KR20140037698A - Composition for antimicrobial or antivirus comprising telomerase peptide - Google Patents

Composition for antimicrobial or antivirus comprising telomerase peptide Download PDF

Info

Publication number
KR20140037698A
KR20140037698A KR1020120104178A KR20120104178A KR20140037698A KR 20140037698 A KR20140037698 A KR 20140037698A KR 1020120104178 A KR1020120104178 A KR 1020120104178A KR 20120104178 A KR20120104178 A KR 20120104178A KR 20140037698 A KR20140037698 A KR 20140037698A
Authority
KR
South Korea
Prior art keywords
leu
arg
ala
val
pro
Prior art date
Application number
KR1020120104178A
Other languages
Korean (ko)
Other versions
KR102038487B1 (en
Inventor
김상재
Original Assignee
주식회사 카엘젬백스
김상재
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 카엘젬백스, 김상재 filed Critical 주식회사 카엘젬백스
Priority to KR1020120104178A priority Critical patent/KR102038487B1/en
Publication of KR20140037698A publication Critical patent/KR20140037698A/en
Application granted granted Critical
Publication of KR102038487B1 publication Critical patent/KR102038487B1/en

Links

Images

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/12Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
    • C12N9/1241Nucleotidyltransferases (2.7.7)
    • C12N9/1276RNA-directed DNA polymerase (2.7.7.49), i.e. reverse transcriptase or telomerase

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • General Engineering & Computer Science (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biochemistry (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Molecular Biology (AREA)
  • Marine Sciences & Fisheries (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Immunology (AREA)
  • Microbiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Epidemiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)

Abstract

The present invention provides a composition for antimicrobial, antifungal or antiviral comprising a peptide having a sequence of SEQ ID NO: 1, a peptide which is a fragment of SEQ ID NO: 1, or a peptide having a sequence homology of 80% or more with the peptide sequence as an active ingredient. It starts.

Description

Composition for antimicrobial or antivirus comprising telomerase peptide

The present invention relates to a composition comprising a telomerase peptide having antimicrobial or antiviral activity.

Telomere is a genetic material that is repeatedly present at the end of a chromosome, and is known to prevent damage to the chromosome or its binding to other chromosomes. As the cell divides, the length of the telomere is getting shorter. When there is more than a certain number of cell divisions, the telomere becomes very short, and the cell stops dividing and dies. On the other hand, it is known that lengthening the telomeres prolongs the life of the cells. For example, it is known that the cancer cells secrete an enzyme called telomerase and prevent the shortening of the telomeres.

European Patent Publication No. 1352597 (2003.11.19) Korean Patent Publication No. 10-2003-0077363 (2003.10.01.) European Patent Publication No. 0841396 (1998.05.13.)

The present invention seeks to provide compositions having excellent antibacterial, antifungal or antiviral activity, including peptides.

An aspect of the present invention provides an antimicrobial, antifungal or antiviral agent comprising a peptide having a sequence of SEQ ID NO: 1, a peptide that is a fragment of SEQ ID NO: 1, or a peptide having a sequence homology of 80% or more with the peptide sequence as an active ingredient. It provides a composition for.

Since a peptide having a sequence of SEQ ID NO: 1, a peptide that is a fragment of the sequence of SEQ ID NO: 1, or a peptide having a sequence homology of 80% or more with the peptide sequence has excellent bacterial and viral activity inhibitory effects, the composition comprising the same It can be used for antifungal or antiviral. In addition, a peptide having a sequence of SEQ ID NO: 1, a peptide which is a fragment of SEQ ID NO: 1, or a peptide having a sequence homology of 80% or more with the peptide sequence according to an aspect of the present invention has low cellular toxicity and low in vivo stability. As it is high, it can be usefully utilized.

1 is a graph showing the antimicrobial activity of E. coli of pep 1 by concentration.
Figure 2 is a graph showing the antimicrobial activity of E. floccosum of pep 1 by concentration.
3 is a graph showing the antimicrobial activity against T. mentargophytes of pep 1 by concentration.

Nearly all higher organisms are known to accumulate or secrete the body's immune system and antibacterial peptides as a defense against pathogenic microbes. To date, more than 2,000 antimicrobial peptides have been discovered, and these peptides are known to have similar amino acid mechanisms although their amino acid composition differs for each species found.

The mechanism of action of antimicrobial peptides exhibits antimicrobial activity is largely classified into two types.

First, antimicrobial peptides exhibit antimicrobial activity through mechanisms that increase the permeability of cell membranes of bacteria to destroy membrane potential and stop cell metabolism. Most known antimicrobial peptides are known to exhibit this mechanism of action.

Second, the antimicrobial peptide may exhibit antimicrobial activity through the mechanism of action that penetrates into fungal cells and binds to DNA or RNA to inhibit transcription or translation. Such a mechanism is a very powerful mechanism of action. Peptides having such a mechanism of action have a strong antimicrobial effect. However, at present, there is almost no research on peptides having such a mechanism of action.

The antimicrobial peptides, first, have a strong antimicrobial activity against a wide range of microorganisms, and second, the host cells act only on pathogens that invade the outside without destroying, acting as antibiotics harmless to the human body, and third, when the induction of resistance of microorganisms is a problem Since it exhibits antimicrobial activity with an activity mechanism completely different from conventional antibiotics, it is less likely to cause resistance. Fourth, since there is no secondary modification such as glycosylation, it can be mass-produced through genetic manipulation. Fifthly, since it has strong physicochemical stability such as heat, acid, or alkali, it has an advantage of great industrial utility in the pharmaceutical and food fields.

One aspect of the present invention provides a peptide for the antimicrobial or antiviral of a peptide having a sequence of SEQ ID NO: 1, a peptide that is a fragment of the sequence of SEQ ID NO: 1 or a peptide having at least 80% sequence homology with the peptide sequence. Peptides having the sequence of SEQ ID NO: 1, peptides that are fragments of the sequence of SEQ ID NO: 1, or peptides having at least 80% sequence homology with the peptide sequence can penetrate into fungal cells and bind to DNA or RNA to transcription or translation. It exhibits antimicrobial activity through a mechanism of action that inhibits translation.

An aspect of the present invention provides an antimicrobial, antifungal or antiviral agent comprising a peptide having a sequence of SEQ ID NO: 1, a peptide that is a fragment of SEQ ID NO: 1, or a peptide having a sequence homology of 80% or more with the peptide sequence as an active ingredient. It provides a composition for.

Peptides disclosed herein can include peptides having a sequence of SEQ ID NO: 1 or a peptide that is a fragment of sequence of SEQ ID NO: 1 and a peptide having at least 80%, at least 85%, at least 90%, or at least 95% sequence homology. Can be. In addition, the peptides disclosed herein may include peptides comprising any one of SEQ ID NOs: 1 to 56, and peptides that differ from one or more amino acids, two or more amino acids, three or more amino acids, four or more amino acids. .

