KR20090125629A - Immunogenic peptide and composition for preventing or treating hpv-related diseases - Google Patents

Immunogenic peptide and composition for preventing or treating hpv-related diseases Download PDF

Info

Publication number
KR20090125629A
KR20090125629A KR1020080051833A KR20080051833A KR20090125629A KR 20090125629 A KR20090125629 A KR 20090125629A KR 1020080051833 A KR1020080051833 A KR 1020080051833A KR 20080051833 A KR20080051833 A KR 20080051833A KR 20090125629 A KR20090125629 A KR 20090125629A
Authority
KR
South Korea
Prior art keywords
peptide
seq
hpv
peptides
hla
Prior art date
Application number
KR1020080051833A
Other languages
Korean (ko)
Inventor
이경률
임종백
Original Assignee
바이오코아 주식회사
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 바이오코아 주식회사 filed Critical 바이오코아 주식회사
Priority to KR1020080051833A priority Critical patent/KR20090125629A/en
Priority to PCT/KR2009/002713 priority patent/WO2009148229A2/en
Publication of KR20090125629A publication Critical patent/KR20090125629A/en

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04Linear peptides containing only normal peptide links
    • C07K7/08Linear peptides containing only normal peptide links having 12 to 20 amino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/20011Papillomaviridae
    • C12N2710/20022New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Virology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)

Abstract

PURPOSE: An E7 protein-derived E7 immunogenic peptide is provided to induce generation of cytotoxic T lymphocyte and prevent or treat HPV-relating disease. CONSTITUTION: An immunogenic peptide contains LEDLLMGTLGIVCPI of sequence number 13 or GTLGIVCPICSQKP of sequence number 14. A composition for preventing or treating HPV-relating disease comprises the immunogenic peptide and pharmaceutically acceptable carrier. A microparticle, liposome or immunostimulating complex(ISCOM) contains the immunogenic peptide or a nucleic acid encoding the same as an active ingredient.

Description

면역성 펩타이드 및 그 펩타이드를 포함하는 HPV 관련 질환 예방 또는 치료용 조성물{Immunogenic Peptide and Composition for preventing or treating HPV-related diseases}Immunogenic Peptide and Composition for Preventing or Treating HPV-related diseases

본 발명은 면역성 펩타이드 및 그 펩타이드를 포함하는 HPV 관련 질환 예방 또는 치료용 조성물에 관한 것으로 더욱 상세하게는 HPV 타입 16의 E7 단백질 유래 E7 면역성 펩타이드 및 그 펩타이드를 포함하는 HPV 관련 질환 예방 또는 치료용 조성물에 관한 것이다.The present invention relates to an immunological peptide and a composition for preventing or treating HPV-related diseases comprising the peptide, and more particularly, to a composition for preventing or treating HPV-related diseases comprising an E7 immunopeptide derived from an E7 protein of HPV type 16 and the peptide. It is about.

자궁 경부암은 여성에게서 발생되는 악성 종양 가운데 두 번째로 발병 빈도가 높은 것으로, 매년 전세계적으로 35만 명 이상의 환자가 자궁 경부암으로 사망하고 있으며, 그 수가 계속 증가하고 있다(zur Hausen H.. Nat Rev Cancer. 2002. 2(5):342-50). 자궁 경부암의 주원인은 인유두종 바이러스(human papilomavirus : HPV)로 알려져 있으며, 100여종이 넘는 HPV 중 40여종이 여성 생식기에 감염을 일으키는 것으로 밝혀 졌다 (de Villiers EM, Fauquet C, Broker TR, Bernard HU and zur Hausen H. Classification of papillomaviruses. Virology. 2004. 324: 17-27). 여러 종류의 HPV 중에서 특히 HPV 타입 16과 HPV 타입 18이 자궁 경부암 환자에게서 가장 흔하게 발견되어 종양발생에 중요하게 관여하고 있음이 알려져 있으며 그 중 HPV 타입 16은 가장 많은 자궁 경부암 환자에서 검출된다. (Munoz N, 외. N. Engl. J. Med. 2003. 348: 518-527). Cervical cancer is the second most common malignant tumor in women, with more than 350,000 people dying from cervical cancer each year, and the number continues to increase (zur Hausen H .. Nat Rev). Cancer 2002. 2 (5): 342-50). The main cause of cervical cancer is known as human papilomavirus (HPV), and it has been found that 40 out of 100 HPV infections cause female genital infections (de Villiers EM, Fauquet C, Broker TR, Bernard HU and zur). Hausen H. Classification of papillomaviruses. Virology. 2004. 324: 17-27). Among the various types of HPV, HPV type 16 and HPV type 18 are most commonly found in cervical cancer patients and are known to be important in tumor development. Among them, HPV type 16 is detected in most cervical cancer patients. (Munoz N, et al. N. Engl. J. Med. 2003. 348: 518-527).

HPV가 정상 세포에 감염되면 바이러스 oncogene이 숙주세포(host cell)의 유전자에 삽입되어 여러 바이러스 protein을 발현하게 되는 데, 그 중 E6와 E7은 강력한 oncoprotein으로서 tumor suppressor인 p53과 RB의 작용을 억제하여 암세포로의 진행과 지속적인 성장을 촉진하는 것으로 밝혀 졌다 (Werness BA, 외. Science. 1990. 248: 76-79;Dyson N, 외. Science. 1989. 243: 934-937). E7은 tumor suppressor 인 RB의 기능을 억제하며 (Kiyono T, 외. Nature. 1998. 396: 84-88), S-phase 유전자인 cyclin A 와 cyclin E의 활성을 촉진하고(Zerfass K, 외.J. Virol. 1995. 69: 6389-6399), 또한 cyclin-dependent kinase inhibitor인 CIP1(p21)과 KIP1(p27)의 기능을 억제하는 등(Jones DL, 외.Genes Dev. 1997. 11: 2101-2111;Funk JO, 외. Genes Dev. 1997. 11: 2090-2100;Zerfass-Thome K, 외. Oncogene. 1996. 13: 2323-2330)의 작용으로 감염된 세포의 apoptosis를 저해하고 종양으로의 전환을 유발하는 것으로 알려졌다. 이러한 바이러스 oncoprotein들은 정상 세포에서는 발견되지 않아 다양한 종류의 암을 대상으로 하는 면역치료에 있어서 아주 유력한 target이 되고, 또한 자궁 경부암의 치료를 위한 세포 독성 T 림프구(cytotoxic T lymphocyte : CTL)를 생성하기 위해 HPV 에피토프을 규명하고자 하는 연구의 주요 대상이 되고 있다.When HPV is infected with normal cells, viral oncogenes are inserted into genes of host cells to express various viral proteins, of which E6 and E7 are potent oncoproteins that inhibit the actions of tumor suppressors p53 and RB. It has been shown to promote the progression and continued growth of cancer cells (Werness BA, et al. Science. 1990. 248: 76-79; Dyson N, et al. Science. 1989. 243: 934-937). E7 inhibits the function of RB, a tumor suppressor (Kiyono T, et al. Nature. 1998. 396: 84-88), promotes the activities of the S-phase genes cyclin A and cyclin E (Zerfass K, et al. J.). Virol. 1995. 69: 6389-6399), and also inhibit the function of the cyclin-dependent kinase inhibitors CIP1 (p21) and KIP1 (p27) (Jones DL, et al. Genes Dev. 1997. 11: 2101-2111). (Funk JO, et al. Genes Dev. 1997. 11: 2090-2100; Zerfass-Thome K, et al. Oncogene. 1996. 13: 2323-2330) inhibit the apoptosis of infected cells and induce conversion into tumors. It is known. These viral oncoproteins are not found in normal cells, making them very promising targets in immunotherapy for various types of cancer, and also for producing cytotoxic T lymphocytes (CTLs) for the treatment of cervical cancer. It is the main subject of research to identify HPV epitopes.

