KR20120027740A - Immunogenic peptide and composition for preventing or treating hpv-related diseases - Google Patents

Immunogenic peptide and composition for preventing or treating hpv-related diseases Download PDF

Info

Publication number
KR20120027740A
KR20120027740A KR1020100089502A KR20100089502A KR20120027740A KR 20120027740 A KR20120027740 A KR 20120027740A KR 1020100089502 A KR1020100089502 A KR 1020100089502A KR 20100089502 A KR20100089502 A KR 20100089502A KR 20120027740 A KR20120027740 A KR 20120027740A
Authority
KR
South Korea
Prior art keywords
peptide
artificial sequence
seq
peptides
mutant
Prior art date
Application number
KR1020100089502A
Other languages
Korean (ko)
Other versions
KR101415554B1 (en
Inventor
이경률
임종백
Original Assignee
바이오코아 주식회사
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 바이오코아 주식회사 filed Critical 바이오코아 주식회사
Priority to KR20100089502A priority Critical patent/KR101415554B1/en
Priority to CN201180044102.8A priority patent/CN103097398B/en
Priority to PCT/KR2011/006727 priority patent/WO2012036437A2/en
Publication of KR20120027740A publication Critical patent/KR20120027740A/en
Application granted granted Critical
Publication of KR101415554B1 publication Critical patent/KR101415554B1/en

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04—Linear peptides containing only normal peptide links
    • C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/12—Viral antigens
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A61P31/20—Antivirals for DNA viruses
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/58—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
    • A61K2039/585—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation wherein the target is cancer
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011—Details
    • C12N2710/20011—Papillomaviridae
    • C12N2710/20022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011—Details
    • C12N2710/20011—Papillomaviridae
    • C12N2710/20032—Use of virus as therapeutic agent, other than vaccine, e.g. as cytolytic agent
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011—Details
    • C12N2710/20011—Papillomaviridae
    • C12N2710/20034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Virology (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Molecular Biology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Oncology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biotechnology (AREA)
  • Engineering & Computer Science (AREA)
  • Communicable Diseases (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Immunology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

PURPOSE: A composition containing immunogenic peptides for preventing or treating HPV-associated diseases is provided to effectively generate cytotoxic T lymphocytes. CONSTITUTION: An immunogenic peptide and mutant of same function with the peptides has amino acid sequences of (sequence number 6) or LCVQSTHVDI(sequence number 35). The mutant has amino acid sequences of CYQSTHVDI(sequnce number 43) or CYVTLRVCL(sequence number 47). A nucleic acid encoding the peptide of sequence number 16 or 35 has base sequences of sequence numbers 48 and 49. A composition for preventing or treating HPV infection-associated diseases contains the immunogenic peptides and pharmaceutically acceptable carrier.

Description

면역성 펩타이드 및 그 펩타이드를 포함하는 ＨＰＶ 관련 질환 예방 또는 치료용 조성물{Immunogenic Peptide and Composition for preventing or treating HPV-related diseases}TECHNICAL FIELD The present invention relates to a composition for preventing or treating an HPV-related disease including an immunogenic peptide and a peptide thereof,

본 발명은 면역성 펩타이드 및 그 펩타이드를 포함하는 HPV 관련 질환 예방 또는 치료용 조성물에 관한 것으로 더욱 상세하게는 HLA-A*2402 타입 자궁 경부암 환자 특이적인 세포 독성 T 림프구 생성을 유도하는 HPV 타입 16 E7 에피토프 및 그 펩타이드를 포함하는 HPV 관련 질환 예방 또는 치료용 조성물에 관한 것이다.The present invention relates to a composition for preventing or treating an HPV-related disease comprising an immunogenic peptide and a peptide thereof, and more particularly, to a composition for preventing or treating an HPV type 16 E7 epitope that induces the production of cytotoxic T lymphocytes specific for HLA- And a composition for preventing or treating an HPV-related disease comprising the peptide.

자궁 경부암은 여성에게서 발생되는 악성 종양 가운데 두 번째로 발병 빈도가 높은 것으로, 매년 전세계적으로 35만 명 이상의 환자가 자궁 경부암으로 사망하고 있으며, 그 수가 계속 증가하고 있다(Pisani P, 등. Int J Cancer 2002;97(1):72-81.). 자궁 경부암의 주원인은 인유두종 바이러스(human papillomavirus : HPV)로 알려져 있으며, 100여종이 넘는 HPV 중 40여종이 여성 생식기에서 작용하는 것으로 밝혀 졌다(de Villiers EM, 등. Virology 2004;324:17-27). 여러 종류의 HPV 중에서 특히 HPV 타입 16과 HPV 타입 18이 자궁 경부암 환자에게서 가장 흔하게 발견되어 종양발생에 중요하게 관여하고 있음을 예측할 수 있으며 그 중 HPV 타입 16은 가장 많은 자궁 경부암 환자가 감염되어 있는 것으로 알려져 있다(Munoz N, 등. N Engl J Med 2003;348(6):518-27). Cervical cancer is the second leading cause of malignancy in women. More than 350,000 patients worldwide die from cervical cancer each year, and the number continues to increase (Pisani P, et al., Int J Cancer 2002; 97 (1): 72-81.). The major cause of cervical cancer is known as human papillomavirus (HPV), and 40 of more than 100 HPV types have been found to act in female reproductive systems (de Villiers EM, et al., Virology 2004; 324: 17-27) . Among the various types of HPV, HPV type 16 and HPV type 18 are most commonly found in cervical cancer patients and can be predicted to be important for tumorigenesis, among which HPV type 16 is the most common cervical cancer patient (Munoz N, et al., N Engl J Med 2003; 348 (6): 518-27).

HPV가 정상 세포에 감염되면 viral oncogene이 숙주세포(host cell)의 유전자에 삽입되어 여러 viral protein을 발현하게 되는 데, 그 중 E6와 E7은 강력한 oncoprotein으로서 tumor suppressor인 p53과 RB의 작용을 억제하여 암세포로의 진행과 지속적인 성장을 촉진하는 것으로 밝혀 졌다(zur Hausen H. Nat Rev Cancer 2002;2(5):342-50). E7은 tumor suppressor 인 RB의 기능을 억제하며, S-phase 유전자인 cyclin A 와 cyclin E의 활성을 촉진하고(zur Hausen H. 등. Nat Rev Cancer 2002;2(5):342-50;Phelps WC, 등. Cell 1988;53(4):539-47), 또한 cyclin-dependent kinase inhibitor인 CIP1(p21)과 KIP1(p27)의 기능을 억제하는 등의 작용으로 감염된 세포의 apoptosis를 저해하고 종양으로의 전환을 유발하는 것으로 알려 졌다(Funk JO, 등. Genes Dev 1997;11(16):2090-100;Zerfass-Thome K, 등 Oncogene 1996; 13(11):2323-30). 이러한 viral oncoprotein들은 정상 세포에서는 발견되지 않아 다양한 종류의 암을 대상으로 하는 면역치료에 있어서 아주 유력한 target이 되고, 또한 자궁 경부암의 치료가 가능한 세포 독성 T 림프구(cytotoxic T lymphocyte: CTL)를 생성하기 위해 HPV 에피토프을 규명하고자 하는 연구의 주요 대상이 되고 있다.When HPV infects normal cells, the viral oncogene is inserted into the host cell gene and expresses several viral proteins. Among them, E6 and E7 are powerful oncoproteins that suppress the action of tumor suppressors p53 and RB And promoted progression to cancer cells and continued growth (zur Hausen H. Nat Rev Cancer 2002; 2 (5): 342-50). E7 inhibits the function of RB, a tumor suppressor, and promotes the activity of the S-phase genes cyclin A and cyclin E. (zur Hausen H. et al., Nat Rev Cancer 2002; 2 (5): 342-50; Phelps WC (P21) and KIP1 (p27), which inhibit the apoptosis of infected cells, and inhibit the function of the tumor by inhibiting the function of the cyclin-dependent kinase inhibitors CIP1 (p21) and KIP1 (Funk JO et al., Genes Dev 1997; 11 (16): 2090-100; Zerfass-Thome K, et al. Oncogene 1996; 13 (11): 2323-30). These viral oncoproteins are not found in normal cells and are a very potent target in immunotherapy for various types of cancer. They are also used to generate cytotoxic T lymphocytes (CTL) that can treat cervical cancer It has become a major object of research to identify HPV epitopes.

현재까지 자궁 경부암 치료를 위해 HPV 타입 16에 특이적인 세포 독성 T 림프구를 생성을 유도하는 특정한 E7 에피토프을 개발하기 위한 연구들은 인류의 인체 백혈구 항원(human leukocyte antigen : HLA) 대립 유전형질(allele) 가운데 대부분을 차지하는 HLA-A*0201 타입의 환자들을 대상으로 진행되어 밝혀진 결과가 있지만(Kast WM, 등. J Immunol 1994;152:3904-12), 많은 인류의 또 다른 주요 인체 백혈구 항원 대립 유전형질인 HLA-A*2402 타입의 환자들에게서 밝혀진 연구 내용이 거의 없는 실정이다.To date, studies to develop a specific E7 epitope that induces the production of cytotoxic T lymphocytes specific for HPV type 16 for the treatment of cervical cancer have shown that most of the human leukocyte antigen (HLA) (Kast WM, et al. J Immunol 1994; 152: 3904-12), another major human leukocyte antigen allelic genetic trait, HLA-A * 0201 There is little research that has been done on patients with type-A * 2402.

따라서, 본 발명에서는 유체 세포측정법(flow cytometry)과 세포 독성(cytotoxicity) 실험을 통하여 HLA-A*2402 타입을 가진 자궁 경부암 환자의 치료가 가능한 세포 독성 T 림프구 생성을 유도하는 HPV 타입 16 E7 에피토프을 규명하고자 한다
Therefore, in the present invention, the HPV type 16 E7 epitope inducing the cytotoxic T lymphocyte generation that can be treated in the cervical cancer patients having the HLA-A * 2402 type was identified through flow cytometry and cytotoxicity experiments I want to

본 발명은 상기의 필요성에 의하여 안출된 것으로서 본 발명의 목적은 HLA-A*2402 타입을 가진 자궁 경부암 환자의 치료가 가능한 세포 독성 T 림프구 생성을 유도하는 HPV 타입 16 E7 펩타이드를 제공하는 것이다.The present invention has been made in view of the above needs, and it is an object of the present invention to provide an HPV type 16 E7 peptide which induces cytotoxic T lymphocyte production which can be treated in cervical cancer patients having HLA-A * 2402 type.

본 발명의 다른 목적은 상기 HPV관련 질환 예방 또는 치료용 조성물을 제공하는 것이다.Another object of the present invention is to provide a composition for preventing or treating HPV-related diseases.

상기의 목적을 달성하기 위하여 본 발명은 HPV 타입 16 E7 단백질로부터 유래한 9개-10개의 아미노산 서열을 가진 펩타이드 및 그 기능적으로 동일한 돌연변이체를 제공한다.In order to achieve the above object, the present invention provides peptides having 9-10 amino acid sequences derived from HPV type 16 E7 protein and functionally equivalent mutants thereof.

또 본 발명에 있어서, 상기 펩타이드 서열은 CDSTLRLCV(서열번호 16) 또는 LCVQSTHVDI(서열번호 35)의 아미노산 서열을 포함하는 것이 바람직하나 이에 한정되지 아니한다.In the present invention, the peptide sequence preferably includes an amino acid sequence of CDSTLRLCV (SEQ ID NO: 16) or LCVQSTHVDI (SEQ ID NO: 35), but is not limited thereto.

본 발명에서 "기능적으로 동일한" 및 "실질적으로 동일한 생물학적 기능 또는 활성"은 각각 각각의 폴리펩타이드의 생물학적 활성이 동일한 절차에 의해서 측정되는 경우에, 그 생물학적 활성의 약 50% 내지 약 100% 또는 그 이상인 정도의 생물학적 활성이 이것이 비교가 되는 폴리펩타이드에 의해서 나타나는 것을 의미한다. 예를 들어, 도 3의 유체 세포측정법을 이용한 HPV 타입 16 E7 에피토프 특이적인 IFN-γ의 생성 확인 및/또는 도 4의 51Cr release assay 법을 이용한 HPV 타입 16 E7 에피토프(9mer, 10mer) 특이적인 자궁 경부암 세포의 사멸효과 확인 실험결과, 본 발명의 기능적으로 동일한 펩타이드는 도 6b와 같은 절차를 거쳐서 도 6c 및 도 6d에서 본 발명의 펩타이드와 실질적으로 동일한 생물학적을 활성을 나타내는 펩타이드를 의미하며, 바람직하게는 상기 기능적으로 동일한 펩타이드는 CYQSTHVDI(서열번호 43) 또는 CYVTLRVCL(서열번호 47)의 아미노산 서열을 가지는 것이 바람직하나 이에 한정되지 아니한다.In the present invention, "functionally equivalent" and "substantially the same biological function or activity" mean about 50% to about 100% of the biological activity, respectively, of the biological activity of each polypeptide when measured by the same procedure. Of the biological activity is indicated by the polypeptide to which it is compared. For example, HPV type 16 E7 epitope-specific IFN-γ production using the fluid cell assay of FIG. 3 and / or HPV type 16 E7 epitope (9mer, 10mer) specificity using the 51 Cr release assay of FIG. As a result of examining the killing effect of cervical cancer cells, the functionally equivalent peptides of the present invention refer to peptides that exhibit substantially the same biological activity as the peptides of the present invention in the cases of FIGS. 6C and 6D through the procedure as shown in FIG. 6B, , The functionally equivalent peptide preferably has an amino acid sequence of CYQSTHVDI (SEQ ID NO: 43) or CYVTLRVCL (SEQ ID NO: 47), but is not limited thereto.

또한 본 발명은 상기 본 발명의 서열번호 16 또는 서열번호 35의 펩타이드를 코딩하는 핵산을 제공한다.The present invention also provides a nucleic acid encoding the peptide of SEQ ID NO: 16 or SEQ ID NO: 35 of the present invention.

또 본 발명은 상기 서열번호 16의 펩타이드를 코딩하는 유전자는 서열번호 48의 염기서열을 가지고, 서열번호 35의 펩타이드를 코딩하는 유전자는 서열번호 49의 염기서열을 가지는 것이 바람직하나 이들 염기서열에 하나 이상의 치환, 결손, 부가 등의 돌연변이를 유발하여 본 발명의 목적하는 효과와 동일한 활성을 나타내는 모든 돌연변이 유전자도 본 발명의 범위에 포함된다.In the present invention, it is preferable that the gene encoding the peptide of SEQ ID NO: 16 has the nucleotide sequence of SEQ ID NO: 48 and the gene coding the peptide of SEQ ID NO: 35 has the nucleotide sequence of SEQ ID NO: 49, All mutant genes which cause mutations such as substitution, deletion, addition and the like and exhibit the same activity as the desired effect of the present invention are also included in the scope of the present invention.

또한 본 발명은 서열번호 43 또는 서열번호 47의 펩타이드를 각각 코딩하는 핵산을 제공한다.The present invention also provides a nucleic acid encoding a peptide of SEQ ID NO: 43 or SEQ ID NO: 47, respectively.

이들 CYQSTHVDI(m3, 치환된 펩타이드 3번)과 CYVTLRVCL (m7, 치환된 펩타이드 7번) 펩타이드는 RNA codon을 이용하여 유전자 서열을 유추할 수는 있는데, 아래와 같이 여러 조합이 나올 수 있다(예를 들어, 서열번호 50-107).These CYQSTHVDI (m3, substituted peptide 3) and CYVTLRVCL (m7, substituted peptide 7) peptides can be used to derive gene sequences using RNA codons, which can be combined as follows , SEQ ID NOS: 50-107).

CC YY QQ SS TT HH VV DD II tgttgt TAT
TACTAT
TAC tcttct acgacg cttctt cggcgg ttgttg tgctgc gtagta

표 1은 modified peptide 3 즉, 서열번호 43 펩타이드를 코딩하는 유전자 서열 표이다.Table 1 is a gene sequence table coding for the modified peptide 3, that is, the peptide of SEQ ID NO: 43.

CC YY VV TT LL RR VV CC LL tgttgt TAT
TACTAT
TAC GTT, GTC, GTA, GTGGTT, GTC, GTA, GTG acgacg cttctt cggcgg GTT, GTC, GTA, GTGGTT, GTC, GTA, GTG tgctgc TTA, TTG, CTT, CTC, CTA, CTGTTA, TTG, CTT, CTC, CTA, CTG

표 2는 modified peptide 7 즉, 서열번호 47을 코딩하는 유전자 서열 표이다.Table 2 is a gene sequence table coding for the modified peptide 7, i.e., SEQ ID NO: 47.

또한 본 발명은 (a)상기의 펩타이드 및 (b)약학적으로 수용가능한 담체를 포함하는 약학용 조성물을 제공한다.The present invention also provides a pharmaceutical composition comprising (a) the above peptide and (b) a pharmaceutically acceptable carrier.