Peptides disclosed herein can be wild-type peptides identified and isolated from a natural source. On the other hand, a peptide disclosed herein is an artificial variant, comprising an amino acid sequence in which one or more amino acids are substituted, deleted, and / or inserted as compared to a peptide having a sequence of SEQ ID NO: 1 or a peptide that is a fragment of the sequence of SEQ ID NO: 1 Can be. Amino acid changes in the wild type polypeptide as well as in artificial variants include conservative amino acid substitutions that do not significantly affect the folding and / or activity of the protein. Examples of conservative substitutions include basic amino acids (arginine, lysine and histidine), acidic amino acids (glutamic acid and aspartic acid), polar amino acids (glutamine and asparagine), hydrophobic amino acids (leucine, isoleucine, valine and methionine), aromatic amino acids (phenylalanine, Tryptophan and tyrosine), and small amino acids (glycine, alanine, serine and threonine). Amino acid substitutions that generally do not alter specific activity are known in the art. The most common exchanges are Ala / Ser, Val / Ile, Asp / Glu, Thr / Ser, Ala / Gly, Ala / Thr, Ser / Asn, Ala / Val, Ser / Gly, Tyr / Phe, Ala / Pro, Lys / Arg, Asp / Asn, Leu / Ile, Leu / Val, Ala / Glu, and Asp / Gly, and vice versa.

In one aspect of the invention, amino acid changes belong to the property that allows the physicochemical properties of the peptide to be altered. For example, amino acid changes can be made, such as improving the thermal stability of the peptide, altering substrate specificity, changing the optimal pH, and the like.

In one aspect of the invention, a peptide having a sequence of SEQ ID NO: 1, a peptide that is a fragment of the sequence of SEQ ID NO: 1, or a peptide having at least 80% sequence homology with the peptide sequence may consist of up to 30 amino acids. have. In another aspect of the present invention, a peptide having a sequence of SEQ ID NO: 1, a peptide that is a fragment of SEQ ID NO: 1, or a peptide having 80% or more sequence homology with the peptide sequence may be any one of SEQ ID NOs: 2 to 56 It may be a peptide comprising a sequence or a sequence having at least 80% sequence homology with the sequence. In another aspect of the present invention, a peptide having a sequence of SEQ ID NO: 1, a peptide that is a fragment of SEQ ID NO: 1, or a peptide having 80% or more sequence homology with the peptide sequence may be any one of SEQ ID NOs: 2 to 56 Sequence or sequence having 80% or more sequence homology with said sequence.

In one aspect of the invention, a peptide having a sequence of SEQ ID NO: 1, a peptide that is a fragment of SEQ ID NO: 1, or a peptide having at least 80% sequence homology with the peptide sequence is a telomerase, specifically human ( Homo sapiens). ) Peptides derived from telomerase.

The peptides set forth in SEQ ID NOs: 1 to 56 are shown in Tables 1 and 2 below. The "names" in Tables 1 and 2 below are named to distinguish each peptide. In one aspect of the invention, the peptide set forth in SEQ ID NO: 1 represents the entire peptide of human telomerase. In another aspect of the present invention, at least one of the peptides set forth in SEQ ID NOS: 1 to 56 includes a "synthetic peptide" synthesized by selecting and synthesizing a peptide at that position among the peptides contained in telomerase.

SEQ ID NO: name Telomerase statue location order Length One [1-1132] MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPWDARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVRSYLPNTVTDALRGSGAWGLLLRRVGLPVLVHLLARCALFVLVAPGASPLASPLASPLPSLAPLPGLPKLPVGPLPAPSLGLPKLP
GAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRLVETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEILAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRELSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKALFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTIPQDRLTEVIASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHLQETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTLLCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNLRKTVVNFPVEDEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTFNRGFKAGRNMRRKLFGVLRLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLPFHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLLKLTRHRVTYVPLLGSLRTAQTQLSRKLPGT TLTALEAAANPALPSDFKTILD
1132 aa
2 pep1 [611-626] EARPALLTSRLRFIPK 16 aa 3 pep2 [660-689] ALFSVLNYERARRPGLLGASVLGLDDIHRA 30 aa 4 pep3 [663-677] SVLNYERARRPGLLG 15 aa 5 pep4 [674-683] GLLGASVLGL 10 aa 6 pep5 [615-624] ALLTSRLRFI 10 aa 7 pep6 [613-621] RPALLTSRL 9 aa 8 pep7 [653-661] RLTSRVKAL 9 aa 9 pep8 [691-705] RTFVLRVRAQDPPPE 15 aa 10 pep9 [653-667] RLTSRVKALFSVLNY 15 aa

11 pep10 [651-665] AERLTSRVKALFSVL 15 aa 12 pep11 [667-675] YERARRPGL 9 aa 13 pep12 [675-683] LLGASVLGL 9 aa 14 pep13 [680-689] VLGLDDIHRA 10 aa 15 pep14 [677-686] GASVLGLDDI 10 aa 16 pep15 [660-669] ALFSVLNYER 10 aa 17 pep16 [663-672] SVLNYERARR 10 aa 18 pep17 [679-688] SVLGLDDIHR 10 aa 19 pep18 [662-671] FSVLNYERAR 10 aa 20 pep19 [666-675] NYERARRPGL 10 aa 21 pep20 [667-676] YERARRPGLL 10 aa 22 pep21 [672-681] RPGLLGASVL 10 aa 23 pep22 [668-676] ERARRPGLL 9 aa 24 pep23 [680-688] VLGLDDIHR 9 aa 25 pep24 [663-671] SVLNYERAR 9 aa 26 pep25 [664-672] VLNYERARR 9 aa 27 pep26 [670-678] ARRPGLLGA 9 aa 28 pep27 [673-681] PGLLGASVL 9 aa 29 pep28 [671-679] RRPGLLGAS 9 aa 30 pep29 [660-668] ALFSVLNYE 9 aa 31 pep30 [674-682] GLLGASVLG 9 aa 32 pep31 [679-687] SVLGLDDIH 9 aa 33 pep32 [668-675] ERARRPGL 8 aa 34 pep33 [670-677] ARRPGLLG 8 aa 35 pep34 [674-681] GLLGASVL 8 aa 36 pep35 [669-676] RARRPGLL 8 aa 37 pep36 [676-683] LGASVLGL 8 aa 38 pep37 [563-577] VTETTFQKNRLFFYR 15 aa 39 pep38 [573-587] LFFYRKSVWSKLQSI 15 aa 40 pep39 [583-597] KLQSIGIRQHLKRVQ 15 aa 41 pep40 [603-617] EAEVRQHREARPALL 15 aa 42 pep41 [613-627] RPALLTSRLRFIPKP 15 aa 43 pep42 [623-637] FIPKPDGLRPIVNMD 15 aa 44 pep43 [643-657] RTFRREKRAERLTSR 15 aa 45 pep45 [683-697] LDDIHRAWRTFVLRV 15 aa 46 pep46 [693-707] FVLRVRAQDPPPELY 15 aa 47 pep47 [721-735] PQDRLTEVIASIIKP 15 aa 48 pep48 [578-592] KSVWSKLQSIGIRQH 15 aa 49 pep49 [593-608] LKRVQLRELSEAEVRQ 16 aa 50 pep-RIA-84 [611-619] EARPALLTS 9 aa 51 pep-RIA-97 [618-626] TSRLRFIPK 9 aa 52 pep-RIA-114 [612-620] ARPALLTSR 9 aa 53 pep-RIA-132 [614-622] PALLTSRLR 9 aa 54 pep-RIA-140 [615-623] ALLTSRLRF 9 aa 55 pep-RIA-147 [616-624] LLTSRLRFI 9 aa 56 pep-RIA-153 [617-625] LTSRLRFIP 9 aa

An aspect of the present invention provides an antimicrobial, antifungal or antiviral agent comprising a peptide having a sequence of SEQ ID NO: 1, a peptide that is a fragment of SEQ ID NO: 1, or a peptide having a sequence homology of 80% or more with the peptide sequence as an active ingredient. It provides a pharmaceutical composition. The pharmaceutical composition according to an aspect of the present invention comprises a peptide having a sequence of SEQ ID NO: 1, a peptide that is a fragment of SEQ ID NO: 1, or a peptide having a sequence homology of 80% or more with the peptide sequence as an active ingredient, and has excellent antibacterial activity. Since it has antifungal and antiviral effects, it is possible to prevent or treat various diseases and symptoms caused by pathogens.