따라서, 본 발명에서는 높은 면역 반응을 나타내는 HLA-A*0201 특이 HPV 타입 16 E7 에피토프을 찾기 위해 E7 아미노산 서열을 이용하여 14개의 후보 펩타이드들을 합성한 후에 유체 세포측정법(flow cytometry)과 세포 독성(cytotoxicity) 실험을 수행하여 실제로 HLA-A*0201 타입을 가진 자궁 경부암 환자의 치료를 위한 세포 독성 T 림프구 생성을 유도할 수 있는 신규 HPV 타입 16 E7 에피토프을 규명하고자 하였으며 그 결과 E779 -93(LEDLLMGTLGIVCPI)와 E785 -98(GTLGIVCPICSQKP) 에피토프을 밝혔다. Therefore, in the present invention, after synthesis of 14 candidate peptides using the E7 amino acid sequence to find HLA-A * 0201 specific HPV type 16 E7 epitope showing a high immune response, flow cytometry and cytotoxicity Experiments were carried out to identify novel HPV type 16 E7 epitopes that could induce cytotoxic T lymphocyte production for the treatment of cervical cancer patients with HLA-A * 0201 type, resulting in E7 79 -93 (LEDLLMGTLGIVCPI) and E7. 85 -98 (GTLGIVCPICSQKP) epitope revealed.

HLA-A*0201 타입을 가진 자궁 경부암 환자의 치료가 가능한 세포 독성 T 림프구 생성을 유도하는 새로운 HPV 타입 16 E7 에피토프을 개발하고자 한다.A new HPV type 16 E7 epitope is proposed to induce the production of cytotoxic T lymphocytes that can be treated in cervical cancer patients with HLA-A * 0201 type.

본 발명은 상기의 필요성에 의하여 안출된 것으로서, 본 발명의 목적은 HPV 관련 질환의 예방 또는 치료를 위한 펩타이드를 제공하는 것이다.The present invention has been made by the above necessity, an object of the present invention to provide a peptide for the prevention or treatment of HPV-related diseases.

상기의 목적을 달성하기 위하여 본 발명은 The present invention to achieve the above object

서열번호 13의 LEDLLMGTLGIVCPI 또는 서열번호 14의 GTLGIVCPICSQKP 아미노산 서열을 함유하는 펩타이드를 제공한다.Peptides containing the LEDLLMGTLGIVCPI of SEQ ID NO: 13 or the GTLGIVCPICSQKP amino acid sequence of SEQ ID NO: 14 are provided.

또한 본 발명은 본 발명의 서열번호 13의 펩타이드 또는 서열번호 14의 펩타이드를 각각 코딩하는 핵산을 제공한다.The present invention also provides a nucleic acid encoding the peptide of SEQ ID NO: 13 or the peptide of SEQ ID NO: 14 of the present invention.

본 발명에 있어서, 상기 핵산 서열은 서열번호 13의 펩타이드에 대해서는 서열번호 18(ttg gaa gac ctg tta atg ggc aca cta gga att gtg tgc ccc atc) 이고 서열번호 14의 펩타이드에 대해서는 서열번호 19인 것(ggc aca cta gga att gtg tgc ccc atc tgt tct cag aaa cca)이 바람직하나 이에 한정되지 아니한다.In the present invention, the nucleic acid sequence is SEQ ID NO: 18 for the peptide of SEQ ID NO: 13 (ttg gaa gac ctg tta atg ggc aca cta gga att gtg tgc ccc atc) and SEQ ID NO: 19 for the peptide of SEQ ID NO: 14 ggc aca cta gga att gtg tgc ccc atc tgt tct cag aaa cca) It is not limited to this.

또 본 발명은 (a) 본 발명의 펩타이드 및 (b)약학적으로 수용가능한 담체를 포함하는 HPV 감염 관련 질환의 예방 또는 치료용 조성물을 제공한다.The present invention also provides a composition for preventing or treating a disease associated with HPV infection, comprising (a) the peptide of the present invention and (b) a pharmaceutically acceptable carrier.

본 발명의 일 실시예에 있어서, 상기의 HPV 감염 관련 질환은 보웬성 구진(bowenoid papulosis), 항문 이형성(anal dysplasia), 호흡기 또는 결막 유두종, 자궁 경부 이형성증, 자궁경부암, 외음암(vulval cancer), 또는 전립선암인 것 이 바람직하나 이에 한정되지 아니한다.In one embodiment of the present invention, the HPV infection-related disease is bowenoid papulosis, anal dysplasia, respiratory or conjunctival papilloma, cervical dysplasia, cervical cancer, vulval cancer, Or prostate cancer, but is not limited thereto.

또한 본 발명은 본 발명의 펩타이드를 유효성분으로 포함하는 미세입자, 리포좀, 또는 면역 자극 복합체(ISCOM)를 제공한다.The present invention also provides a microparticle, liposome, or immune stimulating complex (ISCOM) comprising the peptide of the present invention as an active ingredient.

또 본 발명은 본 발명의 핵산을 유효성분으로 포함하는 미세입자, 리포좀, 또는 면역 자극 복합체(ISCOM)를 제공한다.The present invention also provides a microparticle, liposome, or immune stimulating complex (ISCOM) comprising the nucleic acid of the present invention as an active ingredient.

본 발명의 일 실시예에 있어서, 본 발명의 조성물은 HLA-A*3303 타입 환자 특이적인 것이 바람직하나 이에 한정되지 아니한다.In one embodiment of the present invention, the composition of the present invention is preferably HLA-A * 3303 type patient specific, but is not limited thereto.

또한 본 발명의 펩타이드 또는 핵산은 선택적으로 미세입자, 리포좀, 또는 면역 자극 복합체(ISCOM)(활성성분으로 사포닌만을 포함할 수도 있는) 또는 본 발명의 펩타이드를 투여 대상에 공급하기에 적합한 다른 운반수단 속에 제제화될 수 있다. 미세입자를 사용하는 경우 그것은 바람직하게는 poly-lactic-co-glycolic acid (PLGA)와 같은 공중합체인 중합체 매트릭스를 갖는다.The peptides or nucleic acids of the invention may also optionally be incorporated into microparticles, liposomes, or immune stimulating complexes (ISCOM) (which may include only saponins as active ingredients) or other carriers suitable for supplying the peptides of the invention to a subject. It may be formulated. When using microparticles it preferably has a polymer matrix which is a copolymer such as poly-lactic-co-glycolic acid (PLGA).

포유류에서 면역반응(예를 들어 MHC class I-매개 또는 class II-매개 면역 반응을 포함하는 세포 면역 반응)은 면역원성 펩타이드가 결합하는 MHC 분자를 가지는 포유류, 즉 인간, 유인원, 개, 고양이, 또끼, 소, 쥐에 면역원성 펩타이드를 투여하여 촉발될 수 있다. 상기 본 발명의 펩타이드는 미세입자, 리포좀, 또는 ISCOM, 또는 용액의 일부로 투여될 수 있다. In mammals, an immune response (e.g., a cellular immune response comprising an MHC class I-mediated or class II-mediated immune response) is a mammal having an MHC molecule to which an immunogenic peptide binds, ie humans, apes, dogs, cats, and animals. It can be triggered by administering immunogenic peptides to cows, mice, and rats. The peptide of the present invention may be administered as a microparticle, liposome, or ISCOM, or as part of a solution.

본 발명의 펩타이드를 투여하는 또 다른 방법은 본 발명의 펩타이드를 코딩하는 핵산 서열을 포함하는 발현벡터를 이용하는 것이다. 그 핵산 서열은 선택적으로 상기의 본 발명의 펩타이드에 연결된 신호 서열을 코딩할 수도 있다.그 핵산이 신호 서열을 코딩할 때 바람직하게는 그것은 HLA-DR.alpha로부터 온 신호 서열 Met Ala Ile Ser Gly Val Pro Val Leu Gly Phe Phe Ile Ile Ala Val Leu Met Ser Ala Gln Glu Ser Trp Ala(서열번호 20)을 코딩한다. 그 경우에 본 발명의 서열은 예를 들어 서열번호 3 또는 9의 서열을 가질 수 있다. 바람직하게는 그 핵산은 핵산 감염을 일으키는 바이러스 유전자를 포함하지 아니하고 인택트 E7 단백질을 코딩하지 아니한다. Another method of administering a peptide of the invention is to use an expression vector comprising a nucleic acid sequence encoding the peptide of the invention. The nucleic acid sequence may optionally encode a signal sequence linked to the above peptide of the present invention. When the nucleic acid encodes a signal sequence, preferably it is a signal sequence Met Ala Ile Ser Gly Val from HLA-DR.alpha. Pro Val Leu Gly Phe Phe Ile Ala Val Leu Met Ser Ala Gln Glu Ser Trp Ala (SEQ ID NO: 20). In that case, the sequence of the present invention may have the sequence of SEQ ID NO: 3 or 9, for example. Preferably the nucleic acid does not contain the viral gene causing the nucleic acid infection and does not encode the intact E7 protein.

