensed into 96 well plates by 3.5X10 4 cells / well and cultured in 10% FBS / DMEM medium for 72 hours to form monolayers of fibroblasts. . After removing the culture solution and forming a cell-free zone (scratch wound, gray area) in each well using a wound maker, wash each well 4 times with 100 μl of phosphate buffer solution (pH 7.4) and stepwise with serum free DMEM culture solution. The diluted vascular endothelial cell growth factor (VEGF-A), cell permeable vascular endothelial cell growth factor (LMWP-VEGF-A) fusion protein and transformed growth factor (rhTGF-β) were added to each well at 100 µl. The recovery (regeneration) rate of the wound wound area of each well was measured for 4 hours at 72 hours with an Incucyte Zoom microscope (Essen Bioscience) in a CO2 incubator.
마우스 섬유아세포 경우, 세포 투과형 혈관내피세포성장인자(LMWP-VEGF-A) 융합 단백질이 시험 농도 범위에서 무처치 음성대조군 대비 마우스 섬유아세포의 증식 활성으로 상처 회복율이 향상되었다. 특히, 1 ng/mL 농도로 처리 시 72시간째 상처 회복율은 무처치 음성 대조군 대비 최대 120% 증가하였다(**p < 0.01, 무처치 음성대조군 대비) (도 8).In the case of mouse fibroblasts, the wound recovery rate was improved due to the proliferative activity of mouse fibroblasts compared to the untreated negative control group in the cell concentration permeable vascular endothelial growth factor (LMWP-VEGF-A) fusion protein. In particular, when treated at a concentration of 1 ng / mL, the wound recovery rate increased up to 120% compared to the untreated negative control ( ** p <0.01, compared to the untreated negative control) at 72 hours (FIG. 8).
또한, 인간 섬유아세포의 경우, 세포 투과형 혈관내피세포성장인자(LMWP-VEGF-A) 융합 단백질이 시험 농도 범위에서 무처치 음성대조군 대비 인간 섬유아세포의 증식 활성으로 상처 회복율이 향상되었다. 특히, 50 ng/mL 농도로 처리 시 72시간째 상처 회복율은 무처치 음성 대조군 대비 최대 128% 증가하였다(**p < 0.01, 무처치 음성대조군 대비) (도 9).In addition, in the case of human fibroblasts, the wound recovery rate was improved due to the proliferative activity of human fibroblasts compared to the untreated negative control group in the cell concentration permeable vascular endothelial growth factor (LMWP-VEGF-A) fusion protein. In particular, when treated with a concentration of 50 ng / mL, the wound recovery rate increased up to 128% at 72 hours compared to the untreated negative control group ( ** p <0.01, compared to the untreated negative control group) (FIG. 9).
실시예 9. 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질 및 1,2-헥산디올(Hexandiol) 병용 투여의 콜라겐 생성 촉진 효능Example 9. Efficacy of promoting collagen production by administering a combination of cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein and 1,2-hexanediol (Hexandiol)
인간섬유아세포 (CCD986-sk cell) 배양 시 실시예 1에서 제조된 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질 및 1,2-헥산디올(Hexanediol)을 농도별로 처리하여, 1,2-헥산디올과 세포 투과형 혈관내피세포성장인자 융합 단백질을 병용하여 투여하였을 때, 콜라겐 생성에 시너지 효과를 평가하였다.When culturing human fibroblasts (CCD986-sk cell), the cell-permeable vascular endothelial cell growth factor (LMWP-VEGF) fusion protein and 1,2-hexanediol (Hexanediol) prepared in Example 1 were treated by concentration, 1,2 -When synergistic effect on collagen production was evaluated when hexanediol and cell permeable vascular endothelial growth factor fusion protein were administered in combination.