One aspect of the present invention provides antimicrobial, antifungal and antiviral uses of a peptide having a sequence of SEQ ID NO: 1, a peptide that is a fragment of SEQ ID NO: 1 or a peptide having at least 80% sequence homology with the peptide sequence.

One aspect of the invention provides a method of applying to a subject a peptide having a sequence of SEQ ID NO: 1, a peptide that is a fragment of SEQ ID NO: 1, or a peptide having at least 80% sequence homology with the peptide sequence, or a composition comprising the same. Provided are methods for preventing or treating a pathogen infection.

One aspect of the invention provides a peptide comprising a peptide having a sequence of SEQ ID NO: 1, a peptide that is a fragment of the sequence of SEQ ID NO: 1 or a peptide having at least 80% sequence homology with the peptide sequence; And instructions for disclosing one or more of the dosage, route of administration, frequency of administration, and indications of the peptide or composition comprising the same.

An aspect of the present invention provides an antimicrobial, antifungal or antiviral agent comprising a peptide having a sequence of SEQ ID NO: 1, a peptide that is a fragment of SEQ ID NO: 1, or a peptide having a sequence homology of 80% or more with the peptide sequence as an active ingredient. The external preparation for skin, or a cosmetic composition is provided.

An aspect of the present invention provides an antimicrobial, antifungal or antiviral agent comprising a peptide having a sequence of SEQ ID NO: 1, a peptide that is a fragment of SEQ ID NO: 1, or a peptide having a sequence homology of 80% or more with the peptide sequence as an active ingredient. It provides a food composition for.

As used herein, "antibacterial activity" is defined as activity that can kill microbial cells or inhibit their growth. In the context of the present invention, "antibacterial" means that there is a bactericidal and / or bacteriostatic and / or fungicidal and / or bacteriostatic effect. "Sterilization" means the killing of bacteria, fungi, or cells of lower eukaryotes, such as yeasts or algae, protozoa, etc., and "fungal bacteria" means lower eukaryotes, protists, such as bacteria, yeast, or It means that it is possible to inhibit the growth of fungi, that is, the growth of lower eukaryotes, protists, or fungal cells such as bacteria and yeasts. By "fungicidal" is meant that it can kill fungal cells. The term "fungal fungus" means that it is possible to inhibit fungal growth, ie growth of fungal cells. The term "microbial cell" is a broad concept including bacteria, fungi, or lower eukaryotes or protists such as yeast or algae.

"Antiviral activity" is defined as activity that kills or inhibits growth of a virus or inactivates a virus.

The antimicrobial, antifungal or antiviral peptides disclosed herein are widely applicable regardless of the type of microorganism or the antimicrobial target. It is typically useful at any place contaminated by viruses, bacteria, fungi, yeast or algae. Typically, antibacterial objects are aqueous systems such as cooling water systems, laundry rinsing water, oil systems such as cutting oils, lubricants, oil fields, and the like, and are places where it is necessary to kill microorganisms or inhibit their growth. In addition, the antimicrobial, antifungal or antiviral peptides disclosed herein are useful for antimicrobial, antifungal or antiviral compositions, such as wood, latex, adhesives, glue, paper, cardboard, textiles, leather, plastics, caulking, and feed protection. It can be used in all applications known to be.

Other uses include preservation of foods, beverages, cosmetics such as lotions, creams, gels, ointments, soaps, shampoos, conditioners, limiting agents, deodorants, toothpastes, contact lens products, enzyme preparations, or food ingredients.

On the other hand, the peptides disclosed herein are antiseptics, for example in the treatment of acne, eye or mouth infections, skin infections; In limiting or deodorizing agents; In salts for foot baths; It is useful for cleaning and disinfecting contact lenses, hard surfaces, teeth (oral care), wounds and bruises.

In addition, one aspect of the invention relates to the use of an antimicrobial peptide or composition as a medicament. Furthermore, the peptides or compositions described herein may also be medicament for controlling or fighting microorganisms, such as bacteria, fungi, or lower eukaryotes such as yeast or algae, protozoa, including gram positive or gram negative It can be used for the preparation of. In particular, microbial infections include, but are not limited to, infectious skin diseases such as acne or athlete's foot; Lung diseases, including but not limited to tuberculosis and cystic fibrosis; It may be related to sexually transmitted diseases including but not limited to gonorrhea and chlamydia.

The composition according to one aspect of the present invention comprises 0.1 μg / mg to 1 mg / of a peptide having a sequence of SEQ ID NO: 1, a peptide that is a fragment of SEQ ID NO: 1, or a peptide having a sequence homology of 80% or more with the peptide sequence. Mg, specifically 1 μg / mg to 0.5 mg / mg, more specifically 10 μg / mg to 0.1 mg / mg. When it is included in the above range, it is not only suitable for exhibiting the intended effect of the present invention but also can satisfy both the stability and safety of the composition, and may be suitably included in the above range in terms of cost effectiveness.

The composition according to one aspect of the present invention can be applied to all animals including humans, dogs, chickens, pigs, cattle, sheep, guinea pigs or monkeys.

The pharmaceutical composition according to one aspect of the present invention can be administered orally, rectally, transdermally, intravenously, intramuscularly, intraperitoneally, intramuscularly, intradermally or subcutaneously.

Formulations for oral administration may be, but are not limited to, tablets, pills, soft or hard capsules, granules, powders, solutions or emulsions. Formulations for parenteral administration may be, but are not limited to, injections, drops, lozenges, ointments, gels, creams, suspensions, emulsions, suppositories, patches or spraying agents.

The pharmaceutical composition according to one aspect of the present invention may contain additives such as a diluent, an excipient, a lubricant, a binder, a disintegrant, a buffer, a dispersant, a surfactant, a colorant, a fragrance or a sweetener as necessary. The pharmaceutical composition according to one aspect of the present invention can be prepared by a conventional method in the art.