본 발명의 핵산은 프라즈미드 내에 포함될 수 있고, 선택적으로 중합체 매트릭스를 포함하는 미세입자 내에 제공될 수 있다. 바람직한 실시예에서 중합체 매트릭스는 필수적으로 PLGA의 공중합체로 구성된다. 바람직하게 그 미세입자는 예를 들어 0.02에서 20 마이크론 또는 약 11 마이크론 이하의 직경을 가진다. 바람직하게는 복수의 미세입자들이 0.02에서 20 마이크론 또는 약 11 마이크론 이하의 직경을 가진다.Nucleic acids of the invention can be included in the plasmid and optionally provided in microparticles comprising a polymer matrix. In a preferred embodiment the polymer matrix consists essentially of a copolymer of PLGA. Preferably the microparticles have a diameter of, for example, 0.02 to 20 microns or less than about 11 microns. Preferably the plurality of microparticles has a diameter of 0.02 to 20 microns or less than about 11 microns.

본 발명의 프라즈미드를 포함하는 세포도 본 발명의 범위 내이다. 그 세포는 예를 들어 B 세포 또는 다른 항원 제시 세포(APC)일 수 있다. 그 세포는 그것을 ㅋ코딩하는 프라즈미드로부터 펩타이드 발현을 가능하게 하는 조건에서 배양되거나 유지된다.Cells containing the plasmid of the present invention are also within the scope of the present invention. The cell can be, for example, a B cell or other antigen presenting cell (APC). The cell is cultured or maintained under conditions that allow peptide expression from the plasmid encoding it.

본 발명의 핵산 및 프라즈미드는 예를 들어 "naked DNA"로 포유류에 상기 언급한 플라즈미드를 투여하여 포유류 예를 들어 인간에서 면역 반응을 유도하는 방법에 유용하다. 그 포유류는 HPV 감염, 자궁경부 이형성증, 및/또는 자궁경부암의 위험이나 또는 질환을 가질 수 있다. 본 발명의 핵산 및 플라즈미드도 미세 입자, 리포좀, ISCOMS, 또는 상기에 기재된 것과 같은 다른 적당한 운반 수단에 삽입될 수 있다.Nucleic acids and plasmids of the present invention are useful in methods of inducing an immune response in mammals, eg, humans, by administering the aforementioned plasmids to the mammal, eg, as "naked DNA." The mammal may have a risk or disease of HPV infection, cervical dysplasia, and / or cervical cancer. Nucleic acids and plasmids of the invention can also be inserted into microparticles, liposomes, ISCOMS, or other suitable means of transport as described above.

명세서에서 특별한 정의가 없으면 본 명세서에 사용된 모든 과학적 및 기술적인 용어는 본 발명이 속하는 기술분야에서 당업자에 의하여 통상적으로 이해되는 것과 동일한 의미를 가진다.Unless otherwise defined, all scientific and technical terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs.

본 발명에 개재된 펩타이드들과 그 펩타이드를 코딩하는 핵산은 HPV E7 단백질에 대한 면역 반응을 야기하는데 사용될 수 있다. Peptides disclosed herein and nucleic acids encoding the peptides can be used to elicit an immune response against HPV E7 protein.

본 발명의 펩타이드는 세포내 기관으로 그 펩타이드를 운반하는 수송(trafficking) 서열이 연결될 수 있다. 그 수송서열은 그것이 부착된 펩타이드의 세포내 수송(소기관에서 소기관으로 또는 세포 표면으로 이동을 지시)을 조절하는 기능을 하는 아미노산 사열이다. 그러한 수송 서열들은 ER, 리소좀 또는 엔도좀으로 그 폴리펩타이드들을 수송할 수 있고 시그널 펩타이드들(번역 동안 ER에 단백질을 지시하는 N-말단 서열), 예를 들어 KDEL 과 같은 ER 체류 서열, 및 KFERQ, 또는 QREFK와 같은 와 같은 리소좀 타겟 서열을 포함할 수 있다. The peptide of the present invention may be linked to a transporting sequence that carries the peptide to intracellular organs. The transport sequence is an amino acid sequence that functions to regulate intracellular transport (directing movement from organelles to organelles or to the cell surface) of the peptide to which it is attached. Such transport sequences can transport the polypeptides to ER, lysosomes or endosomes and signal peptides (N-terminal sequences that direct the protein to the ER during translation), for example ER retention sequences such as KDEL, and KFERQ, Or a lysosomal target sequence such as QREFK.

짧은 아미노산 사열들은 특정세포내 기관으로 단백질을 타겟하는 시그널로 작용할 수 있다. 예를 들어 ER로 가는 단백질의 아미노 말단에서 소수성 시그널 펩타이드가 발견된다.Short amino acid sequences can act as signals to target proteins to specific intracellular organs. For example, a hydrophobic signal peptide is found at the amino terminus of the protein towards ER.

그러한 수송 서열은 HLA-DR.알파 리더 서열인 Met Ala Ile Ser Gly Val Pro Val Leu Gly Phe Phe Ile Ile Ala Val Leu Met Ser Ala Gln Glu Ser Trp Ala (서열번호 20)일 수 있다. 만약 그 부분이 본 발명의 폴리펩타이드를 ER로 수송하는데 충분하다면, 그 시그널 펩타이드의 상기 특정된 25개의 잔기 서열 중 일부분(예를 들어 적어도 10개의 아미노산 잔기)만을 포함할 수 있다. Such a transport sequence may be the HLA-DR.alpha leader sequence Met Ala Ile Ser Gly Val Pro Val Leu Gly Phe Ile Ala Val Leu Met Ser Ala Gln Glu Ser Trp Ala (SEQ ID NO: 20). If that portion is sufficient to transport the polypeptide of the invention to the ER, it may comprise only a portion of the above specified 25 residue sequences (eg at least 10 amino acid residues) of the signal peptide.

일부 경우에는 시그널 펩티데이즈에 의한 가공(즉 절단)을 가능하게 하기 위하여 본 발명의 HPV E7 항원성 펩타이드를 코딩하는 서열과 수송 서열을 연결하는 부분은 변형되는 것이 바람직하다. 시그널 펩타이드들에 대한 인식 서열들은 Von Heijne, NAR 14:4683, 1986에 기재된다. In some cases, it is desirable to modify the portion linking the transport coding sequence with the sequence encoding the HPV E7 antigenic peptide of the present invention to enable processing (ie cleavage) by signal peptides. Recognition sequences for signal peptides are described in Von Heijne, NAR 14: 4683, 1986.

본 발명의 펩타이드를 코딩하는 DNA를 구축하는데 표준 기술이 사용될 수 있다(예를 들어 WO 94/04171에 기재된 기술을 참고). 그 구축물은 인간 세포들에서 발현을 증가시키는 부가적인 서열들 예를 들어 적당한 프로모터, 코딩 서열의 RNA 안정 5' 과 3' 서열, 인트론(코딩되는 서열 내에 5' 또는 3' 어느 쪽에도 위치될 수 있음), 및 폴리(A) 부가 자리뿐만 아니라 그 구축물이 원핵 및/또는 진핵 숙주에 대한 선택 및 복제를 가능하게 하는 복제 오리진 및 선택 마커들을 포함할 수 있다. Standard techniques can be used to construct DNA encoding the peptides of the invention (see eg the technique described in WO 94/04171). The construct can be located on additional sequences that increase expression in human cells, such as appropriate promoters, RNA stable 5 'and 3' sequences of coding sequences, introns (5 'or 3' in the sequence being encoded). ), And poly (A) addition sites, as well as their constructs, may include replication origin and selection markers that allow for selection and replication for prokaryotic and / or eukaryotic hosts.