상기의 조성물은 HPV 감염 관련 질환 예를 들어 보웬성 구진(bowenoid papulosis), 항문 이형성(anal dysplasia), 호흡기 또는 결막 유두종, 자궁 경부 이형성증, 자궁경부암, 외음암(vulval cancer), 또는 전립선암의 치료 또는 예방에 유용하나 이에 한정되지 아니한다.Such compositions may be useful for the treatment of HPV infection related diseases such as bowenoid papulosis, anal dysplasia, respiratory or conjunctival papilloma, cervical dysplasia, cervical cancer, vulval cancer, or prostate cancer Or prevention, but are not limited thereto.

본 발명에 있어서, 상기의 조성물은 HLA-A*2402 타입 환자 특이적인 것을 특징으로 한다.In the present invention, the composition is characterized by being HLA-A * 2402 type patient specific.

또한 본 발명의 펩타이드 또는 핵산은 선택적으로 미세입자, 리포좀, 또는 면역 자극 복합체(ISCOM)(활성성분으로 사포닌만을 포함할 수도 있는) 또는 본 발명의 펩타이드를 투여 대상에 공급하기에 적합한 다른 운반수단 속에 제제화될 수 있다. 미세입자를 사용하는 경우 그것은 바람직하게는 poly-lactic-co-glycolic acid (PLGA)와 같은 공중합체인 중합체 매트릭스를 갖는다.The peptides or nucleic acids of the present invention can also optionally be in the form of microparticles, liposomes, or immunostimulatory complexes (ISCOMs) (which may only contain saponin as the active ingredient) or peptides of the invention into other delivery vehicles Can be formulated. When fine particles are used, it preferably has a polymer matrix that is a copolymer such as poly-lactic-co-glycolic acid (PLGA).

포유류에서 면역반응(예를 들어 MHC class I-매개 또는 class II-매개 면역 반응을 포함하는 세포 면역 반응)은 면역원성 펩타이드가 결합하는 MHC 분자를 가지는 포유류, 즉 인간, 유인원, 개, 고양이, 또끼, 소, 쥐에 면역원성 펩타이드를 투여하여 촉발될 수 있다. 상기 본 발명의 펩타이드는 미세입자, 리포좀, 또는 ISCOM, 또는 용액의 일부로 투여될 수 있다. An immune response in mammals (e. G., A cellular immune response involving an MHC class I-mediated or class II-mediated immune response) may be induced by a mammal having an MHC molecule to which an immunogenic peptide binds, such as a human, an ape, a dog, , Bovine, rats may be triggered by administration of immunogenic peptides. The peptides of the present invention may be administered as microparticles, liposomes, or ISCOMs, or as part of a solution.

본 발명의 펩타이드를 투여하는 또 다른 방법은 본 발명의 펩타이드를 코딩하는 핵산 서열을 포함하는 발현벡터를 이용하는 것이다. 그 핵산 서열은 선택적으로 상기의 본 발명의 펩타이드에 연결된 신호 서열을 코딩할 수도 있다.그 핵산이 신호 서열을 코딩할 때 바람직하게는 그것은 HLA-DR.alpha로부터 온 신호 서열 Met Ala Ile Ser Gly Val Pro Val Leu Gly Phe Phe Ile Ile Ala Val Leu Met Ser Ala Gln Glu Ser Trp Ala(서열번호 108)을 코딩한다. 그 경우에 본 발명의 서열은 예를 들어 서열번호 16 또는 35 또는 그 돌연변이체의 서열을 가질 수 있다. 바람직하게는 그 핵산은 핵산 감염을 일으키는 바이러스 유전자를 포함하지 아니하고 인택트 E7 단백질을 코딩하지 아니한다. Another method of administering the peptides of the present invention is to use an expression vector comprising a nucleic acid sequence encoding the peptide of the present invention. The nucleic acid sequence may optionally encode a signal sequence that is linked to the peptide of the invention. When the nucleic acid encodes the signal sequence it is preferably a signal sequence from HLA-DR.alpha Met Ala Ile Ser Gly Val Pro Val Leu Gly Phe Phe Ile Ile Ala Val Leu Met Ser Ala Gln Glu Ser Trp Ala (SEQ ID NO: 108). In that case, the sequence of the present invention may, for example, have the sequence of SEQ ID NO: 16 or 35 or a mutant thereof. Preferably, the nucleic acid does not contain a viral gene that causes a nucleic acid infection and does not encode an Intage E7 protein.

본 발명의 핵산은 프라즈미드 내에 포함될 수 있고, 선택적으로 중합체 매트릭스를 포함하는 미세입자 내에 제공될 수 있다. 바람직한 실시예에서 중합체 매트릭스는 필수적으로 PLGA의 공중합체로 구성된다. 바람직하게 그 미세입자는 예를 들어 0.02에서 20 마이크론 또는 약 11 마이크론 이하의 직경을 가진다. 바람직하게는 복수의 미세입자들이 0.02에서 20 마이크론 또는 약 11 마이크론 이하의 직경을 가진다.The nucleic acid of the present invention may be contained in a plasmid and optionally provided in microparticles comprising a polymer matrix. In a preferred embodiment, the polymer matrix essentially consists of a copolymer of PLGA. Preferably, the microparticles have a diameter of, for example, 0.02 to 20 microns or less than about 11 microns. Preferably, the plurality of microparticles have a diameter of 0.02 to 20 microns or less than about 11 microns.

본 발명의 프라즈미드를 포함하는 세포도 본 발명의 범위 내이다. 그 세포는 예를 들어 B 세포 또는 다른 항원 제시 세포(APC)일 수 있다. 그 세포는 그것을 ㅋ코딩하는 프라즈미드로부터 펩타이드 발현을 가능하게 하는 조건에서 배양되거나 유지된다.Cells comprising the plasmids of the invention are also within the scope of the present invention. The cell may be, for example, a B cell or another antigen presenting cell (APC). The cell is cultured or maintained under conditions that allow peptide expression from the plasmid in which it is encoded.

본 발명의 핵산 및 프라즈미드는 예를 들어 "naked DNA"로 포유류에 상기 언급한 플라즈미드를 투여하여 포유류 예를 들어 인간에서 면역 반응을 유도하는 방법에 유용하다. 그 포유류는 HPV 감염, 자궁경부 이형성증, 및/또는 자궁경부암의 위험이나 또는 질환을 가질 수 있다. 본 발명의 핵산 및 플라즈미드도 미세 입자, 리포좀, ISCOMS, 또는 상기에 기재된 것과 같은 다른 적당한 운반 수단에 삽입될 수 있다.Nucleic acids and plasmids of the present invention are useful in methods of inducing an immune response in a mammal, e.g., a human, by administering the above-mentioned plasmid to a mammal, e.g., "naked DNA. &Quot; The mammal may have a risk or disease of HPV infection, cervical dysplasia, and / or cervical cancer. The nucleic acids and plasmids of the present invention may also be incorporated into microparticles, liposomes, ISCOMS, or other suitable delivery means such as those described above.

명세서에서 특별한 정의가 없으면 본 명세서에 사용된 모든 과학적 및 기술적인 용어는 본 발명이 속하는 기술분야에서 당업자에 의하여 통상적으로 이해되는 것과 동일한 의미를 가진다.Unless defined otherwise in the specification, all scientific and technical terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs.

본 발명에 개재된 펩타이드들과 그 펩타이드를 코딩하는 핵산은 HPV E7 단백질에 대한 면역 반응을 야기하는데 사용될 수 있다. The peptides and the nucleic acid encoding the peptides interposed in the present invention can be used to cause an immune response to the HPV E7 protein.

본 발명의 펩타이드는 세포내 기관으로 그 펩타이드를 운반하는 수송(trafficking) 서열이 연결될 수 있다. 그 수송서열은 그것이 부착된 펩타이드의 세포내 수송(소기관에서 소기관으로 또는 세포 표면으로 이동을 지시)을 조절하는 기능을 하는 아미노산 사열이다. 그러한 수송 서열들은 ER, 리소좀 또는 엔도좀으로 그 폴리펩타이드들을 수송할 수 있고 시그널 펩타이드들(번역 동안 ER에 단백질을 지시하는 N-말단 서열), 예를 들어 KDEL 과 같은 ER 체류 서열, 및 KFERQ, 또는 QREFK와 같은 와 같은 리소좀 타겟 서열을 포함할 수 있다. The peptide of the present invention may be linked to a trafficking sequence that carries the peptide to an intracellular organ. The transport sequence is an amino acid sequence that functions to regulate intracellular transport of the attached peptide (directing migration from the organelle to the organelle or cell surface). Such transport sequences are capable of transporting the polypeptides to ER, lysosomes or endosomes and include signal peptides (N-terminal sequences that direct proteins to ER during translation), ER retention sequences such as KDEL, and KFERQ, Or a lysosomal target sequence such as QREFK.

짧은 아미노산 사열들은 특정세포내 기관으로 단백질을 타겟하는 시그널로 작용할 수 있다. 예를 들어 ER로 가는 단백질의 아미노 말단에서 소수성 시그널 펩타이드가 발견된다.Short amino acid sequences can act as a signal to target proteins to specific intracellular organs. For example, a hydrophobic signal peptide is found at the amino terminus of a protein directed to the ER.

그러한 수송 서열은 HLA-DR.알파 리더 서열인 Met Ala Ile Ser Gly Val Pro Val Leu Gly Phe Phe Ile Ile Ala Val Leu Met Ser Ala Gln Glu Ser Trp Ala (서열번호 108)일 수 있다. 만약 그 부분이 본 발명의 폴리펩타이드를 ER로 수송하는데 충분하다면, 그 시그널 펩타이드의 상기 특정된 25개의 잔기 서열 중 일부분(예를 들어 적어도 9개의 아미노산 잔기)만을 포함할 수 있다. Such a transport sequence may be the HLA-DR. Alpha leader sequence Met Ala Ile Ser Gly Val Pro Val Leu Gly Phe Phe Ile Ile Ala Val Leu Met Ser Ala Gln Glu Ser Trp Ala (SEQ ID NO: 108). If the portion is sufficient to transport the polypeptide of the invention to the ER, it may comprise only a portion (e.g., at least 9 amino acid residues) of the specified 25 residue sequences of the signal peptide.

일부 경우에는 시그널 펩티데이즈에 의한 가공(즉 절단)을 가능하게 하기 위하여 본 발명의 HPV E7 항원성 펩타이드를 코딩하는 서열과 수송 서열을 연결하는 부분은 변형되는 것이 바람직하다. 시그널 펩타이드들에 대한 인식 서열들은 Von Heijne, NAR 14:4683, 1986에 기재된다. In some cases, it is preferred that the portion linking the sequence encoding the HPV E7 antigenic peptide of the present invention to the transport sequence is modified to enable processing (i. E., Cleavage) by the signal peptidase. The recognition sequences for the signal peptides are described in Von Heijne, NAR 14: 4683, 1986.

본 발명의 펩타이드를 코딩하는 DNA를 구축하는데 표준 기술이 사용될 수 있다(예를 들어 WO 94/04171에 기재된 기술을 참고). 그 구축물은 인간 세포들에서 발현을 증가시키는 부가적인 서열들 예를 들어 적당한 프로모터, 코딩 서열의 RNA 안정 5' 과 3' 서열, 인트론(코딩되는 서열 내에 5' 또는 3' 어느 쪽에도 위치될 수 있음), 및 폴리(A) 부가 자리뿐만 아니라 그 구축물이 원핵 및/또는 진핵 숙주에 대한 선택 및 복제를 가능하게 하는 복제 오리진 및 선택 마커들을 포함할 수 있다. Standard techniques can be used to construct DNA encoding the peptides of the invention (see, e. G., The techniques described in WO 94/04171). The construct may contain additional sequences that increase expression in human cells such as, for example, appropriate promoters, RNA stabilizing 5 ' and 3 ' sequences of coding sequences, introns (either 5 ' or 3 ' ), And poly (A) addition sites as well as replication origin and selection markers that allow selection and replication of the constructs to the prokaryotic and / or eukaryotic host.

본 발명의 플라즈미드 내에는 가나마이신 저항 유전자(519-1313 부위), SV40 얼리 프로모터(131-484 부위) 및 thymidine kinase (TK) 폴리아데닐레이션 자리(1314-1758 부위)를 가질 수 있다. 가나마이신 저항 유전자 및 관련 조절 서열은 단지 선택의 목적을 위한 것이고 만약 선택이 필요하지 않거나 바람직하지 않으면 플라즈미드로부터 제거될 수 있다.The plasmid of the present invention may have a kanamycin resistance gene (519-1313 region), SV40 early promoter (131-484 region), and thymidine kinase (TK) polyadenylation site (1314-1758 region). The kanamycin resistance gene and related regulatory sequences are for selection purposes only and may be removed from the plasmid if selection is not necessary or desirable.

본 발명의 펩타이드 및 핵산은 HPV에 의하여 감염된 것으로 알려졌거나, HPV에 의하여 감염된 것이 의심스럽거나, HPV에 의하여 감염될 수 있는 대상에서 예방 또는 치료적인 백신으로 사용될 수 있다. 다른 적당한 대상들은 HPV-관련 질환의 증상을 나타내거나 질환이 발생할 것 같은 사람들을 포함한다. 본 발명의 펩타이드 및 백신은 HPV 균주 16의 감염과 관련된 질환들, 예를 들어 보웬성 구진(bowenoid papulosis), 항문 이형성(anal dysplasia), 호흡기 또는 결막 유두종, 자궁 경부 이형성증, 자궁경부암, 외음암(vulval cancer), 또는 전립선암을 치료하거나 예방하는 백신으로 사용될 수 있다. The peptides and nucleic acids of the present invention may be used as preventive or therapeutic vaccines in subjects known to be infected by HPV, suspected of being infected by HPV, or infected by HPV. Other suitable subjects include those who exhibit symptoms of, or susceptibility to, HPV-related diseases. The peptides and vaccines of the present invention are useful for treating diseases associated with infection of HPV strain 16, such as bowenoid papulosis, anal dysplasia, respiratory or conjunctival papilloma, cervical dysplasia, cervical cancer, vulval cancer, or a vaccine that treats or prevents prostate cancer.

본 발명의 펩타이드 또는 핵산들은 HPV 감염 또는 HPV 감염과 관련된 질환들을 치료하기 위하여 단독 또는 당업계에 공지된 다른 치료법 예를 들어 화학요법제, 방사선 및 수술과 같이 투여될 수 있다. 또한 본 발명의 펩타이드들 및 핵산들은 면역 반응을 증진하기 위하여 고안된 다른 치료, 예를 들어 당업계에 주지된 것과 같은 어쥬번트 또는 사이토카인(또는 사이토카인을 코딩하는 핵산)과 혼합하여 투여될 수 있다.The peptides or nucleic acids of the present invention may be administered alone or in combination with other therapies known in the art such as chemotherapeutic agents, radiation, and surgery to treat diseases associated with HPV infection or HPV infection. The peptides and nucleic acids of the present invention may also be administered in combination with other therapies designed to promote an immune response, such as adjuvants or cytokines (or nucleic acids encoding cytokines) such as those well known in the art .

본 발명의 펩타이드 또는 핵산들은 HPV 감염 또는 HPV 감염 관련 질환의 예방 또는 치료용 약제의 제조에 사용될 수 있다. The peptides or nucleic acids of the present invention can be used for the preparation of medicaments for the prevention or treatment of HPV infection or HPV infection related diseases.

본 발명의 운반 시스템들은 HPV에 대한 면역 반응을 촉진시키려는 적당한 세포들에 펩타이드 또는 그 펩타이드를 발현하는 DNA 컨스트럭트를 운반하는데 사용될 수 있다. The delivery systems of the present invention can be used to deliver DNA constructs that express the peptides or peptides thereof to appropriate cells that are intended to stimulate an immune response to HPV.

본 발명의 펩타이드 또는 그 펩타이드를 코딩하는 핵산들은 표준 방법, 예를 들어 Donnelly et al., J. Imm. Methods 176:145, 1994, 및 Vitiello et al., J. Clin. Invest. 95:341, 1995에 기재된 것과 같은 방법을 사용하여 투여될 수 있다.Nucleic acids encoding the peptides or peptides of the present invention can be prepared by standard methods, e. G., Donnelly et al., J. Imm. Methods 176: 145, 1994, and Vitiello et al., J. Clin. Invest. 95: 341, < RTI ID = 0.0 > 1995. < / RTI >

본 발명의 펩타이드 또는 핵산들은 대상에 당업계에 공지된 형태, 예를 들어 근육주사, 정맥주사, 동맥주사, 피내주사, 복강주사, 코의내부, 질내, 관장내, 피하내 주사될 수 있거나 그들은 예를 들어 미세입자를 포함하는 분말 또는 용액의 흡입에 의하여 위장관, 점막 또는 호흡기로 투여될 수 있다. 투여는 국소적(예를 들어 자궁경부 또는 다른 감염자리) 또는 전신성일 수 있다. The peptides or nucleic acids of the present invention may be administered to a subject in a form known in the art such as intramuscular, intravenous, intramuscular, intradermal, intraperitoneal, intraperitoneal, intrathecal, intramuscular, subcutaneous injection For example, by inhalation of a powder or solution containing microparticles, into the gastrointestinal tract, mucosa or the respiratory tract. Administration may be topical (e.g., cervical or other site of infection) or systemic.