The effective ingredients of the pharmaceutical composition according to one aspect of the present invention will vary depending on the age, sex, weight, pathological condition and severity of the subject to be administered, route of administration, or judgment of the prescriber. Determination of the amount of application based on these factors is within the level of ordinary skill in the art and its daily dose is, for example, from 0.1 [mu] g / kg / day to 1 g / kg / day, Kg / day, more specifically, 10 μg / kg / day to 1 mg / kg / day, and more particularly 50 μg / kg / day to 100 μg / kg / day. The pharmaceutical composition according to one aspect of the present invention may be administered once to three times a day, but is not limited thereto.

The cosmetic composition according to one aspect of the present invention may be provided in all formulations suitable for topical application. For example, it may be provided as a solution, an emulsion obtained by dispersing an oil phase in an aqueous phase, an emulsion obtained by dispersing an oil phase in water, a suspension, a solid, a gel, a powder, a paste, a foam or an aerosol. Such formulations may be prepared according to conventional methods in the art.

The cosmetic composition according to one aspect of the present invention may contain other ingredients which can give synergy to the main effect, preferably to the extent that the main effect is not impaired. In addition, the cosmetic composition according to an aspect of the present invention may further include a moisturizer, an emulsifier, a surfactant, a UV absorber, a preservative, a bactericide, an antioxidant, a pH adjuster, an organic or inorganic pigment, a perfume, a cooling agent, or a restriction agent. It may include. The blending amount of the above components can be easily selected by those skilled in the art within the range not impairing the objects and effects of the present invention. The blending amount thereof is 0.01 to 5% by weight, specifically 0.01 to 3% by weight .

The formulation of the food composition according to one aspect of the present invention is not particularly limited, but can be formulated into, for example, tablets, granules, powders, liquids, solid preparations and the like. Each formulation may be appropriately selected and formulated by those skilled in the art according to the formulation or purpose of use, in addition to the active ingredient, and may be synergistic when applied simultaneously with other raw materials.

Determination of the dosage of the active ingredient is within the level of ordinary skill in the art and its daily dose is, for example, 1 μg / kg / day to 10 mg / kg / day, more specifically 10 μg / kg / day Day to 100 mg / kg / day, but it is not limited thereto, and it may be various factors such as the age, health condition, and complication of the subject to be administered ≪ / RTI >

Hereinafter, the configuration and effects of the present invention will be described in more detail with reference to experimental examples. However, the following experimental examples are provided only for the purpose of illustration in order to help the understanding of the present invention, and the scope and scope of the present invention are not limited thereto.

Experimental Example Evaluation of Antimicrobial Activity of Peptides

To 1 ml of liquid medium was added pep 1 at concentrations of 300 μg / ml, 600 μg / ml and 1 mg / ml, respectively. Separately, pep 1 was added to 1 to 5 μl of the test bacteria ( E. coli ( Escherichia coli ) E. floccosum ( Epidermophyton floccosum ) and T. mentagrophytes ( Trichophyton mentagrophytes )) precultured in liquid medium for 3 to 5 days. It was inoculated into the liquid medium (cell number: 10 3 to 10 5 / ml in vitro). Cultures were incubated for a time (1 day to 3 days) sufficient for growth at the growth temperature of each strain. The OD value of each test tube was measured and shown in Tables 3 to 5 below, and FIGS. 1 to 3. On the other hand, the negative control group was cultured only each strain as a negative control, each strain and antibiotics were incubated together as a positive control (antibiotic, the bacteria used Tetracycline, the fungus is the amphotericin ratio (Amphotericin B) was used).

Germ Fungus + antibiotic 300 μg / ml 1 mg / ml E. coli 0.427 0.072 0.362 0.081

Germ Fungus + antibiotic 300 μg / ml 600 μg / ml E. floccosum 0.346 0.066 0.053 0.045

Germ Fungus + antibiotic 300 μg / ml 600 μg / ml T. mentagrophytes 0.319 0.065 0.147 0.047

As can be seen from the results, pep 1 showed antibacterial activity at the concentration of 1 mg / ㎖ for E. coli, and showed antibacterial activity at 300 ㎍ / ㎖ and 600 ㎍ / ㎖ concentrations for E. floccosum . T. mentargophytes showed antimicrobial activity at 600 µg / ml.