본 발명의 플라즈미드 내에는 가나마이신 저항 유전자(519-1313 부위), SV40 얼리 프로모터(131-484 부위) 및 thymidine kinase (TK) 폴리아데닐레이션 자리(1314-1758 부위)를 가질 수 있다. 가나마이신 저항 유전자 및 관련 조절 서열은 단지 선택의 목적을 위한 것이고 만약 선택이 필요하지 않거나 바람직하지 않으면 플라즈미드로부터 제거될 수 있다.The plasmid of the present invention may have a kanamycin resistance gene (519-1313 site), an SV40 early promoter (131-484 site), and a thymidine kinase (TK) polyadenylation site (1314-1758 site). Kanamycin resistance genes and related regulatory sequences are for selection purposes only and can be removed from the plasmid if selection is not required or desired.

본 발명의 펩타이드 및 핵산은 HPV에 의하여 감염된 것으로 알려졌거나, HPV에 의하여 감염된 것이 의심스럽거나, HPV에 의하여 감염될 수 있는 대상에서 예방 또는 치료적인 백신으로 사용될 수 있다. 다른 적당한 대상들은 HPV-관련 질환의 증상을 나타내거나 질환이 발생할 것 같은 사람들을 포함한다. 본 발명의 펩타이드 및 백신은 HPV 균주 16의 감염과 관련된 질환들, 예를 들어 보웬성 구진(bowenoid papulosis), 항문 이형성(anal dysplasia), 호흡기 또는 결막 유두종, 자궁 경부 이형성증, 자궁경부암, 외음암(vulval cancer), 또는 전립선암을 치료하거나 예방하는 백신으로 사용될 수 있다. The peptides and nucleic acids of the invention can be used as prophylactic or therapeutic vaccines in subjects known to be infected by HPV, suspected of being infected by HPV, or susceptible to infection by HPV. Other suitable subjects include those who exhibit or are likely to develop symptoms of HPV-related diseases. Peptides and vaccines of the invention may be used to treat diseases associated with infection of HPV strain 16, such as bowenoid papulosis, anal dysplasia, respiratory or conjunctival papillomas, cervical dysplasia, cervical cancer, and vulvar cancer. vulval cancer, or as a vaccine to treat or prevent prostate cancer.

본 발명의 펩타이드 또는 핵산들은 HPV 감염 또는 HPV 감염과 관련된 질환들을 치료하기 위하여 단독 또는 당업계에 공지된 다른 치료법 예를 들어 화학요법제, 방사선 및 수술과 같이 투여될 수 있다. 또한 본 발명의 펩타이드들 및 핵산들은 면역 반응을 증진하기 위하여 고안된 다른 치료, 예를 들어 당업계에 주지된 것과 같은 어쥬번트 또는 사이토카인(또는 사이토카인을 코딩하는 핵산)과 혼합하여 투여될 수 있다.Peptides or nucleic acids of the invention can be administered alone or in combination with other therapies known in the art, such as chemotherapeutic agents, radiation and surgery to treat HPV infection or diseases associated with HPV infection. Peptides and nucleic acids of the invention can also be administered in combination with other therapies designed to enhance an immune response, for example adjuvant or cytokines (or nucleic acids encoding cytokines), as is well known in the art. .

본 발명의 펩타이드 또는 핵산들은 HPV 감염 또는 HPV 감염 관련 질환의 예방 또는 치료용 약제의 제조에 사용될 수 있다. Peptides or nucleic acids of the invention can be used in the manufacture of a medicament for the prevention or treatment of HPV infection or a disease associated with HPV infection.

본 발명의 운반 시스템들은 HPV에 대한 면역 반응을 촉진시키려는 적당한 세포들에 펩타이드 또는 그 펩타이드를 발현하는 DNA 컨스트럭트를 운반하는데 사용될 수 있다.The delivery systems of the present invention can be used to deliver a peptide or DNA construct that expresses the peptide to appropriate cells that are intended to promote an immune response against HPV.

본 발명의 펩타이드 또는 그 펩타이드를 코딩하는 핵산들은 표준 방법, 예를 들어 Donnelly et al., J. Imm. Methods 176:145, 1994, 및 Vitiello et al., J. Clin. Invest. 95:341, 1995에 기재된 것과 같은 방법을 사용하여 투여될 수 있다.Peptides of the invention or nucleic acids encoding the peptides are standard methods, for example Donnelly et al., J. Imm. Methods 176: 145, 1994, and Vitiello et al., J. Clin. Invest. 95: 341, may be administered using a method such as that described in 1995.

본 발명의 펩타이드 또는 핵산들은 대상에 당업계에 공지된 형태, 예를 들어 근육주사, 정맥주사, 동맥주사, 피내주사, 복강주사, 코의내부, 질내, 관장내, 피하내 주사될 수 있거나 그들은 예를 들어 미세입자를 포함하는 분말 또는 용액의 흡입에 의하여 위장관, 점막 또는 호흡기로 투여될 수 있다. 투여는 국소적(예를 들어 자궁경부 또는 다른 감염자리) 또는 전신성일 수 있다. Peptides or nucleic acids of the invention can be injected in a form known in the art to a subject, such as intramuscular injection, intravenous injection, arterial injection, intradermal injection, intraperitoneal injection, intranasal, intravaginal, enema, subcutaneous or they For example, it may be administered to the gastrointestinal tract, mucosa or respiratory tract by inhalation of a powder or solution containing microparticles. Administration can be local (eg cervical or other infectious site) or systemic.

본 발명의 펩타이드 또는 그 펩타이드를 코딩하는 핵산들은 콜로이드 현탁액, 분말, 식염수, 지질, 리포좀, 미소구체(microspheres), 또는 나노구형입자와 같은 약학적으로 수용될 수 있는 담체에 운반될 수 있다. 그들은 운반 수단과 복합체를 형성하거나 관련되거나 또는 네이키드될 수 있고 지질, 리포좀, 미세입자, 금, 나노입자, 폴리머, 축하반응제, 다당류, 폴리아미노산, 덴드리머, 사포닌, 흡착 증진 물질 또는 지방산과 같은 당업계에 공지된 운반 시스템을 사용하여 운반될 수 있다.The peptides of the present invention or nucleic acids encoding the peptides can be carried in pharmaceutically acceptable carriers such as colloidal suspensions, powders, saline, lipids, liposomes, microspheres, or nanospheres. They may be complexed with, associated with, or naked with a vehicle and may be lipids, liposomes, microparticles, gold, nanoparticles, polymers, catalyzers, polysaccharides, polyamino acids, dendrimers, saponins, adsorption enhancing substances or fatty acids. The delivery can be carried out using a delivery system known in the art.

약 0.1에서 100 마이크로몰의 펩타이드 용량 또는 약 1에서 200 마이크로그램의 DNA의 용량이 1회 체중 kg 당 투여되는 것이 바람직하다. 물론 당업계에 주지된 바와 같이 주어진 환자에 대한 용량은 환자의 키, 체표면적, 나이, 투여되는 특정 화합물, 성별, 투여 시간과 경로, 일반적 건강상태 및 동시에 투여되는 다른 약제를 포함하는 많은 인자들에 의존한다. 적정 투여량의 결정은 통상의 지식을 가진 약사들의 능력 범위내에서 능숙하다.Preferably, a dose of about 0.1 to 100 micromoles of peptide or about 1 to 200 micrograms of DNA is administered per kg of body weight once. Of course, as is well known in the art, a dose for a given patient may be based on a number of factors including the patient's height, body surface area, age, the specific compound administered, sex, time and route of administration, general health and other agents administered simultaneously. Depends on Determination of the appropriate dosage is skillful within the capabilities of pharmacists of ordinary skill.

