KR20140103002A - Peptide for targeting to mitochondria - Google Patents

Peptide for targeting to mitochondria Download PDF

Info

Publication number
KR20140103002A
KR20140103002A KR1020130016622A KR20130016622A KR20140103002A KR 20140103002 A KR20140103002 A KR 20140103002A KR 1020130016622 A KR1020130016622 A KR 1020130016622A KR 20130016622 A KR20130016622 A KR 20130016622A KR 20140103002 A KR20140103002 A KR 20140103002A
Authority
KR
South Korea
Prior art keywords
mitochondria
peptide
amino acid
acid sequence
seq
Prior art date
Application number
KR1020130016622A
Other languages
Korean (ko)
Other versions
KR101490580B1 (en
Inventor
장덕진
Original Assignee
경북대학교 산학협력단
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 경북대학교 산학협력단 filed Critical 경북대학교 산학협력단
Priority to KR20130016622A priority Critical patent/KR101490580B1/en
Publication of KR20140103002A publication Critical patent/KR20140103002A/en
Application granted granted Critical
Publication of KR101490580B1 publication Critical patent/KR101490580B1/en

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04Linear peptides containing only normal peptide links
    • C07K7/08Linear peptides containing only normal peptide links having 12 to 20 amino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/66Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid the modifying agent being a pre-targeting system involving a peptide or protein for targeting specific cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/07Fusion polypeptide containing a localisation/targetting motif containing a mitochondrial localisation signal

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Engineering & Computer Science (AREA)
  • Medicinal Chemistry (AREA)
  • Wood Science & Technology (AREA)
  • Biotechnology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Biomedical Technology (AREA)
  • Physics & Mathematics (AREA)
  • Cell Biology (AREA)
  • Plant Pathology (AREA)
  • Microbiology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)

Abstract

The present invention relates to a peptide for targeting mitochondria, a recombinant vector including the peptide, a method for moving target proteins to mitochondria in order to be distributed using the same, and to a pharmaceutical composition for preventing or treating diseases accompanying mitochondria hypofunction using the same. An amino acid sequence of sequence number 1 in the present invention is targeted to mitochondria so that a peptide including the same can move and distribute a material (compound, protein, gene) exhibiting pharmacological activities in mitochondria. Moreover, the peptide having the amino acid sequence of sequence number 1 serves as a target sequence for moving a particular material to mitochondria. Accordingly, when a composite is produced by binding the peptide with a pharmacologically active material (compound, protein, gene), the pharmacologically active material can be moved to mitochondria in order to directly act therein so that diseases related to mitochondria hypofunction can be prevented or treated using the same.

Description

미토콘드리아 타겟팅용 펩타이드{Peptide for targeting to mitochondria}Peptides for targeting to mitochondria {Peptide for targeting to mitochondria}

본 발명은 미토콘드리아 타겟팅용 펩타이드, 상기 펩타이드를 포함하는 재조합 벡터, 이를 이용한 목적 단백질을 미토콘드리아로 이동 및 분포시키는 방법 및 이를 이용한 미토콘드리아 기능부전(기능이상)을 동반하는 질환의 예방 또는 치료용 약제학적 조성물에 관한 것이다.The present invention relates to a peptide for targeting mitochondria, a recombinant vector containing the peptide, a method for transferring and distributing a target protein using the peptide to mitochondria, and a pharmaceutical composition for preventing or treating diseases accompanied by mitochondrial dysfunction .

우리 몸에는 수많은 세포가 존재하며 개개의 세포에는 소포체, 핵, 미토콘드리아, 퍼록시좀, 골지 등을 포함하는 소기관들이 존재하며 이들 소기관들은 각각 독특한 막에 의해 둘러싸여 있다. 하나의 세포에는 대략 십억개의 단백질들이 존재하며 이들 단백질들이 자신의 고유기능을 수행하기 위해서는 세포내의 특정한 소기관 혹은 막, 사이토졸, 핵 등으로 옮겨져야 한다.There are numerous cells in our body, and there are small organelles in each cell, including the endoplasmic reticulum, nucleus, mitochondria, peroxysomes, and goliaths. These organelles are surrounded by unique membranes. One cell has about one billion proteins, and these proteins must be transferred to specific organelles, membranes, cytosols, nuclei, etc. in the cell to perform their own functions.

세포가 단백질을 특정 소기관으로 운반하는 것을 “단백질 타겟팅(protein targeting)이라고 하며, 이러한 단백질 타겟팅을 위해서는 새롭게 합성된 단백질이 소포체, 골지체 및 최종 목적 소기관으로 순차적으로 운반되어져야 한다.The transport of proteins to specific organelles by cells is called "protein targeting," and for this protein targeting, newly synthesized proteins must be transported sequentially to the endoplasmic reticulum, the Golgi and the final target organelles.

새롭게 합성된 단백질이 소포체로 운반되기 위해서는 신호서열(signal sequence)라는 짧은 아미노산 서열이 중요한 역할을 하며 신호서열은 단백질 합성 초기에 만들어져 소포체로 운반된 후 제거되게 된다. 이후 단백질은 골지체로 운반되어 당, 지방 등이 단백질에 결합하는 과정을 거친다. 또한 미토콘드리아, 핵 등 세포내 소기관으로 운반되기 위해서는 별도의 신호서열이 존재하여야 하며, 이러한 서열은 소포체로 보내는 신호서열과 구분해서 미토콘드리아신호서열, 핵신호서열이라고 부르기도 한다.In order for the newly synthesized protein to be transferred to the endoplasmic reticulum, a short amino acid sequence called the signal sequence plays an important role and the signal sequence is made in the early stage of protein synthesis and then transported to the endoplasmic reticulum and then removed. The protein is then transported to the Golgi body, where the sugar, fat, etc. are bound to the protein. In addition, a separate signal sequence must be present in order to be transported to the intracellular organelles such as mitochondria and nucleus, and this sequence may be referred to as a mitochondrial signal sequence or a nuclear signal sequence separately from a signal sequence to be transmitted to an endoplasmic reticulum.

이와 같이, 세포 내에서 기능을 하는 목적 단백질을 세포내 소기관으로 전달시키는 단백질 신호서열은 목적하는 단백질을 전달하기 위한 매우 효율적인 방법으로서, 특정 세포내 소기관으로 타겟팅을 이끌 수 있는 신호서열을 찾아내는 것은 매우 중요한 일이라 하겠다.Thus, a protein signal sequence that transfers a target protein functioning in a cell to an intracellular organelle is a very efficient method for delivering a desired protein, and it is very difficult to find a signal sequence capable of targeting to a specific intracellular organelle It is important.

특히 세포내 소기관 중 미토콘드리아는 세포질에 그물망 형태로 존재하면서, 지속적인 융합과 분열을 반복하며 세포 호흡을 통하여 세포의 생존에 필요한 에너지를 생산하는 기능을 한다. 이러한 미토콘드리아는 세포내 에너지 대사의 중추이므로 미토콘드리아의 기능 이상은 다양한 질병을 유발한다. 미토콘드리아의 기능 이상에 의해 발생하는 질병으로는 파킨슨병, 헌틴턴병과 같이 노화에 따라 흔하게 발생할 수 있는 발병률이 높은 질병이 있으며, 바쓰 증후군(Barth Syndrome), 리증후군 (Leigh Syndrome), 멜라스 증후군(MELAS Syndrome)과 같은 발병률이 낮은 희귀 질병 등이 있다. 또한 최근의 연구결과에 따르면 미토콘드리아의 이상은 대사성증후군인 제2형 당뇨병 발병원인일 가능성이 있음이 확인되었다. 미토콘드리아의 기능 이상에 의해 발생하는 이러한 질환들은 세포의 에너지공급 체계에 이상이 발생하는 것으로 대부분 근 질환과 뇌질환을 동반한다.Among the intracellular organelles, mitochondria exist in a net form in the cytoplasm, and they repeat the fusion and division repeatedly and function to produce the energy required for cell survival through cell respiration. Since these mitochondria are the backbone of intracellular energy metabolism, malfunctioning of mitochondria causes various diseases. Diseases caused by dysfunction of the mitochondria include Parkinson's disease, Huntington's disease, and other diseases that frequently occur due to aging. Barth syndrome, Leigh syndrome, Melas syndrome MELAS Syndrome) and rare diseases with low incidence. Recent studies have also shown that mitochondrial abnormalities may be the cause of type 2 diabetes, the metabolic syndrome. These diseases, caused by malfunction of the mitochondria, are caused by an abnormality in the energy supply system of the cell, most of which are accompanied by muscle and brain diseases.

세포 에너지 생산에 필수적인 미토콘드리아의 호흡기능은 미토콘드리아의 내막에 존재하는 호흡복합체를 통하여 이루어진다. 미토콘드리아 내막의 호흡복합체는 다섯 종류가 있으며 각 복합체는 특이적 기질로부터 전자를 전달 받아 최종적으로 산소에 전달한다.The respiratory function of the mitochondria essential for cell energy production is through the respiratory complex present in the inner membrane of the mitochondria. There are five types of mitochondrial respiratory complexes, each of which receives electrons from specific substrates and ultimately transfers them to oxygen.

미토콘드리아를 구성하고 있는 단백질은 약 1500종으로 미토콘드리아는 세포내 다른 소기관들과 달리 자신의 고유한 유전정보를 가지고 있다. 즉, 미토콘드리아는 핵에 존재하며 세포의 모든 유전정보를 담고 있는 게놈 DNA(genomic DNA) 이외에 메트릭스에 자신의 고유한 유전정보를 미토콘드리아 DNA(mtDNA) 형태로 가지고 있다. mtDNA의 크기는 약 1600kbp이며 그 안에 미토콘드리아 호흡복합체를 구성하는 13종의 단백질을 암호화하고 있다. 미토콘드리아 호흡복합체는 genomic DNA와 mtDNA의 두 유전물질로부터 만들어진 단백질들에 의해 구성되어지므로 다른 세포내 소기관과 비교하여 복잡한 조절기작에 의해 그 형성과정이 조절되어진다.Mitochondria are composed of about 1,500 proteins, and mitochondria have their own unique genetic information, unlike other organelles in the cell. In other words, the mitochondria have their own genetic information in the form of mitochondrial DNA (mtDNA) in addition to the genomic DNA that exists in the nucleus and contains all the genetic information of the cell. The size of the mtDNA is about 1600 kbp, and it encodes 13 proteins constituting the mitochondrial respiratory complex. Because mitochondrial respiratory complexes are composed of proteins made from two genetic materials, genomic DNA and mtDNA, their formation processes are controlled by complex regulatory mechanisms compared to other intracellular organelles.

또한 미토콘드리아와 핵 사이의 신호전달이 미토콘드리아의 형성과 기능 조절에 매우 중요한 역할을 할 것으로 보이며 그 매개체 역할을 할 수 있는 단백질에 대한 연구가 요청된다.In addition, signal transduction between the mitochondria and the nucleus appears to play a very important role in the formation and function of mitochondria, and research is needed on proteins that can act as mediators.