인간섬유아세포(CCD-986sk cell)를 296 well plate에 3.5X104 cells/well 씩 동일하게 heamacytometer를 이용하여 계수한 후 분주하여 배양하였다. 10% FBS를 함유하는 DMEM에서 48시간 배양하여 배양용기 표면적의 ~50%만큼 배양되면, 실시예 1에서 제조된 세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질을 배지 내 최종농도가 10.0 ppm의 농도로 투여하고, 1,2-헥산디올을 총 배지 볼륨 내에서 0.1% 및 2.5%가 되도록 각각 처리하여 48시간 더 배양하였다. 그 뒤, 프로콜라겐 타입 I C-펩티드(Procollagen type I C-peptide; PIP) ELSA 키트를 사용하여, 제조사에서 제시된 실험방법에 의해 콜라겐 생성 정도를 측정하였다.Human fibroblasts (CCD-986sk cells) were counted on a 296 well plate using a heamacytometer equal to 3.5X10 4 cells / well and cultured by dispensing. When cultured for 48 hours in DMEM containing 10% FBS and cultured for ~ 50% of the surface area of the culture vessel, the final concentration in the medium of the cell permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein prepared in Example 1 was 10.0. It was administered at a concentration of ppm, and treated with 1,2-hexanediol to be 0.1% and 2.5% in the total medium volume, respectively, and further cultured for 48 hours. Then, using a procollagen type I C-peptide (PIP) ELSA kit, the degree of collagen production was measured by an experimental method suggested by the manufacturer.
세포 투과형 혈관내피세포성장인자(LMWP-VEGF) 융합 단백질을 단독으로 처리한 군(2)에서는 약 150% 콜라겐 생성 촉진이 나타나는 반면, 1,2-헥산디올을 추가로 더 처리한 군(3 및 4)에서는 약 180% 및 222%의 콜라겐 생성 촉진 효과를 보였다. 특히, 2.5% 1,2-헥산디올을 더 포함하는 군(4)에서는 세포 투과형 혈관내피세포성장인자 융합 단백질 단독 처리군에 비하여 약 1.5 배 이상 콜라겐 생성 촉진의 현저한 상승 효과를 발휘하였다(도 10 및 도 11).In the group (2) treated with the cell-permeable vascular endothelial growth factor (LMWP-VEGF) fusion protein alone, about 150% collagen production was promoted, whereas the group further treated with 1,2-hexanediol (3 and In 4), about 180% and 222% of collagen production was promoted. In particular, in the group (4) further containing 2.5% 1,2-hexanediol, the cell permeable vascular endothelial growth factor fusion protein alone exhibited a remarkable synergistic effect of promoting collagen production by about 1.5 times or more (FIG. 10). And Figure 11).
상기 결과를 통해 본 발명에 따른 세포 투과형 혈관내피세포성장인자 융합 단백질은 단독으로 처리한 경우에 비하여, 1,2-헥산디올을 추가로 더 포함하는 경우에 콜라겐 생성 촉진에 현저한 시너지 효과가 존재함을 알 수 있다.Through the above results, the cell permeable vascular endothelial cell growth factor fusion protein according to the present invention has a remarkable synergistic effect in promoting collagen production when it further contains 1,2-hexanediol compared to the case of being treated alone. Can be seen.
<110> BIO-FD&C <120> Topical Formulation Composed of Cell Permeable Vascular Endothelial Growth Factor (LMWP-VEGF) with Skin Physiological Activity <130> KPA01286 <150> KR 2016-0119277 <151> 2016-09-19 <160> 2 <170> KoPatentIn 3.0 <210> 1 <211> 14 <212> PRT <213> Artificial Sequence <220> <223> LMWP <400> 1 Val Ser Arg Arg Arg Arg Arg Arg Gly Gly Arg Arg Arg Arg 1 5 10 <210> 2 <211> 126 <212> PRT <213> Artificial Sequence <220> <223> LMWP-VEGF <400> 2 Val Ser Arg Arg Arg Arg Arg Arg Gly