바이오리스틱(biolistic) 전달 또는 생체 외(ex vivo) 처리와 같은 다른 표준 전달 방법들이 사용될 수도 있다. 생체 외 처리에서 예를 들어 항원제시 세포들(APCs), 수지상세포들, 말초혈액 단핵구 세포들, 또는 골수세포들을 환자 또는 적당한 공여자로부터 얻어서 본 면역 조성물로 생체 외에서 활성화된 후 그 환자에게 투여될 수 있다. Other standard delivery methods may be used, such as biolistic delivery or ex vivo treatment. In vitro treatment, for example, antigen presenting cells (APCs), dendritic cells, peripheral blood mononuclear cells, or bone marrow cells can be obtained from a patient or a suitable donor and activated in vitro with the present immune composition and then administered to the patient. have.

미국 특허 제 5,783,567에 기재된 것을 포함하는 미세입자들이 세포 속으로DNA, 또는 펩타이드와 같은 거대분자를 운반하기 위한 운송수단으로 사용될 수 있다. 그들은 폴리머의 쉘 내에 둘러 쌓여 있거나 폴리머 매트릭스에 들어간 거대분자들을 포함한다. 미세입자들은 예를 들어 들어있는 DNA를 분해되지 않은 상태로 유지하는 것과 같은 거대분자의 특성을 유지하는 작용을 한다. 미세입자들은 또 거대분자들의 펄스된 운반 및 특정 위치에 운반 또는 특정 세포 또는 타겟 세포군으로 운반에 사용될 수 있다.Microparticles, including those described in US Pat. No. 5,783,567, can be used as vehicles for transporting macromolecules such as DNA or peptides into cells. They contain macromolecules enclosed within the shell of the polymer or entered into the polymer matrix. Microparticles act to maintain the properties of macromolecules, for example to keep the DNA intact. Microparticles can also be used for pulsed delivery of macromolecules and for delivery to specific locations or to specific cells or target cell populations.

폴리머 매트릭스는 poly-lactic-co-glycolic acid, 전분, 젤라틴 또는 키틴과 같은 생분해성 공중합체일 수 있다. 미세입자들은 대상의 식세포로 DNA 분자들의 이동을 최대화하는데 특히 사용될 수 있다. 또는 그 미세입자들은 조직에 주사되거나 이식될 수 있다. The polymer matrix may be a biodegradable copolymer such as poly-lactic-co-glycolic acid, starch, gelatin or chitin. Microparticles can be used in particular to maximize the transport of DNA molecules into the phagocytes of the subject. Or the microparticles can be injected or implanted into tissue.

본 발명의 펩타이드는 당업계에 주지된 지질, 덴드리머 또는 리포좀을 통하여 대상에 투여될 수 있다. 예를 들어 면역 펩타이드 또는 그 펩타이드를 코딩하는 핵산들을 운반하는 리포좀들은 인 비보에서 CTL 반응을 야기하는 것으로 알려졌다(Reddy et al., J. Immunol. 148:1585, 1992; Collins et al., J. Immunol. 148:3336-3341, 1992; Fries et al., Proc. Natl. Acad. Sci. USA 89:358, 1992; Nabel et al., Proc. Nat. Acad. Sci. (USA) 89:5157, 1992).Peptides of the invention can be administered to a subject via lipids, dendrimers or liposomes well known in the art. For example, liposomes carrying an immunopeptide or nucleic acids encoding the peptide are known to cause a CTL response in vivo (Reddy et al., J. Immunol. 148: 1585, 1992; Collins et al., J. Immunol. 148: 3336-3341, 1992; Fries et al., Proc. Natl. Acad. Sci. USA 89: 358, 1992; Nabel et al., Proc. Nat. Acad. Sci. (USA) 89: 5157, 1992).

본 발명의 펩타이드 및 핵산들은 사포닌 단독 또는 콜레스테롤 및 Quil A (사포닌)을 동시에 혼합하여 생성된 30-40 nm 크기의 (-) 차지된 케이지 유사 구조인 Immune Stimulating Complexes (ISCOMS)을 사용하여 투여될 수 있다. 본 발명의 펩타이드 및 핵산들은 ISCOMS와 동시 또는 별도로 투여될 수 있다. Peptides and nucleic acids of the invention can be administered using Immune Stimulating Complexes (ISCOMS), a 30-40 nm sized (-) occupied cage-like structure produced by mixing saponin alone or cholesterol and Quil A (saponin) simultaneously. have. Peptides and nucleic acids of the invention can be administered simultaneously or separately from ISCOMS.

보호면역은 항원에 대한 운반 수단으로 ISCOMS을 사용한 톡소플라스마증 및 Epstein-Barr 바이러스 유도된 종양들을 포함하는 감염의 여러 실험 모델에서 생성되어 왔다(Mowat et al., Immunology Today 12:383-385, 1991). ISCOMS에서 캡슐화된 1ug의 낮은 항원 용량이 클래스 I 매개된 CTL 반응을 생성하는 것이 발견되었다(Takahashi et al., Nature 344:873-875, 1990).Protected immunity has been generated in several experimental models of infections including toxoplasmosis and Epstein-Barr virus induced tumors using ISCOMS as a vehicle for antigen (Mowat et al., Immunology Today 12: 383-385, 1991). ). Low antigen doses of 1 ug encapsulated in ISCOMS have been found to produce class I mediated CTL responses (Takahashi et al., Nature 344: 873-875, 1990).

면역 반응을 야기하는 본 발명의 펩타이드 및 핵산의 능력은 당업계에 주지된 면역 반응을 측정하는 방법들을 사용하여 분석할 수 있다. 예를 들어 세포 독성T 세포들의 생성은 MHC 테트라머를 사용하거나 세포내 사이토카인 발현을 측정하거나 표준 51Cr release 분석에서 나타낼 수 있다. ELISA 또는 ELISPOT와 같은 표준 분석도 T 세포 활성화에 기여하는 사이토카인 프로화일을 측정하는데 사용될 수 있다. T 세포 증식은 또 당업계에 공지된 다른 분석들과 3H-thymidine 업테이크와 같은 분석을 사용하여 측정될 수 있다. B 세포 반응들은 ELISA와 같은 분석을 사용하여 측정될 수 있다. The ability of the peptides and nucleic acids of the invention to elicit an immune response can be analyzed using methods for measuring immune responses well known in the art. For example, the generation of cytotoxic T cells can be expressed using MHC tetramers, measuring intracellular cytokine expression or in a standard 51 Cr release assay. Standard assays such as ELISA or ELISPOT can also be used to determine cytokine profiles that contribute to T cell activation. T cell proliferation can also be measured using other assays known in the art and assays such as the 3 H-thymidine uptake. B cell responses can be measured using an assay such as ELISA.

디지털 이미징, 세포학적 질확대경 및 조직학적 검사와 같은 다른 방법들이 유두종 바이러스 관련 병소 또는 유두종 바이러스 레벨에 대한 본 발명의 펩타이드 와 핵산의 효과를 측정하는데 사용될 수 있다. Other methods such as digital imaging, cytoscopy, and histological examination can be used to determine the effect of the peptides and nucleic acids of the invention on papilloma virus related lesions or papilloma virus levels.

이하, 본 발명을 설명한다.Hereinafter, the present invention will be described.

자궁 경부암은 여성에게서 발생되는 악성 종양 가운데 두 번째로 발병 빈도가 매우 높아 그 위험성이 잘 알려져 있다. 인유두종 바이러스(HPV)가 자궁 경부암의 주원인으로 알려져 있으며, 그 중에서도 HPV 타입 16이 자궁 경부암 환자에서 가장 많이 검출됨이 밝혀져 있다. HPV 타입 16 E6와 E7은 viral oncoprotein으로서 HPV 감염된 자궁 경부세포를 암세포로의 진행을 야기 시키며 암세포의 지속적인 성장을 촉진하는 것으로 밝혀 졌다. HPV 타입 16 E7은 tumor suppressor 인 Rb의 기능을 억제하며 감염된 세포의 apoptosis를 저해하고 종양으로의 전환을 유발하는 데, 자궁 경부암 치료를 위한 세포독성 T 림프구를 이용한 면역세포 치료법 개발에 있어 유력한 표적항원 (target antigen)으로 지목되어 연구가 진행되어 가고 있다. Cervical cancer is the second most common malignant tumor in women and its risk is well known. Human papillomavirus (HPV) is known to be the major cause of cervical cancer, among which HPV type 16 has been found to be the most detected in cervical cancer patients. HPV types 16 E6 and E7 are viral oncoproteins that have been shown to cause HPV-infected cervical cells to progress into cancer cells and promote the continued growth of cancer cells. HPV type 16 E7 inhibits the function of Rb, a tumor suppressor, inhibits apoptosis of infected cells and induces the transition to tumors. HPV type 16 E7 is a potent target antigen in the development of immune cell therapy using cytotoxic T lymphocytes for the treatment of cervical cancer. It is being studied as a target antigen.