따라서 미토콘드리아의 기능 및 안정성을 조절하는 것에 의해 약리학적 활성을 나타내는 물질(화학물질, 단백질 및 유전자 포함)을 미토콘드리아로 타겟팅할 수 있는 펩타이드, 단백질 또는 이를 암호화하는 유전자와 융합하는 것에 의해 미토콘드리아로 이동시킬 수 있다면 그 활성이 보다 배가될 수 있을 것이다.Therefore, by modulating the function and stability of mitochondria, it is possible to transfer a substance (including chemicals, proteins, and genes) exhibiting pharmacological activity to mitochondria by fusing with peptides, proteins or genes capable of targeting mitochondria If possible, the activity would be doubled.

한편, 시알산 함유 당지질인 강글리오시드(ganglioside)는 비루스나 독소 단백질 및 미생물에 대한 수용체로서 뿐만 아니라 세포의 분화, 증식, 성장과 신호전달, 암화 및 암전이 등에서도 중요한 기능을 하는 것으로 잘 알려져 있다. GM1은 이러한 강글리오시드 수용체의 일종으로 ‘ganglioside Galβ1-3GalNAcβ1-4(Neu5Acα2-3)Galβ1-4Galβ1-1Ceramide’의 약칭이다. GM1과 관련된 종래 연구에서는 랜덤 펩타이드 라이브러리(random peptide library)를 이용한 GM1-결합 펩타이드를 개시하고 있으나, 이러한 GM1-결합 펩타이드의 미토콘드리아 타겟팅 기능에 대해서는 전혀 보고된 바가 없다.On the other hand, it is well known that ganglioside, a sialic acid-containing glycolipid, plays an important role not only as a receptor for viral and toxin proteins and microorganisms, but also in cell differentiation, proliferation, growth and signal transduction, have. GM1 is a type of this ganglioside receptor and is an abbreviation of 'ganglioside Galβ1-3GalNAcβ1-4 (Neu5Acα2-3) Galβ1-4Galβ1-1Ceramide'. Previous studies related to GM1 have disclosed GM1-linked peptides using a random peptide library, but there has been no report on the mitochondrial targeting function of such GM1-linked peptides.

이에, 본 발명자들은 미토콘드리아로의 타겟팅 효과를 이끌 수 있는 펩타이드 서열을 연구하던 중, 종래 GM1(ganglioside Galβ1-3GalNAcβ1-4(Neu5Acα2-3)Galβ1-4Galβ1-1Ceramide) 결합 펩타이드로 알려진 특정서열이 미토콘드리아로 타겟팅 효과를 가짐을 최초로 확인함으로써 본 발명을 완성하였다.Therefore, the inventors of the present invention have studied a peptide sequence capable of leading to the targeting effect to mitochondria, and have found that a specific sequence known as GM1 (ganglioside Galβ1-3GalNAcβ1-4 (Neu5Acα2-3) Galβ1-4Galβ1-1Ceramide) The present invention has been completed.

한국공개특허 제2010-0086164호Korean Patent Publication No. 2010-0086164

따라서 본 발명의 목적은 미토콘드리아로의 타겟팅 용도를 가진 펩타이드를 제공하는 것이다.It is therefore an object of the present invention to provide a peptide having targeting use for mitochondria.

본 발명의 다른 목적은 상기 펩타이드의 아미노산 서열을 코딩하는 유전자를 포함하는 재조합 벡터를 제공하는 것이다.Another object of the present invention is to provide a recombinant vector comprising a gene encoding the amino acid sequence of the peptide.

본 발명의 또 다른 목적은 상기 재조합 벡터를 이용하여 목적 단백질을 미토콘드리아로 이동 및 분포시키는 방법을 제공하는 것이다.Yet another object of the present invention is to provide a method for transferring and distributing a target protein to mitochondria using the recombinant vector.

본 발명의 또 다른 목적은 상기 펩타이드와 약리학적으로 활성을 나타내는 물질이 결합된 복합체를 이용하여 미토콘드리아 기능부전과 관련된 질환을 예방 또는 치료할 수 있는 약제학적 조성물을 제공하는 것이다.It is still another object of the present invention to provide a pharmaceutical composition capable of preventing or treating a disease associated with mitochondrial dysfunction by using a complex in which the peptide and a pharmacologically active substance are combined.

본 발명의 또 다른 목적은 상기 펩타이드의 아미노산 서열을 코딩하는 유전자 및 목적 단백질을 코딩하는 유전자가 작동 가능하게 연결된 재조합 벡터를 이용하여 미토콘드리아 기능부전과 관련된 질환을 예방 또는 치료할 수 있는 약제학적 조성물을 제공하는 것이다.Yet another object of the present invention is to provide a pharmaceutical composition capable of preventing or treating a disease associated with mitochondrial dysfunction by using a recombinant vector in which a gene encoding the amino acid sequence of the peptide and a gene encoding a target protein are operably linked .

상기와 같은 본 발명의 목적을 달성하기 위해서, 본 발명은 서열번호 1의 아미노산 서열을 포함하는 미토콘드리아 타겟팅용 펩타이드를 제공한다.In order to accomplish the above object, the present invention provides a peptide for targeting mitochondria comprising the amino acid sequence of SEQ ID NO: 1.

또한, 본 발명은 서열번호 1의 아미노산 서열을 코딩하는 유전자를 포함하는 재조합 벡터를 제공한다.The present invention also provides a recombinant vector comprising a gene encoding the amino acid sequence of SEQ ID NO: 1.

본 발명의 일실시예에 있어서, 상기 재조합 벡터는 프로모터, 서열번호 1의 아미노산 서열을 코딩하는 유전자 및 목적 단백질을 코딩하는 유전자가 작동 가능하게 연결될 수 있다.In one embodiment of the present invention, the recombinant vector may be operably linked to a promoter, a gene encoding the amino acid sequence of SEQ ID NO: 1, and a gene encoding a target protein.

또한, 본 발명은 상기 재조합 벡터를 세포 내에 도입하는 단계를 포함하는 목적 단백질을 미토콘드리아로 이동 및 분포시키는 방법을 제공한다.The present invention also provides a method for transferring and distributing a target protein into mitochondria, which comprises introducing the recombinant vector into a cell.

또한, 본 발명은 서열번호 1의 아미노산 서열을 포함하는 미토콘드리아 타겟팅용 펩타이드 및 약리학적으로 활성을 나타내는 물질이 결합된 복합체를 유효성분으로 포함하는 미토콘드리아 기능부전과 관련된 질환의 예방 또는 치료용 약제학적 조성물을 제공한다.The present invention also provides a pharmaceutical composition for preventing or treating diseases associated with mitochondrial dysfunction, comprising an effective component of a peptide having a peptide for targeting mitochondria comprising the amino acid sequence of SEQ ID NO: 1 and a pharmacologically active substance- .

본 발명의 일실시예에 있어서, 상기 약리학적으로 활성을 나타내는 물질은 화합물, 단백질 또는 유전자일 수 있다.In one embodiment of the present invention, the pharmacologically active substance may be a compound, a protein or a gene.

또한, 본 발명은 프로모터, 서열번호 1의 아미노산 서열을 코딩하는 유전자 및 목적 단백질을 코딩하는 유전자가 작동 가능하게 연결된 재조합 벡터를 유효성분으로 포함하는 미토콘드리아 기능부전과 관련된 질환의 예방 또는 치료용 약제학적 조성물을 제공한다.The present invention also relates to a pharmaceutical composition for the prevention or treatment of diseases associated with mitochondrial dysfunction, comprising a promoter, a gene encoding the amino acid sequence of SEQ ID NO: 1, and a recombinant vector operably linked to a gene encoding a target protein, Lt; / RTI >

본 발명의 일실시예에 있어서, 상기 미토콘드리아 기능부전과 관련된 질환은 알쯔하이머병, 파킨슨병, 헌팅톤병, 근육 이영양증, 근긴장성 이영양증, 만성 피로 증후군, 프리드리히 운동실소증, 간질, 말초신경병, 시신경병, 자율 신경병, 신경유래의 장 기능부전, 감각신경의 난청, 신경유래의 방광 기능부전, 편두통, 운동실소증, 신세뇨관성 산증, 확장성 심근증, 지방간염, 간부전, 유산성혈증, 미토콘드리아 뇌근증(mitochondrial encephalopathy with lactic acidemia and strokelike episodes; MELAS), 레버 시신경위축증(Leber's hereditary optic neuropathy: LHON), MERRF 증후군, MNGIE(Mitochondrial neurogastrointestinal encephalopathy syndrome), NARP((neuropathy, ataxia, and retinitis pigmantosa), 바쓰 증후군(Barth Syndrome), 리증후군 (Leigh Syndrome) 및 칸스-사이레스 증후군으로 이루어진 군으로부터 선택될 수 있다.In one embodiment of the present invention, the disease associated with mitochondrial dysfunction is selected from the group consisting of Alzheimer's disease, Parkinson's disease, Huntington's disease, muscular dystrophy, dystrophic dystrophy, chronic fatigue syndrome, Friedrich's ataxia, epilepsy, peripheral neuropathy, Autonomic neuropathy, nerve-induced intestinal dysfunction, sensory nerve deafness, neurodegenerative bladder dysfunction, migraine, exercise laicosis, renal tubular acidosis, dilated cardiomyopathy, fatty liver disease, hepatic failure, abortion, mitochondrial dysfunction (MELAS), Leber's hereditary optic neuropathy (LHON), MERRF syndrome, MNGIE (mitochondrial neurogastrointestinal encephalopathy syndrome), NARP (neuropathy, ataxia, and retinitis pigmantosa), Barth syndrome Barth Syndrome, Leigh Syndrome, and Kans-Sirens Syndrome.

본 발명의 서열번호 1의 아미노산 서열은 미토콘드리아로 타겟팅되는 특징을 가지므로, 이를 포함하는 펩타이드는 약리학적으로 활성을 나타내는 물질(화합물, 단백질, 유전자)을 미토콘드리아로 이동 및 분포시킬 수 있다. 또한 서열번호 1의 아미노산 서열을 갖는 펩타이드는 특정 물질을 미토콘드리아로 이동시키는 표적서열로 작용하므로, 이러한 펩타이드를 약리학적으로 활성을 나타내는 물질(화합물, 단백질, 유전자)과 결합하여 복합체를 형성하는 경우, 약리학적으로 활성을 나타내는 물질이 미토콘드리아로 이동하여 직접적으로 작용할 수 있으므로, 미토콘드리아 기능부전과 관련된 질환의 예방 또는 치료에 있어서 유용하게 사용될 수 있다.Since the amino acid sequence of SEQ ID NO: 1 of the present invention has a characteristic of being targeted to mitochondria, the peptide comprising the same can transfer and distribute a pharmacologically active substance (compound, protein, gene) to mitochondria. In addition, since the peptide having the amino acid sequence of SEQ ID NO: 1 functions as a target sequence for transferring a specific substance to mitochondria, when such a peptide is combined with a substance (compound, protein, gene) exhibiting pharmacological activity to form a complex, Since a pharmacologically active substance can migrate directly to mitochondria and act directly, it can be useful in the prevention or treatment of diseases related to mitochondrial dysfunction.