본 발명의 펩타이드 또는 그 펩타이드를 코딩하는 핵산들은 콜로이드 현탁액, 분말, 식염수, 지질, 리포좀, 미소구체(microspheres), 또는 나노구형입자와 같은 약학적으로 수용될 수 있는 담체에 운반될 수 있다. 그들은 운반 수단과 복합체를 형성하거나 관련되거나 또는 네이키드될 수 있고 지질, 리포좀, 미세입자, 금, 나노입자, 폴리머, 축하반응제, 다당류, 폴리아미노산, 덴드리머, 사포닌, 흡착 증진 물질 또는 지방산과 같은 당업계에 공지된 운반 시스템을 사용하여 운반될 수 있다.Nucleic acids encoding the peptides or peptides of the invention can be delivered to a pharmaceutically acceptable carrier such as a colloidal suspension, powder, saline, lipid, liposome, microspheres, or nanospheric particles. They can be conjugated to, or complex with, carrier means such as lipids, liposomes, microparticles, gold, nanoparticles, polymers, conformational reactants, polysaccharides, polyamino acids, dendrimers, saponins, And may be carried using a delivery system known in the art.

약 0.1에서 100 마이크로몰의 펩타이드 용량 또는 약 1에서 200 마이크로그램의 DNA의 용량이 1회 체중 kg 당 투여되는 것이 바람직하다. 물론 당업계에 주지된 바와 같이 주어진 환자에 대한 용량은 환자의 키, 체표면적, 나이, 투여되는 특정 화합물, 성별, 투여 시간과 경로, 일반적 건강상태 및 동시에 투여되는 다른 약제를 포함하는 많은 인자들에 의존한다. 적정 투여량의 결정은 통상의 지식을 가진 약사들의 능력 범위내에서 능숙하다.It is preferred that a peptide dose of about 0.1 to 100 micromolar or a dose of about 1 to 200 micrograms of DNA is administered per kg of body weight once per day. Of course, as is well known in the art, the dosage for a given patient will depend on many factors, including the patient's height, body surface area, age, the particular compound being administered, sex, time and route of administration, general health, Lt; / RTI > Determination of the proper dosage is well within the capabilities of pharmacists of ordinary skill.

바이오리스틱(biolistic) 전달 또는 생체 외(ex vivo) 처리와 같은 다른 표준 전달 방법들이 사용될 수도 있다. 생체 외 처리에서 예를 들어 항원제시 세포들(APCs), 수지상세포들, 말초혈액 단핵구 세포들, 또는 골수세포들을 환자 또는 적당한 공여자로부터 얻어서 본 면역 조성물로 생체 외에서 활성화된 후 그 환자에게 투여될 수 있다. Other standard delivery methods such as biolistic delivery or ex vivo treatment may be used. In vivo treatment, for example, antigen presenting cells (APCs), dendritic cells, peripheral blood mononuclear cells, or bone marrow cells can be obtained from a patient or a suitable donor and then administered to the patient after being activated in vitro with the immunoconjugate have.

미국 특허 제 5,783,567에 기재된 것을 포함하는 미세입자들이 세포 속으로DNA, 또는 펩타이드와 같은 거대분자를 운반하기 위한 운송수단으로 사용될 수 있다. 그들은 폴리머의 쉘 내에 둘러 쌓여 있거나 폴리머 매트릭스에 들어간 거대분자들을 포함한다. 미세입자들은 예를 들어 들어있는 DNA를 분해되지 않은 상태로 유지하는 것과 같은 거대분자의 특성을 유지하는 작용을 한다. 미세입자들은 또 거대분자들의 펄스된 운반 및 특정 위치에 운반 또는 특정 세포 또는 타겟 세포군으로 운반에 사용될 수 있다.Microparticles, including those described in U.S. Patent No. 5,783,567, can be used as a vehicle for transporting macromolecules such as DNA or peptides into cells. They contain macromolecules that are enclosed within the shell of the polymer or enter the polymer matrix. Microparticles act, for example, to maintain macromolecular properties such as keeping the DNA in an undecomposed state. Microparticles may also be used for pulsed delivery of macromolecules and delivery to a specific site or delivery to a specific cell or target cell population.

폴리머 매트릭스는 poly-lactic-co-glycolic acid, 전분, 젤라틴 또는 키틴과 같은 생분해성 공중합체일 수 있다. 미세입자들은 대상의 식세포로 DNA 분자들의 이동을 최대화하는데 특히 사용될 수 있다. 또는 그 미세입자들은 조직에 주사되거나 이식될 수 있다. The polymer matrix may be a biodegradable copolymer such as poly-lactic-co-glycolic acid, starch, gelatin or chitin. Microparticles can be used particularly to maximize the migration of DNA molecules into the phagocytic cells of the subject. Or the microparticles may be injected or implanted into the tissue.

본 발명의 펩타이드는 당업계에 주지된 지질, 덴드리머 또는 리포좀을 통하여 대상에 투여될 수 있다. 예를 들어 면역 펩타이드 또는 그 펩타이드를 코딩하는 핵산들을 운반하는 리포좀들은 인 비보에서 CTL 반응을 야기하는 것으로 알려졌다(Reddy et al., J. Immunol. 148:1585, 1992; Collins et al., J. Immunol. 148:3336-3341, 1992; Fries et al., Proc. Natl. Acad. Sci. USA 89:358, 1992; Nabel et al., Proc. Nat. Acad. Sci. (USA) 89:5157, 1992).The peptides of the present invention can be administered to a subject through lipids, dendrimers or liposomes well known in the art. For example, liposomes carrying nucleic acids encoding immune peptides or peptides thereof have been found to cause CTL responses in in vivo (Reddy et al., J. Immunol. 148: 1585, 1992; Collins et al. Nabel et al., Proc. Nat. Acad. Sci. (USA) 89: 5157, 1992. Proc. Natl. Acad. Sci. USA 89: 358, 1992. Immunol., 148: 3336-3341, 1992. Fries et al., Proc. 1992).

본 발명의 펩타이드 및 핵산들은 사포닌 단독 또는 콜레스테롤 및 Quil A (사포닌)을 동시에 혼합하여 생성된 30-40 nm 크기의 (-) 차지된 케이지 유사 구조인 Immune Stimulating Complexes (ISCOMS)을 사용하여 투여될 수 있다. 본 발명의 펩타이드 및 핵산들은 ISCOMS와 동시 또는 별도로 투여될 수 있다. The peptides and nucleic acids of the present invention can be administered using Immune Stimulating Complexes (ISCOMS), a cage-like structure occupied by saponin alone or a mixture of cholesterol and Quil A (saponin) in a size of 30-40 nm have. The peptides and nucleic acids of the present invention can be administered simultaneously or separately with ISCOMS.

보호면역은 항원에 대한 운반 수단으로 ISCOMS을 사용한 톡소플라스마증 및 Epstein-Barr 바이러스 유도된 종양들을 포함하는 감염의 여러 실험 모델에서 생성되어 왔다(Mowat et al., Immunology Today 12:383-385, 1991). ISCOMS에서 캡슐화된 1ug의 낮은 항원 용량이 클래스 I 매개된 CTL 반응을 생성하는 것이 발견되었다(Takahashi et al., Nature 344:873-875, 1990).Protective immunity has been generated in several experimental models of infection involving toxoplasmosis and Epstein-Barr virus induced tumors using ISCOMS as a vehicle for antigen (Mowat et al., Immunology Today 12: 383-385, 1991 ). A low antigenic dose of 1 ug encapsulated in ISCOMS was found to produce Class I mediated CTL responses (Takahashi et al., Nature 344: 873-875, 1990).

면역 반응을 야기하는 본 발명의 펩타이드 및 핵산의 능력은 당업계에 주지된 면역 반응을 측정하는 방법들을 사용하여 분석할 수 있다. 예를 들어 세포 독성T 세포들의 생성은 MHC 테트라머를 사용하거나 세포내 사이토카인 발현을 측정하거나 표준 51Cr release 분석에서 나타낼 수 있다. ELISA 또는 ELISPOT와 같은 표준 분석도 T 세포 활성화에 기여하는 사이토카인 프로화일을 측정하는데 사용될 수 있다. T 세포 증식은 또 당업계에 공지된 다른 분석들과 3H-thymidine 업테이크와 같은 분석을 사용하여 측정될 수 있다. B 세포 반응들은 ELISA와 같은 분석을 사용하여 측정될 수 있다. The ability of the peptides and nucleic acids of the invention to elicit an immune response can be assayed using methods known in the art for measuring immune responses. For example, the production of cytotoxic T cells can be measured using MHC tetramers or by measuring intracellular cytokine expression or by standard 51 Cr release assays. Standard assays such as ELISA or ELISPOT can also be used to measure cytokine profiling that contribute to T cell activation. T cell proliferation can also be measured using other assays known in the art and assays such as 3 H-thymidine uptake. B cell responses can be measured using an assay such as ELISA.

디지털 이미징, 세포학적 질확대경 및 조직학적 검사와 같은 다른 방법들이 유두종 바이러스 관련 병소 또는 유두종 바이러스 레벨에 대한 본 발명의 펩타이드와 핵산의 효과를 측정하는데 사용될 수 있다. Other methods such as digital imaging, cytologic colposcopy and histologic examination can be used to measure the effect of the peptides and nucleic acids of the invention on papilloma virus-associated lesions or papillomavirus levels.

이하 본 발명을 상세하게 설명한다.Hereinafter, the present invention will be described in detail.

그 동안 이루어진 HPV 타입 16 E7을 대상으로 하는 adoptive CD8+ T 세포치료에 관한 연구는 HLA-A*0201 타입을 갖는 백인종(cacasian)을 위주로 진행되어 항암효과를 나타내는 몇몇의 특이적인 E7 에피토프을 밝혀내었다. 그러나, 전세계 인구의 절반 이상을 차지하고 있는 아시아인종(Asian) 중 다수를 차지하는 HLA-A*2402 타입 환자의 adoptive CD8+ T 세포치료를 위해 진행되어 나타난 HPV 타입 16 E7 에피토프의 연구 결과물은 전무한 실정이다.The study of adoptive CD8 + T cell therapy targeting HPV type 16 E7 has revealed several specific E7 epitopes that are predominantly cacasian with HLA-A * 0201 type and exhibit anti-cancer effect. However, there are no studies of HPV type 16 E7 epitopes that have been conducted for the adoptive CD8 + T cell treatment of HLA-A * 2402 type patients, which accounts for more than half of the Asian population, which accounts for more than half of the world's population.

본 발명에서는 정상 HLA-A*2402 타입 혈액 증여자에게서 PBMC를 공급받아 합성된 E7 펩타이드를 처리하여 1주 혹은 2주간 배양한 후 IFN-γ 의 발현 정도를 측정하여 CD8+ T 세포로의 분화를 유도하는 펩타이드의 후보를 선정하고, 세포 독성 실험인 51Cr release assay 을 사용하여 실제적인 항암 효과를 확인해 보았다. 그림 1에서 볼 수 있었듯이, 합성된 14개의 15mer 펩타이드 중 E7 61-75(CDSTLRLCVQSTHVD), E7 67-81 (LCVQSTHVDIRTLED) 펩타이드가 다른 E7 펩타이드에 비해 높은 수치의 IFN-γ의 생성을 나타냈고, 유체 세포측정법을 사용하여 선별한 E7 61-75(CDSTLRLCVQSTHVD)와 E7 67-81(LCVQSTHVDIRTLED) 에피토프이 실제로 HLA-A*2402 타입의 자궁 경부암 세포에 대해 항암효과를 나타내는 지를 확인하기 위해 51Cr release assay 기법을 이용하여 세포 사멸효과를 측정해 본 결과, E7 67-81(LCVQSTHVDIRTLED) 에피토프을 처리한 실험군에서 음성대조군보다 월등히 높은 세포 사멸효과를 나타내는 것을 알 수 있었다. 반면, 유체 세포측정법에서 IFN-γ와 CD69의 발현 정도가 E7 67-81(LCVQSTHVDIRTLED) eptiope과 유사하게 나타난 E7 61-75(CDSTLRLCVQSTHVD) 에피토프은 예상과 달리 세포 사멸 효과가 E7 67-81(LCVQSTHVDIRTLED) 에피토프에 비해 낮게 나타났다 (그림 2). 이러한 결과는 두 E7 에피토프의 아미노산 서열 차이에서 기인하는 실제 자궁 경부암 세포에 대한 면역성 유발 정도가 다르기 때문에 나타난 것으로 예상된다.In the present invention, the E7 peptide treated with PBMC in the normal HLA-A * 2402 type blood donor was cultured for 1 week or 2 weeks, and the expression level of IFN-y was measured to induce differentiation into CD8 + T cells Peptide candidates were selected and the anticancer effect of 51 Cr release assay was examined. As shown in Figure 1, E7 61-75 (CDSTLRLCVQSTHVD) and E7 67-81 (LCVQSTHVDIRTLED) peptides among 14 synthesized 14-mer peptides showed higher levels of IFN-γ than the other E7 peptides, To determine whether E7 61-75 (CDSTLRLCVQSTHVD) and E7 67-81 (LCVQSTHVDIRTLED) epitopes selected by cell counts actually show anti-cancer effects on HLA-A * 2402 type cervical cancer cells, the 51 Cr release assay technique (E7 67-81 (LCVQSTHVDIRTLED) epitope treated group showed significantly higher apoptotic effect than the negative control group. On the other hand, the E7 61-75 (CDSTLRLCVQSTHVD) epitope, similar to the E7 67-81 (LCVQSTHVDIRTLED) eptiope in IFN-γ and CD69 expression in fluid cell assays, showed that the apoptotic effect was E7 67-81 (LCVQSTHVDIRTLED) epitope (Figure 2). These results are expected to be due to differences in the degree of immune induction against actual cervical cancer cells resulting from the amino acid sequence differences of the two E7 epitopes.

실제로 암세포의 MHC class I 분자에 제시되는 정확한 에피토프을 찾기 위해 위에서 밝혀진 15mer 펩타이드를 이용해 MHC class I 분자에 결합하는 에피토프의 길이로 알려진 9mer와 10mer로 각각 합성하여() 유세포 측정법을 이용하여 분석한 결과 E7 61-69(CDSTLRLCV)와 E7 67-76(LCVQSTHVDI) 펩타이드가 효과적으로 세포 독성 T 세포의 활성을 유도하는 것으로 나타나 높은 면역성(immunogenic)을 가지고 있음을 예상할 수 있었다 (그림 3). 또한, 선별된 E7 61-69(CDSTLRLCV)와 E7 67-76(LCVQSTHVDI) 펩타이드를 이용하여 PBMC를 배양한 후 51Cr release assay 기법을 이용하여 자궁 경부암 세포 사멸 효과를 측정한 결과, 두 펩타이드 모두 E7 67-81(LCVQSTHVDIRTLED) 에피토프 보다 높은 효능을 나타내는 것을 확인할 수 있었다 (그림 4).Actually, 9-mer and 10-mer, which are known as the length of epitope bound to MHC class I molecules, were synthesized using the 15-mer peptides described above in order to find the exact epitope shown in MHC class I molecules of cancer cells. 61-69 (CDSTLRLCV) and E7 67-76 (LCVQSTHVDI) peptides effectively induced cytotoxic T cell activity, suggesting that they have high immunogenicity (Fig. 3). In addition, PBMCs were cultured using selected E7 61-69 (CDSTLRLCV) and E7 67-76 (LCVQSTHVDI) peptides, and the cytotoxic effect of cervical cancer cells was measured using the 51 Cr release assay technique. As a result, 67-81 (LCVQSTHVDIRTLED) epitope (Figure 4).