HLA-A*0201 타입의 세포 독성 T 림프구의 생성을 유도하는 특정한 HPV 타입 16 E7 에피토프을 개발하기 위해 합성된 HPV 타입 16 E7 후보 펩타이드들을 이용하여 유체 세포측정법 (flow cytometry)을 실행한 결과 E7 후보 펩타이드 가운데 E779 -93(LEDLLMGTLGIVCPI)와 E785 -98(GTLGIVCPICSQKP) 에피토프이 높은 수치의 세포 독성 T 세포의 분화 및 활성을 유도 하는 것을 알 수 있었으며, 또한 세포 독성 (cytotoxicity) 실험을 통해 E779 -93(LEDLLMGTLGIVCPI)와 E785 -98(GTLGIVCPICSQKP) 에피토프이 기존 연구에서 잘 밝혀진 E782 -90(LLMGTLGIV)과 E786 -93(TLGIVCPI) peptide가 동일하거나 우수한 자궁 경부암 세포사멸 효과를 유발함을 알 수 있었다. 따라서, E779 -93(LEDLLMGTLGIVCPI)와 E785 -98(GTLGIVCPICSQKP) 에피토프이 자궁 경부암 환자의 치료 및 백신 개발에 효과적으로 적용될 수 있는 신규 HLA-A*0201 에피토프임을 규명하였다.E7 candidate peptides as a result of flow cytometry using HPV type 16 E7 candidate peptides synthesized to develop specific HPV type 16 E7 epitopes that induce the production of HLA-A * 0201 type cytotoxic T lymphocytes Among them, E7 79 -93 (LEDLLMGTLGIVCPI) and E7 85 -98 (GTLGIVCPICSQKP) epitopes induced high levels of differentiation and activity of cytotoxic T cells, and cytotoxicity experiments showed that E7 79 -93 ( LEDLLMGTLGIVCPI ) it was found that LEDLLMGTLGIVCPI) and E7 85 -98 (GTLGIVCPICSQKP) epitopeuyi well identified E7 82 -90 (LLMGTLGIV) and E7 86 -93 (TLGIVCPI) peptide induced the same or superior cervical cancer cell killing effects in previous studies. Thus, we identified that E7 79 -93 (LEDLLMGTLGIVCPI) and E7 85 -98 (GTLGIVCPICSQKP) epitopes are novel HLA-A * 0201 epitopes that can be effectively applied to the treatment and vaccine development of cervical cancer patients.

즉 본 발명에서는 기존에 밝혀진 E7 에피토프보다 높은 항암효과를 나타내는 펩타이드를 찾기 위해 정상 HLA-A*0201 타입 혈액 증여자에게서 PBMC를 공급받아 합성된 E7 펩타이드를 처리하여 1주 혹은 2주간 배양한 후 IFN-γ의 발현 정도를 측정하여 CD8+ T 세포로의 분화를 유도하는 펩타이드의 후보를 선정하고, 세포 독성 실험인 51Cr release assay 을 사용하여 실제적인 항암 효과를 확인해 보았다. 그림 1에서 볼 수 있었듯이, 합성된 14개의 펩타이드 중 E779 -93(LEDLLMGTLGIVCPI)와 E785 -98(GTLGIVCPICSQKP) 펩타이드가 다른 E7 펩타이드에 비해 높은 수치의 IFN-γ의 생성을 나타냄으로써 효과적인 면역성(immunogenic)을 가지고 있음을 예상할 수 있었다. In other words, in the present invention, in order to find a peptide having a higher anticancer effect than the known E7 epitope, a PBMC was supplied from a normal HLA-A * 0201 type blood donor and treated with a synthesized E7 peptide, followed by incubation for 1 week or 2 weeks, and then IFN- γ expression was measured to select candidate peptides to induce differentiation into CD8 + T cells, and the actual anti-cancer effect was confirmed using 51 Cr release assay, a cytotoxicity test. As it was shown in Figure 1, effective immunity by showing the production of IFN-γ of higher than the cost of the synthetic peptides E7 14 79 -93 (LEDLLMGTLGIVCPI) and E7 85 -98 (GTLGIVCPICSQKP) peptide other E7 peptide ( immunogenic).

유체 세포측정법을 사용하여 선별한 E779 -93(LEDLLMGTLGIVCPI)와 E785 -98(GTLGIVCPICSQKP) 에피토프이 실제로 HLA-A*0201 타입의 자궁 경부암 세포에 대해 항암효과를 나타내는 지를 확인하기 위해 51Cr release assay 기법을 이용하여 세포 사멸효과를 측정해 본 결과, E779 -93(LEDLLMGTLGIVCPI) 펩타이드를 처리한 실험군에서 CMVpp65495 -503(A02, NLVPMVATV) 펩타이드를 처리한 양성대조군보다 월등히 높은 세포 사멸효과를 나타내는 것을 알 수 있었다(그림 2). 반면, 유체 세포측정법에서 IFN-γ 의 발현 정도가 E785 -98(GTLGIVCPICSQKP) eptiope과 유사하게 나타난 E779 -93(LEDLLMGTLGIVCPI) eptiope은 세포 사멸 효과가 E785 -98(GTLGIVCPICSQKP) eptitope에 비해 다소 낮게 나타났지만 기존의 보고된 양성대조군들과 비슷한 암세포 사멸효과를 보였다 (그림 2a, 2b). 이러한 결과는 두 E7 에피토프의 아미노산 서열 차이에서 기인하는 실제 자궁 경부암 세포에 대한 면역성 유발 정도가 다르기 때문에 나타난 것으로 예상된다. 또한, 선행된 연구에서 면역효과가 밝혀진 E782 -90(LLMGTLGIV)과 E786 -93(TLGIVCPI) 펩타이드와 본 연구에서 면역효과가 나타난 E779 -93(LEDLLMGTLGIVCPI)과 E785 -98(GTLGIVCPICSQKP) 펩타이드의 세포 사멸 효과를 비교해 본 결과, E785 -98(GTLGIVCPICSQKP) 펩타이드가 가장 높은 항암효과를 나타내는 것을 확인할 수 있었다(그림 3). 51 Cr release assay technique to determine whether E7 79 -93 (LEDLLMGTLGIVCPI) and E7 85 -98 (GTLGIVCPICSQKP) epitopes screened using fluid cytometry actually have anticancer effects on HLA-A * 0201 type cervical cancer cells As a result of measuring the cell death effect, the experimental group treated with E7 79 -93 (LEDLLMGTLGIVCPI) peptide showed significantly higher cell killing effect than the positive control group treated with CMVpp65 495 -503 (A02, NLVPMVATV) peptide. (Figure 2). On the other hand, the expression level of IFN-γ in the fluid cytometry E7 85 -98 79 (GTLGIVCPICSQKP) E7 appears similar to the eptiope -93 (LEDLLMGTLGIVCPI) eptiope is rather low cell killing effect as compared to E7 85 -98 (GTLGIVCPICSQKP) eptitope Although similar to the previously reported positive controls, cancer cell death was shown (Figures 2a and 2b). This result is expected to be due to the different degree of immunity to actual cervical cancer cells due to the difference in amino acid sequence of the two E7 epitopes. In addition, E7 82 -90 (LLMGTLGIV) and E7 86 -93 (TLGIVCPI) peptides, which have been shown to be immune in the preceding studies, and E7 79 -93 (LEDLLMGTLGIVCPI) and E7 85 -98 (GTLGIVCPICSQKP) peptides, which have been shown to be immunosuppressive in this study. Comparison of the apoptosis effects of E7 85 -98 (GTLGIVCPICSQKP) peptide showed the highest anti-cancer effect (Fig. 3).