도 1은 GMs(p3):EGFP가 미토콘드리아에 위치하고 있음을 나타내는 사진으로서, 녹색은 본 발명의 GMs(p3) 단백질이 내는 형광이고, 붉은색은 미토콘드리아 마커인 MitoTracker가 내는 형광이며, GMs(p3) 단백질과 MitoTracker 형광이 겹쳐 보이는 부분은 노란색을 나타낸다.FIG. 1 is a photograph showing that GMs (p3): EGFP is located in the mitochondria. Green is fluorescence emitted by GM3 (p3) protein of the present invention, red is fluorescence emitted by mitochondrial marker MitoTracker, GMs (p3) The part where the protein and MitoTracker fluorescence overlap is yellow.

본 발명에서 사용되는 용어에 대한 정의는 이하와 같다.
The terms used in the present invention are defined as follows.

"미토콘드리아"는 대부분의 진핵세포에 존재하는 세포성 소기관이다. 미토콘드리아의 주 기능 중 하나는 산화성 인산화이고, 상기 과정을 통하여 포도당 또는 지방산과 같은 연료 물질의 대사로부터 유래되는 에너지가 ATP로 전환되며, 이는 다양한 에너지-요구 생합성 및 다른 대사성 활성을 추진시키는 데 이용된다. 미토콘드리아는 자신의 게놈(genome)을 갖고 있고, 이는 핵 DNA와 분리되어 있으며, 약 16,000 염기쌍을 갖는 환형의 DNA이다. 각각의 미토콘드리아는 자신의 게놈(genome)의 다수의 카피를 갖고 있고, 각각의 세포는 수백개의 미토콘드리아를 갖고 있는 것으로 알려져 있다."Mitochondria" are cellular organelles present in most eukaryotic cells. One of the main functions of the mitochondria is oxidative phosphorylation, through which energy derived from the metabolism of fuel substances such as glucose or fatty acids is converted to ATP, which is used to drive a variety of energy-requiring biosynthesis and other metabolic activities . A mitochondrion has its own genome, which is isolated from nuclear DNA and is a circular DNA with about 16,000 base pairs. Each mitochondrion has multiple copies of its genome, and each cell is known to have hundreds of mitochondria.

"미토콘드리아 기능부전과 관련된 질환"은 미토콘드리아의 정상적인 기능이 선천적 유전 결함이나, 세균감염, 장애, 기타 원인에 의해 기능이 저하되거나 제대로 기능을 하지 못하는 상태에서 나타나는 질환을 의미한다."Diseases associated with mitochondrial dysfunction" means diseases where the normal function of the mitochondria is due to inherited genetic defects, bacterial infections, disorders, or other causes that result in reduced function or inadequate functioning.

"핵산"은 임의의 DNA 또는 RNA, 예를 들어, 조직 샘플에 존재하는 염색체, 미토콘드리아, 바이러스 및/또는 세균 핵산을 포함하는 의미이다. 이중가닥 핵산 분자의 하나 또는 두개 모두의 가닥을 포함하고, 손상되지 않은 핵산 분자의 임의의 단편 또는 일부를 포함한다."Nucleic acid" is meant to include any DNA or RNA, such as chromosomes, mitochondria, viruses and / or bacterial nucleic acids present in a tissue sample. Includes one or both strands of a double-stranded nucleic acid molecule, and includes any fragment or portion of the intact nucleic acid molecule.

"유전자"는 단백질 코딩 또는 전사 시에 또는 다른 유전자 발현의 조절 시에 기능적 역할을 갖는 임의의 핵산 서열 또는 그의 일부를 의미한다. 유전자는 기능적 단백질을 코딩하는 모든 핵산 또는 단백질을 코딩 또는 발현하는 핵산의 일부만으로 이루어질 수 있다. 핵산 서열은 엑손, 인트론, 개시 또는 종료 영역, 프로모터 서열, 다른 조절 서열 또는 유전자에 인접한 특유한 서열 내에 유전자 이상을 포함할 수 있다."Gene" means any nucleic acid sequence or portion thereof that has a functional role at the time of protein coding or transcription, or in the control of other gene expression. The gene may consist of only a portion of the nucleic acid encoding or expressing any nucleic acid or protein that encodes the functional protein. The nucleic acid sequence may comprise an exon, an intron, an initiation or termination region, a promoter sequence, another regulatory sequence, or a gene abnormality within a particular sequence adjacent to the gene.

"프라이머"는 상보성 RNA 또는 DNA 표적 폴리뉴클레오티드에 혼성화하고 예를 들어 폴리머라제 연쇄 반응에서 발생하는 뉴클레오티딜트랜스퍼라제의 작용에 의해 모노뉴클레오티드로부터 폴리뉴클레오티드의 단계적 합성을 위한 출발점으로 기능하는 올리고뉴클레오티드 서열을 의미한다."Primer" refers to an oligonucleotide sequence that hybridizes to a complementary RNA or DNA-targeted polynucleotide and serves as a starting point for the stepwise synthesis of a polynucleotide from a mononucleotide by the action of, for example, a nucleotidyltransferase that occurs in the polymerase chain reaction .

"코딩 영역" 또는 "코딩 서열"은, 통상적인 염기쌍과 코돈 용법 관계에 따라, 발현이 요구되는 특정 유전자 생성물 또는 이의 단편을 코딩하는 핵산 서열, 이의 상보체, 또는 이들의 일부분을 지칭한다. 코딩 서열은 성숙 mRNA를 제공하기 위해 세포의 생화학 기구에 의해 함께 연결되는 게놈 DNA 또는 미성숙 1차 RNA 전사체에서의 엑손을 포함한다. 안티센스(antisense) 가닥은 상기 핵산의 상보체이고, 코딩 서열은 이들로부터 추정될 수 있다. 코딩 서열은, 적절한 길이의 전사체가 생성되고 적절한 리딩 프레임에서 번역되어 목적하는 기능 생성물이 생성되도록, 전사 조절 요소 및 번역 개시 및 종결 코돈과의 관계에 놓인다."Coding region" or "coding sequence" refers to a nucleic acid sequence, a complement thereof, or a portion thereof, which encodes a particular gene product or fragment thereof that is required to be expressed, according to a common base pairing and codon usage relationship. Coding sequences include exons in genomic DNA or immature primary RNA transcripts that are joined together by a biochemical machinery of cells to provide mature mRNA. The antisense strand is a complement of the nucleic acid, and the coding sequence can be deduced therefrom. The coding sequences are placed in the relationship of transcriptional regulatory elements and translation initiation and termination codons such that transcripts of appropriate length are generated and translated in the appropriate reading frame to produce the desired functional product.

"형질전환, 형질감염 또는 트랜스펙션"은 세포외부 DNA가, 수반물질이 있고 없는 상태로 숙주 세포로 들어가는 과정을 말한다. "트랜스펙션된 세포"란 세포 외부 DNA가 세포 내로 도입되어 세포 외부 DNA를 가지고 있는 세포를 가리킨다. DNA는 세포로 도입되어 핵산이 염색체에 삽입되거나 혹은 염색체 외 물질로 복제될 수 있다. 그리고 외부 DNA 등이 도입된 세포 등을 '형질전환체'라고 한다."Transfection, transfection or transfection" refers to the process by which extracellular DNA enters a host cell with and without accompanying entities. "Transfected cell" refers to a cell in which extracellular DNA is introduced into a cell and contains extracellular DNA. DNA can be introduced into the cell and the nucleic acid can be inserted into the chromosome or replicated as an extrachromosomal material. And cells into which external DNA is introduced are referred to as " transformants. &Quot;

" 벡터" 라는 용어는 숙주 세포에 삽입되어 숙주 세포 게놈과 재조합되고 이에 삽입되거나, 또는 에피좀으로서 자발적으로 복제하는 컴피턴트 뉴클레오티드 서열을 포함하는 임의의 핵산을 의미한다. 이러한 벡터로는 선형 핵산, 플라스미드, 파지미드, 코스미드, RNA 벡터, 바이러스 벡터 등이 있다.The term "vector" refers to any nucleic acid that is inserted into a host cell, recombined with the host cell genome, inserted into it, or contains a competent nucleotide sequence that replicates spontaneously as an episome. Such vectors include linear nucleic acids, plasmids, phagemids, cosmids, RNA vectors, and viral vectors.

"숙주 세포"는 하나 이상의 DNA 또는 벡터가 도입되는 진핵 또는 원핵세포를 가리키며, 특정 대상 세포만이 아니라 그 자손 혹은 잠재적 자손까지도 가리키는 것으로 이해되어야 한다. 어떤 변형이 돌연변이 혹은 환경적 영향 때문에 후속 세대에 일어날 수 있기 때문에 사실 상기 자손은 부모 세포와 동일하지는 않지만, 본 명세서에서 사용된 바와 같이 상기 용어의 범주 내에서 여전히 포함된다.
"Host cell" refers to a eukaryotic or prokaryotic cell into which one or more DNA or vectors are introduced, and is understood to refer not only to a particular target cell but also to its progeny or potential progeny. In fact, the offspring are not identical to the parent cell, but are still included within the scope of the term, as used herein, since certain modifications may occur in subsequent generations due to mutations or environmental influences.

이하, 본 발명을 상세히 설명한다.
Hereinafter, the present invention will be described in detail.

본 발명은 세포내 미토콘드리아로 목적 물질(화합물, 단백질, 유전자)을 이동 및 분포시킬 수 있는 펩타이드를 제공하는데 그 특징이 있으며, 보다 구체적으로는 서열번호 1의 아미노산 서열을 포함하는 미토콘드리아(mitochondria) 타겟팅용 펩타이드를 제공하는데 그 특징이 있다.The present invention is characterized by providing a peptide capable of moving and distributing a target substance (compound, protein, gene) into an intracellular mitochondria. More specifically, the present invention provides a peptide having an amino acid sequence of mitochondria targeting It is characterized by providing a peptide for use.

시알산 함유 당지질인 강글리오시드(ganglioside)는 비루스나 독소 단백질 및 미생물에 대한 수용체로서 뿐만 아니라 세포의 분화, 증식, 성장과 신호전달, 암화 및 암전이 등에서도 중요한 기능을 하는 것으로 잘 알려져 있다. GM1은 이러한 강글리오시드 수용체의 일종으로 ‘ganglioside Galβ1-3GalNAcβ1-4(Neu5Acα2-3)Galβ1-4Galβ1-1Ceramide’의 약칭이다. GM1과 관련된 종래 연구에서는 랜덤 펩타이드 라이브러리(random peptide library)를 이용한 GM1-결합 펩타이드를 개시하고 있으나, 이러한 GM1-결합 펩타이드의 미토콘드리아 타겟팅 기능에 대해서는 전혀 보고된 바가 없다.It is well known that ganglioside, a sialic acid-containing glycolipid, plays an important role not only as a receptor for viral and toxin proteins and microorganisms, but also for cell differentiation, proliferation, growth and signal transduction, carcinogenesis and metastasis. GM1 is a type of this ganglioside receptor and is an abbreviation of 'ganglioside Galβ1-3GalNAcβ1-4 (Neu5Acα2-3) Galβ1-4Galβ1-1Ceramide'. Previous studies related to GM1 have disclosed GM1-linked peptides using a random peptide library, but there has been no report on the mitochondrial targeting function of such GM1-linked peptides.