이와 더불어, 분자 결합력을 예측하는 컴퓨터 프로그램을 이용해 E7 61-69(CDSTLRLCV)와 E7 67-76(LCVQSTHVDI) 펩타이드의 아미노산 서열을 HLA-A*2402 분자와 결합력이 높은 형태로 치환하여 합성된 CYQSTHVDI(m3, 치환된 펩타이드 3번) 와 CYVTLRVCL (m7, 치환된 펩타이드 7번) 펩타이드를 처리하여 PBMC를 배양한 뒤 유세포 측정법을 실시한 결과, 기존 펩타이드 보다 높은 세포 독성 T 세포의 활성을 유도함을 확인할 수 있었다 (그림 6). 또한, E7 61-69(CDSTLRLCV)와 E7 67-76(LCVQSTHVDI) 펩타이드를 HLA-A*2402 분자와 결합력이 높은 형태로 치환하여 합성한 CYQSTHVDI(m3, 치환된 펩타이드 3번) 와 CYVTLRVCL(m7, 치환된 펩타이드 7번) 펩타이드를 처리하여 PBMC를 배양한 뒤 세포 사멸 효과를 측정한 결과, 기존 펩타이드보다 높은 세포 사멸 효능을 나타냄을 알 수 있었다 (그림 6). 따라서, E7 61-69(CDSTLRLCV)와 E7 67-76 (LCVQSTHVDI) 에피토프을 이용한 세포 독성 T 세포의 활성 유도가 실제 자궁 경부암 세포의 사멸에 효과적으로 작용할 수 있음을 확인하였고, 그 변형 펩타이드인 CYQSTHVDI(m3, 치환된 펩타이드 3번) 와 CYVTLRVCL(m7, 치환된 펩타이드 7번)가 HLA-A*2402 타입 자궁 경부암 환자의 치료 및 백신 개발에 효과적으로 적용될 수 있음을 확인할 수 있었다 (그림 7).In addition, a computer program for predicting molecular binding capacity was used to compare the amino acid sequences of E7 61-69 (CDSTLRLCV) and E7 67-76 (LCVQSTHVDI) peptides with those of HLA-A * 2402 molecules and to synthesize CYQSTHVDI m3, and substituted peptide 3) and CYVTLRVCL (m7, substituted peptide 7) peptides were cultured and cultured, and flow cytometry was performed. As a result, it was confirmed that cytotoxic T cells were more active than existing peptides (Figure 6). In addition, CYQSTHVDI (m3, substituted peptide 3) and CYVTLRVCL (m7, C7) synthesized by replacing E7 61-69 (CDSTLRLCV) and E7 67-76 (LCVQSTHVDI) peptides with HLA- (Fig. 6). As shown in Fig. 6, when the PBMCs were treated with the substituted peptide (No. 7) peptides, the cell killing effect was higher than that of the existing peptides. Therefore, it was confirmed that the induction of cytotoxic T cell activation using E7 61-69 (CDSTLRLCV) and E7 67-76 (LCVQSTHVDI) epitopes could effectively act on the actual cervical cancer cell death, and the modified peptide CYQSTHVDI (m3, (Fig. 7). It was confirmed that CYVTLRVCL (m7, substituted peptide 7) can be effectively applied to the treatment and vaccine development of HLA-A * 2402 type cervical cancer patients.

이전 연구를 통해 자궁 경부암 동물 모델을 이용한 실험에서 세포 독성 T 세포의 항암 효과가 확인되었다(Patel S, 등. Curr Opin Obstet Gynecol 2009;21(1):54-9;Kim TY, 등. Cancer Res 2002;62: 7234-40). 본 발명에서는 선별된 E7 에피토프의 항암 효능을 in vivo상에서 확인하기 위해 HLA-A*2402 타입의 자궁 경부암 세포주인 SiHa를 이용하여 마우스 모델을 구축하였다. 5주 연령된 BALB/c 누드 마우스에 자궁 경부암 세포주인 SiHa를 주입하여 종양을 형성한 후, 선별된 E7 peptide를 처리하여 배양한 PBMC 또는 CD8+ T 세포를 투여하여 세포 독성 T 세포의 종양 제거 혹은 억제 효과를 확인하였다. 결과에서 볼 수 있듯이, E7 67-76(LCVQSTHVDI)을 처리하여 배양한 PBMC를 종양이 생성된 마우스에 투여하였을 때 아무 것도 처리하지 않은 음성대조군에 비해 종양의 성장이 억제되는 것을 알 수 있었고 (그림 7a), Previous studies have demonstrated antitumor effects of cytotoxic T cells in cervical cancer animal models (Patel S, et al., Curr Opin Obstet Gynecol 2009; 21 (1): 54-9; 2002; 62: 7234-40). In the present invention, a mouse model was constructed using HLA-A * 2402 type cervical cancer cell line SiHa in order to confirm the anticancer efficacy of the selected E7 epitope in vivo. Cervical cancer cell line SiHa was injected into 5-week-old BALB / c nude mouse to induce tumor formation, and PBMC or CD8 + T cells cultured with selective E7 peptide treatment were administered to remove or suppress cytotoxic T cell tumor The effect was confirmed. As can be seen from the results, when PBMC cultured with E7 67-76 (LCVQSTHVDI) was administered to the tumor-bearing mice, tumor growth was inhibited compared to the negative control, which was not treated 7a ),

또한, E7 61-69(CDSTLRLCV), E7 67-76(LCVQSTHVDI), CYQSTHVDI(m3, 치환된 펩타이드 3번) 와 CYVTLRVCL(m7, 치환된 펩타이드 7번)을 처리하여 배양한 CD8+ T 세포를 마우스에 투여한 후 종양의 크기를 확인하였을 때, 아무것도 처리하지 않은 음성대조군에 비해 종양의 성장이 크게 억제되는 것을 확인할 수 있었다(그림 8b, c). 따라서, 자궁 경부암 마우스 모델을 이용한 동물 실험을 통해 in vitro 실험에서 선별된 E7 61-69(CDSTLRLCV), E7 67-76(LCVQSTHVDI), CYQSTHVDI (m3, 치환된 펩타이드 3번) 및 CYVTLRVCL(m7, 치환된 펩타이드 7번) 펩타이드를 처리하여 배양한 세포 독성 T 세포가 자궁 경부암의 성장의 억제 효과가 있음을 확인할 수 있었다. In addition, CD8 + T cells cultured by treatment with E7 61-69 (CDSTLRLCV), E7 67-76 (LCVQSTHVDI), CYQSTHVDI (m3, substituted peptide 3) and CYVTLRVCL (m7, substituted peptide 7) When tumor size was determined after administration, tumor growth was significantly inhibited compared with negative control (Fig. 8b, c). Therefore, in animal experiments using mouse models of cervical cancer, E7 61-69 (CDSTLRLCV), E7 67-76 (LCVQSTHVDI), CYQSTHVDI (m3, substituted peptide 3) and CYVTLRVCL And the cytotoxic T cells cultured and treated with the peptide (No. 7 peptide) inhibited the growth of cervical cancer.

결론적으로, 유체 세포측정법과 세포 독성 실험을 통해 HPV 타입 16 E7 67-81(LCVQSTHVDIRTLED)가 자궁 경부암 특이적인 세포 독성 T 세포를 생성할 수 있는 에피토프으로 이용이 가능하며, E7 67-81(LCVQSTHVDIRTLED)의 15개 아미노산 서열 가운데 9mer 및 10mer 길이의 E7 61-69(CDSTLRLCV)와 E7 67-76(LCVQSTHVDI) 에피토프이 HLA-A*2402에 실질적으로 표현되어 면역성을 유도하는 것으로 예측된다.In conclusion, HPV type 16 E7 67-81 (LCVQSTHVDIRTLED) can be used as an epitope capable of producing cervical cancer-specific cytotoxic T cells through fluid cell assays and cytotoxicity experiments. E7 67-81 (LCVQSTHVDIRTLED) (CDSTLRLCV) and E7 67-76 (LCVQSTHVDI) epitopes are predicted to induce immunity substantially expressed in HLA-A * 2402 in the 9-mer and 10-mer lengths of the 15 amino acid sequence.

또한, E7 61-69(CDSTLRLCV)와 E7 67-76(LCVQSTHVDI) 펩타이드의 아미노산이 치환된 형태의 CYQSTHVDI(m3, 치환된 펩타이드 3번) 와 CYVTLRVCL(m7, 치환된 펩타이드 7번) 펩타이드가 항암 효능이 보다 더 높은 것으로 나타나 HLA-A*2402 타입 자궁 경부암의 백신 개발과 adoptive 면역세포치료에 필요한 세포 독성 T 림프구 생성에 효과적인 에피토프임을 규명할 수 있었다.
In addition, CYQSTHVDI (m3, substituted peptide 3) and CYVTLRVCL (m7, substituted peptide 7) peptides in which the amino acids of E7 61-69 (CDSTLRLCV) and E7 67-76 (LCVQSTHVDI) , Which is an effective epitope for cytotoxic T lymphocyte production required for the development of vaccine against HLA-A * 2402 type cervical cancer and for the adoptive immune cell therapy.

본 발명을 통해서 알 수 있는 바와 같이, HPV 타입 16 E7 가운데 15mer 길이의 67-81(LCVQSTHV DIRTLED)가 자궁 경부암 특이적인 세포 독성 T 세포를 생성할 수 있는 에피토프으로 이용이 가능하며 그 가운데 E7 61-69(CDSTLRLCV)와 E7 67-76(LCVQSTHVDI) 에피토프 이 보다 높은 항암 효능이 있음을 확인하였으며, E7 61-69(CDSTLRLCV)와 E7 67-76(LCVQSTHVDI) 펩타이드의 아미노산이 치환된 형태의 CYQSTHVDI와 CYVTLRVCL 펩타이드가 항암 효과가 보다 더 높은 것으로 나타나 HLA-A*2402 타입 자궁 경부암의 백신 개발과 adoptive 면역세포치료에 필요한 세포 독성 T 림프구 생성에 효과적인 에피토프임을 규명할 수 있었다.
As can be seen from the present invention, 15-mer 67-81 (LCVQSTHV DIRTLED) among HPV type 16 E7 can be used as an epitope capable of producing cervical cancer-specific cytotoxic T cells, among which E7 61- 69 (CDSTLRLCV) and E7 67-76 (LCVQSTHVDI) epitopes were found to have higher anticancer efficacy. CYQSTHVDI and CYVTLRVCL in which the amino acids of E7 61-69 (CDSTLRLCV) and E7 67-76 (LCVQSTHVDI) Peptides were found to have higher anticancer efficacy, indicating that they are effective epitopes for the development of vaccines against HLA-A * 2402 type cervical cancer and cytotoxic T lymphocytes required for adoptive immune cell therapy.

도 1은 유체 세포측정법을 이용한 HPV 타입 16 E7 에피토프 (15mer) 특이적인 IFN-γ의 생성 확인. Donor 1: HLA-A*2402/2601.
도 2는 51Cr release assay 법을 이용한 HPV 타입 16 E7 에피토프 (15mer) 특이적인 자궁 경부암 세포의 사멸효과 확인. Donor 2: HLA-A*2402/3303. (E: effector, T: target cell)
도 3은 유체 세포측정법을 이용한 HPV 타입 16 E7 에피토프(9mer/10mer) 특이적인 IFN-γ의 생성 확인. Donor 3: HLA-A*0203/2402.
도 4는 51Cr release assay 법을 이용한 HPV 타입 16 E7 에피토프(9mer, 10mer) 특이적인 자궁 경부암 세포의 사멸효과 확인. Donor 4: HLA-A*2402/3101. (E: effector, T: target cell)
도 5는 51Cr release assay 법을 이용한 PBMC에서 분리된 CTL과 CTL이 제거된 PBMC와의 자궁 경부암 세포 사멸 효과의 비교. Donor 5 : HLA-A*0206/2402. (E: effector, T: target cell)
도 6은 아미노산을 치환하여 합성된 HPV 타입 16 E7 에피토프 특이적인 세포 독성 효과의 확인. (a) E7 61-69(9mer; peptide 16) 및 E7 67-76 (10mer, peptide 35)와 HLA-A*2402 분자와의 결합 구조 예측도 (b) 아미노산 치환 합성된 HPV 타입 16 E7 펩타이드의 결합 에너지 산정 (c) 유체 세포측정법을 이용한 치환 합성된 HPV 타입 16 E7 에피토프 특이적인 IFN-γ의 생성확인. (d) 51Cr release assay 법을 이용한 치환 합성된 HPV 타입 16 E7 에피토프 특이적인 자궁 경부암 세포의 사멸효과 확인. (c) Donor 6: HLA-A*2402/2402 (d) Donor 7: HLA-A*2402/3101. (E: effector, T: target cell)
도 7은 자궁 경부암 마우스 모델에서 세포 독성 T 세포의 항암 치료 효과 확인. (a) 선별된 E7 펩타이드를 처리하여 배양한 PBMC를 자궁 경부암 종양이 이식된 마우스에 투여한 후, 종양의 크기 변화를 측정 (b) 선별된 E7 펩타이드를 처리하여 배양한 CTL을 자궁 경부암 종양이 이식된 마우스에 투여한 후, 종양의 크기 변화 및 무게(c)를 측정. (a) Donor 8: HLA-A*0206/2402 (b) Donor 9: HLA-A*2402/3303.Figure 1 shows the production of HPV type 16 E7 epitope (15mer) -specific IFN-y using flow cytometry. Donor 1: HLA-A * 2402/2601.
FIG. 2 shows the killing effect of HPV type 16 E7 epitope (15mer) -specific cervical cancer cells using 51 Cr release assay. Donor 2: HLA-A * 2402/3303. (E: effector, T: target cell)
Figure 3 shows the production of HPV type 16 E7 epitope (9mer / 10mer) specific IFN-y using fluid cell assay. Donor 3: HLA-A * 0203/2402.
FIG. 4 shows the killing effect of HPV type 16 E7 epitope (9mer, 10mer) specific cervical cancer cells using 51 Cr release assay. Donor 4: HLA-A * 2402/3101. (E: effector, T: target cell)
FIG. 5 is a graph comparing the cytotoxic effect of cervical cancer cell lines with PBMCs isolated from PBMCs by 51 Cr release assay. Donor 5: HLA-A * 0206/2402. (E: effector, T: target cell)
FIG. 6 shows the cytotoxic effect specific for HPV type 16 E7 epitope synthesized by amino acid substitution. (a) Prediction of binding structure between E7 61-69 (9mer; peptide 16) and E7 67-76 (10mer, peptide 35) and HLA-A * 2402 molecules (b) Amino acid substitution HPV type 16 E7 peptide (C) Confirmation of the production of replacement HPV type 16 E7 epitope-specific IFN-γ by fluid cell assay. (d) Determination of the killing effect of HPV type 16 E7 epitope-specific cervical cancer cells by the 51 Cr release assay. (c) Donor 6: HLA-A * 2402/2402 (d) Donor 7: HLA-A * 2402/3101. (E: effector, T: target cell)
FIG. 7 shows the effect of cytotoxic T cells on the anti-cancer treatment in a cervical cancer mouse model. (a) The PBMC cultured and treated with the selected E7 peptide were administered to mice transplanted with cervical cancer, and the size of the tumor was measured. (b) CTL cultured by treatment with the selected E7 peptide was used for the cervical cancer tumor After administration to the transplanted mice, the tumor size change and weight (c) were measured. (a) Donor 8: HLA-A * 0206/2402 (b) Donor 9: HLA-A * 2402/3303.

이하 비한정적인 실시예를 통하여 본 발명을 더욱 상세하게 설명한다. 단 하기 실시예는 본 발명을 예시하기 위한 의도록 기재된 것으로서 본 발명의 범위는 하기 실시예에 의하여 제한되는 것으로 해석되지 아니한다.The present invention will now be described in more detail by way of non-limiting examples. The following examples are intended to illustrate the invention and the scope of the invention is not to be construed as being limited by the following examples.

실시예Example 1:  One: 펩타이드Peptides (( peptidepeptide ) 합성) synthesis

HPV 타입 16 E7 단백질의 전체 아미노산 서열을 컴퓨터 알고리즘(computer algorithms)을 이용하여 각각 15mer의 크기로 중복(overlapping)되도록 나누어 합성한 후 고성능 액체 크로마토그래피 (high performance liquid chromatography : HPLC)기기를 이용하여 순도가 95% 이상 되는 펩타이드를 최종적으로 선택하여 총 14개를 합성하였다(표 3). 14개의 합성된 15mer 길이의 펩타이드 가운데 실제로 MHC class I 분자에 제시되는 에피토프을 밝히기 위해 실험을 통해 항암효능이 높은 2개의 펩타이드를 선별하여 MHC class I 분자에 제시되는 에피토프의 크기로 알려진 9mer와 10mer로 중복되도록 나누어 합성한 후 HPLC기기를 이용하여 순도가 95%이상 되는 펩타이드를 총 25개 합성하였다(표 4). 합성된 9mer 및 10mer 길이의 25개의 펩타이드 가운데 항암효능이 높은 2개의 펩타이드를 선별하여 이를 바탕으로 컴퓨터 구조분석 프로그램을 이용해 실제로 HLA-A*2402 분자에 가장 결합력이 높은 아미노산 서열을 예측하여 일부 아미노산을 치환 합성하였다(표 5). 이런 식으로 합성된 펩타이드는 1% DMSO PBS에 녹인 후 -20℃에 냉동 보관한 후 사용 직전에 실온에서 해동하여 사용하였다. 본 발명의 펩타이드는 대한민국 연기군 소재 A & Pep 사에 의뢰하여 합성하였다.The entire amino acid sequence of HPV type 16 E7 protein was synthesized by computer algorithms in the form of overlapping at a size of 15mer each and then purified using a high performance liquid chromatography (HPLC) (95%) were finally selected to synthesize a total of 14 peptides (Table 3). Of the 14 synthesized 15-mer peptides, two peptides with high anticancer efficacy were screened to reveal the epitope present in the MHC class I molecules. The peptides were selected to overlap with 9-mer and 10-mer, known as the sizes of epitopes presented on MHC class I molecules And 25 total peptides with a purity of 95% or more were synthesized using an HPLC apparatus (Table 4). Two peptides with high anticancer efficacy were selected among the synthesized 9-mer and 25-mer peptides. Based on this, a computer structural analysis program was used to predict the amino acid sequence of HLA-A * (Table 5). Peptides synthesized in this manner were dissolved in 1% DMSO PBS, stored frozen at -20 ° C, and thawed at room temperature immediately before use. The peptide of the present invention was synthesized by asking A &

서열 번호SEQ ID NO: 아미노산 위치Amino acid position 아미노산 서열Amino acid sequence 1One 1-151-15 MHGDTPTLHEYMLDLMHGDTPTLHEYMLDL 22 7-217-21 TLHEYMLDLQPETTDTLHEYMLDLQPETTD 33 13-2713-27 LDLQPETTDLYCYEQLDLQPETTDLYCYEQ 44 19-3319-33 TTDLYCYEQLNDSSETTDLYCYEQLNDSSE 55 25-3925-39 YEQLNDSSEEEDEIDYEQLNDSSEEEDEID 66 31-4531-45 SSEEEDEIDGPAGQASSEEEDEIDGPAGQA 77 37-5137-51 EIDGPAGQAEPDRAHEIDGPAGQAEPDRAH 88 43-5743-57 GQAEPDRAHYNIVTFGQAEPDRAHYNIVTF 99 49-6349-63 RAHYNIVTFCCKCDSRAHYNIVTFCCKCDS 1010 55-6955-69 VTFCCKCDSTLRLCVVTFCCKCDSTLRLCV 1111 61-7561-75 CDSTLRLCVQSTHVDCDSTLRLCVQSTHVD 1212 67-8167-81 LCVQSTHVDIRTLEDLCVQSTHVDIRTLED 1313 73-8773-87 HVDIRTLEDLLMGTLHVDIRTLEDLLMGTL 1414 79-9379-93 LEDLLMGTLGIVCPILEDLLMGTLGIVCPI 1515 85-9885-98 GTLGIVCPICSQKPGTLGIVCPICSQKP

표 3은 합성된 HPV 타입 16 E7 펩타이드 (15mer)이다.Table 3 shows the synthesized HPV type 16 E7 peptide (15mer).