                         SEQUENCE LISTING <110> KAEL-GemVax Co., Ltd.   <120> Composition for antimicrobial or antivirus comprising telomerase        peptide <130> 12P554 <160> 56 <170> PatentIn version 3.2 <210> 1 <211> 1132 <212> PRT <213> Homo sapiens <400> 1 Met Pro Arg Ala Pro Arg Cys Arg Ala Val Arg Ser Leu Leu Arg Ser 1 5 10 15 His Tyr Arg Glu Val Leu Pro Leu Ala Thr Phe Val Arg Arg Leu Gly             20 25 30 Pro Gln Gly Trp Arg Leu Val Gln Arg Gly Asp Pro Ala Ala Phe Arg         35 40 45 Ala Leu Val Ala Gln Cys Leu Val Cys Val Pro Trp Asp Ala Arg Pro     50 55 60 Pro Pro Ala Ala Pro Ser Phe Arg Gln Val Ser Cys Leu Lys Glu Leu 65 70 75 80 Val Ala Arg Val Leu Gln Arg Leu Cys Glu Arg Gly Ala Lys Asn Val                 85 90 95 Leu Ala Phe Gly Phe Ala Leu Leu Asp Gly Ala Arg Gly Gly Pro Pro             100 105 110 Glu Ala Phe Thr Thr Ser Val Arg Ser Tyr Leu Pro Asn Thr Val Thr         115 120 125 Asp Ala Leu Arg Gly Ser Gly Ala Trp Gly Leu Leu Leu Arg Arg Val     130 135 140 Gly Asp Asp Val Leu Val His Leu Leu Ala Arg Cys Ala Leu Phe Val 145 150 155 160 Leu Val Ala Pro Ser Cys Ala Tyr Gln Val Cys Gly Pro Pro Leu Tyr                 165 170 175 Gln Leu Gly Ala Ala Thr Gln Ala Arg Pro Pro His Ala Ser Gly             180 185 190 Pro Arg Arg Arg Leu Gly Cys Glu Arg Ala Trp Asn His Ser Val Arg         195 200 205 Glu Ala Gly Val Pro Leu Gly Leu Pro Ala Pro Gly Ala Arg Arg Arg     210 215 220 Gly Gly Ser Ala Ser Arg Ser Leu Pro Leu Pro Lys Arg Pro Arg Arg 225 230 235 240 Gly Ala Ala Pro Glu Pro Glu Arg Thr Pro Val Gly Gln Gly Ser Trp                 245 250 255 Ala His Pro Gly Arg Thr Arg Gly Pro Ser Asp Arg Gly Phe Cys Val             260 265 270 Val Ser Pro Ala Arg Pro Ala Glu Glu Ala Thr Ser Leu Glu Gly Ala         275 280 285 Leu Ser Gly Thr Arg His Ser Ser Ser Val Gly Arg Gln His His     290 295 300 Ala Gly Pro Pro Ser Thr Ser Arg Pro Pro Arg Pro Trp Asp Thr Pro 305 310 315 320 Cys Pro Pro Val Tyr Ala Glu Thr Lys His Phe Leu Tyr Ser Ser Gly                 325 330 335 Asp Lys Glu Gln Leu Arg Pro Ser Phe Leu Leu Ser Ser Leu Arg Pro             340 345 350 Ser Leu Thr Gly Ala Arg Arg Leu Val Glu Thr Ile Phe Leu Gly Ser         355 360 365 Arg Pro Trp Met Pro Gly Thr Pro Arg Arg Leu Pro Arg Leu Pro Gln     370 375 380 Arg Tyr Trp Gln Met Arg Pro Leu Phe Leu Glu Leu Leu Gly Asn His 385 390 395 400 Ala Gln Cys Pro Tyr Gly Val Leu Leu Lys Thr His Cys Pro Leu Arg                 405 410 415 Ala Ala Val Thr Pro Ala Ala Gly Val Cys Ala Arg Glu Lys Pro Gln             420 425 430 Gly Ser Val Ala Ala Pro Glu Glu Glu Asp Thr Asp Pro Arg Arg Leu         435 440 445 Val Gln Leu Leu Arg Gln His Ser Ser Pro Trp Gln Val Tyr Gly Phe     450 455 460 Val Arg Ala Cys Leu Arg Arg Leu Val Pro Pro Gly Leu Trp Gly Ser 465 470 475 480 Arg His Asn Glu Arg Arg Phe Leu Arg Asn Thr Lys Lys Phe Ile Ser                 485 490 495 Leu Gly Lys His Ala Lys Leu Ser Leu Gln Glu Leu Thr Trp Lys Met             500 505 510 Ser Val Arg Asp Cys Ala Trp Leu Arg Arg Ser Pro Gly Val Gly Cys         515 520 525 Val Pro Ala Ala Glu His Arg Leu Arg Glu Glu Ile Leu Ala Lys Phe     530 535 540 Leu His Trp Leu Met Ser Val Tyr Val Val Glu Leu Leu Arg Ser Phe 545 550 555 560 Phe Tyr Val Thr Glu Thr Thr Phe Gln Lys Asn Arg Leu Phe Phe Tyr                 565 570 575 Arg Lys Ser Val Trp Ser Lys Leu Gln Ser Ile Gly Ile Arg Gln His             580 585 590 Leu Lys Arg Val Gln Leu Arg Glu Leu Ser Glu Ala Glu Val Arg Gln         595 600 605 His Arg Glu Ala Arg Pro Ala Leu Leu Thr Ser Arg Leu Arg Phe Ile     610 615 620 Pro Lys Pro Asp Gly Leu Arg Pro Ile Val Asn Met Asp Tyr Val Val 625 630 635 640 Gly Ala Arg Thr Phe Arg Arg Glu Lys Arg Ala Glu Arg Leu Thr Ser                 645 650 655 Arg Val Lys Ala Leu Phe Ser Val Leu Asn Tyr Glu Arg Ala Arg Arg             660 665 670 Pro Gly Leu Leu Gly Ala Ser Val Leu Gly Leu Asp Asp Ile His Arg         675 680 685 Ala Trp Arg Thr Phe Val Leu Arg Val Arg Ala Gln Asp Pro Pro Pro     690 695 700 Glu Leu Tyr Phe Val Lys Val Asp Val Thr Gly Ala Tyr Asp Thr Ile 705 710 715 720 Pro Gln Asp Arg Leu Thr Glu Val Ile Ala Ser Ile Ile Lys Pro Gln                 725 730 735 Asn Thr Tyr Cys Val Arg Arg Tyr Ala Val Val Gln Lys Ala Ala His             740 745 750 Gly His Val Arg Lys Ala Phe Lys Ser His Val Ser Thr Leu Thr Asp         755 760 765 Leu Gln Pro Tyr Met Arg Gln Phe Val Ala His Leu Gln Glu Thr Ser     770 775 780 Pro Leu Arg Asp Ala Val Valle Glu Gln Ser Ser Ser Leu Asn Glu 785 790 795 800 Ala Ser Ser Gly Leu Phe Asp Val Phe Leu Arg Phe Met Cys His His                 805 810 815 Ala Val Arg Ile Arg Gly Lys Ser Tyr Val Gln Cys Gln Gly Ile Pro             820 825 830 Gln Gly Ser Ile Leu Ser Thr Leu Leu Cys Ser Leu Cys Tyr Gly Asp         835 840 845 Met Glu Asn Lys Leu Phe Ala Gly Ile Arg Arg Asp Gly Leu Leu Leu     850 855 860 Arg Leu Val Asp Asp Phe Leu Leu Val Thr Pro His Leu Thr His Ala 865 870 875 880 Lys Thr Phe Leu Arg Thr Leu Val Arg Gly Val Pro Glu Tyr Gly Cys                 885 890 895 Val Val Asn Leu Arg Lys Thr Val Val Asn Phe Pro Val Glu Asp Glu             900 905 910 Ala Leu Gly Gly Thr Ala Phe Val Gln Met Pro Ala His Gly Leu Phe         915 920 925 Pro Trp Cys Gly Leu Leu Leu Asp Thr Arg Thr Leu Glu Val Gln Ser     930 935 940 Asp Tyr Ser Ser Tyr Ala Arg Thr Ser Ile Arg Ala Ser Leu Thr Phe 945 950 955 960 Asn Arg Gly Phe Lys Ala Gly Arg Asn Met Arg Arg Lys Leu Phe Gly                 965 970 975 Val Leu Arg Leu Lys Cys His Ser Leu Phe Leu Asp Leu Gln Val Asn             980 985 990 Ser Leu Gln Thr Val Cys Thr Asn Ile Tyr Lys Ile Leu Leu Leu Gln         995 1000 1005 Ala Tyr Arg Phe His Ala Cys Val Leu Gln Leu Pro Phe His Gln     1010 1015 1020 Gln Val Trp Lys Asn Pro Thr Phe Phe Leu Arg Val Ile Ser Asp     1025 1030 1035 Thr Ala Ser Leu Cys Tyr Ser Ile Leu Lys Ala Lys Asn Ala Gly     1040 1045 1050 Met Ser Leu Gly Ala Lys Gly Ala Ala Gly Pro Leu Pro Ser Glu     1055 1060 1065 Ala Val Gln Trp Leu Cys His Gln Ala Phe Leu Leu Lys Leu Thr     1070 1075 1080 Arg His Arg Val Thr Tyr Val Pro Leu Leu Gly Ser Leu Arg Thr     1085 1090 1095 Ala Gln Thr Gln Leu Ser Arg Lys