본 발명자들은 미토콘드리아로의 타겟팅 효과를 이끌 수 있는 펩타이드 서열을 연구하던 중, 종래 GM1 결합 펩타이드로 알려진 특정서열이 미토콘드리아로 타겟팅 효과를 가짐을 최초로 확인하였다.The present inventors first studied the peptide sequence capable of leading to the targeting effect to the mitochondria, and confirmed for the first time that a specific sequence known as a GM1 binding peptide has a targeting effect to mitochondria.

본 발명의 하기 실시예 1에서는, 종래 GM1 결합 펩타이드로 알려진 특정서열이 미토콘드리아로 타겟팅 효과를 가지는 지를 실험하기 위하여 먼저, 이전에 연구된 논문 (Matubara et al (2007), Langmuir)을 참고하여 글리코스핑고리피드(glycosphingolipid)의 일종인 GM1에 결합하는 펩타이드로 알려져 있는 P3(MVWRLLAPPFSNRLLP) 및 이를 변형한 펩타이드를 제조하였으며, 이들을 각각 GMs(p3), GMs(p3)mt로 명명하였다(하기 표 1 참조).In the following Example 1 of the present invention, in order to test whether a specific sequence known as a GM1-binding peptide has a targeting effect to a mitochondria, first, a previously studied article (Matubara et al (2007), Langmuir) P3 (MVWRLLAPPFSNRLLP), known as a peptide that binds to GM1, a type of glycosphingolipid, and its modified peptide were named GMs (p3) and GMs (p3) ).

한편, 본 발명의 하기 실시예 2에서는 GMs(p3) 및 GMs(p3)mt 펩타이드의 세포내 분포 위치를 확인하기 위하여, 상기 펩타이드를 코딩하는 폴리뉴클레오티드(유전자) 각각을 PCR로 증폭한 후 EGFP(enhanced green fluorescent protein)를 포함하는 플라스미드 벡터에 서브 클로닝한 다음, 이러한 혼성 플라스미드를 HEK293T 세포에 도입하고, 이들을 발현시켜 펩타이드 위치를 형광영상을 통해 확인하였다. 그 결과 GMs(p3):EGFP에 의한 녹색 형광과 미토콘드리아 마커인 MitoTracker에 의한 적색 형광이 세포내 동일 위치에서 관찰되었으나, GMs(p3)mt:EGFP에 의한 녹색 형광은 MitoTracker에 의한 적색 형광과 완전히 다른 패턴을 보여주었다. 이러한 결과를 통해 본 발명의 GMs(p3) 펩타이드가 세포내 미토콘드리아로의 이동 신호를 가진 펩타이드 임을 확인하였다(도 1 참조).In the following Example 2 of the present invention, polynucleotides (genes) encoding the peptides were amplified by PCR to confirm the intracellular distribution positions of GMs (p3) and GMs (p3) mt peptides, and then EGFP enhanced green fluorescent protein), and these hybrid plasmids were introduced into HEK293T cells, and these plasmids were expressed to identify peptide positions through fluorescence imaging. Green fluorescence by GMs (p3): EGFP and red fluorescence by MitoTracker, a mitochondrial marker, were observed at the same location in the cell, but green fluorescence by GMs (p3) mt: EGFP was completely different from red fluorescence by MitoTracker I showed the pattern. From these results, it was confirmed that the GMs (p3) peptide of the present invention is a peptide having a migration signal to intracellular mitochondria (see FIG. 1).

상기와 같은 실험결과를 통해, 본 발명자들은 GMs(p3) 펩타이드가 세포내 미토콘드리아로의 타겟팅에 효과적이라는 사실을 실험적으로 입증하였으며, 본 발명에서는 GMs(p3) 펩타이드의 아미노산 서열을 간단하게 서열번호 1로 표시하였다.The present inventors have experimentally proved that GMs (p3) peptide is effective for targeting to intracellular mitochondria through the above experimental results. In the present invention, the amino acid sequence of GMs (p3) peptide is simply represented by SEQ ID NO: Respectively.

본 발명의 서열번호 1의 아미노산 서열을 포함하는 미토콘드리아 타겟팅용 펩타이드는 화학적으로 합성하거나, 유전자 재조합 기술을 이용하여 얻을 수 있다.The peptide for targeting mitochondria comprising the amino acid sequence of SEQ ID NO: 1 of the present invention can be chemically synthesized or obtained using gene recombination technology.

먼저 본 발명의 서열번호 1의 아미노산 서열을 포함하는 미토콘드리아 타겟팅용 펩타이드는 화학적으로 합성할 수 있다. 화학적으로 합성하여 제조하는 경우, 당 분야에 널리 공지된 화학적 합성(Creighton, Proteins; Structures and Molecular Principles, W. H. Freeman and Co., NY, 1983)에 의해 제조될 수 있다. 대표적인 방법으로서 이들로 한정되는 것은 아니지만 액체 또는 고체상 합성, 단편 응축, F-MOC 또는 T-BOC 화학법이 포함된다(Chemical Approaches to the Synthesis of Peptides and Proteins, Williams et al., Eds., CRC Press, Boca Raton Florida, 1997; A Practical Approach, Athert on & Sheppard, Eds., IRL Press, Oxford, England, 1989).First, the peptide for targeting mitochondria comprising the amino acid sequence of SEQ ID NO: 1 of the present invention can be chemically synthesized. When chemically synthesized, it can be prepared by chemical synthesis (Creighton, Proteins, Structures and Molecular Principles, W. H. Freeman and Co., NY, 1983) well known in the art. Representative methods include, but are not limited to, liquid or solid phase synthesis, fractional condensation, F-MOC or T-BOC chemistry (see for example Chemical Approaches to the Synthesis of Peptides and Proteins, Williams et al., Eds., CRC Press , Boca Raton Florida, 1997; A Practical Approach, Atherton and Sheppard, Eds., IRL Press, Oxford, England, 1989).

또한 본 발명의 서열번호 1의 아미노산 서열을 포함하는 미토콘드리아 타겟팅용 펩타이드는 유전공학적 방법에 의해 제조될 수 있다. 우선, 통상적인 방법에 따라 상기 펩타이드를 코딩하는 헥산(DNA) 서열을 작제한다. DNA 서열은 적절한 프라이머를 사용하여 PCR 증폭함으로써 작제할 수 있다. 다른 방법으로 당업계에 공지된 표준 방법에 의해, 예컨대, 자동 DNA 합성기(예를 들면, Biosearch 또는 Applied iosystems사에서 판매하는 것)를 사용하여 DNA 서열을 합성할 수도 있다. 제작된 DNA 서열은 이 DNA 서열에 작동가능하게 연결되어 그 DNA 서열의 발현을 조절하는 하나 또는 그 이상의 발현 조절 서열 (예: 프로모터, 인핸서 등)을 포함하는 벡터에 삽입시키고, 이로부터 형성된 재조합 발현 벡터로 숙주세포를 형질전환시킨다. 생성된 형질전환체를 상기 DNA 서열이 발현되도록 하기에 적절한 배지 및 조건 하에서 배양하여, 배양물로부터 상기 DNA 서열에 의해 코딩된 실질적으로 순수한 펩타이드를 회수한다. 상기 회수는 당업계에 공지된 방법(예컨대, 크로마토그래피)을 이용하여 수행할 수 있다. 상기에서 '실질적으로 순수한 펩타이드'라 함은 본 발명에 따른 펩타이드가 숙주로부터 유래된 어떠한 다른 단백질도 실질적으로 포함하지 않는 것을 의미한다. 본 발명의 펩타이드 합성을 위한 유전공학적 방법은 다음의 문헌을 참고할 수 있다: Maniatis et al., MolecularCloning; A laboratory Manual, Cold Spring Harbor laboratory, 1982; Sambrook et al., Molecular Cloning: A Laboratory Manual, ColdSpring Harbor Press, N.Y., Second(1998) and Third(2000) Edition; Gene Expression Technology, Method in Enzymology, Genetics and Molecular Biology, Method in Enzymology, Guthrie & Fink (eds.), Academic Press, San Diego, Calif, 1991; 및 Hitzeman et al., J. Biol. Chem., 255:12073-12080, 1990.Also, the peptide for targeting mitochondria comprising the amino acid sequence of SEQ ID NO: 1 of the present invention can be produced by a genetic engineering method. First, a hexane (DNA) sequence encoding the peptide is prepared according to a conventional method. DNA sequences can be constructed by PCR amplification using appropriate primers. Alternatively, DNA sequences may be synthesized by standard methods known in the art, for example, using an automated DNA synthesizer (e.g., commercially available from Biosearch or Applied iosystems). The constructed DNA sequence is inserted into a vector comprising one or more expression control sequences (e.g., promoters, enhancers, etc.) operably linked to the DNA sequence and controlling the expression of the DNA sequence, and recombinant expression Transform the host cell into a vector. The resulting transformant is cultivated under conditions and conditions suitable for the expression of the DNA sequence to recover a substantially pure peptide encoded by the DNA sequence from the culture. The recovery can be carried out using methods known in the art (for example, chromatography). By "substantially pure peptide" herein is meant that the peptide according to the invention is substantially free of any other proteins derived from the host. Genetic engineering methods for peptide synthesis of the present invention can be found in the following references: Maniatis et al., Molecular Cloning; A laboratory Manual, Cold Spring Harbor Laboratory, 1982; Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press, N.Y., Second (1998) and Third (2000) Edition; Gene Expression Technology, Method in Enzymology, Genetics and Molecular Biology, Method in Enzymology, Guthrie & Fink (eds.), Academic Press, San Diego, Calif., 1991; And Hitzeman et al., J. Biol. Chem., 255: 12073-12080,1990.

본 발명은 또한 서열번호 1의 아미노산 서열을 코딩하는 유전자, 또는 상기 유전자가 작동 가능하게 연결된 재조합 벡터를 제공한다.The present invention also provides a gene encoding the amino acid sequence of SEQ ID NO: 1, or a recombinant vector to which said gene is operably linked.

본 발명에 있어서, 상기 서열번호 1의 아미노산 서열을 코딩하는 유전자는 서열번호 1의 아미노산 서열을 갖는 펩타이드를 코딩하는 폴리뉴클레오티드를 의미하며, 이러한 폴리뉴클레오티드는 단위체(monomer)가 공유결합에 의해 길게 사슬모양으로 이어진 뉴클레오티드의 중합체(polymer)로 일정한 길이 이상의 DNA 또는 RNA 가닥이다.In the present invention, the gene encoding the amino acid sequence of SEQ ID NO: 1 refers to a polynucleotide encoding a peptide having the amino acid sequence of SEQ ID NO: 1, and the polynucleotide is a polynucleotide, And is a DNA or RNA strand of a certain length or more.

본 발명에 있어서, 상기 재조합 벡터는 본 발명의 서열번호 1의 아미노산 서열을 코딩하는 유전자를 발현시키기 위한 수단으로서, 플라스미드 벡터, 코즈미드 벡터, 박테리오파아지 벡터 등 공지의 발현벡터를 사용할 수 있으며, 벡터는 DNA 재조합 기술을 이용한 임의의 공지된 방법에 따라 당업자가 용이하게 제조할 수 있다.In the present invention, as the recombinant vector, known expression vectors such as a plasmid vector, a cosmid vector, and a bacteriophage vector can be used as a means for expressing the gene encoding the amino acid sequence of SEQ ID NO: 1 of the present invention. Can be readily prepared by those skilled in the art according to any known method using DNA recombinant techniques.