서열 번호SEQ ID NO: 아미노산 위치Amino acid position 아미노산 서열Amino acid sequence 1616 61-6961-69 CDSTLRLCVCDSTLRLCV 1717 62-7062-70 DSTLRLCVQDSTLRLCVQ 1818 63-7163-71 STLRLCVQSSTLRLCVQS 1919 64-7264-72 TLRLCVQSTTLRLCVQST 2020 65-7365-73 LRLCVQSTHLRLCVQSTH 2121 66-7466-74 RLCVQSTHVRLCVQSTHV 2222 67-7567-75 LCVQSTHVDLCVQSTHVD 2323 68-7668-76 CVQSTHVDICVQSTHVDI 2424 69-7769-77 VQSTHVDIRVQSTHVDIR 2525 70-7870-78 QSTHVDIRTQSTHVDIRT 2626 71-7971-79 STHVDIRTLSTHVDIRTL 2727 72-8072-80 THVDIRTLETHVDIRTLE 2828 73-8173-81 HVDIRTLEDHVDIRTLED 2929 61-7061-70 CDSTLRLCVQCDSTLRLCVQ 3030 62-7162-71 DSTLRLCVQSDSTLRLCVQS 3131 63-7263-72 STLRLCVQSTSTLRLCVQST 3232 64-7364-73 TLRLCVQSTHTLRLCVQSTH 3333 65-7465-74 LRLCVQSTHVLRLCVQSTHV 3434 66-7566-75 RLCVQSTHVDRLCVQSTHVD 3535 67-7667-76 LCVQSTHVDILCVQSTHVDI 3636 68-7768-77 CVQSTHVDIRCVQSTHVDIR 3737 69-7869-78 VQSTHVDIRTVQSTHVDIRT 3838 70-7970-79 QSTHVDIRTLQSTHVDIRTL 3939 71-8071-80 STHVDIRTLESTHVDIRTLE 4040 72-8172-81 THVDIRTLEDTHVDIRTLED

표 4는 합성된 HPV 타입 16 E7 펩타이드(9mer 및 10mer)이다. Table 4 shows synthesized HPV type 16 E7 peptides (9mer and 10mer).

서열 번호SEQ ID NO: 기존 아미노산 서열Existing amino acid sequence 치환된 아미노산 서열Substituted amino acid sequence 4141 LCVQSTHVDI (68-76)LCVQSTHVDI (68-76) CIQSTHVDICIQSTHVDI 4242 LCVQSTHVDI (68-76)LCVQSTHVDI (68-76) CYQSTSVDLCYQSTSVDL 4343 LCVQSTHVDI (68-76)LCVQSTHVDI (68-76) CYQSTHVDICYQSTHVDI 4444 LCVQSTHVDI (68-76)LCVQSTHVDI (68-76) CYQSTHVDLCYQSTHVDL 4545 CDSTLRLCV (61-69)CDSTLRLCV (61-69) CYATLRVCLCYATLRVCL 4646 CDSTLRLCV (61-69)CDSTLRLCV (61-69) CYSTLRACLCYSTLRACL 4747 CDSTLRLCV (61-69)CDSTLRLCV (61-69) CYVTLRVCLCYVTLRVCL

표 5는 합성된 HPV 타입 16 E7 펩타이드 (아미노산 치환)이다. Table 5 shows the synthesized HPV type 16 E7 peptide (amino acid substitution).

실시예Example 2: 세포의 준비 2: Cell preparation

연구 동의서에 서명한 HLA-A*2402 타입 혈액 증여자(표 4)의 혈액에서 원심분리(centrifugation)를 이용해 PBMC(peripheral blood mononuclear cell)를 분리한다. 간략히 설명하면, Ficoll-Hypaque 1.077를 사용하여 농도기울기(density-gradient)를 형성한 후 그 위에 증여자의 혈액을 조심스럽게 흘려 넣은 뒤 2000 rpm의 속도로 상온에서 15분간 원심분리를 실시한 후 백혈구 층(buffy coat)만을 채취하여 PBS로 2회 세척하여 실험에 사용하였다.
Separate peripheral blood mononuclear cells (PBMC) using centrifugation in the blood of HLA-A * 2402-type blood donors (Table 4) who signed the study agreement. Briefly, after forming a density-gradient using Ficoll-Hypaque 1.077, donor blood was carefully poured on it, centrifuged at room temperature for 15 minutes at a rate of 2000 rpm, buffy coat) and washed twice with PBS.

혈액 증여자(donor)The blood donor (donor) 성별gender HLA-AHLA-A HLA-BHLA-B HLA-CHLA-C 1One 남south A*2402/2601A * 2402/2601 15, 3515, 35 03, 0403, 04 22 남south A*2402/3303A * 2402/3303 07, 4407, 44 07, 0707, 07 33 남south A*0203/2402A * 0203/2402 35, 5135, 51 07, 1407, 14 44 남south A*2402/3001A * 2402/3001 13, 5513, 55 01, 0601, 06 55 남south A*0206/2402A * 0206/2402 07, 5907, 59 01 ,0701, 07 66 남south A*2402/2402A * 2402/2402 40, 4040, 40 03, 0403, 04 77 남south A*2402/3101A * 2402/3101 35, 5135, 51 03, 1403, 14 88 남south A*0206/2402A * 0206/2402 35, 5435, 54 01, 0301, 03 99 남south A*2402/3303A * 2402/3303 40, 5840, 58 03, 0803, 08

표 6은 HLA-A*2402 타입 혈액 증여자에 대한 표이다.Table 6 is a table for HLA-A * 2402 type blood donors.

실시예Example 3: 3: PBMCPBMC 로부터 자가 수지상 세포(Lt; RTI ID = 0.0 > autologousautologous dendriticdendritic cellcell )의 생성)

원심분리를 통해 얻어진 PBMC를 RPMI 배양액(10% FBS, 5% antibiotics)이 들어 있는 T75 플라스크에 넣어 37℃에서 2시간 동안 배양하였다. 그 후, 부유된 세포들을 제거하고 플라스크에 고착된 단핵 세포(monocyte)에 Interleukin-4(IL-4, 1000U/ml)와 granulocyte-macrophage stimulating factor(GM-CSF, 800U/ml)를 첨가한다. 배양 시작 후 2일, 4일째 되는 때에 IL-4(1000U/ml)와 GM-CSF(1600U/ml)을 각각 넣어 준다. 세포의 성장에 맞춰 수시로 RPMI 배양액을 교체해 주었다. 배양 시작 후 5일째 되는 때에 tumor necrosis factor-α(TNF-α, 1000u/ml)를 첨가하였다(Lim JB, 등. Exp Hematol 2006;34(3):296-307;Provenzano M, 등. J Immunother 2002;25:342-351). The PBMCs obtained by centrifugation were placed in a T75 flask containing RPMI medium (10% FBS, 5% antibiotics) and cultured at 37 ° C for 2 hours. After that, the suspended cells are removed and Interleukin-4 (IL-4, 1000 U / ml) and granulocyte-macrophage stimulating factor (GM-CSF, 800 U / ml) are added to the monocytes fixed to the flask. Add IL-4 (1000 U / ml) and GM-CSF (1600 U / ml) at the 2nd and 4th days after the start of culture. The RPMI medium was changed from time to time according to the cell growth. At 5 days after the start of culture, tumor necrosis factor-α (TNF-α, 1000 u / ml) was added (Lim JB et al., Exp Hematol 2006; 34 (3): 296-307, Provenzano M, 2002; 25: 342-351).

실시예Example 4: 4: 펩타이드에To peptides 특이적인  Specific polyclonalpolyclonal 세포 독성 T 세포의 생성 Generation of cytotoxic T cells

초저온 동결되어 있는 HLA-A*2402 타입 혈액 증여자의 PBMC를 해동시켜 각 well당 2ml의 RPMI 배양액이 채워진 24 well 배양용기에 적정한 수의 세포를 넣어 주었다. 배양 시작 후 1일째 되는 때에 시험하고자 하는 펩타이드(10μg/ml)와 Interleukin-2(IL-2, 1000U/ml)를 각 well에 첨가해 주었다. 배양기간 중 이틀 간격으로 IL-2(1000U/ml)을 넣어주고 배양액을 교체해 주었다. 배양 시작 후 7일째 되는 때에 위에 언급한 방법으로 생성된 수지상 세포(세포 독성 T 세포수의 최소 10분의 1 이상의 세포수)와 펩타이드(20μg/ml)를 첨가해 주었다. The PBMCs of HLA-A * 2402-type blood donors which had been frozen at an extremely low temperature were thawed and an appropriate number of cells were added to a 24-well culture container filled with 2 ml of RPMI culture medium per well. The peptide to be tested (10 μg / ml) and Interleukin-2 (IL-2, 1000 U / ml) were added to each well at the first day after the start of culture. During the incubation period, IL-2 (1000 U / ml) was added every two days and the culture medium was changed. On the seventh day after the start of culture, dendritic cells (at least one tenth of the number of cytotoxic T cells) and peptides (20 μg / ml) produced by the above-mentioned method were added.

실시예Example 5:유체  5: Fluid 세포측정법(flow cytometry)를Flow cytometry 이용한  Used 세포내Intracellular InterferonInterferon -γ(-γ ( IFNIFN -γ) 생성측정-γ) production measurement

배양 시작 후 7일째 되는 때에 수지상 세포와 펩타이드가 첨가된 세포 독성 T 세포를 37℃에서 1시간 동안 배양하였다. 이 때, 실험군 중 한 그룹에 phytohemagglutinin(PHA, 0.25 μg/ml)을 넣어 주었다. 배양 후 10 μg의 brefeldin A(BFA)를 각각 첨가해 준 뒤, 37℃에서 5시간 동안 배양하였다. 그 후, 각각의 well에서 세포를 채취하여 PBS(phosphate-buffered saline)으로 세척해 주었다. 세척 후 1mM 농도의 EDTA가 들어 있는 PBS를 넣어 주고 37℃에서 10분간 배양하였다. 배양이 끝나면, 5% FBS가 포함된 PBS로 2회 세척해 주고, 형광표지된 항체인 perdinin-chlorophyll-protein(PerCP)-conjugated mouse anti-human CD3+항체와 phycoerythrin(PE)-conjugated mouse anti-human CD8+ 항체를 각각 1:100의 비율로 넣어 준 뒤 4℃에서 15분간 dark상태로 배양하였다. 배양 후, lysing solution과 permeabilization solution을 각각 처리해 주고, fluorescein isothiocyanate (FITC)-conjugated mouse anti-human IFN-γ 항체를 첨가해 준 뒤 4℃에서 30분간 dark상태로 배양하였다. 이 후, 5% FBS가 포함된 PBS로 2회 세척해 주고 1% formaldehyde로 고정시킨 뒤 FACS(fluorescence activated cell sorting)장비를 이용해 측정하여 분석하였다 (Kern F, 등. Eur J Immunol 2000;30:1676-1682;Gratama JW, 등. Cytometry 2004;58:79-86).At the 7th day after the start of the culture, the dendritic cells and the cytotoxic T cells to which the peptide had been added were cultured at 37 ° C for 1 hour. At that time, phytohemagglutinin (PHA, 0.25 μg / ml) was added to one of the experimental groups. After incubation, 10 μg of brefeldin A (BFA) was added to each well, followed by incubation at 37 ° C for 5 hours. Cells were then harvested from each well and washed with PBS (phosphate-buffered saline). After washing, 1mM EDTA-containing PBS was added and incubated at 37 ° C for 10 minutes. After incubation, the cells were washed twice with PBS containing 5% FBS and incubated with perdinin-chlorophyll-protein (PerCP) -conjugated mouse anti-human CD3 + antibody and phycoerythrin (PE) -conjugated mouse anti-human CD8 + antibody was added at a ratio of 1: 100, and then incubated at 4 ° C for 15 minutes in a dark state. After incubation, lysing solution and permeabilization solution were each treated with fluorescein isothiocyanate (FITC) -conjugated mouse anti-human IFN-γ antibody and incubated at 4 ° C for 30 min in dark. After washing with PBS containing 5% FBS twice, the cells were fixed with 1% formaldehyde and analyzed by FACS (Kern F, et al., Eur J Immunol 2000; 30: 1676-1682; Gratama JW, et al., Cytometry 2004; 58: 79-86).

실시예Example 6:세포 독성 실험( 6: Cytotoxicity experiment ( cytotoxicitycytotoxicity assayassay ))

자궁 경부암 세포주를 목표 세포(target cell)로 하여 51Cr release assay를 사용하여 세포 독성 실험을 실시하였다. 간략히 설명하면, RPMI 배양액에서 배양된 HLA-A*2402 타입의 자궁 경부암 세포주에 0.1 mCi 의 Na2 51CrO4를 첨가하여 37℃에서 45분간 배양하였다. PBS로 2회 세척한 후, 적정수의 목표 세포를 세포 독성 T 세포에 다양한 비율로 넣어 주고 37℃에서 5시간 동안 배양하였다. 배양이 끝나면 1500 rpm으로 5분간 원심분리를 해주고 미리 준비한 γ-counter tube에 100μl씩 옮겨 넣는다. γ-ray counter를 이용해 측정하여 분석하였다. 세포 독성 T 세포 특이적인 목표 세포 사멸의 정도는 [(experimental cpm-spontaneous cpm)/(maximum cpm-spontaneous cpm)]×100의 공식을 이용하여 산정하였다(Bao L, 등. Biol Blood Marrow Transplant 2008;14:1156-1162).
The cervical cancer cell line was used as a target cell and the cytotoxicity test was carried out using the 51 Cr release assay. Briefly, 0.1 mCi of Na 2 51 CrO 4 was added to the HLA-A * 2402 type cervical cancer cell line cultured in the RPMI medium, and cultured at 37 ° C for 45 minutes. After washing twice with PBS, an appropriate number of target cells were added to the cytotoxic T cells at various ratios and cultured at 37 ° C for 5 hours. After culturing, centrifuge at 1500 rpm for 5 minutes and transfer 100 μl into a γ-counter tube prepared beforehand. and analyzed using a γ-ray counter. The degree of cytotoxic T cell-specific target cell apoptosis was estimated using the formula [(experimental cpm-spontaneous cpm) / (maximum cpm-spontaneous cpm)] × 100 (Bao L et al., Biol Blood Marrow Transplant 2008; 14: 1156-1162).