Gly Arg Arg Arg Arg Ala Pro 1 5 10 15 Met Ala Glu Gly Gly Gly Gln Asn His His Glu Val Val Lys Phe Met 20 25 30 Asp Val Tyr Gln Arg Ser Tyr Cys His Pro Ile Glu Thr Leu Val Asp 35 40 45 Ile Phe Gln Glu Tyr Pro Asp Glu Ile Glu Tyr Ile Phe Lys Pro Ser 50 55 60 Cys Val Pro Leu Met Arg Cys Gly Gly Cys Cys Asn Asp Glu Gly Leu 65 70 75 80 Glu Cys Val Pro Thr Glu Glu Ser Asn Ile Thr Met Gln Ile Met Arg 85 90 95 Ile Lys Pro His Gln Gly Gln His Ile Gly Glu Met Ser Phe Leu Gln 100 105 110 His Asn Lys Cys Glu Cys Arg Pro Lys Lys Asp Arg Ala Arg 115 120 125 <110> BIO-FD & C <120> Topical Formulation Composed of Cell Permeable Vascular Endothelial Growth Factor (LMWP-VEGF) with Skin Physiological Activity <130> KPA01286 <150> KR 2016-0119277 <151> 2016-09-19 <160> 2 <170> KoPatentIn 3.0 <210> 1 <211> 14 <212> PRT <213> Artificial Sequence <220> <223> LMWP <400> 1 Val Ser Arg Arg Arg Arg Arg Arg Gly Gly Arg Arg Arg Arg 1 5 10 <210> 2 <211> 126 <212> PRT <213> Artificial Sequence <220> <223> LMWP-VEGF <400> 2 Val Ser Arg Arg Arg Arg Arg Arg Gly Gly Arg Arg Arg Arg Ala Pro 1 5 10 15 Met Ala Glu Gly Gly Gly Gln Asn His His Glu Val Val Lys Phe Met 20 25 30 Asp Val Tyr Gln Arg Ser Tyr Cys His Pro Ile Glu Thr Leu Val Asp 35 40 45 Ile Phe Gln Glu Tyr Pro Asp Glu Ile Glu Tyr Ile Phe Lys Pro Ser 50 55 60 Cys Val Pro Leu Met Arg Cys Gly Gly Cys Cys Asn Asp Glu Gly Leu 65 70 75 80 Glu Cys Val Pro Thr Glu Glu Ser Asn Ile Thr Met Gln Ile Met Arg 85 90 95 Ile Lys Pro His Gln Gly Gln His Ile Gly Glu Met Ser Phe Leu Gln 100 105 110 His Asn Lys Cys Glu Cys Arg Pro Lys Lys Asp Arg Ala Arg 115 120 125
Claims (9)
상기 세포 투과형 혈관내피세포성장인자 융합 단백질은 상기 혈관내피세포성장인자(VEGF)의 N-말단, C-말단 또는 N-말단 및 C-말단에 세포 투과형 펩타이드의 아미노산 서열이 결합되는 것을 특징으로 하는, 피부 외용제 조성물.According to claim 1,
The cell permeable vascular endothelial growth factor fusion protein is characterized in that the amino acid sequence of the cell permeable peptide is coupled to the N-terminal, C-terminal or N-terminal and C-terminal of the vascular endothelial cell growth factor (VEGF). , External composition for skin.
상기 세포 투과형 혈관내피세포성장인자 융합 단백질은 상기 피부 외용제 조성물 중 0.01 내지 100 ppm 농도로 포함되는 것인, 피부 외용제 조성물.According to claim 1,
The cell permeable vascular endothelial cell growth factor fusion protein is contained in a concentration of 0.01 to 100 ppm in the composition for external application for skin, the composition for external application for skin.
상기 1,2-헥산디올은 상기 피부 외용제 조성물 100 중량부 기준으로 0.1 중량부 내지 2.5 중량부를 포함하는 것인, 피부 외용제 조성물.According to claim 1,
The 1,2-hexanediol comprises 0.1 parts by weight to 2.5 parts by weight based on 100 parts by weight of the composition for external application for skin.
상기 조성물은 콜라겐 생성 촉진용인 것인, 피부 외용제 조성물.According to claim 1,
The composition is for promoting collagen production, a composition for external application for skin.
상기 조성물은 피부 재생용인, 피부 외용제 조성물.According to claim 1,
The composition is for skin regeneration, external composition for skin.