상기 "작동 가능하게 연결된"은 발현 조절 서열이 서열번호 1의 아미노산 서열을 코딩하는 유전자를 전사 및 해독을 조절하도록 연결된 것을 말하며, 발현 조절 서열(프로모터 포함)의 조절 하에 유전자(폴리뉴클레오티드)가 발현되어 유전자에 의해 코딩되는 본 발명의 펩타이드 생성되도록 정확한 해독 프레임을 유지시키는 것을 포함한다.Operably linked "means that the expression control sequence is linked to regulate the transcription and translation of the gene encoding the amino acid sequence of SEQ ID NO: 1, and the expression of the gene (polynucleotide) under the control of the expression control sequence And maintaining the correct decoding frame to produce the peptide of the invention encoded by the gene.

본 발명의 일 구체예에서 있어서, 상기 재조합 벡터는 프로모터, 서열번호 1의 아미노산 서열을 코딩하는 유전자, 목적 단백질을 코딩하는 유전자가 작동 가능하게 연결될 수 있다.In one embodiment of the present invention, the recombinant vector may be operably linked to a promoter, a gene encoding the amino acid sequence of SEQ ID NO: 1, or a gene encoding a target protein.

본 발명에 있어서, 서열번호 1의 아미노산 서열을 코딩하는 유전자는 미토콘드리아 타겟팅에 효과적이므로, 미토콘드리아로 타겟팅 하고자 하는 목적 유전자에 본 발명의 서열번호 1의 아미노산 서열을 코딩하는 유전자를 작동 가능하게 연결하여 벡터에 삽입한 후, 이를 발현시키는 경우 목적 단백질을 미토콘드리아로 타겟팅할 수 있다.In the present invention, since the gene encoding the amino acid sequence of SEQ ID NO: 1 is effective for targeting mitochondria, a gene encoding the amino acid sequence of SEQ ID NO: 1 of the present invention is operatively linked to a target gene to be targeted to mitochondria, The target protein can be targeted to the mitochondria when it is expressed.

또한, 본 발명의 다른 구체예에 있어서, 상기 재조합 벡터는 프로모터, 서열번호 1의 아미노산 서열을 코딩하는 유전자, 목적 단백질을 코딩하는 유전자 및 형광단백질 유전자가 작동 가능하게 연결될 수 있다. 이러한 경우, 형광단백질의 발현으로 인해 목적 단백질의 미토콘드리아로의 이동/분포 여부를 확인할 수 있는 것이다.In another embodiment of the present invention, the recombinant vector may be operably linked to a promoter, a gene encoding the amino acid sequence of SEQ ID NO: 1, a gene encoding a target protein, and a fluorescent protein gene. In this case, the expression of the fluorescent protein can confirm the movement / distribution of the target protein to the mitochondria.

상기 형광단백질은 녹색 형광단백질(Green Fluorescent Protein: GFP) 또는 적색 형광단백질(Red Fluorescent Protein: RFP)일 수 있으나, 특별히 그 종류를 제한하는 것은 아니다.The fluorescent protein may be Green Fluorescent Protein (GFP) or Red Fluorescent Protein (RFP), but the type of the fluorescent protein is not particularly limited.

본 발명은 또한 상기 재조합 벡터를 세포 내에 도입하는 단계를 포함하는 목적 단백질을 미토콘드리아로 이동 및 분포시키는 방법을 제공한다.The present invention also provides a method for transferring and distributing a target protein to mitochondria, comprising introducing the recombinant vector into a cell.

또한 본 발명은 (a) 서열번호 1의 아미노산 서열을 코딩하는 유전자, 목적 단백질을 코딩하는 유전자 및 형광단백질을 코딩하는 유전자를 포함하는 혼성 플라스미드 준비 단계; (b) 상기 혼성 플라스미드를 세포 내에 도입한 후 유전자가 발현되도록 하는 단계; 및 (c) 상기 형질전환세포 내에서 발현되는 목적 단백질의 이동 및 분포를 형광영상 측정을 통해 확인하는 단계를 포함하는, 세포 내에서 목적 단백질의 미토콘드리아로의 이동과 공간적 분포를 확인하는 방법을 제공한다.(A) preparing a hybrid plasmid comprising a gene encoding the amino acid sequence of SEQ ID NO: 1, a gene encoding a target protein, and a gene encoding a fluorescent protein; (b) introducing the hybrid plasmid into a cell and expressing the gene; And (c) confirming the movement and distribution of the target protein expressed in the transformed cells through fluorescence imaging, to determine the migration and spatial distribution of the target protein into the mitochondria in the cell. do.

본 발명의 상기 (a) 단계는 서열번호 1의 아미노산 서열을 코딩하는 유전자, 목적 단백질을 코딩하는 유전자 및 형광단백질을 코딩하는 유전자를 포함하는 혼성 플라스미드 준비하는 단계이다.The step (a) of the present invention is a step of preparing a hybrid plasmid comprising a gene encoding the amino acid sequence of SEQ ID NO: 1, a gene encoding a target protein, and a gene encoding a fluorescent protein.

본 발명에 있어서, 상기 서열번호 1의 아미노산 서열을 코딩하는 유전자는 미토콘드리아로 타겟팅하는 용도를 가지며, 목적 단백질을 코딩하는 유전자는 미토콘드리아로 이동 및 분포시키고자 하는 특정 단백질을 코딩하는 유전자이며, 형광단백질을 코딩하는 유전자는 목적 단백질이 실제적으로 미토콘드리아로 이동 및 분포되는지는 확인할 수 가시화 기능을 갖는다.In the present invention, the gene encoding the amino acid sequence of SEQ ID NO: 1 has a purpose of targeting mitochondria, and the gene encoding the target protein is a gene encoding a specific protein to be transferred and distributed to mitochondria. Has a visualization function that can confirm whether the target protein actually migrates and distributes to the mitochondria.

본 발명의 상기 (b) 단계는 상기 (a) 단계를 통해 준비된 혼성 플라스미드를 세포 내에 도입한 후 유전자가 발현되도록 하는 단계이다.The step (b) of the present invention is a step of introducing the hybrid plasmid prepared in the step (a) into a cell and expressing the gene.

본 발명에 있어서, 혼성 플라스미드를 세포 내에 도입은, 혼성 플라스미드를 이용하여 세포를 형질전환시키는 것으로서, 형질전환 방법은 당 분야의 통상의 지식을 가진 기술자들에게 잘 알려진 방법을 이용할 수 있다. 예를 들면, PEG(polyethylene glycol), 인산칼슘, DEAE-덱스트란 등의 화학물질을 이용하는 방법; 양이온성 지질을 이용하는 라이포펙션(lipofection) 방법; 마이크로인젝션법; 일렉트로포레이션법; 일렉트로퓨젼법 등을 사용할 수 있으나, 특별히 이를 제한하는 것은 아니다. 형질전환된 세포에서 신호단백질(후기골지망 타겟팅 펩타이드)과 형광단백질이 연결된 목적 단백질이 효율적으로 발현되도록 조건을 최적화할 필요가 있는데, 이는 당 분야에서 통상의 지식을 가진 자에 의하여 각 신호단백질 및 형광단백질의 종류에 따라 적절히 조절하여 선택할 수 있을 것이다.In the present invention, introduction of a hybrid plasmid into a cell transforms a cell using a hybrid plasmid, and the transforming method can be performed by a method well known to a person having ordinary skill in the art. For example, a method using a chemical substance such as PEG (polyethylene glycol), calcium phosphate, DEAE-dextran; Lipofection methods using cationic lipids; Microinjection method; Electroporation method; Electroporation method, and the like may be used, but the present invention is not limited thereto. It is necessary to optimize the conditions so that the target protein to which the signal protein (late target gene targeting peptide) and the fluorescent protein are linked in the transformed cell is efficiently expressed, It may be appropriately selected depending on the type of fluorescent protein.

본 발명의 일 구체예에서, 상기 세포는 진핵세포일 수 있으며, 상기 형광단백질은 녹색 형광단백질(Green Fluorescent Protein: GFP) 또는 적색 형광단백질(Red Fluorescent Protein: RFP)일 수 있다.In one embodiment of the present invention, the cell may be a eukaryotic cell, and the fluorescent protein may be Green Fluorescent Protein (GFP) or Red Fluorescent Protein (RFP).

상기 형질전환된 세포에서 발현되는 단백질로부터 방출되는 특정 파장의 형광을 형광현미경을 사용하여 상기 세포가 살아있는 상태에서 계속하여 영상화할 수 있게 함으로써, 세포 내에서의 목적 단백질의 발현과정 및 미토콘드리아로의 이동과정을 단계별로 세밀하게 가시화할 수 있다.By allowing the fluorescence of a specific wavelength emitted from the protein expressed in the transformed cells to be continuously visualized using the fluorescence microscope in the living state, the expression of the target protein in the cell and the migration to the mitochondria The process can be visualized step by step.

또한 본 발명은 서열번호 1의 아미노산 서열을 포함하는 미토콘드리아 타겟팅용 펩타이드 및 약리학적으로 활성을 나타내는 물질이 결합된 복합체를 유효성분으로 포함하는 미토콘드리아 기능부전과 관련된 질환의 예방 또는 치료용 약제학적 조성물을 제공한다.The present invention also provides a pharmaceutical composition for preventing or treating diseases associated with mitochondrial dysfunction, which comprises, as an active ingredient, a complex comprising a peptide for targeting mitochondria comprising the amino acid sequence of SEQ ID NO: 1 and a pharmacologically active substance to provide.

본 발명의 상기 복합체는 미토콘드리아로의 타겟팅을 이끌 수 있는 펩타이드를 포함함으로써, 미토콘드리아에 작용하여 직접적인 약리학적 활성을 나타낼 수 있는 물질을 미토콘드리아로 이동시켜 머물게 할 수 있다. 따라서 미토콘드리아의 기능부전(기능이상)과 관련된 질환의 예방 또는 치료에 유용하게 사용될 수 있다.The complex of the present invention may contain a peptide capable of targeting to mitochondria so that a substance capable of acting on mitochondria and exhibiting a direct pharmacological activity can be transferred to the mitochondria. Therefore, it can be usefully used for the prevention or treatment of diseases related to dysfunction (dysfunction) of mitochondria.

상기 약리학적으로 활성을 나타내는 물질은 미토콘드리아에 작용하여 특정 활성을 나타낼 수 있는 천연물, 화합물, 단백질 또는 유전자(DNA, RNA 또는 PNA)일 수 있다.The pharmacologically active substance may be a natural product, a compound, a protein or a gene (DNA, RNA or PNA) which can act on mitochondria and exhibit a specific activity.

또한 본 발명은 프로모터, 서열번호 1의 아미노산 서열을 코딩하는 유전자 및 목적 단백질을 코딩하는 유전자가 작동 가능하게 연결된 재조합 벡터를 유효성분으로 포함하는 미토콘드리아 기능부전과 관련된 질환의 예방 또는 치료용 약제학적 조성물을 제공한다.The present invention also provides a pharmaceutical composition for preventing or treating diseases associated with mitochondrial dysfunction, comprising a promoter, a gene encoding the amino acid sequence of SEQ ID NO: 1, and a recombinant vector in which a gene encoding a target protein is operably linked, as an active ingredient .