실시예Example 7: 단백질- 7: Protein- MHCMHC 복합체 결합  Complex binding 친화도의Affinity InIn silicosilico 측정법 Measurement method

펩타이드와 MHC 분자와의 결합 친화도를 측정하기 위해 펩타이드-MHC 복합체 모델을 구성하여 결합 상태와 분리 상태의 에너지 차이를 산정하여 복합체 형성 에너지를 계산하였고, 더 안정적인 복합체가 보다 높은 결합 친화도를 갖는 것으로 가정하였다. 우선, 펩타이드-MHC 복합체 구조는 PDB id 2BAK의 구조를 바탕으로 모델링하고, 복합체 에너지 최소화는 CHARMM(Chemistry at HARvard Macromolecular Mechanics) force field를 기초로 한 Insight Ⅱ (Accelrys Software Inc) 프로그램을 이용하였다. 에너지 최소화 후, 복합체 형성의 에너지 기여도와 각 잔기(residue)간의 접촉은 단백질 디자인과 결합 친화도 산정 프로그램인 EGAD를 이용하여 산정하였으며, 초기 설정이 복합체 형성 에너지 산정에 사용되었다(Pokala N, 등. J Mol Biol 2005;347:203-27). 프로그램의 산정 결과를 바탕으로 복합체 형성 에너지 비교 측정에 몇 'pseudo_DELTA_G_complex_formation' 수치가 이용되었다. 각 접점(interface) 잔기의 에너지 기여도 측정을 위해, 각 레벨 1 접점 잔기의 dG 수치가 수집되었다.
In order to measure the binding affinity between peptide and MHC molecule, a peptide-MHC complex model was constructed to calculate the energy of complex formation and the energy of separation state, and a more stable complex had higher binding affinity . First, the peptide-MHC complex structure was modeled based on the PDB id 2BAK structure, and the complex energy minimization was performed using the Insight II (Accelrys Software Inc) program based on CHARMM (Chemistry at HARVard Macromolecular Mechanics) force field. After energy minimization, the energy contribution of the complex formation and the contact between each residue were estimated using protein design and EGAD, a binding affinity estimation program, and the initial setting was used to estimate complex formation energy (Pokala N, et al. J Mol Biol 2005; 347: 203-27). A number of 'pseudo_DELTA_G_complex_formation' values were used to measure complex formation energy based on the program estimates. To measure the energy contribution of each interface residue, the dG value of each level 1 contact residue was collected.

실시예Example 8: 자궁 경부암 마우스 모델을 이용한 동물 실험 8: Animal experiment using cervical cancer mouse model

5주 연령의 BALB/c 누드 마우스의 오른쪽 옆구리에 자궁 경부암 세포주인 SiHa 세포(Friedl F, 등. Proc Soc Exp Biol Med 1970;135(2):543-5)를 5X105 개를 주입하여 종양 형성을 유도하였다. 세포 독성 T 세포의 자궁 경부암에 대한 치료효과를 확인하기 위해 종양의 크기가 일정 수치(40mm3 ~ 50mm3)가 되었을 때, 각각의 펩타이드를 처리한 PBMC(lX107 개) 혹은 분리된 CTL(3X106) 을 마우스의 꼬리 정맥을 통해 말초 혈액으로 주입하였다. 종양의 크기는 매일 캘리퍼(caliper)를 이용하여 측정하고 [(a x b)/2, a는 장축, b는 단축]의 공식을 이용해 평균값을 산정하여 기록하였다.5X10 5 injections of cervical cancer cell line SiHa cells (Friedl F, et al., Proc Soc Exp Biol Med 1970; 135 (2): 543-5) were injected into the right flank of 5 week old BALB / Lt; / RTI > To determine the therapeutic effect of cytotoxic T cells on cervical cancer, when the size of the tumor reached a certain value (40 mm 3 ~ 50 mm 3 ), each peptide-treated PBMC (lX10 7 Or separate CTLs (3X10 6 ) were injected into the peripheral blood through the tail vein of the mice. The size of the tumor was measured daily using a caliper and the mean value was calculated using the formula [(axb) / 2, a is the major axis and b is the minor axis].

상기 실시예의 결과는 다음과 같다.The results of the above embodiment are as follows.

(1) HLA-A*2402 특이적인 15mer 길이의 HPV 타입 16 E7 에피토프의 규명(1) Identification of HLA-A * 2402 specific 15-mer long HPV type 16 E7 epitope

합성된 14개의 HPV 타입 16 E7 펩타이드 가운데 HLA-A*2402 타입 환자 특이적으로 세포 독성 T 세포 생성을 유도하는 E7 에피토프의 후보를 선정하기 위해, 혈액 증여자의 PBMC에 각각의 펩타이드를 처리해 주고 1주일 후에 배양된 IL-2(음성대조군), pp65 328-336(CMV A24, QYDPVAALF, 양성대조군)(Szmania S, 등. Blood 2001;98(3):505-12)와 pp65 495-493 (CMV A02, NLVPMVATV, 음성대조군)(Solache A, 등. J Immunol 1999;163:5512-8)을 각각 처리한 대조군과 비교하여 보았다. 그림 1에서 나타났듯이, 14개의 펩타이드 모두 IL-2만을 처리한 대조군 보다 높은 IFN-γ 의 생성을 유도하였고, 음성대조군(negative control)보다 높은 수치의 IFN-γ의 생성을 보이는 펩타이드 중 E7 61-75(CDSTLRLCVQSTHVD)와 E7 67-81(LCVQSTHVDIRTLED) 펩타이드를 처리한 실험군에서 양성대조군(positive control)에 거의 근접한 수준으로 IFN-γ의 생성수치가 높게 나타나는 것을 알 수 있었다. 유체 세포측정법을 이용해 선별한 E7 에피토프이 실제로 HLA-A*2402 타입 자궁 경부암 세포에 작용하여 사멸시키는 효과를 나타내는 지를 확인하기 위해 51Cr release assay 법을 이용해 분석해 보았다. 혈액 증여자의 PBMC에 IL-2, E7 61-75(CDSTLRLCVQSTHVD), E7 67-81(LCVQSTHVDIRTLED)과 pp65 495-493 (CMV A02, NLVPMVATV, 음성대조군) 펩타이드를 각각 처리해 주고 1주일 후에 배양된 동일 환자의 수지상 세포와 함께 각각의 펩타이드를 다시 한번 처리해 준 뒤 1주일간 배양 후, 51Cr이 표지된 HLA-A*2402 타입 자궁 경부암 세포와 섞어 5시간 동안 배양하고 감마방사선 측정기를 이용하여 분석하였다. 분석한 결과를 살펴 보면, E7 67-81(LCVQSTHVDIRTLED) 펩타이드를 처리한 실험군의 사멸 효과가 IL-2나 pp65 495-493 (CMV A02, NLVPMVATV) 등을 처리한 음성대조군보다 월등히 높은 수치의 세포 사멸 효과를 보여 주었다. E7 61-75(CDSTLRLCVQSTHVD) 펩타이드를 처리한 실험군은 E7 67-81(LCVQSTHVDIRTLED) 펩타이드의 효과에는 미치지 못하는 것을 알 수 있었다 (그림 2).
Among the 14 HPV type 16 E7 peptides synthesized, HLA-A * 2402 type patients. To select candidates for E7 epitopes that specifically induce the production of cytotoxic T cells, PBMCs of blood donors were treated with respective peptides, (CMV A24, QYDPVAALF, positive control) (Szmania S, et al. Blood 2001; 98 (3): 505-12) and pp65 495-493 (CMV A02 , NLVPMVATV, negative control) (Solache A, et al., J Immunol 1999; 163: 5512-8). As shown in Fig. 1, all 14 peptides induce the production of IFN-γ higher than that of the control treated with IL-2 alone. Among the peptides showing higher IFN-γ than the negative control, E7 61 -75 (CDSTLRLCVQSTHVD) and E7 67-81 (LCVQSTHVDIRTLED) peptides showed a high level of production of IFN-γ at a level close to that of the positive control. The 51 Cr release assay was used to determine whether E7 epitopes selected by flow cytometry actually act on HLA-A * 2402 type cervical cancer cells and kill them. The PBMCs of blood donors were treated with IL-2, E7 61-75 (CDSTLRLCVQSTHVD), E7 67-81 (LCVQSTHVDIRTLED) and pp65 495-493 (CMV A02, NLVPMVATV, negative control) . After incubation for 1 week, the cells were incubated with 51 Cr-labeled HLA-A * 2402 cervical cancer cells for 5 hours and analyzed using a gamma-ray detector. The results of the analysis showed that the killing effect of the E7 67-81 (LCVQSTHVDIRTLED) peptide-treated group was significantly higher than that of the negative control group treated with IL-2 or pp65 495-493 (CMV A02, NLVPMVATV) Effect. The experimental group treated with E7 61-75 (CDSTLRLCVQSTHVD) peptides did not show the effect of E7 67-81 (LCVQSTHVDIRTLED) peptide (Figure 2).

(2) HLA-A*2402 특이적인 9/10mer 길이의 HPV 타입 16 E7 에피토프 의 규명(2) Identification of HLA-A * 2402-specific 9/10-mer-long HPV type 16 E7 epitope

위의 결과를 통해 E7 61-75(CDSTLRLCVQSTHVD)와 E7 67-81(LCVQSTHVDIRTLED) 펩타이드를 유력한 에피토프 후보로 선정하였고, 이 펩타이드를 대상으로 각각 9mer와 10mer의 길이로 재합성된 펩타이드를 PBMC에 처리하여 배양한 후 IL-2(음성대조군), pp65 328-336(CMV A24, QYDPVAALF, 양성대조군) 및 pp65 91-100(CMV A33, SVNVHNPTGR, 음성대조군)과 비교한 결과, E7 61-69(CDSTLRLCV)와 E7 67-76(LCVQSTHVDI) 펩타이드를 처리한 실험군에서 양성대조군에 비해 높은 수치가 나타나는 것을 확인할 수 있었다 (그림 3). 또한, E7 67-81(LCVQSTHVDIRTLED) 펩타이드를 토대로 하여 합성한 9mer 및 10mer 길이의 후보 펩타이드인 E7 61-69(CDSTLRLCV)와 E7 67-76(LCVQSTHVDI)를 PBMC에 처리하여 pp65 495-493 (CMV A02, NLVPMVATV, 음성대조군) 및 앞서 선별된 15mer 길이의 E7 67-81(LCVQSTHVDIRTLED) 펩타이드를 처리한 대조군과 51Cr release assay 법을 이용해 비교해 본 결과, 새로 합성된 두 펩타이드가 15mer 길이의 E7 67-81(LCVQSTHVDIRTLED) 펩타이드보다 높거나 유사한 세포 사멸 효과를 나타내는 것을 확인할 수 있었다 (그림 4).
As a result, E7 61-75 (CDSTLRLCVQSTHVD) and E7 67-81 (LCVQSTHVDIRTLED) peptides were selected as potential epitope candidates. The peptides were treated with PBMCs with 9-mer and 10-mer re- E7 61-69 (CDSTLRLCV) was compared with IL-2 (negative control), pp65 328-336 (CMV A24, QYDPVAALF, positive control) and pp65 91-100 (CMV A33, SVNVHNPTGR, negative control) And E7 67-76 (LCVQSTHVDI) peptides were higher than those in the positive control group (Fig. 3). In addition, the 9-mer and 10-mer candidate peptides E7 61-69 (CDSTLRLCV) and E7 67-76 (LCVQSTHVDI) synthesized on the basis of E7 67-81 (LCVQSTHVDIRTLED) peptide were treated with PBMC to obtain pp65 495-493 (CMV A02 , NLVPMVATV, negative control group) and the 15-mer-length E7 67-81 (LCVQSTHVDIRTLED) peptide treated with the 51 Cr release assay. As a result, two newly synthesized peptides were identified as E7 67-81 (LCVQSTHVDIRTLED) peptides (Figure 4).

(3) CTL에 의한 HPV 16 E7 펩타이드 특이적인 세포독성 효과의 확인(3) Confirmation of CTV-specific cytotoxic effect of HPV 16 E7 peptide

앞서 확인된 HPV 16 E7 펩타이드 특이적인 세포독성 효과가 PBMC에 포함된 CTL에 의한 작용임을 증명하기 위해, anti-CD8+ antibody가 결합된 microbead를 사용하여 혈액 증여자의 PBMC로부터 CD8+ T 세포를 분리한 후, 선별된 E7 peptide를 각각 처리하여 배양한 뒤, 같은 조건으로 배양된 CD8+ T 세포를 제거한 PBMC와 51Cr release assay 법을 이용해 비교해 본 결과, CD8+ T 세포를 제거한 PBMC에서는 세포 독성 효과가 나타나지 않아 PBMC에 포함된 CTL이 실제적으로 세포 독성 작용에 관여함을 알 수 있었다 (그림 5).
To demonstrate that the previously identified cytotoxic effect of HPV 16 E7 peptide is due to CTL contained in PBMC, CD8 + T cells were isolated from blood donor PBMCs using anti-CD8 + antibody-conjugated microbeads, The PBMCs treated with the selected E7 peptides were compared with the PBMCs cultured under the same conditions and the 51 Cr release assay. As a result, no cytotoxic effect was observed in PBMCs from which CD8 + T cells were removed. The CTLs involved were found to be involved in the cytotoxic action (Figure 5).

(4) 아미노산이 치환된 E7 펩타이드의 세포 독성 효과 확인 (4) Identification of cytotoxic effect of amino acid-substituted E7 peptide

앞서 나타난 결과를 뒷받침하기 위해 E7 에피토프과 MHC 복합체의 결합 형성 에너지를 EGAD 프로그램을 이용하여 계산한 결과, E7 61-69(CDSTLRLCV) 및 E7 67-76(LCVQSTHVDI) 펩타이드와 HLA-A*2402 복합체의 결합 형성 에너지가 음의 값으로 낮게 산정되어 안정된 결합임을 확인할 수 있었다 (그림 6a). 따라서, 두 펩타이드가 HLA-A*2402 분자에 결합하여 면역 활성을 일으킬 수 있다는 예측이 가능하였다. In order to support the above results, binding energy of E7 epitope and MHC complex was calculated using EGAD program. As a result, binding of E7 61-69 (CDSTLRLCV) and E7 67-76 (LCVQSTHVDI) peptide to HLA-A * 2402 complex The formation energy is estimated to be low as a negative value, indicating stable binding (Fig. 6a). Thus, it was possible to predict that the two peptides could bind to HLA-A * 2402 molecules and cause immune activation.

이러한 결과를 토대로 선별된 두 9mer/10mer 길이의 펩타이드와 HLA-A*2402 분자와의 결합력을 Insight Ⅱ 프로그램을 이용해 계산하여, E7 61-69(CDSTLRLCV)와 E7 67-76(LCVQSTHVDI) 펩타이드의 일부 아미노산 서열을 치환하여 보다 높은 결합력 수치가 산정된 펩타이드를 예측하여 합성한 후(그림 6b), PBMC에 1주일간 처리하여 배양한 후 pp65 328-336(CMV A24, QYDPVAALF, 양성대조군), pp65 495-493 (CMV A02, NLVPMVATV, 음성대조군) 및 기존 E7 61-69(CDSTLRLCV)와 E7 67-76 (LCVQSTHVDI) 펩타이드와 비교한 결과, 치환된 펩타이드 CYQSTHVDI(m-peptide 3, 치환된 펩타이드 3번)와 CYVTLRVCL(m-peptide 7, 치환된 펩타이드 7번)가 대조군 및 기존 펩타이드에 비해 IFN-γ의 생성을 강하게 유도하는 것으로 확인되었다 (그림 6c). 또한, 유체 세포측정법을 통해 선별된 CYQSTHVDI(m-peptide 3, 치환된 펩타이드 3번) 와 CYVTLRVCL(m-peptide 7, 치환된 펩타이드 7번)의 세포 사멸 효과를 확인하기 위해, 두 펩타이드와 기존의 E7 61-69(CDSTLRLCV)와 E7 67-76(LCVQSTHVDI) 펩타이드를 51Cr release assay 법을 이용해 비교한 결과, 아미노산이 치환된 펩타이드가 기존 펩타이드 보다 높은 세포 사멸 효과를 나타내는 것을 확인 할 수 있었다 (그림 6d). 따라서, E7 61-69(CDSTLRLCV)와 E7 67-76(LCVQSTHVDI) 펩타이드를 유력한 특이적 E7 에피토프으로 예상할 수 있었고 두 펩타이드를 HLA-A*2402 분자와 가장 결합력이 높은 형태로 아미노산을 치환하면 세포 독성 T 세포의 활성을 보다 더 강하게 유도함을 알 수 있었다.
Based on these results, the binding capacity of two selected 9-mer / 10-mer peptides to HLA-A * 2402 molecules was calculated using the Insight II program and the results of E7 61-69 (CDSTLRLCV) and E7 67-76 (LCVQSTHVDI) (CMV A24, QYDPVAALF, positive control), pp65 495-336 (CMV A24, QYDPVAALF, positive control) after PBMC treatment for 1 week after incubation with the peptide (M-peptide 3, substituted peptide 3) with the peptide CYQSTHVDI (493 (CMV A02, NLVPMVATV, negative control) and the existing E7 61-69 (CDSTLRLCV) and E7 67-76 (LCVQSTHVDI) CYVTLRVCL (m-peptide 7, substituted peptide 7) was found to strongly induce the production of IFN-γ compared to the control and existing peptides (Figure 6c). In order to examine the cytotoxic effect of CYQSTHVDI (m-peptide 3, substituted peptide 3) and CYVTLRVCL (m-peptide 7, substituted peptide 7) selected by fluid cell assay, E7 61-69 (CDSTLRLCV) and E7 67-76 (LCVQSTHVDI) peptides were compared using the 51 Cr release assay method, and it was confirmed that the amino acid-substituted peptides exhibited higher apoptotic effects than the existing peptides 6d). Thus, E7 61-69 (CDSTLRLCV) and E7 67-76 (LCVQSTHVDI) peptides could be predicted as potent specific E7 epitopes, and if two peptides were substituted with HLA-A * 2402 molecules, And the activity of toxic T cells was more strongly induced.