결론적으로, 유체 세포측정법과 세포 독성 실험을 통해 HPV 타입 16 E7 E779 -93(LEDLLMGTLGIVCPI)와 E785 -98(GTLGIVCPICSQKP) 펩타이드가 HLA-A*0201 타입 자궁 경부암의 백신 개발과 adoptive 면역세포치료에 필요한 세포 독성 T 림프구 생성에 효과적인 에피토프임을 규명할 수 있었다. In conclusion, HPV type 16 E7 E7 79 -93 (LEDLLMGTLGIVCPI) and E7 85 -98 (GTLGIVCPICSQKP) peptides were used to develop vaccines and adoptive immune cell therapy for HLA-A * 0201 type cervical cancer. It was found that it was an effective epitope for the production of the necessary cytotoxic T lymphocytes.

본 발명에서 알 수 있는 바와 같이 HPV 타입 16 E7 E779 -93(LEDLLMGTLGIVCPI)와 E785 -98(GTLGIVCPICSQKP) 펩타이드가 HLA-A*0201 타입 자궁 경부암의 백신 개발과 adoptive 면역세포치료에 필요한 세포 독성 T 림프구 생성에 효과적인 에피토프임을 규명할 수 있었다. As can be seen in the present invention HPV type 16 E7 E7 79 -93 (LEDLLMGTLGIVCPI) and E7 85 -98 (GTLGIVCPICSQKP) peptide is HLA-A * 0201-type vaccine development of cervical cancer and cytotoxic T required for adoptive immune therapy cell The epitope was found to be effective for lymphocyte production.

이하 비한정적인 실시예를 통하여 본 발명을 더욱 상세하게 설명한다.Hereinafter, the present invention will be described in more detail with reference to non-limiting examples.

실시예Example :1 :One 펩타이드Peptide (( peptidepeptide ) 합성) synthesis

HPV 타입 16 E7 단백질의 전체 아미노산 서열을 컴퓨터 알고리즘(computer algorithms)을이용하여 각각 15mer의 크기로 중복(overlapping)되도록 나누어 합성한 후 고성능 액체 크로마토그래피 (high performance liquid chromatography : HPLC)기기를 이용하여 순도가 95% 이상 되는 펩타이드를 최종적으로 선택하여 총 14개를 합성하였다(표 1). 이런 식으로 합성된 펩타이드는 1% DMSO PBS에 녹인 후 -20℃에 냉동 보관한 후 사용 직전에 실온에서 해동하여 사용하였다. The entire amino acid sequence of HPV type 16 E7 protein was synthesized by using computer algorithms to overlap each of 15mer in size, and then purified using a high performance liquid chromatography (HPLC) instrument. A total of 14 peptides were synthesized by finally selecting more than 95% of peptides (Table 1). Peptide synthesized in this way was dissolved in 1% DMSO PBS and stored frozen at -20 ℃ and thawed at room temperature immediately before use.

펩타이드 번호(서열번호)Peptide Number (SEQ ID NO) 아미노산 위치Amino acid position 아미노산 서열Amino acid sequence 1One 1-151-15 MHGDTPTLHEYMLDLMHGDTPTLHEYMLDL 22 7-217-21 TLHEYMLDLQPETTDTLHEYMLDLQPETTD 33 13-2713-27 LDLQPETTDLYCYEQLDLQPETTDLYCYEQ 44 19-3319-33 TTDLYCYEQLNDSSETTDLYCYEQLNDSSE 55 25-3925-39 YEQLNDSSEEEDEIDYEQLNDSSEEEDEID 66 31-4531-45 SSEEEDEIDGPAGQASSEEEDEIDGPAGQA 77 37-5137-51 EIDGPAGQAEPDRAHEIDGPAGQAEPDRAH 88 43-5743-57 GQAEPDRAHYNIVTFGQAEPDRAHYNIVTF 99 49-6349-63 RAHYNIVTFCCKCDSRAHYNIVTFCCKCDS 1010 61-7561-75 CDSTLRLCVQSTHVDCDSTLRLCVQSTHVD 1111 67-8167-81 LCVQSTHVDIRTLEDLCVQSTHVDIRTLED 1212 73-8773-87 HVDIRTLEDLLMGTLHVDIRTLEDLLMGTL 1313 79-9379-93 LEDLLMGTLGIVCPILEDLLMGTLGIVCPI 1414 85-9885-98 GTLGIVCPICSQKPGTLGIVCPICSQKP

상기 표 1은 합성된 HPV 타입 16 E7 펩타이드를 나타낸다.Table 1 shows the synthesized HPV type 16 E7 peptide.

실시예Example 2:세포의 준비 2: Preparation of Cells

연구 동의서에 서명한 HLA-A*0201 타입 혈액 공여자 (표2)의 혈액을 원심분리(centrifugation)하여 PBMC (peripheral blood mononuclear cell)를 분리한다. 간략히 설명하면, Ficoll-Hypaque 1.077를 사용하여 농도기울기(density-gradient)를 형성한 후 그 위에 증여자의 혈액을 조심스럽게 흘려 넣은 뒤 2000 rpm의 속도로 상온에서 15분간 원심분리를 실시한 후 백혈구 층(buffy coat)만을 채취하여 PBS로 2회 세척하여 실험에 사용하였다.Peripheral blood mononuclear cells (PBMCs) are isolated by centrifugation of the blood of HLA-A * 0201 type blood donors (Table 2) who signed the study agreement. Briefly, after forming a density gradient using Ficoll-Hypaque 1.077, the blood of the donor was carefully flowed thereon, followed by centrifugation at room temperature for 15 minutes at a rate of 2000 rpm, followed by a leukocyte layer ( Only buffy coat) was collected and washed twice with PBS and used for the experiment.

혈액 증여자(donor)Blood donor 성별gender HLA-AHLA-A HLA-BHLA-B HLA-CHLA-C 1One south A*0201/2402A * 0201/2402 13, 4013, 40 03, 0303, 03 22 south A*0201/3303A * 0201/3303 44, 4444, 44 03, 1403, 14 33 south A*0201/3303A * 0201/3303 44, 4444, 44 03, 1403, 14 44 south A*0201/2402A * 0201/2402 40, 4040, 40 03, 0403, 04 55 south A*0201/3001A * 0201/3001 13, 3513, 35 03, 0603, 06

표 2는 HLA-A*0201 타입 혈액 증여자를 나타낸다.Table 2 shows HLA-A * 0201 type blood donors.

실시예Example 3:  3: PBMCPBMC 로부터 자가 수지상 세포(From autologous dendritic cells ( autologousautologous dendriticdendritic cellcell )의 생성) Generation

원심분리를 통해 얻어진 PBMC를 RPMI 배양액(10% FBS, 5% antibiotics)이 들어 있는 T75 플라스크에 넣어 37℃에서 2시간 동안 배양하였다. 그 후, 부유된 세포들을 제거하고 플라스크에 고착된 단핵 세포(monocyte)에 Interleukin-4(IL-4, 1000U/ml)와 granulocyte-macrophage stimulating factor(GM-CSF, 800U/ml)를 첨가하였다. 배양 시작 후 2일, 4일째 되는 때에 IL-4(1000U/ml)와 GM-CSF(1600U/ml)을 각각 넣어 주었다. 세포의 성장에 맞춰 수시로 RPMI 배양액을 교체해 주었다. 배양 시작 후 5일째 되는 때에 tumor necrosis factor-α(TNF-α, 1000u/ml)를 첨가하였다. PBMC obtained by centrifugation was placed in a T75 flask containing RPMI culture (10% FBS, 5% antibiotics) and incubated at 37 ° C. for 2 hours. Thereafter, the suspended cells were removed and Interleukin-4 (IL-4, 1000 U / ml) and granulocyte-macrophage stimulating factor (GM-CSF, 800 U / ml) were added to the monocytes attached to the flask. IL-4 (1000U / ml) and GM-CSF (1600U / ml) were added at 2 and 4 days after incubation. RPMI culture medium was changed from time to time as the cells grow. At 5 days after the start of the culture, tumor necrosis factor-α (TNF-α, 1000u / ml) was added.