본 발명의 약제학적 조성물에 의해 예방 또는 치료되는 상기 미토콘드리아 기능부전과 관련된 질환은 미토콘드리아의 DNA의 변이, 결손, 또는 재배열에 유래되는 질환; 미토콘드리아의 호흡 사슬의 핵-암호화 결함 단백질 성분에 의해 유래되는 질환; 노화 관련 질환; 세포독성 암 화학요법제의 투여에 의해 유래되는 질환; 미토콘드리아 복합체 Ι, Ⅱ, Ⅲ, Ⅳ 또는 Ⅴ의 활성 결함에 의해 유래되는 질환; 선천성 미토콘드리아 질환; 신경퇴행성 질환; 및 신경근육 퇴행성 질환 등일 수 있다.The diseases associated with the mitochondrial dysfunction that are prevented or treated by the pharmaceutical composition of the present invention include diseases caused by mutation, deletion, or rearrangement of DNA of mitochondria; A disease caused by the nuclear-coded defective protein component of the respiratory chain of mitochondria; Aging-related diseases; A disease caused by administration of a cytotoxic cancer chemotherapeutic agent; Diseases caused by active defects of the mitochondrial complexes I, II, III, IV or V; Congenital mitochondrial disease; Neurodegenerative disease; And neuromuscular degenerative diseases.

상기와 같은 질환의 구체적인 예를 들면, 알츠하이머병, 파킨슨병, 헌팅톤병, 근육 이영양증, 근긴장성 이영양증, 만성 피로 증후군, 프리드리히 운동실소증, 간질, 말초신경병, 시신경병, 자율 신경병, 신경유래의 장 기능부전, 감각신경의 난청, 신경유래의 방광 기능부전, 편두통, 운동실소증, 신세뇨관성 산증, 확장성 심근증, 지방간염, 간부전, 유산성혈증, 미토콘드리아 뇌근증(mitochondrial encephalopathy with lactic acidemia and strokelike episodes; MELAS), 레버 시신경위축증(Leber's hereditary optic neuropathy: LHON), MERRF 증후군, MNGIE(Mitochondrial neurogastrointestinal encephalopathy syndrome), NARP((neuropathy, ataxia, and retinitis pigmantosa), 바쓰 증후군(Barth Syndrome), 리증후군 (Leigh Syndrome) 및 칸스-사이레스 증후군 등일 수 있다.Specific examples of such diseases include Alzheimer's disease, Parkinson's disease, Huntington's disease, muscular dystrophy, myotonic dystrophy, chronic fatigue syndrome, Friedrich's alexithymia, epilepsy, peripheral neuropathy, optic nerve disease, autonomic neuropathy, It has been reported that the incidence of mitochondrial encephalopathy with lactic acidemia and strokelike is higher than that of patients with acute myocardial infarction. (MELAS), Leber's hereditary optic neuropathy (LHON), MERRF syndrome, MNGIE (Mitochondrial neurogastrointestinal encephalopathy syndrome), NARP (neuropathy, ataxia and retinitis pigmantosa), Barth syndrome, Lee's syndrome Leigh Syndrome) and Kans-sirece syndrome.

본 발명의 약제학적 조성물은 상기 유효성분 이외에 약제학적으로 적합하고 생리학적으로 허용되는 보조제를 사용하여 제조될 수 있으며, 상기 보조제로는 부형제, 붕해제, 감미제, 결합제, 피복제, 팽창제, 윤활제, 활택제 또는 향미제 등을 사용할 수 있다.The pharmaceutical composition of the present invention can be prepared by using pharmaceutically acceptable and physiologically acceptable adjuvants in addition to the above-mentioned active ingredients. Examples of the adjuvants include excipients, disintegrants, sweeteners, binders, coating agents, swelling agents, lubricants, A lubricant or a flavoring agent can be used.

상기 약제학적 조성물은 투여를 위해서 상기 기재한 유효성분 이외에 추가로 약제학적으로 허용 가능한 담체를 1종 이상 포함하여 약제학적 조성물로 바람직하게 제제화할 수 있다.The pharmaceutical composition may be formulated into a pharmaceutical composition containing at least one pharmaceutically acceptable carrier in addition to the above-described active ingredients for administration.

상기 약제학적 조성물의 제제 형태는 과립제, 산제, 정제, 피복정, 캡슐제, 좌제, 액제, 시럽, 즙, 현탁제, 유제, 점적제 또는 주사 가능한 액제 등이 될 수 있다. 예를 들어, 정제 또는 캡슐제의 형태로의 제제화를 위해, 유효 성분은 에탄올, 글리세롤, 물 등과 같은 경구, 무독성의 약제학적으로 허용 가능한 불활성 담체와 결합될 수 있다. 또한, 원하거나 필요한 경우, 적합한 결합제, 윤활제, 붕해제 및 발색제 또한 혼합물로 포함될 수 있다. 적합한 결합제는 이에 제한되는 것은 아니나, 녹말, 젤라틴, 글루코스 또는 베타-락토오스와 같은 천연 당, 옥수수 감미제, 아카시아, 트래커캔스 또는 소듐올레이트와 같은 천연 및 합성 검, 소듐 스테아레이트, 마그네슘 스테아레이트, 소듐 벤조에이트, 소듐 아세테이트, 소듐 클로라이드 등을 포함한다. 붕해제는 이에 제한되는 것은 아니나, 녹말, 메틸 셀룰로스, 아가, 벤토니트, 잔탄 검 등을 포함한다. 액상 용액으로 제제화되는 조성물에 있어서 허용 가능한 약제학적 담체로는, 멸균 및 생체에 적합한 것으로서, 식염수, 멸균수, 링거액, 완충 식염수, 알부민 주사용액, 덱스트로즈 용액, 말토 덱스트린 용액, 글리세롤, 에탄올 및 이들 성분 중 1 성분 이상을 혼합하여 사용할 수 있으며, 필요에 따라 항산화제, 완충액, 정균제 등 다른 통상의 첨가제를 첨가할 수 있다. 또한 희석제, 분산제, 계면활성제, 결합제 및 윤활제를 부가적으로 첨가하여 수용액, 현탁액, 유탁액 등과 같은 주사용 제형, 환약, 캡슐, 과립 또는 정제로 제제화할 수 있다. 더 나아가 해당분야의 적절한 방법으로 Remington's Pharmaceutical Science, Mack Publishing Company, Easton PA에 개시되어 있는 방법을 이용하여 각 질환에 따라 또는 성분에 따라 바람직하게 제제화 할 수 있다.The pharmaceutical composition may be in the form of granules, powders, tablets, coated tablets, capsules, suppositories, liquids, syrups, juices, suspensions, emulsions, drops or injectable solutions. For example, for formulation into tablets or capsules, the active ingredient may be combined with an oral, non-toxic pharmaceutically acceptable inert carrier such as ethanol, glycerol, water, and the like. Also, if desired or necessary, suitable binders, lubricants, disintegrants and coloring agents may also be included as a mixture. Suitable binders include, but are not limited to, natural sugars such as starch, gelatin, glucose or beta-lactose, natural and synthetic gums such as corn sweeteners, acacia, tracker candles or sodium oleate, sodium stearate, magnesium stearate, sodium Benzoate, sodium acetate, sodium chloride, and the like. Disintegrants include, but are not limited to, starch, methyl cellulose, agar, bentonite, xanthan gum and the like. Acceptable pharmaceutical carriers for compositions that are formulated into a liquid solution include sterile water and sterile water suitable for the living body such as saline, sterile water, Ringer's solution, buffered saline, albumin injection solution, dextrose solution, maltodextrin solution, glycerol, One or more of these components may be mixed and used. If necessary, other conventional additives such as an antioxidant, a buffer, and a bacteriostatic agent may be added. In addition, diluents, dispersants, surfactants, binders, and lubricants may be additionally added to formulate into injectable solutions, pills, capsules, granules or tablets such as aqueous solutions, suspensions, emulsions and the like. Further, it can be suitably formulated according to each disease or ingredient, using the method disclosed in Remington's Pharmaceutical Science, Mack Publishing Company, Easton PA as an appropriate method in the field.

또한 본 발명은 미토콘드리아 기능부전과 관련된 질환의 예방 또는 치료용 의약의 제조를 위한 상기 (ⅰ) 서열번호 1의 아미노산 서열을 포함하는 미토콘드리아 타겟팅용 펩타이드 및 약리학적으로 활성을 나타내는 물질이 결합된 복합체 또는 (ⅱ) 프로모터, 서열번호 1의 아미노산 서열을 코딩하는 유전자 및 목적 단백질을 코딩하는 유전자가 작동 가능하게 연결된 재조합 벡터를 유효성분으로 포함하는 조성물의 용도를 제공한다. 상기한 복합체 또는 재조합 벡터를 유효성분으로 포함하는 본 발명의 조성물은 미토콘드리아 기능부전과 관련된 질환의 예방 또는 치료용 의약의 제조를 위한 용도로 이용될 수 있다.The present invention also relates to a kit for the preparation of a medicament for preventing or treating diseases associated with mitochondrial dysfunction, comprising (i) a complex comprising a peptide for targeting mitochondria comprising the amino acid sequence of SEQ ID NO: 1 and a pharmacologically active substance, (Ii) a promoter, a gene encoding the amino acid sequence of SEQ ID NO: 1, and a recombinant vector operably linked to a gene encoding a target protein as an active ingredient. The composition of the present invention comprising the above complex or recombinant vector as an active ingredient can be used for the preparation of a medicament for the prevention or treatment of diseases related to mitochondrial dysfunction.

또한 본 발명은 포유동물에게 (ⅰ) 서열번호 1의 아미노산 서열을 포함하는 미토콘드리아 타겟팅용 펩타이드 및 약리학적으로 활성을 나타내는 물질이 결합된 복합체 또는 (ⅱ) 프로모터, 서열번호 1의 아미노산 서열을 코딩하는 유전자 및 목적 단백질을 코딩하는 유전자가 작동 가능하게 연결된 재조합 벡터를 투여하는 것을 포함하는 미토콘드리아 기능부전과 관련된 질환의 예방 또는 치료방법을 제공한다.The present invention also relates to a method for producing a mitochondrial targeting peptide comprising the steps of: (i) providing a complex comprising a peptide for targeting mitochondria and a pharmacologically active substance comprising the amino acid sequence of SEQ ID NO: 1; or (ii) a promoter, There is provided a method for preventing or treating a disease associated with mitochondrial dysfunction, which comprises administering a recombinant vector operably linked to a gene encoding a gene and a target protein.

여기에서 사용된 용어 "포유동물"은 치료, 관찰 또는 실험의 대상인 포유동물을 말하며, 바람직하게는 인간을 말한다.The term "mammal " as used herein refers to a mammal that is the subject of treatment, observation or experimentation, preferably a human.