Leu Pro Gly Thr Thr Leu Thr     1100 1105 1110 Ala Leu Glu Ala Ala Ala Asn Pro Ala Leu Pro Ser Asp Phe Lys     1115 1120 1125 Thr Ile Leu Asp     1130 <210> 2 <211> 16 <212> PRT <213> Homo sapiens <400> 2 Glu Ala Arg Pro Ala Leu Leu Thr Ser Arg Leu Arg Phe Ile Pro Lys 1 5 10 15 <210> 3 <211> 30 <212> PRT <213> Homo sapiens <400> 3 Ala Leu Phe Ser Val Leu Asn Tyr Glu Arg Ala Arg Arg Pro Gly Leu 1 5 10 15 Leu Gly Ala Ser Val Leu Gly Leu Asp Asp Ile His Arg Ala             20 25 30 <210> 4 <211> 15 <212> PRT <213> Homo sapiens <400> 4 Ser Val Leu Asn Tyr Glu Arg Ala Arg Arg Pro Gly Leu Leu Gly 1 5 10 15 <210> 5 <211> 10 <212> PRT <213> Homo sapiens <400> 5 Gly Leu Leu Gly Ala Ser Val Leu Gly Leu 1 5 10 <210> 6 <211> 10 <212> PRT <213> Homo sapiens <400> 6 Ala Leu Leu Thr Ser Arg Leu Arg Phe Ile 1 5 10 <210> 7 <211> 9 <212> PRT <213> Homo sapiens <400> 7 Arg Pro Ala Leu Leu Thr Ser Arg Leu 1 5 <210> 8 <211> 9 <212> PRT <213> Homo sapiens <400> 8 Arg Leu Thr Ser Arg Val Lys Ala Leu 1 5 <210> 9 <211> 15 <212> PRT <213> Homo sapiens <400> 9 Arg Thr Phe Val Leu Arg Val Arg Ala Gln Asp Pro Pro Pro Glu 1 5 10 15 <210> 10 <211> 15 <212> PRT <213> Homo sapiens <400> 10 Arg Leu Thr Ser Arg Val Lys Ala Leu Phe Ser Val Leu Asn Tyr 1 5 10 15 <210> 11 <211> 15 <212> PRT <213> Homo sapiens <400> 11 Ala Glu Arg Leu Thr Ser Arg Val Lys Ala Leu Phe Ser Val Leu 1 5 10 15 <210> 12 <211> 9 <212> PRT <213> Homo sapiens <400> 12 Tyr Glu Arg Ala Arg Arg Pro Gly Leu 1 5 <210> 13 <211> 9 <212> PRT <213> Homo sapiens <400> 13 Leu Leu Gly Ala Ser Val Leu Gly Leu 1 5 <210> 14 <211> 10 <212> PRT <213> Homo sapiens <400> 14 Val Leu Gly Leu Asp Asp Ile His Arg Ala 1 5 10 <210> 15 <211> 10 <212> PRT <213> Homo sapiens <400> 15 Gly Ala Ser Val Leu Gly Leu Asp Asp Ile 1 5 10 <210> 16 <211> 10 <212> PRT <213> Homo sapiens <400> 16 Ala Leu Phe Ser Val Leu Asn Tyr Glu Arg 1 5 10 <210> 17 <211> 10 <212> PRT <213> Homo sapiens <400> 17 Ser Val Leu Asn Tyr Glu Arg Ala Arg Arg 1 5 10 <210> 18 <211> 10 <212> PRT <213> Homo sapiens <400> 18 Ser Val Leu Gly Leu Asp Asp Ile His Arg 1 5 10 <210> 19 <211> 10 <212> PRT <213> Homo sapiens <400> 19 Phe Ser Val Leu Asn Tyr Glu Arg Ala Arg 1 5 10 <210> 20 <211> 10 <212> PRT <213> Homo sapiens <400> 20 Asn Tyr Glu Arg Ala Arg Arg Pro Gly Leu 1 5 10 <210> 21 <211> 10 <212> PRT <213> Homo sapiens <400> 21 Tyr Glu Arg Ala Arg Arg Pro Gly Leu Leu 1 5 10 <210> 22 <211> 10 <212> PRT <213> Homo sapiens <400> 22 Arg Pro Gly Leu Leu Gly Ala Ser Val Leu 1 5 10 <210> 23 <211> 9 <212> PRT <213> Homo sapiens <400> 23 Glu Arg Ala Arg Arg Pro Gly Leu Leu 1 5 <210> 24 <211> 9 <212> PRT <213> Homo sapiens <400> 24 Val Leu Gly Leu Asp Asp Ile His Arg 1 5 <210> 25 <211> 9 <212> PRT <213> Homo sapiens <400> 25 Ser Val Leu Asn Tyr Glu Arg Ala Arg 1 5 <210> 26 <211> 9 <212> PRT <213> Homo sapiens <400> 26 Val Leu Asn Tyr Glu Arg Ala Arg Arg 1 5 <210> 27 <211> 9 <212> PRT <213> Homo sapiens <400> 27 Ala Arg Arg Pro Gly Leu Leu Gly Ala 1 5 <210> 28 <211> 9 <212> PRT <213> Homo sapiens <400> 28 Pro Gly Leu Leu Gly Ala Ser Val Leu 1 5 <210> 29 <211> 9 <212> PRT <213> Homo sapiens <400> 29 Arg Arg Pro Gly Leu Leu Gly Ala Ser 1 5 <210> 30 <211> 9 <212> PRT <213> Homo sapiens <400> 30 Ala Leu Phe Ser Val Leu Asn Tyr Glu 1 5 <210> 31 <211> 9 <212> PRT <213> Homo sapiens <400> 31 Gly Leu Leu Gly Ala Ser Val Leu Gly 1 5 <210> 32 <211> 9 <212> PRT <213> Homo sapiens <400> 32 Ser Val Leu Gly Leu Asp Asp Ile His 1 5 <210> 33 <211> 8 <212> PRT <213> Homo sapiens <400> 33 Glu Arg Ala Arg Arg Pro Gly Leu 1 5 <210> 34 <211> 8 <212> PRT <213> Homo sapiens <400> 34 Ala Arg Arg Pro Gly Leu Leu Gly 1 5 <210> 35 <211> 8 <212> PRT <213> Homo sapiens <400> 35 Gly Leu Leu Gly Ala Ser Val Leu 1 5 <210> 36 <211> 8 <212> PRT <213> Homo sapiens <400> 36 Arg Ala Arg Arg Pro Gly Leu Leu 1 5 <210> 37 <211> 8 <212> PRT <213> Homo sapiens <400> 37 Leu Gly Ala Ser Val Leu Gly Leu 1 5 <210> 38 <211> 15 <212> PRT <213> Homo sapiens <400> 38 Val Thr Glu Thr Thr Phe Gln Lys Asn Arg Leu Phe Phe Tyr Arg 1 5 10 15 <210> 39 <211> 15 <212> PRT <213> Homo sapiens <400> 39 Leu Phe Phe Tyr Arg Lys Ser Val Trp Ser Lys Leu Gln Ser Ile 1 5 10 15 <210> 40 <211> 15 <212> PRT <213> Homo sapiens <400> 40 Lys Leu Gln Ser Ile Gly Ile Arg Gln His Leu Lys Arg Val Gln 1 5 10 15 <210> 41 <211> 15 <212> PRT <213> Homo sapiens <400> 41 Glu Ala Glu Val Arg Gln His Arg Glu Ala Arg Pro Ala Leu Leu 1 5 10 15 <210> 42 <211> 15 <212> PRT <213> Homo sapiens <400> 42 Arg Pro Ala Leu Leu Thr Ser Arg Leu Arg Phe Ile Pro Lys Pro 1 5 10 15 <210> 43 <211> 15 <212> PRT <213> Homo sapiens <400> 43 Phe Ile Pro Lys Pro Asp Gly Leu Arg Pro Ile Val Asn Met Asp 1 5 10 15 <210> 44 <211> 15 <212> PRT <213> Homo sapiens <400> 44 Arg Thr Phe Arg Arg Glu Lys Arg Ala Glu Arg Leu Thr Ser Arg 1 5 10 15 <210> 45 <211> 15 <212> PRT <213> Homo sapiens <400> 45 Leu Asp Asp Ile His Arg Ala Trp Arg Thr Phe Val Leu Arg Val 1 5 10 15 <210> 46 <211> 15 <212> PRT <213> Homo sapiens <400> 46 Phe Val Leu Arg Val Arg Ala Gln Asp Pro Pro Pro Glu Leu Tyr 1 5 10 15 <210> 47 <211> 15 <212> PRT <213> Homo sapiens <400> 47 Pro Gln Asp Arg Leu Thr Glu Val Ile Ala Ser Ile Ile Lys Pro 1 5 10 15 <210> 48 <211> 15 <212> PRT <213> Homo sapiens <400> 48 Lys Ser Val Trp Ser Lys Leu Gln Ser Ile Gly Ile Arg Gln His 1 5 10 15 <210> 49 <211> 16 <212> PRT <213> Homo sapiens <400> 49 Leu Lys Arg Val Gln Leu Arg Glu Leu Ser Glu Ala Glu Val Arg Gln 1 5 10 15 <210> 50 <211> 9 <212> PRT <213> Homo sapiens <400> 50 Glu Ala Arg Pro Ala Leu Leu Thr Ser 1 5 <210> 51 <211> 9 <212> PRT <213> Homo sapiens <400> 51 Thr Ser Arg Leu Arg Phe Ile Pro Lys 1 5 <210> 52 <211> 9 <212> PRT <213> Homo sapiens <400> 52 Ala Arg Pro Ala Leu Leu Thr Ser Arg 1 5 <210> 53 <211> 9 <212> PRT <213> Homo sapiens <400> 53 Pro Ala Leu Leu Thr Ser Arg Leu Arg 1 5 <210> 54 <211> 9 <212> PRT <213> Homo sapiens <400> 54 Ala Leu Leu Thr Ser Arg Leu Arg Phe 1 5 <210> 55 <211> 9 <212> PRT <213> Homo sapiens <400> 55 Leu Leu Thr Ser Arg Leu Arg Phe Ile 1 5 <210> 56 <211> 9 <212> PRT <213> Homo sapiens <400> 56 Leu Thr Ser Arg Leu Arg Phe Ile Pro 1 5