(5) 자궁 경부암 마우스 모델에서 세포 독성 T 세포를 이용한 항암 실험(5) Cytotoxic T cell-mediated chemotherapy in cervical cancer mouse model

BALB/c 누드 마우스에 자궁 경부암 세포주인 SiHa를 주입하여 종양을 형성한 후, in vitro 실험을 통해 선별된 이용하여 세포 독성 T 세포의 항암 효과를 확인하였다. 그림 7에서 볼 수 있듯이 E7 67-76(LCVQSTHVDI)을 처리하여 배양한 PBMC를 마우스에 투여하였을 때 아무 것도 처리하지 않은 음성 대조군(G1)에 비해 종양의 성장이 억제되는 것을 알 수 있었다 (그림 7a). 또한, E7 61-69(CDSTLRLCV), E7 67-76(LCVQSTHVDI), CYQSTHVDI (m3, 치환된 펩타이드 3번) 및 CYVTLRVCL(m7, 치환된 펩타이드 7번)을 처리하여 배양한 CD8+ T 세포를 마우스에 투여한 후 종양의 크기를 확인하였을 때, 아무것도 처리하지 않은 음성대조군(G1)에 비해 종양의 성장이 크게 억제되는 것을 확인할 수 있었다(그림 7b, c). 따라서, 자궁 경부암 마우스 모델을 이용한 동물 실험을 통해 유세포 측정법과 세포 독성 실험을 통해 선별한 E7 61-69(CDSTLRLCV), E7 67-76(LCVQSTHVDI) CYQSTHVDI (m3, 치환된 펩타이드 3번) 및 CYVTLRVCL(m7, 치환된 펩타이드 7번)펩타이드를 처리하여 배양한 세포 독성 T 세포가 자궁 경부암의 성장을 억제하여 항암 효과가 있음을 확인할 수 있었다.BALB / c nude mice were injected with cervical cancer cell line SiHa to form tumors, and then in vitro experiments were carried out to confirm the antitumor effect of cytotoxic T cells. As shown in Fig. 7, when the PBMC cultured with E7 67-76 (LCVQSTHVDI) was administered to mice, tumor growth was inhibited compared to the negative control (G1), which was not treated ). In addition, CD8 + T cells cultured and treated with E7 61-69 (CDSTLRLCV), E7 67-76 (LCVQSTHVDI), CYQSTHVDI (m3, substituted peptide 3) and CYVTLRVCL (m7, substituted peptide 7) When the size of the tumor was confirmed after administration, tumor growth was significantly inhibited compared to the negative control (G1) (Fig. 7b, c). Therefore, E7 61-69 (CDSTLRLCV), E7 67-76 (LCVQSTHVDI), CYQSTHVDI (m3, substituted peptide 3) and CYVTLRVCL (cilia) were screened through flow cytometry and cytotoxicity tests in animal models of cervical cancer mouse models m7, substituted peptide No. 7) peptides inhibited the growth of cervical cancer and showed anti-cancer effect.

<110> BIOCORE CO.,LTD. <120> Immunogenic Peptide and Composition for preventing or treating HPV-related diseases <160> 108 <170> KopatentIn 1.71 <210> 1 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 1 Met His Gly Asp Thr Pro Thr Leu His Glu Tyr Met Leu Asp Leu 1 5 10 15 <210> 2 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 2 Thr Leu His Glu Tyr Met Leu Asp Leu Gln Pro Glu Thr Thr Asp 1 5 10 15 <210> 3 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 3 Leu Asp Leu Gln Pro Glu Thr Thr Asp Leu Tyr Cys Tyr Glu Gln 1 5 10 15 <210> 4 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 4 Thr Thr Asp Leu Tyr Cys Tyr Glu Gln Leu Asn Asp Ser Ser Glu 1 5 10 15 <210> 5 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 5 Tyr Glu Gln Leu Asn Asp Ser Ser Glu Glu Glu Asp Glu Ile Asp 1 5 10 15 <210> 6 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 6 Ser Ser Glu Glu Glu Asp Glu Ile Asp Gly Pro Ala Gly Gln Ala 1 5 10 15 <210> 7 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 7 Glu Ile Asp Gly Pro Ala Gly Gln Ala Glu Pro Asp Arg Ala His 1 5 10 15 <210> 8 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 8 Gly Gln Ala Glu Pro Asp Arg Ala His Tyr Asn Ile Val Thr Phe 1 5 10 15 <210> 9 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 9 Arg Ala His Tyr Asn Ile Val Thr Phe Cys Cys Lys Cys Asp Ser 1 5 10 15 <210> 10 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 10 Val Thr Phe Cys Cys Lys Cys Asp Ser Thr Leu Arg Leu Cys Val 1 5 10 15 <210> 11 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 11 Cys Asp Ser Thr Leu Arg Leu Cys Val Gln Ser Thr His Val Asp 1 5 10 15 <210> 12 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 12 Leu Cys Val Gln Ser Thr His Val Asp Ile Arg Thr Leu Glu Asp 1 5 10 15 <210> 13 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 13 His Val Asp Ile Arg Thr Leu Glu Asp Leu Leu Met Gly Thr Leu 1 5 10 15 <210> 14 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 14 Leu Glu Asp Leu Leu Met Gly Thr Leu Gly Ile Val Cys Pro Ile 1 5 10 15 <210> 15 <211> 14 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 15 Gly Thr Leu Gly Ile Val Cys Pro Ile Cys Ser Gln Lys Pro 1 5 10 <210> 16 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 16 Cys Asp Ser Thr Leu Arg Leu Cys Val 1 5 <210> 17 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 17 Asp Ser Thr Leu Arg Leu Cys Val Gln 1 5 <210> 18 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 18 Ser Thr Leu Arg Leu Cys Val Gln Ser 1 5 <210> 19 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 19 Thr Leu Arg Leu Cys Val Gln Ser Thr 1 5 <210> 20 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 20 Leu Arg Leu Cys Val Gln Ser Thr His 1 5 <210> 21 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 21 Arg Leu Cys Val Gln Ser Thr His Val 1 5 <210> 22 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 22 Leu Cys Val Gln Ser Thr His Val Asp 1 5 <210> 23 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 23 Cys Val Gln Ser Thr His Val Asp Ile 1 5 <210> 24 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 24 Val Gln Ser Thr His Val Asp Ile Arg 1 5 <210> 25 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 25 Gln Ser Thr His Val Asp Ile Arg Thr 1 5 <210> 26 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 26 Ser Thr His Val Asp Ile Arg Thr Leu 1 5 <210> 27 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 27 Thr His Val Asp Ile Arg Thr Leu Glu 1 5 <210> 28 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 28 His Val Asp Ile Arg Thr Leu Glu Asp 1 5 <210> 29 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 29 Cys Asp Ser Thr Leu Arg Leu Cys Val Gln 1 5 10 <210> 30 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 30 Asp Ser Thr Leu Arg Leu Cys Val Gln Ser 1 5 10 <210> 31 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 31 Ser Thr Leu Arg Leu Cys Val Gln Ser Thr 1 5 10 <210> 32 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 32 Thr Leu Arg Leu Cys Val Gln Ser Thr His 1 5 10 <210> 33 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 33 Leu Arg Leu Cys Val Gln Ser Thr His Val 1 5 10 <210> 34 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 34 Arg Leu Cys Val Gln Ser Thr His Val Asp 1 5 10 <210> 35 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 35 Leu Cys Val Gln Ser Thr His Val Asp Ile 1 5 10 <210> 36 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 36 Cys Val Gln Ser Thr His Val Asp Ile Arg 1 5 10 <210> 37 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 37 Val Gln Ser Thr His Val Asp Ile Arg Thr 1 5 10 <210> 38 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 38 Gln Ser Thr His Val Asp Ile Arg Thr Leu 1 5 10 <210> 39 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 39 Ser Thr His Val Asp Ile Arg Thr Leu Glu 1 5 10 <210> 40 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 40 Thr His Val Asp Ile Arg Thr Leu Glu Asp 1 5 10 <210> 41 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 41 Cys Ile Gln Ser Thr His Val Asp Ile 1 5 <210> 42 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 42 Cys Tyr Gln Ser Thr Ser Val Asp Leu 1 5 <210> 43 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 43 Cys Tyr Gln Ser Thr His Val Asp Ile 1 5 <210> 44 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 44 Cys Tyr Gln Ser Thr His Val Asp Leu 1 5 <210> 45 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 45 Cys Tyr Ala Thr Leu Arg Val Cys Leu 1 5 <210> 46 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 46 Cys Tyr Ser Thr Leu Arg Ala Cys Leu 1 5 <210> 47 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 47 Cys Tyr Val Thr Leu Arg Val Cys Leu 1 5 <210> 48 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> gene <400> 48 tgtgactcta cgcttcggtt gtgcgta 27 <210> 49 <211> 30 <212> DNA <213> Artificial Sequence <220> <223> gene <400> 49 ttgtgcgtac aaagcacaca cgtagacatt 30 <210> 50 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 50 tgttattcta cgcttcggtt gtgcgta 27 <210> 51 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 51 tgttactcta cgcttcggtt gtgcgta 27 <210> 52 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 52 tgttatgtta cgcttcgggt ttgctta 27 <210> 53 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 53 tgttacgtta cgcttcgggt ttgctta 27 <210> 54 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 54 tgttatgtca cgcttcgggt ttgctta 27 <210> 55 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 55 tgttacgtca cgcttcgggt ttgctta 27 <210> 56 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 56 tgttatgtaa cgcttcgggt ttgctta 27 <210> 57 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 57 tgttacgtaa cgcttcgggt ttgctta 27 <210> 58 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 58 tgttatgtga cgcttcgggt ttgctta 27 <210> 59 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 59 tgttacgtga cgcttcgggt ttgctta 27 <210> 60 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 60 tgttatgtta cgcttcgggt ctgctta 27 <210> 61 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 61 tgttacgtta cgcttcgggt ctgctta 27 <210> 62 <211> 28 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 62 tgttatgtaa cgcttcgggt ctcgctta 28 <210> 63 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 63 tgttacgtaa cgcttcgggt ctgctta 27 <210> 64 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 64 tgttatgtga cgcttcgggt ctgctta 27 <210> 65 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 65 tgttacgtga cgcttcgggt ctgctta 27 <210> 66 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 66 tgttatgtta cgcttcgggt atgctta 27 <210> 67 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 67 tgttacgtta cgcttcgggt atgctta 27 <210> 68 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 68 tgttatgtaa cgcttcgggt atgctta 27 <210> 69 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 69 tgttacgtaa cgcttcgggt atgctta 27 <210> 70 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 70 tgttatgtga cgcttcgggt atgctta 27 <210> 71 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 71 tgttacgtga cgcttcgggt atgctta 27 <210> 72 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 72 tgttatgtta cgcttcgggt gtgctta 27 <210> 73 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 73 tgttacgtta cgcttcgggt gtgctta 27 <210> 74 <211> 28 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 74 tgttatgtaa cgcttcgggt gtcgctta 28 <210> 75 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 75 tgttacgtaa cgcttcgggt gtgctta 27 <210> 76 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 76 tgttatgtga cgcttcgggt gtgctta 27 <210> 77 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 77 tgttacgtga cgcttcgggt gtgctta 27 <210> 78 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 78 tgttatgtta cgcttcgggt gtgcttg 27 <210> 79 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 79 tgttacgtta cgcttcgggt gtgcttg 27 <210> 80 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 80 tgttatgtaa cgcttcgggt gtgcttg 27 <210> 81 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 81 tgttacgtaa cgcttcgggt gtgcttg 27 <210> 82 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 82 tgttatgtga cgcttcgggt gtgcttg 27 <210> 83 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 83 tgttacgtga cgcttcgggt gtgcttg 27 <210> 84 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 84 tgttatgtta cgcttcgggt gtgcctt 27 <210> 85 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 85 tgttacgtta cgcttcgggt gtgcctt 27 <210> 86 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 86 tgttatgtaa cgcttcgggt gtgcctt 27 <210> 87 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 87 tgttacgtaa cgcttcgggt gtgcctt 27 <210> 88 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 88 tgttatgtga cgcttcgggt gtgcctt 27 <210> 89 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 89 tgttacgtga cgcttcgggt gtgcctt 27 <210> 90 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 90 tgttatgtta cgcttcgggt gtgcctc 27 <210> 91 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 91 tgttacgtta cgcttcgggt gtgcctc 27 <210> 92 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 92 tgttatgtaa cgcttcgggt gtgcctc 27 <210> 93 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 93 tgttacgtaa cgcttcgggt gtgcctc 27 <210> 94 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 94 tgttatgtga cgcttcgggt gtgcctc 27 <210> 95 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 95 tgttacgtga cgcttcgggt gtgcctc 27 <210> 96 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 96 tgttatgtta cgcttcgggt gtgccta 27 <210> 97 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 97 tgttacgtta cgcttcgggt gtgccta 27 <210> 98 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 98 tgttatgtaa cgcttcgggt gtgccta 27 <210> 99 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 99 tgttacgtaa cgcttcgggt gtgccta 27 <210> 100 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 100 tgttatgtga cgcttcgggt gtgccta 27 <210> 101 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 101 tgttacgtga cgcttcgggt gtgccta 27 <210> 102 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 102 tgttatgtta cgcttcgggt gtgcctg 27 <210> 103 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 103 tgttacgtta cgcttcgggt gtgcctg 27 <210> 104 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 104 tgttatgtaa cgcttcgggt gtgcctg 27 <210> 105 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 105 tgttacgtaa cgcttcgggt gtgcctg 27 <210> 106 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 106 tgttatgtga cgcttcgggt gtgcctg 27 <210> 107 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 107 tgttacgtga cgcttcgggt gtgcctg 27 <210> 108 <211> 25 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 108 Met Ala Ile Ser Gly Val Pro Val Leu Gly Phe Phe Ile Ile Ala Val 1 5 10 15 Leu Met Ser Ala Gln Glu Ser Trp Ala 20 25 <110> BIOCORE CO., LTD. <120> Immunogenic Peptide and Composition for or treating          HPV-related diseases <160> 108 <170> Kopatentin 1.71 <210> 1 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 1 Met His Gly Asp Thr Pro Thr Leu His Glu Tyr Met Leu Asp Leu   1 5 10 15 <210> 2 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 2 Thr Leu His Glu Tyr Met Leu Asp Leu Gln Pro Glu Thr Thr Asp   1 5 10 15 <210> 3 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 3 Leu Asp Leu Gln Pro Glu Thr Thr Asp Leu Tyr Cys Tyr Glu Gln   1 5 10 15 <210> 4 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 4 Thr Thr Asp Leu Tyr Cys Tyr Glu Gln Leu Asn Asp Ser Ser Glu   1 5 10 15 <210> 5 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 5 Tyr Glu Gln Leu Asn Asp Ser Ser Glu Glu Glu Asp Glu Ile Asp   1 5 10 15 <210> 6 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 6 Ser Ser Glu Glu Glu Asp Glu Ile Asp Gly Pro Ala Gly Gln Ala   1 5 10 15 <210> 7 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 7 Glu Ile Asp Gly Pro Ala Gly Gln Ala Glu Pro Asp Arg Ala His   1 5 10 15 <210> 8 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 8 Gly Gln Ala Glu Pro Asp Arg Ala His Tyr Asn Ile Val Thr Phe   1 5 10 15 <210> 9 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 9 Arg Ala His Tyr Asn Ile Val Thr Phe Cys Cys Lys Cys Asp Ser   1 5 10 15 <210> 10 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 10 Val Thr Phe Cys Cys Lys Cys Asp Ser Thr Leu Arg Leu Cys Val   1 5 10 15 <210> 11 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 11 Cys Asp Ser Thr Leu Arg Leu Cys Val Gln Ser Thr His Val Asp   1 5 10 15 <210> 12 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 12 Leu Cys Val Gln Ser Thr His Val Asp Ile Arg Thr Leu Glu Asp   1 5 10 15 <210> 13 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 13 His Val Asp Ile Arg Thr Leu Glu Asp Leu Leu Met Gly Thr Leu   1 5 10 15 <210> 14 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 14 Leu Glu Asp Leu Leu Met Gly Thr Leu Gly Ile Val Cys Pro Ile   1 5 10 15 <210> 15 <211> 14 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 15 Gly Thr Leu Gly Ile Val Cys Pro Ile Cys Ser Gln Lys Pro   1 5 10 <210> 16 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 16 Cys Asp Ser Thr Leu Arg Leu Cys Val   1 5 <210> 17 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 17 Asp Ser Thr Leu Arg Leu Cys Val Gln   1 5 <210> 18 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 18 Ser Thr Leu Arg Leu Cys Val Gln Ser   1 5 <210> 19 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 19 Thr Leu Arg Leu Cys Val Gln Ser Thr   1 5 <210> 20 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 20 Leu Arg Leu Cys Val Gln Ser Thr His   1 5 <210> 21 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 21 Arg Leu Cys Val Gln Ser Thr His Val   1 5 <210> 22 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 22 Leu Cys Val Gln Ser Thr His Val Asp   1 5 <210> 23 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 23 Cys Val Gln Ser Thr His Val Asp Ile   1 5 <210> 24 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 24 Val Gln Ser Thr His Val Asp Ile Arg   1 5 <210> 25 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 25 Gln Ser Thr His Val Asp Ile Arg Thr   1 5 <210> 26 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 26 Ser Thr His Val Asp Ile Arg Thr Leu   1 5 <210> 27 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 27 Thr His Val Asp Ile Arg Thr Leu Glu   1 5 <210> 28 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 28 His Val Asp Ile Arg Thr Leu Glu Asp   1 5 <210> 29 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 29 Cys Asp Ser Thr Leu Arg Leu Cys Val Gln   1 5 10 <210> 30 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 30 Asp Ser Thr Leu Arg Leu Cys Val Gln Ser   1 5 10 <210> 31 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 31 Ser Thr Leu Arg Leu Cys Val Gln Ser Thr   1 5 10 <210> 32 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 32 Thr Leu Arg Leu Cys Val Gln Ser Thr His   1 5 10 <210> 33 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 33 Leu Arg Leu Cys Val Gln Ser Thr His Val   1 5 10 <210> 34 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 34 Arg Leu Cys Val Gln Ser Thr His Val Asp   1 5 10 <210> 35 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 35 Leu Cys Val Gln Ser Thr His Val Asp Ile   1 5 10 <210> 36 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 36 Cys Val Gln Ser Thr His Val Asp Ile Arg   1 5 10 <210> 37 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 37 Val Gln Ser Thr His Val Asp Ile Arg Thr   1 5 10 <210> 38 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 38 Gln Ser Thr His Val Asp Ile Arg Thr Leu   1 5 10 <210> 39 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 39 Ser Thr His Val Asp Ile Arg Thr Leu Glu   1 5 10 <210> 40 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 40 Thr His Val Asp Ile Arg Thr Leu Glu Asp   1 5 10 <210> 41 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 41 Cys Ile Gln Ser Thr His Val Asp Ile   1 5 <210> 42 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 42 Cys Tyr Gln Ser Thr Ser Val Asp Leu   1 5 <210> 43 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 43 Cys Tyr Gln Ser Thr His Val Asp Ile   1 5 <210> 44 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 44 Cys Tyr Gln Ser Thr His Val Asp Leu   1 5 <210> 45 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 45 Cys Tyr Ala Thr Leu Arg Val Cys Leu   1 5 <210> 46 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 46 Cys Tyr Ser Thr Leu Arg Ala Cys Leu   1 5 <210> 47 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 47 Cys Tyr Val Thr Leu Arg Val Cys Leu   1 5 <210> 48 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> gene <400> 48 tgtgactcta cgcttcggtt gtgcgta 27 <210> 49 <211> 30 <212> DNA <213> Artificial Sequence <220> <223> gene <400> 49 ttgtgcgtac aaagcacaca cgtagacatt 30 <210> 50 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 50 tgttattcta cgcttcggtt gtgcgta 27 <210> 51 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 51 tgttactcta cgcttcggtt gtgcgta 27 <210> 52 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 52 tgttatgtta cgcttcgggt ttgctta 27 <210> 53 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 53 tgttacgtta cgcttcgggt ttgctta 27 <210> 54 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 54 tgttatgtca cgcttcgggt ttgctta 27 <210> 55 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 55 tgttacgtca cgcttcgggt ttgctta 27 <210> 56 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 56 tgttatgtaa cgcttcgggt ttgctta 27 <210> 57 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 57 tgttacgtaa cgcttcgggt ttgctta 27 <210> 58 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 58 tgttatgtga cgcttcgggt ttgctta 27 <210> 59 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 59 tgttacgtga cgcttcgggt ttgctta 27 <210> 60 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 60 tgttatgtta cgcttcgggt ctgctta 27 <210> 61 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 61 tgttacgtta cgcttcgggt ctgctta 27 <210> 62 <211> 28 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 62 tgttatgtaa cgcttcgggt ctcgctta 28 <210> 63 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 63 tgttacgtaa cgcttcgggt ctgctta 27 <210> 64 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 64 tgttatgtga cgcttcgggt ctgctta 27 <210> 65 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 65 tgttacgtga cgcttcgggt ctgctta 27 <210> 66 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 66 tgttatgtta cgcttcgggt atgctta 27 <210> 67 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 67 tgttacgtta cgcttcgggt atgctta 27 <210> 68 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 68 tgttatgtaa cgcttcgggt atgctta 27 <210> 69 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 69 tgttacgtaa cgcttcgggt atgctta 27 <210> 70 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 70 tgttatgtga cgcttcgggt atgctta 27 <210> 71 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 71 tgttacgtga cgcttcgggt atgctta 27 <210> 72 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 72 tgttatgtta cgcttcgggt gtgctta 27 <210> 73 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 73 tgttacgtta cgcttcgggt gtgctta 27 <210> 74 <211> 28 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 74 tgttatgtaa cgcttcgggt gtcgctta 28 <210> 75 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 75 tgttacgtaa cgcttcgggt gtgctta 27 <210> 76 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 76 tgttatgtga cgcttcgggt gtgctta 27 <210> 77 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 77 tgttacgtga cgcttcgggt gtgctta 27 <210> 78 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 78 tgttatgtta cgcttcgggt gtgcttg 27 <210> 79 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 79 tgttacgtta cgcttcgggt gtgcttg 27 <210> 80 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 80 tgttatgtaa cgcttcgggt gtgcttg 27 <210> 81 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 81 tgttacgtaa cgcttcgggt gtgcttg 27 <210> 82 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 82 tgttatgtga cgcttcgggt gtgcttg 27 <210> 83 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 83 tgttacgtga cgcttcgggt gtgcttg 27 <210> 84 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 84 tgttatgtta cgcttcgggt gtgcctt 27 <210> 85 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 85 tgttacgtta cgcttcgggt gtgcctt 27 <210> 86 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 86 tgttatgtaa cgcttcgggt gtgcctt 27 <210> 87 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 87 tgttacgtaa cgcttcgggt gtgcctt 27 <210> 88 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 88 tgttatgtga cgcttcgggt gtgcctt 27 <210> 89 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 89 tgttacgtga cgcttcgggt gtgcctt 27 <210> 90 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 90 tgttatgtta cgcttcgggt gtgcctc 27 <210> 91 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 91 tgttacgtta cgcttcgggt gtgcctc 27 <210> 92 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 92 tgttatgtaa cgcttcgggt gtgcctc 27 <210> 93 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 93 tgttacgtaa cgcttcgggt gtgcctc 27 <210> 94 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 94 tgttatgtga cgcttcgggt gtgcctc 27 <210> 95 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 95 tgttacgtga cgcttcgggt gtgcctc 27 <210> 96 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 96 tgttatgtta cgcttcgggt gtgccta 27 <210> 97 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 97 tgttacgtta cgcttcgggt gtgccta 27 <210> 98 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 98 tgttatgtaa cgcttcgggt gtgccta 27 <210> 99 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 99 tgttacgtaa cgcttcgggt gtgccta 27 <210> 100 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 100 tgttatgtga cgcttcgggt gtgccta 27 <210> 101 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 101 tgttacgtga cgcttcgggt gtgccta 27 <210> 102 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 102 tgttatgtta cgcttcgggt gtgcctg 27 <210> 103 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 103 tgttacgtta cgcttcgggt gtgcctg 27 <210> 104 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 104 tgttatgtaa cgcttcgggt gtgcctg 27 <210> 105 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 105 tgttacgtaa cgcttcgggt gtgcctg 27 <210> 106 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 106 tgttatgtga cgcttcgggt gtgcctg 27 <210> 107 <211> 27 <212> DNA <213> Artificial Sequence <220> <223> mutant <400> 107 tgttacgtga cgcttcgggt gtgcctg 27 <210> 108 <211> 25 <212> PRT <213> Artificial Sequence <220> <223> peptide <400> 108 Met Ala Ile Ser Gly Val Val Leu Gly Phe Phe Ile Ile Ala Val   1 5 10 15 Leu Met Ser Ala Gln Glu Ser Trp Ala              20 25