여기에서 사용된 용어 "치료상 유효량"은 연구자, 수의사, 의사 또는 기타 임상에 의해 생각되는 조직계, 동물 또는 인간에서 생물학적 또는 의학적 반응을 유도하는 유효 성분 또는 약학적 조성물의 양을 의미하는 것으로, 이는 치료되는 질환 또는 장애의 증상의 완화를 유도하는 양을 포함한다. 본 발명의 유효 성분에 대한 치료상 유효 투여량 및 투여횟수는 원하는 효과에 따라 변화될 것임은 당업자에게 자명하다. 그러므로 투여될 최적의 투여량은 당업자에 의해 쉽게 결정될 수 있으며, 질환의 종류, 질환의 중증도, 조성물에 함유된 유효성분 및 다른 성분의 함량, 제형의 종류, 및 환자의 연령, 체중, 일반 건강 상태, 성별 및 식이, 투여 시간, 투여 경로 및 조성물의 분비율, 치료기간, 동시 사용되는 약물을 비롯한 다양한 인자에 따라 조절될 수 있다.The term "therapeutically effective amount " as used herein refers to the amount of active ingredient or pharmaceutical composition that induces a biological or medical response in a tissue system, animal or human, as contemplated by a researcher, veterinarian, physician or other clinician, The amount that induces the relief of the symptoms of the disease or disorder being treated. It will be apparent to those skilled in the art that the therapeutically effective dose and the number of administrations of the active ingredient of the present invention will vary depending on the desired effect. The optimal dosage to be administered can therefore be readily determined by those skilled in the art and will depend upon the nature of the disease, the severity of the disease, the amount of active and other ingredients contained in the composition, the type of formulation, and the age, , Sex and diet, time of administration, route of administration and rate of administration of the composition, duration of treatment, concurrent administration of the drug, and the like.

본 발명의 치료방법에서 상기한 복합체 또는 재조합 벡터를 유효성분으로 포함하는 조성물은 경구, 직장, 정맥내, 동맥내, 복강내, 근육내, 흉골내, 경피, 국소, 안구내 또는 피내 경로를 통해 통상적인 방식으로 투여할 수 있다.
In the therapeutic method of the present invention, the above-described complex or composition comprising the recombinant vector as an active ingredient can be administered orally, rectally, intravenously, intraarterially, intraperitoneally, intramuscularly, intramuscularly, transdermally, topically, And can be administered in a conventional manner.

이하, 실시예를 통하여 본 발명을 보다 상세히 설명하고자 한다. 이들 실시예는 본 발명을 보다 구체적으로 설명하기 위한 것으로, 본 발명의 범위가 이들 실시예에 한정되는 것은 아니다.
Hereinafter, the present invention will be described in more detail with reference to Examples. These examples are for further illustrating the present invention, and the scope of the present invention is not limited to these examples.

<< 실시예Example 1> 1>

미토콘드리아로의 Mitochondrial 타겟팅Targeting 효과를 이끌 수 있는  That can lead to an effect 펩타이드Peptides

본 발명자들은 종래 GM1(ganglioside Galβ1-3GalNAcβ1-4(Neu5Acα2-3)Galβ1-4Galβ1-1Ceramide) 결합 펩타이드로 알려진 특정서열이 미토콘드리아로 타겟팅 효과를 가지는 지를 실험하기 위하여 먼저, 이전에 연구된 논문 (Matubara et al (2007), Langmuir)을 참고하여 글리코스핑고리피드(glycosphingolipid)의 일종인 GM1 결합 펩타이드로 알려져 있는 P3(MVWRLLAPPFSNRLLP) 및 이를 변형한 펩타이드를 제조하였다.
The present inventors first examined whether a specific sequence known as GM1 (ganglioside Galβ1-3GalNAcβ1-4 (Neu5Acα2-3) Galβ1-4Galβ1-1Ceramide) binding peptide has a targeting effect on mitochondria, (MVWRLLAPPFSNRLLP), which is a kind of glycosphingolipid, which is known as a GM1 binding peptide, and a modified peptide thereof, were prepared by referring to the above-mentioned method.

GM1 결합 펩타이드 및 이를 변형한 펩타이드 제조GM1 binding peptide and its modified peptide 펩타이드 종류Type of peptide 펩터이드 서열Peptidase sequence 약칭Abbreviation GM1 결합 펩타이드GM1 binding peptide MVWRLLAPPFSNRLLPMVWRLLAPPFSNRLLP GMs(p3)GMs (p3) 변형 펩타이드Modified peptide MV G RLLAPPFSN E LLPMV G RLLAPPFSN E LLP GMs(p3)mtGMs (p3) mt

<< 실시예Example 2>  2>

GM1GM1 결합  Combination 펩타이드Peptides 및 이의 변형  And its variants 펩타이드의Of peptide 세포내Intracellular 분포 확인 Check distribution

본 발명자들은 상기 표 1의 GM1 결합 펩타이드 및 이의 변형 펩타이드의 세포내에서 분포 위치를 확인하기 위하여, 상기 표 1의 서열을 코딩하는 폴리뉴클레오티드(유전자) 각각을 PCR로 증폭한 후 EGFP(enhanced green fluorescent protein)를 포함하는 플라스미드 벡터에 서브 클로닝한 다음, 혼성 플라스미드를 HEK293T 세포에 도입하고, 이들을 발현시켜 펩타이드 위치를 형광영상을 통해 확인하였다.To confirm the distribution of the GM1-binding peptide and the modified peptide thereof in Table 1, the present inventors amplified each of the polynucleotides (genes) encoding the sequence of Table 1 by PCR and amplified with EGFP (enhanced green fluorescent protein), and then hybrid plasmids were introduced into HEK293T cells. These plasmids were expressed to identify peptide positions through fluorescence imaging.

자세하게는, 먼저 상기 표 1의 GM1 결합 펩타이드 및 이의 변형 펩타이드를 코딩하는 폴리뉴클레오티드(유전자) 각각을 제조한 후(표 2 참조) 이들을 하기 표 3의 특정 프라이머 서열을 이용하여 PCR로 증폭하였다. PCR의 조건은 하기 표 4와 같다. 이렇게 증폭된 폴리펩티드는 pcDNA3.1 (BD bioscience clontech)벡터에 HindIII/XbaI 자리에 넣고 EGFP를 c-말단에 연결함으로써 혼성 플라스미드를 제조하였다. 그런 다음, DMEM 배양액(10% FBS+ Penicillin/streptomycin)에서 37 ℃(5% CO2)에서 배양된 HEK293T 세포에, 상기 혼성 플라스미드를 Ca2+ phosphate(Clontech)방법을 이용해 형질주입(transfection)하였다. 이후 혼성 플라스미드가 발현됨에 따라 HEK293T 세포내의 형광영상을 Cal Zeiss 공초점 현미경을 이용해 측정하였다. 이때 미토콘드리아 마커로 MitoTracker를 이용하였다.Specifically, each of the polynucleotides (genes) encoding the GM1-binding peptide and its modified peptide of Table 1 was first prepared (see Table 2) and then amplified by PCR using the specific primer sequence shown in Table 3 below. The conditions of the PCR are shown in Table 4 below. The hybridized plasmid was prepared by ligating the amplified polypeptide to the HindIII / XbaI site of pcDNA3.1 (BD bioscience clontech) and ligating EGFP to the c-terminus. Then, the hybrid plasmid was transfected into HEK293T cells cultured in DMEM medium (10% FBS + Penicillin / streptomycin) at 37 ° C (5% CO 2) using Ca 2+ phosphate (Clontech) method. Fluorescence images in HEK293T cells were then measured using a Cal Zeiss confocal microscope as hybrid plasmids were expressed. MitoTracker was used as a mitochondrial marker.

그 결과는 도 1에서 나타낸 바와 같이, GMs(p3):EGFP에 의한 녹색 형광과 미토콘드리아 마커인 MitoTracker에 의한 적색 형광이 세포내 동일 위치에서 관찰되었으나, GMs(p3)mt:EGFP에 의한 녹색 형광은 MitoTracker (MitoTracker Red FM, Molecular probe)에 의한 적색 형광과 완전히 다른 패턴을 보여주었다. 이러한 결과를 통해 본 발명의 GMs(p3) 펩타이드가 세포내 미토콘드리아로의 이동 신호를 가진 펩타이드 임을 확인할 수 있었다.
As shown in FIG. 1, the green fluorescence by GMs (p3): EGFP and the red fluorescence by MitoTracker, which is a mitochondrial marker, were observed at the same position in the cell, while the green fluorescence by GMs (p3) Showed a completely different pattern from red fluorescence by MitoTracker (MitoTracker Red FM, Molecular probe). From these results, it was confirmed that the GMs (p3) peptide of the present invention is a peptide having a migration signal to intracellular mitochondria.

GM1 결합 펩타이드 및 이를 변형한 펩타이드 각각의 폴리뉴클레오티드 서열The polynucleotide sequence of each GM1-binding peptide and its modified peptide 펩타이드 종류Type of peptide 약칭Abbreviation 폴리뉴클레오티드 서열Polynucleotide sequence GM1 결합 펩타이드GM1 binding peptide GMs(p3)GMs (p3) 5’-ATG TGG CGA CTG CTG GCA CCT CCT TTC TCA AAC CGA CTG CTG CCT-3’5'-ATG TGG CGA CTG CTG GCA CCT CCT TTC TCA AAC CGA CTG CTG CCT-3 ' 변형 펩타이드Modified peptide GMs(p3)mtGMs (p3) mt 5’-ATG GGC CGA CTG CTG GCA CCT CCT TTC TCA AAC GAG CTG CTG CCT-3’5'-ATG GGC CGA CTG CTG GCA CCT CCT TTC TCA AAC GAG CTG CTG CCT-3 '

PCR에 사용된 프라이머 서열The primer sequences used in PCR 유전자
(폴리뉴클레오티드)
gene
(Polynucleotide)
프라이머 서열Primer sequence
GMs(p3)GMs (p3) sensesense 5’-CGC CCA AGC TTG CCA CCA TGG TGT GGC GAC TGC TGG CAC CTC CTT T-3’5'-CGC CCA AGC TTG CCA CCA TGG TGT GGC GAC TGC TGG CAC CTC CTT T-3 ' antisenseantisense 5’-GCT CTA GAA GGC AGC AGT CGG TTT GAG AAA GGA GGT GCC AGC AGT C-3’5'-GCT CTA GAA GGC AGC AGT CGG TTT GAG AAA GGA GGT GCC AGC AGT C-3 ' GMs(p3)mtGMs (p3) mt sensesense 5’- CGC CCA AGC TTG CCA CCA TGG TGG GCC GAC TGC TG-3’5'-CGC CCA AGC TTG CCA CCA TGG TGG GCC GAC TGC TG-3 ' antisenseantisense 5’-GCT CTA GAA GGC AGC AGC TCG TTT GAG AA-3’5'-GCT CTA GAA GGC AGC AGC TCG TTT GAG AA-3 '

PCR 조건PCR conditions 온도Temperature 시간time CycleCycle 94℃94 ° C 2분2 minutes 1One 94℃94 ° C 20초20 seconds 3030 48℃48 ° C 20초20 seconds 72℃72 ℃ 40초40 seconds 72℃72 ℃ 5분5 minutes 44 4℃4 ℃ 1One

이제까지 본 발명에 대하여 그 바람직한 실시예들을 중심으로 살펴보았다. 본 발명이 속하는 기술 분야에서 통상의 지식을 가진 자는 본 발명이 본 발명의 본질적인 특성에서 벗어나지 않는 범위에서 변형된 형태로 구현될 수 있음을 이해할 수 있을 것이다. 그러므로 개시된 실시예들은 한정적인 관점이 아니라 설명적인 관점에서 고려되어야 한다. 본 발명의 범위는 전술한 설명이 아니라 특허청구범위에 나타나 있으며, 그와 동등한 범위 내에 있는 모든 차이점은 본 발명에 포함된 것으로 해석되어야 할 것이다.The present invention has been described with reference to the preferred embodiments. It will be understood by those skilled in the art that various changes in form and details may be made therein without departing from the spirit and scope of the invention as defined by the appended claims. Therefore, the disclosed embodiments should be considered in an illustrative rather than a restrictive sense. The scope of the present invention is defined by the appended claims rather than by the foregoing description, and all differences within the scope of equivalents thereof should be construed as being included in the present invention.