Claims (6)

A peptide having the sequence of SEQ ID NO: 1,
Peptides that are fragments of the sequence of SEQ ID NO: 1 or
An antimicrobial, antifungal or antiviral composition comprising a peptide having at least 80% sequence homology with the peptide sequence as an active ingredient.
The method of claim 1,
Peptides are antimicrobial, antifungal or antiviral composition consisting of up to 30 amino acids.
The method of claim 1,
The peptide is an antimicrobial, antifungal or antiviral composition comprising any one of SEQ ID NOs: 2 to 56 or a sequence having 80% or more sequence homology with the sequence.
The method of claim 3, wherein
The peptide is an antimicrobial, antifungal or antiviral composition comprising any one of SEQ ID NOs: 2 to 56 or a sequence having at least 80% sequence homology with the sequence.
The method of claim 1,
Peptides are antimicrobial, antifungal or antiviral compositions derived from human telomerase.
The method of claim 1,
The composition is an antimicrobial, antifungal or antiviral composition comprising a peptide in an amount of 0.1 μg / mg to 1 mg / mg.
KR1020120104178A 2012-09-19 2012-09-19 Antimicrobial or antifungal composition comprising telomerase peptide KR102038487B1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
KR1020120104178A KR102038487B1 (en) 2012-09-19 2012-09-19 Antimicrobial or antifungal composition comprising telomerase peptide

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
KR1020120104178A KR102038487B1 (en) 2012-09-19 2012-09-19 Antimicrobial or antifungal composition comprising telomerase peptide

Publications (2)

Publication Number Publication Date
KR20140037698A true KR20140037698A (en) 2014-03-27
KR102038487B1 KR102038487B1 (en) 2019-10-30

Family

ID=50646465

Family Applications (1)

Application Number Title Priority Date Filing Date
KR1020120104178A KR102038487B1 (en) 2012-09-19 2012-09-19 Antimicrobial or antifungal composition comprising telomerase peptide

Country Status (1)

Country Link
KR (1) KR102038487B1 (en)

Cited By (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017003267A1 (en) * 2015-07-02 2017-01-05 주식회사 젬백스앤카엘 Peptide having anti-viral effect and composition containing same
US10034922B2 (en) 2013-11-22 2018-07-31 Gemvax & Kael Co., Ltd. Peptide having angiogenesis inhibitory activity and composition containing same
US10039811B2 (en) 2012-05-11 2018-08-07 Gemvax & Kael Co., Ltd. Anti-inflammatory peptides and composition comprising the same
US10383926B2 (en) 2013-06-07 2019-08-20 Gemvax & Kael Co., Ltd. Biological markers useful in cancer immunotherapy
US10463708B2 (en) 2014-12-23 2019-11-05 Gemvax & Kael Co., Ltd. Peptide for treating ocular diseases and composition for treating ocular diseases comprising same
US10561703B2 (en) 2013-06-21 2020-02-18 Gemvax & Kael Co., Ltd. Method of modulating sex hormone levels using a sex hormone secretion modulator
US10662223B2 (en) 2014-04-30 2020-05-26 Gemvax & Kael Co., Ltd. Composition for organ, tissue, or cell transplantation, kit, and transplantation method
US10835582B2 (en) 2015-02-27 2020-11-17 Gemvax & Kael Co. Ltd. Peptide for preventing hearing loss, and composition comprising same
US10898540B2 (en) 2016-04-07 2021-01-26 Gem Vax & KAEL Co., Ltd. Peptide having effects of increasing telomerase activity and extending telomere, and composition containing same
US10967000B2 (en) 2012-07-11 2021-04-06 Gemvax & Kael Co., Ltd. Cell-penetrating peptide, conjugate comprising same and composition comprising same
US11058744B2 (en) 2013-12-17 2021-07-13 Gemvax & Kael Co., Ltd. Composition for treating prostate cancer
KR102445492B1 (en) * 2021-12-24 2022-09-21 엔케이젠 주식회사 Composition for mass proliferation of natural killer cells comprising novel peptide, and method for mass proliferation of natural killer cells using the same

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0841396A1 (en) 1996-10-01 1998-05-13 Geron Corporation Human telomerase catalytic subunit
KR20030077363A (en) 2002-03-26 2003-10-01 한국과학기술원 Antimicrobial peptide, its analogs and antimicrobial composition comprising thereof
EP1362597A1 (en) 1998-07-08 2003-11-19 GemVax AS Antigenic peptides derived from telomerase

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0841396A1 (en) 1996-10-01 1998-05-13 Geron Corporation Human telomerase catalytic subunit
EP1362597A1 (en) 1998-07-08 2003-11-19 GemVax AS Antigenic peptides derived from telomerase
KR20030077363A (en) 2002-03-26 2003-10-01 한국과학기술원 Antimicrobial peptide, its analogs and antimicrobial composition comprising thereof