상기 조성물은 상처 치유용인, 피부 외용제 조성물.According to any one of claims 1, 3, 5, and 6,
The composition is for wound healing, external composition for skin.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020160119277 | 2016-09-19 | ||
KR20160119277 | 2016-09-19 |
Publications (2)
Publication Number | Publication Date |
---|---|
KR20180032187A KR20180032187A (en) | 2018-03-29 |
KR102114845B1 true KR102114845B1 (en) | 2020-05-27 |
Family
ID=61906974
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020170120420A KR102114845B1 (en) | 2016-09-19 | 2017-09-19 | Topical Formulation Composed of Cell Permeable Vascular Endothelial Growth Factor (LMWP-VEGF) fusion protein with Skin Physiological Activity |
Country Status (1)
Country | Link |
---|---|
KR (1) | KR102114845B1 (en) |
Family Cites Families (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR100422763B1 (en) * | 2002-01-17 | 2004-03-12 | 주식회사 태평양 | Preparation of botanical nano-particles having excellent percutaneous absorption properties, and cosmetic and medical composition comprising the nano-particles |
KR101095841B1 (en) | 2009-02-19 | 2011-12-21 | 주식회사 나이벡 | Target Activated Cells/Tissue Translocation Peptide for Impermeable Compound StrategyTACTICS and Use Thereof |
KR101417328B1 (en) * | 2011-08-31 | 2014-07-08 | (주)아모레퍼시픽 | Biomembrane Permeable Composition |
-
2017
- 2017-09-19 KR KR1020170120420A patent/KR102114845B1/en active IP Right Grant
Also Published As
Publication number | Publication date |
---|---|
KR20180032187A (en) | 2018-03-29 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
KR101944388B1 (en) | Skin penetrating peptide and method of use thereof | |
RU2670135C2 (en) | Novel cell penetrating peptide, conjugate thereof with botulinum toxin, and use thereof | |
KR101757946B1 (en) | Compounds which inhibit muscle contraction | |
KR102607079B1 (en) | Neuron cells penetrability enhanced peptide regulating neurotransmitter secretion | |
KR101393397B1 (en) | Transdermal delivery system of dermatological active ingredients using cellular transduction peptides | |
KR100787393B1 (en) | 506 Cell-transducing fusion protein which comprising FK506 binding protein and protein transducing domain | |
US11547649B2 (en) | Fusion protein bound to cell-permeable peptide, and composition comprising fusion protein or cell-permeable peptide and epithelial cell growth factor as active ingredients | |
KR101679310B1 (en) | Cosmetic composition for skin regeneration and skin soothing comprising novel peptide and growth factor complex | |
KR101813560B1 (en) | Topical formulation with Skin Physiological Activity Composed of Cell Permeable Growth Factors | |
KR102114842B1 (en) | Topical Formulation Composed of Cell Permeable basic Fibroblast Growth Factor (LMWP-bFGF) fusion protein with Skin Physiological Activity | |
KR102114845B1 (en) | Topical Formulation Composed of Cell Permeable Vascular Endothelial Growth Factor (LMWP-VEGF) fusion protein with Skin Physiological Activity | |
KR20190001724A (en) | Cosmetic composition containing peptide regulating neurotransmitters to neuron cells | |
EP3401324A1 (en) | Novel protein transduction domain and use thereof | |
KR101620148B1 (en) | Development of long acting and cell permeable beta-defensin 3 and -3H by conjugating lauric acid and cell permeable peptide respectively and Cosmetic compostion comprising the Same | |
KR101417328B1 (en) | Biomembrane Permeable Composition | |
US10858395B2 (en) | Skin-penetrating peptide and method for using same | |
KR102622462B1 (en) | Peptide for accelerating delivery to nerve cells | |
KR102590533B1 (en) | Method for producing protein transduction domain-Sirtuin6 and cosmetic composition and pharmaceutical composition containing the same | |
US11951204B2 (en) | Cell-penetrating peptides and composition including the same | |
KR102206808B1 (en) | Novel cell-penetrating peptiedes and composition for skin improvement including the same | |
KR101626758B1 (en) | Development and production of basic fibroblast growth factor with skin permeation and cosmetic composition therefrom | |
KR100773274B1 (en) | Cell-transducing Fusion Protein of Cyclophilin A | |
KR100802480B1 (en) | Growth receptor factor bound protein 7 fusion protein | |
KR101962801B1 (en) | Niacinamide-Peptide Fusions With the Effect of Reducing Skin Wrinkles and Skin Cell Regeneration And Using Thereof | |
KR20050029879A (en) | Hiv-2 tat transducing domain, transducing domain-cargo molecule fusion protein and uses thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
A201 | Request for examination | ||
E902 | Notification of reason for refusal | ||
E701 | Decision to grant or registration of patent right | ||
GRNT | Written decision to grant |