Claims (11)

CDSTLRLCV(서열번호 16) 또는 LCVQSTHVDI(서열번호 35)의 아미노산 서열을 가지는 면역성 펩타이드 및 그 기능적으로 동일한 돌연변이체.An immunogenic peptide having the amino acid sequence of CDSTLRLCV (SEQ ID NO: 16) or LCVQSTHVDI (SEQ ID NO: 35), and functionally equivalent mutants thereof. 제 1항에 있어서, 상기 기능적으로 동일한 돌연변이체는 CYQSTHVDI(서열번호 43) 또는 CYVTLRVCL(서열번호 47)의 아미노산 서열을 가지는 것을 특징으로 하는 면역성 펩타이드 및 그 기능적 돌연변이체.2. The immunogenic peptide of claim 1, wherein the functionally identical mutant has the amino acid sequence of CYQSTHVDI (SEQ ID NO: 43) or CYVTLRVCL (SEQ ID NO: 47) and a functional mutant thereof. 제 1항의 서열번호 16 또는 서열번호 35의 펩타이드를 코딩하는 핵산.16. A nucleic acid encoding a peptide of SEQ ID NO: 16 or SEQ ID NO: 35 of claim 1. 제3항에 있어서, 상기 핵산은 각각 서열번호 48 및 서열번호 49의 염기서열을 가진 것을 특징으로 하는 핵산. 4. The nucleic acid according to claim 3, wherein the nucleic acid has the nucleotide sequence of SEQ ID NO: 48 and SEQ ID NO: 49, respectively. 제 2항의 서열번호 43 또는 서열번호 47의 펩타이드를 코딩하는 핵산.43. A nucleic acid encoding a peptide of SEQ ID NO: 43 or SEQ ID NO: 47 of claim 2. 제 5항에 있어서, 상기 핵산은 서열번호 50 내지 서열번호 107 중 어느 하나의 염기서열을 가지는 것을 특징으로 하는 핵산. 6. The nucleic acid according to claim 5, wherein the nucleic acid has a nucleotide sequence selected from the group consisting of SEQ ID NO: 50 to SEQ ID NO: 107. (a)제1항 또는 제 2항의 펩타이드 및 (b)약학적으로 수용가능한 담체를 포함하는 HPV 감염 관련 질환의 예방 또는 치료용 조성물.A composition for preventing or treating HPV infection-related diseases comprising (a) the peptide of (1) or (2) and (b) a pharmaceutically acceptable carrier. 제7항에 있어서, 상기의 HPV 감염 관련 질환은 보웬성 구진(bowenoid papulosis), 항문 이형성(anal dysplasia), 호흡기 또는 결막 유두종, 자궁 경부 이형성증, 자궁경부암, 외음암(vulval cancer), 또는 전립선암인 것을 특징으로 하는 조성물.8. The method according to claim 7, wherein the HPV infection-related disease is selected from the group consisting of bowenoid papulosis, anal dysplasia, respiratory or conjunctivodendrocnemia, cervical dysplasia, cervical cancer, vulval cancer, &Lt; / RTI &gt; 제1항의 펩타이드를 유효성분으로 포함하는 미세입자, 리포좀, 또는 면역 자극 복합체(ISCOM).A microparticle, liposome, or immunostimulatory complex (ISCOM) comprising the peptide of claim 1 as an active ingredient. 제 3항 또는 제 5항 중 어느 한 항의 핵산을 유효성분으로 포함하는 미세입자, 리포좀, 또는 면역 자극 복합체(ISCOM).7. A microparticle, liposome, or immunostimulatory complex (ISCOM) comprising the nucleic acid of any one of claims 3 to 5 as an active ingredient. 제 7항 또는 제 8항에 있어서, 상기의 조성물은 HLA-A*2402 타입 환자 특이적인 것을 특징으로 하는 조성물.9. The composition of claim 7 or 8, wherein said composition is HLA-A * 2402 type patient specific.
KR20100089502A 2010-09-13 2010-09-13 Immunogenic Peptide and Composition for preventing or treating HPV-related diseases KR101415554B1 (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
KR20100089502A KR101415554B1 (en) 2010-09-13 2010-09-13 Immunogenic Peptide and Composition for preventing or treating HPV-related diseases
CN201180044102.8A CN103097398B (en) 2010-09-13 2011-09-09 Immunogenic peptide and comprise the composition for preventing or treat HPV relative disease of this peptide
PCT/KR2011/006727 WO2012036437A2 (en) 2010-09-13 2011-09-09 Immunogenic peptide and composition having the peptide for preventing or treating hpv-related disease

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
KR20100089502A KR101415554B1 (en) 2010-09-13 2010-09-13 Immunogenic Peptide and Composition for preventing or treating HPV-related diseases

Publications (2)

Publication Number Publication Date
KR20120027740A true KR20120027740A (en) 2012-03-22
KR101415554B1 KR101415554B1 (en) 2014-07-04

Family

ID=45832079

Family Applications (1)

Application Number Title Priority Date Filing Date
KR20100089502A KR101415554B1 (en) 2010-09-13 2010-09-13 Immunogenic Peptide and Composition for preventing or treating HPV-related diseases

Country Status (3)

Country Link
KR (1) KR101415554B1 (en)
CN (1) CN103097398B (en)
WO (1) WO2012036437A2 (en)

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
MX2019003768A (en) 2016-10-03 2019-06-24 Juno Therapeutics Inc Hpv-specific binding molecules.
JP2020537515A (en) 2017-10-03 2020-12-24 ジュノー セラピューティクス インコーポレイテッド HPV-specific binding molecule
KR20210019993A (en) 2018-04-05 2021-02-23 주노 쎄러퓨티크스 인코퍼레이티드 Τ Cell receptor and engineered cells expressing it
KR102711471B1 (en) * 2020-08-14 2024-09-30 서울대학교산학협력단 A pharmaceutical composition for preventing or treating cancer comprising hepatitis b virus-derived polypeptide

Also Published As

Publication number Publication date
WO2012036437A3 (en) 2012-06-28
CN103097398A (en) 2013-05-08
WO2012036437A2 (en) 2012-03-22
CN103097398B (en) 2015-09-30
WO2012036437A9 (en) 2012-12-27
KR101415554B1 (en) 2014-07-04

Similar Documents

Publication Publication Date Title
Davila et al. Generation of antitumor immunity by cytotoxic T lymphocyte epitope peptide vaccination, CpG-oligodeoxynucleotide adjuvant, and CTLA-4 blockade
Boczkowski et al. Dendritic cells pulsed with RNA are potent antigen-presenting cells in vitro and in vivo.
KR102148866B1 (en) Method for activating T cells to treat cancer
CA2305683C (en) Immunogenic peptides from the hpv e7 protein
Lasarte et al. The extra domain A from fibronectin targets antigens to TLR4-expressing cells and induces cytotoxic T cell responses in vivo
US20010006639A1 (en) Immunogenic peptides from the HPV E7 protein
JP2021511805A (en) HPV-specific T cell production
Tseng et al. Low-dose radiation enhances therapeutic HPV DNA vaccination in tumor-bearing hosts
TW201805012A (en) Compositions and methods for tumor vaccination using prostate cancer-associated antigens
Wells et al. Combined triggering of dendritic cell receptors results in synergistic activation and potent cytotoxic immunity
SA519410007B1 (en) Peptides and methods for the treatment of diabetes
JP2006518219A (en) Method of loading antigen to cells by electroporation
KR101415554B1 (en) Immunogenic Peptide and Composition for preventing or treating HPV-related diseases
JPH10505339A (en) Live vaccines for the treatment of tumor diseases
WO2017177907A1 (en) Anti-immune checkpoint pd-l1 and pd-l2 tumor vaccines
Coukos et al. Immunotherapy for gynaecological malignancies
KR20090125629A (en) Immunogenic peptide and composition for preventing or treating hpv-related diseases
KR20090103571A (en) Immunogenic Peptide and Composition for preventing or treating HPV-related diseases
US9475841B2 (en) Melanoma antigen peptide and uses thereof
KR20090125628A (en) Immunogenic peptide and composition for preventing or treating hpv-related diseases
CN115286690B (en) Use of antigen short peptide for screening medicine for treating HPV related diseases and screened TCR thereof
JPWO2007058235A1 (en) Fusion protein and its pharmaceutical use
US9573975B2 (en) Melanoma antigen peptide and uses thereof
WO2005061538A2 (en) Vaccine comprising an angiomotin or a polynucleotide encoding an angiomotin and its uses for the treatment of angiogenic-related disorders
KR20200097654A (en) A Method for activating T cells to treat cancer

Legal Events

Date Code Title Description
A201 Request for examination
E902 Notification of reason for refusal
E701 Decision to grant or registration of patent right
GRNT Written decision to grant
FPAY Annual fee payment

Payment date: 20170622

Year of fee payment: 4

FPAY Annual fee payment

Payment date: 20180531

Year of fee payment: 5

FPAY Annual fee payment

Payment date: 20190423

Year of fee payment: 6