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
Clin. Cancer Res., 2011, 제17권, 제13호, 페이지 4568-4580 *

Cited By (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10960056B2 (en) 2012-05-11 2021-03-30 Gemvax & Kael Co., Ltd. Anti-inflammatory peptides and composition comprising the same
US11857607B2 (en) 2012-05-11 2024-01-02 Gemvax & Kael Co., Ltd. Anti-inflammatory peptides and composition comprising the same
US11369665B2 (en) 2012-05-11 2022-06-28 Gemvax & Kael Co., Ltd. Anti-inflammatory peptides and composition comprising the same
US10039811B2 (en) 2012-05-11 2018-08-07 Gemvax & Kael Co., Ltd. Anti-inflammatory peptides and composition comprising the same
US10967000B2 (en) 2012-07-11 2021-04-06 Gemvax & Kael Co., Ltd. Cell-penetrating peptide, conjugate comprising same and composition comprising same
US10383926B2 (en) 2013-06-07 2019-08-20 Gemvax & Kael Co., Ltd. Biological markers useful in cancer immunotherapy
US10561703B2 (en) 2013-06-21 2020-02-18 Gemvax & Kael Co., Ltd. Method of modulating sex hormone levels using a sex hormone secretion modulator
US10034922B2 (en) 2013-11-22 2018-07-31 Gemvax & Kael Co., Ltd. Peptide having angiogenesis inhibitory activity and composition containing same
US11058744B2 (en) 2013-12-17 2021-07-13 Gemvax & Kael Co., Ltd. Composition for treating prostate cancer
US10662223B2 (en) 2014-04-30 2020-05-26 Gemvax & Kael Co., Ltd. Composition for organ, tissue, or cell transplantation, kit, and transplantation method
US11077163B2 (en) 2014-12-23 2021-08-03 Gemvax & Kael Co., Ltd. Peptide for treating ocular diseases and composition for treating ocular diseases comprising same
US10463708B2 (en) 2014-12-23 2019-11-05 Gemvax & Kael Co., Ltd. Peptide for treating ocular diseases and composition for treating ocular diseases comprising same
US10835582B2 (en) 2015-02-27 2020-11-17 Gemvax & Kael Co. Ltd. Peptide for preventing hearing loss, and composition comprising same
US11015179B2 (en) 2015-07-02 2021-05-25 Gemvax & Kael Co., Ltd. Peptide having anti-viral effect and composition containing same
WO2017003267A1 (en) * 2015-07-02 2017-01-05 주식회사 젬백스앤카엘 Peptide having anti-viral effect and composition containing same
JP2018526332A (en) * 2015-07-02 2018-09-13 ジェムバックス アンド カエル カンパニー,リミティド Peptide having antiviral activity and composition containing the same
JP2021175746A (en) * 2015-07-02 2021-11-04 ジェムバックス アンド カエル カンパニー,リミティド Peptide having anti-viral effect and composition containing the same
CN107847551B (en) * 2015-07-02 2022-02-08 珍白斯凯尔有限公司 Peptides having antiviral action and compositions comprising the same
CN107847551A (en) * 2015-07-02 2018-03-27 珍白斯凯尔有限公司 Peptide with antivirus action and include its composition
KR20180016410A (en) * 2015-07-02 2018-02-14 주식회사 젬백스앤카엘 Peptides having antiviral activity and compositions comprising same
US10898540B2 (en) 2016-04-07 2021-01-26 Gem Vax & KAEL Co., Ltd. Peptide having effects of increasing telomerase activity and extending telomere, and composition containing same
KR102445492B1 (en) * 2021-12-24 2022-09-21 엔케이젠 주식회사 Composition for mass proliferation of natural killer cells comprising novel peptide, and method for mass proliferation of natural killer cells using the same
WO2023120844A1 (en) * 2021-12-24 2023-06-29 엔케이젠 주식회사 Composition for mass proliferating natural killer cells, comprising novel peptide, and method for mass proliferating natural killer cells by using same

Also Published As

Publication number Publication date
KR102038487B1 (en) 2019-10-30

Similar Documents

Publication Publication Date Title
KR102038487B1 (en) Antimicrobial or antifungal composition comprising telomerase peptide
Lei et al. The antimicrobial peptides and their potential clinical applications
KR20180056226A (en) Antimicrobial Peptide Analogues Derived From The Abalone, Haliotis Discus, And Antimicrobial Pharmaceutical Composition Containing The Same
KR102224929B1 (en) Novel antimicrobial peptide derived from antimicrobial peptides isolated from Korean sea cucumber and uses thereof
KR101629386B1 (en) An anti-microbial peptide Scolopendrasin-7 isolated from the Scolopendra subspinipes mutilans and its synthetic peptide
AU2004287281A1 (en) Disinfecting composition and methods of making and using same
Jindal et al. Net charge, hydrophobicity and specific amino acids contribute to the activity of antimicrobial peptides
US20210361738A1 (en) Bacteriophage-derived recombinant protein having antimicrobial activity against pathogenic gram-negative bacteria
EP3120850B1 (en) Niacinamide for inducing generation of antimicrobial peptides
KR102272901B1 (en) Composition for external application to the skin containing meso-2,3-butanediol as a preservative
JP2020164548A (en) Composition containing meso-2,3-butanediol
KR102320505B1 (en) Antibacterial Composition containing meso-2,3-butanediol
Kim et al. Effects of the synthetic coprisin analog peptide, CopA3 in pathogenic microorganisms and mammalian cancer cells
KR100836596B1 (en) Salt-resistant antimicrobial peptides and antimicrobial composition comprising thereof
KR101430084B1 (en) Novel antibiotic peptide against Propionibacterium acnes and use therof
KR101818499B1 (en) Antibiotic composition with novel endolysin LysSA97 from Staphylococcus aureus bacteriophage and compound from essential oil
KR102541856B1 (en) Cosmetic composition for antibacterial comprising the fk-13 peptide as an active ingredient
AU2004212179A1 (en) Antimicrobial agents from Streptococcus mitis and Streptococcus oralis
KR102260163B1 (en) Antimicrobial Cosmetic Composition
KR20180078853A (en) Antimicrobial Peptide Derived From The Mytilus coruscus And Its Use
KR101977800B1 (en) Pseudomonas specific antimicrobial peptide and antimicrobial composition comprising the same
AU2016269417B2 (en) Disinfectant and antimicrobial compositions, in particular for the veterinary field
KR102554966B1 (en) Cosmetic composition for antibacterial comprising the indolicidin analog as an active ingredient
KR101838208B1 (en) Antimicrobial peptide with improved specificity to gram-negative pathogen and antimicrobial composition comprising the same
KR102358469B1 (en) Antimicrobial peptide derived from Impatiens balsamina and antimicrobial composition comprising the same

Legal Events

Date Code Title Description
N231 Notification of change of applicant
A201 Request for examination
E902 Notification of reason for refusal
E902 Notification of reason for refusal
E701 Decision to grant or registration of patent right
GRNT Written decision to grant