GM1: ganglioside Galβ1-3GalNAcβ1-4(Neu5Acα2-3)Galβ1-4Galβ1-1CeramideGM1: ganglioside Galβ1-3GalNAcβ1-4 (Neu5Acα2-3) Galβ1-4Galβ1-1Ceramide

<110> Kyungpook National University Industry-Academic Cooperation Foundation <120> Peptide for targeting to mitochondria <130> PN1211-516 <160> 1 <170> KopatentIn 2.0 <210> 1 <211> 16 <212> PRT <213> Artificial Sequence <220> <223> mitochondria targeting peptide <400> 1 Met Val Trp Arg Leu Leu Ala Pro Pro Phe Ser Asn Arg Leu Leu Pro 1 5 10 15 <110> Kyungpook National University Industry-Academic Cooperation Foundation <120> Peptide for targeting to mitochondria <130> PN1211-516 <160> 1 <170> Kopatentin 2.0 <210> 1 <211> 16 <212> PRT <213> Artificial Sequence <220> <223> mitochondria targeting peptide <400> 1 Met Val Trp Arg Leu Leu Ala Pro Pro Phe Ser Asn Arg Leu Leu Pro   1 5 10 15

Claims (8)

서열번호 1의 아미노산 서열을 포함하는 미토콘드리아 타겟팅용 펩타이드.A peptide for targeting mitochondria comprising the amino acid sequence of SEQ ID NO: 1. 서열번호 1의 아미노산 서열을 코딩하는 유전자를 포함하는 재조합 벡터.A recombinant vector comprising a gene encoding the amino acid sequence of SEQ ID NO: 1. 제2항에 있어서,
상기 재조합 벡터는 프로모터, 서열번호 1의 아미노산 서열을 코딩하는 유전자 및 목적 단백질을 코딩하는 유전자가 작동 가능하게 연결된 것을 특징으로 하는 재조합 벡터.
3. The method of claim 2,
Wherein the recombinant vector is operably linked to a promoter, a gene encoding the amino acid sequence of SEQ ID NO: 1, and a gene encoding a target protein.
제2항 또는 제3항의 재조합 벡터를 세포 내에 도입하는 단계를 포함하는 목적 단백질을 미토콘드리아로 이동 및 분포시키는 방법. A method for transferring and distributing a target protein to mitochondria, comprising introducing the recombinant vector of claim 2 or 3 into a cell. 서열번호 1의 아미노산 서열을 포함하는 미토콘드리아 타겟팅용 펩타이드 및 약리학적으로 활성을 나타내는 물질이 결합된 복합체를 유효성분으로 포함하는 미토콘드리아 기능부전과 관련된 질환의 예방 또는 치료용 약제학적 조성물.1. A pharmaceutical composition for preventing or treating a disease associated with mitochondrial dysfunction comprising, as an active ingredient, a complex comprising a peptide for targeting mitochondria comprising the amino acid sequence of SEQ ID NO: 1 and a pharmacologically active substance. 제5항에 있어서,
상기 약리학적으로 활성을 나타내는 물질은 화합물, 단백질 또는 유전자인 것을 특징으로 하는 약제학적 조성물.
6. The method of claim 5,
Wherein the pharmacologically active substance is a compound, a protein or a gene.
프로모터, 서열번호 1의 아미노산 서열을 코딩하는 유전자 및 목적 단백질을 코딩하는 유전자가 작동 가능하게 연결된 재조합 벡터를 유효성분으로 포함하는 미토콘드리아 기능부전과 관련된 질환의 예방 또는 치료용 약제학적 조성물.1. A pharmaceutical composition for preventing or treating a disease associated with mitochondrial dysfunction, comprising a promoter, a gene encoding the amino acid sequence of SEQ ID NO: 1, and a recombinant vector operably linked to a gene encoding a target protein as an active ingredient. 제5항 내지 제7항 중 어느 한 항에 있어서,
상기 미토콘드리아 기능부전과 관련된 질환은 알쯔하이머병, 파킨슨병, 헌팅톤병, 근육 이영양증, 근긴장성 이영양증, 만성 피로 증후군, 프리드리히 운동실소증, 간질, 말초신경병, 시신경병, 자율 신경병, 신경유래의 장 기능부전, 감각신경의 난청, 신경유래의 방광 기능부전, 편두통, 운동실소증, 신세뇨관성 산증, 확장성 심근증, 지방간염, 간부전, 유산성혈증, 미토콘드리아 뇌근증(mitochondrial encephalopathy with lactic acidemia and strokelike episodes; MELAS), 레버 시신경위축증(Leber's hereditary optic neuropathy: LHON), MERRF 증후군, MNGIE(Mitochondrial neurogastrointestinal encephalopathy syndrome), NARP((neuropathy, ataxia, and retinitis pigmantosa), 바쓰 증후군(Barth Syndrome), 리증후군 (Leigh Syndrome) 및 칸스-사이레스 증후군으로 이루어진 군으로부터 선택되는 것을 특징으로 하는 약제학적 조성물.
8. The method according to any one of claims 5 to 7,
The diseases associated with mitochondrial dysfunction include, but are not limited to, Alzheimer's disease, Parkinson's disease, Huntington's disease, muscular dystrophy, myotonic dystrophy, chronic fatigue syndrome, Friedreich's ataxia, epilepsy, peripheral neuropathy, optic nerve disease, autonomic neuropathy, , Mitral regurgitation, sensory nerve deafness, neurodegenerative bladder dysfunction, migraine, athlete's syndrome, renal tubular acidosis, dilated cardiomyopathy, fatty liver, liver failure, abortion, mitochondrial cerebral apathy MELAS, Leber's hereditary optic neuropathy (LHON), MERRF syndrome, MNGIE, NARP, Barth syndrome, Leigh Syndrome, ) And Kans-sire syndrome. &Lt; RTI ID = 0.0 &gt; 11. &lt; / RTI &gt;
KR20130016622A 2013-02-15 2013-02-15 Peptide for targeting to mitochondria KR101490580B1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
KR20130016622A KR101490580B1 (en) 2013-02-15 2013-02-15 Peptide for targeting to mitochondria

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
KR20130016622A KR101490580B1 (en) 2013-02-15 2013-02-15 Peptide for targeting to mitochondria

Publications (2)

Publication Number Publication Date
KR20140103002A true KR20140103002A (en) 2014-08-25
KR101490580B1 KR101490580B1 (en) 2015-02-05

Family

ID=51747550

Family Applications (1)

Application Number Title Priority Date Filing Date
KR20130016622A KR101490580B1 (en) 2013-02-15 2013-02-15 Peptide for targeting to mitochondria

Country Status (1)

Country Link
KR (1) KR101490580B1 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20180019444A (en) 2016-08-16 2018-02-26 경북대학교 산학협력단 Composition and vector for nuclear exclusion and targeting to plasma membrane

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR102527406B1 (en) * 2021-01-15 2023-04-28 아주대학교산학협력단 Composition for preventing or treating mitochondrial dysfunction-related diseases
WO2021145743A1 (en) * 2020-01-16 2021-07-22 아주대학교산학협력단 Mitochondria-targeting protein and use thereof

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8283444B2 (en) 2003-10-24 2012-10-09 Wake Forest University Non-viral delivery of compounds to mitochondria
RU2318500C2 (en) * 2005-10-18 2008-03-10 Общество С Ограниченной Ответственностью "Митотехнология" Method for on body by target delivery of biologically active substances in mitochondria, pharmaceutical composition for its realization and compound used for this aim
KR20100074177A (en) 2007-09-10 2010-07-01 유니버시티 오브 매사추세츠 Mitochondria-targeted anti-tumour agents

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20180019444A (en) 2016-08-16 2018-02-26 경북대학교 산학협력단 Composition and vector for nuclear exclusion and targeting to plasma membrane

Also Published As

Publication number Publication date
KR101490580B1 (en) 2015-02-05

Similar Documents

Publication Publication Date Title
Rodrigues et al. Therapeutic potential of targeting mitochondrial dynamics in cancer
US10787492B2 (en) Cell-permeable (iCP)-SOCS3 recombinant protein and uses thereof
EP3013353B1 (en) Cell-permeable peptide inhibitors of the jnk signal transduction pathway for the treatment of cystitis
JPH01501283A (en) Novel type of colony stimulating factor-1
US11041157B2 (en) Slit2D2-HSA fusion protein and use thereof against tumours
Muratovska et al. Targeting large molecules to mitochondria
US20220339251A1 (en) Compositions and methods for recombinant nerve growth factor
KR101490580B1 (en) Peptide for targeting to mitochondria
US9550981B2 (en) Modified tafazzin proteins and methods of making and using the same
Brown et al. Functional amyloids in the human body
KR20050114229A (en) Use of bv8 and/or eg-vegf to promote hematopoiesis
EP3884055B1 (en) Double and inducible suicide gene construct and its use in gene therapy
AU2001259453B2 (en) Methods for stimulating nervous system regeneration and repair by regulating arginase 1 and polyamine synthesis
EP2264062B1 (en) Beta sheet inhibiting peptides for preventing and/or treating alzheimer&#39;s disease
JP2018506506A (en) Neurodegenerative disorder
JP2001527402A (en) NGF mutant
EP3230308B1 (en) Methods for treating and preventing cardiomyopathy
US20220177547A1 (en) Ferritin nanocage for multi-displaying trail trimer and cancer-targeting peptide and use thereof as anticancer agent
WO2004105784A1 (en) Class iii slrp agonists for the reduction of blood vessel formation
JPH08507204A (en) RAS-related GAP protein
JP2007209214A (en) Insulin secretion-inducing agent, insulin secretion-inducing composition and method for producing the composition and virus vector for gene therapy
Frison et al. The 18 kDa Translocator protein (TSPO): cholesterol trafficking and the biology of a prognostic and therapeutic mitochondrial target
KR20190080814A (en) Recombinant fusion protein of BAF57 and uses thereof
CN110483645B (en) Mitochondrial localization proton pump type rhodopsin, mutant protein thereof and application thereof
CN112043819B (en) Use of LAPF and related substances for anti-infection

Legal Events

Date Code Title Description
A201 Request for examination
E902 Notification of reason for refusal
E701 Decision to grant or registration of patent right
GRNT Written decision to grant
FPAY Annual fee payment

Payment date: 20171208

Year of fee payment: 4

FPAY Annual fee payment

Payment date: 20200102

Year of fee payment: 6