실시예Example 4:  4: 펩타이드에On peptides 특이적인  Specific polyclonalpolyclonal 세포 독성 T 세포의 생성 Generation of Cytotoxic T Cells

초저온 동결 되어 있는 HLA-A*0201 타입 혈액 증여자의 PBMC를 해동시켜 각 well당 2ml의 RPMI 배양액이 채워진 24 well 배양용기에 적정한 수의 세포를 넣어 주었다. 배양 시작 후 1일째 되는 때에 시험하고자 하는 펩타이드(10μg/ml)와 Interleukin-2(IL-2, 100U/ml)를 각 웰에 첨가해 주었다. 배양기간 중 이틀 간격으로 IL-2(1000U/ml)을 넣어주고 배양액을 교체해 주었다. 배양 시작 후 7일째 되는 때에 위에 언급한 방법으로 생성된 수지상 세포(세포 독성 T 세포수의 최소 10분의 1 이상의 세포수)와 펩타이드(20μg/ml)를 첨가해 주었다.PBMCs of cryofreezing HLA-A * 0201 type blood donors were thawed and placed in the appropriate number of cells in a 24 well culture vessel filled with 2 ml RPMI culture medium per well. At 1 day after the start of the culture, the peptide (10 μg / ml) and Interleukin-2 (IL-2, 100 U / ml) to be tested were added to each well. IL-2 (1000U / ml) was added at intervals of two days during the incubation period, and the culture medium was replaced. At 7 days after the start of the culture, the dendritic cells (at least 10/10 the number of cytotoxic T cells) and peptides (20 μg / ml) generated by the above-mentioned method were added.

실시예 5: 유체 세포측정법(flow cytometry)를 이용한 세포내 Interferon-γ(IFN-γ) 생성측정Example 5 Intracellular Interferon-γ (IFN-γ) Production Measurement Using Flow Cytometry

배양 시작 후 7일째 되는 때에 수지상 세포와 펩타이드가 첨가된 세포 독성 T 세포를 37℃에서 1시간 동안 배양하였다. 이 때, 실험군 중 한 그룹에 phytohemagglutinin(PHA, 0.25 μg/ml)을 넣어 주었다. 배양 후 10 μg의 brefeldin A(BFA)를 각각 첨가해 준 뒤, 37℃에서 5시간 동안 배양하였다. 그 후, 각각의 well에서 세포를 채취하여 PBS(phosphate-buffered saline)으로 세척해 주었다. 세척 후 1mM 농도의 EDTA가 들어 있는 PBS를 넣어 주고 37℃에서 10분간 배양하였다. 배양이 끝나면, 5% FBS가 포함된 PBS로 2회 세척해 주고, 형광표지된 항체인 perdinin-chlorophyll-protien(PerCP)-conjugated mouse anti-human CD3+항체와 phycoerythrin(PE)-conjugated mouse anti-human CD8+ 항체를 각각 1:100의 비율로 넣어 준 뒤 4℃에서 15분간 dark상태로 배양하였다. 배양 후, lysing solution과 permeabilization solution을 각각 처리해 주고, fluorescein isothiocyanate (FITC)-conjugated mouse anti-human IFN-γ 항체를 첨가해 준 뒤 4℃에서 30분간 dark상태로 배양하였다. 이 후, 5% FBS가 포함된 PBS로 2회 세척해 주고 1% formaldehyde로 고정시킨 뒤 FACS(fluorescence activated cell sorting)장비를 이용해 측정하여 분석하였다.Seven days after the start of the culture, dendritic cells and cytotoxic T cells to which the peptide was added were incubated at 37 ° C. for 1 hour. At this time, phytohemagglutinin (PHA, 0.25 μg / ml) was added to one of the experimental groups. After incubation, 10 μg of brefeldin A (BFA) was added thereto, and then incubated at 37 ° C. for 5 hours. Then, cells were collected from each well and washed with PBS (phosphate-buffered saline). After washing, put PBS containing 1 mM concentration of EDTA and incubated for 10 minutes at 37 ℃. After the incubation, the cells were washed twice with PBS containing 5% FBS. CD8 + antibodies were put in a ratio of 1: 100, respectively, and then incubated in a dark state at 4 ° C. for 15 minutes. After incubation, the lysing solution and permeabilization solution were treated, and fluorescein isothiocyanate (FITC) -conjugated mouse anti-human IFN-γ antibody was added and incubated in dark at 4 ° C for 30 minutes. Thereafter, the cells were washed twice with PBS containing 5% FBS, fixed with 1% formaldehyde, and analyzed by FACS (fluorescence activated cell sorting).

실시예Example 6: 세포 독성 실험( 6: cytotoxicity test ( cytotoxicitycytotoxicity assayassay ))

자궁 경부암 세포주를 목표 세포(target cell)로 하여 51Cr release assay를 사용하여 세포 독성 실험을 실시하였다. 간략히 설명하면, RPMI 배양액에서 배양된 HLA-A*3303 타입의 자궁 경부암 세포주에 0.1 mCi 의 Na2 51CrO4를 첨가하여 37℃에서 45분간 배양하였다. PBS로 2회 세척한 후, 적정수의 목표 세포를 세포 독성 T 세포에 다양한 비율로 넣어 주고 37℃에서 5시간 동안 배양하였다. 배양이 끝나면 1500 rpm으로 5분간 원심분리를 해주고 미리 준비한 γ-counter tube에 100μl씩 옮겨 넣었다. γ-ray counter를 이용해 측정하여 분석한다. 세포 독성 T 세포 특이적인 목표 세포 사멸의 정도는 [(experimental cpm-spontaneous cpm)/(maximum cpm-spontaneous cpm)]×100 의 공식을 이용하여 산정한다. Cytotoxicity experiments were performed using a 51 Cr release assay using cervical cancer cell lines as target cells. Briefly, 0.1 mCi Na 2 51 CrO 4 was added to HLA-A * 3303 type cervical cancer cell line cultured in RPMI culture and incubated at 37 ° C. for 45 minutes. After washing twice with PBS, an appropriate number of target cells were put in various ratios to cytotoxic T cells and incubated at 37 ° C for 5 hours. After incubation, centrifuge at 1500 rpm for 5 minutes and transfer 100μl to the prepared γ-counter tube. Measure and analyze using γ-ray counter. The extent of cytotoxic T cell specific target cell death is calculated using the formula [(experimental cpm-spontaneous cpm) / (maximum cpm-spontaneous cpm)] × 100.

상기의 실시예의 결과는 다음과 같다.The result of the above Example is as follows.

(1)유세포 분석법을 이용한 HPV 타입 16 E7 에피토프 특이적인 CD8+ 세포독성 T 림프구로부터 IFN-γ의 생성확인(1) Confirmation of production of IFN-γ from HPV type 16 E7 epitope-specific CD8 + cytotoxic T lymphocytes using flow cytometry

합성된 14개의 HPV 타입 16 E7 펩타이드 가운데 HLA-A*0201 타입 환자 특이적으로 세포 독성 T 세포 생성을 유도하는 E7 에피토프의 후보를 선정하기 위해, 혈액 증여자의 PBMC에 각각의 펩타이드를 처리해 주고 1주일 후에 배양된 IL-2(음성대조군), CMVpp65495 -503(NLVPMVATV, HLA-A*0201, 양성대조군)을 각각 처리한 대조군을 비교하여 보았다. 그림 1에서 나타났듯이, 14개의 후보 펩타이드 대부분 IL-2만을 처리한 대조군 보다 높은 IFN-γ 의 생성을 유도하였고, 음성대조군(negative control)보다 높은 수치의 IFN-γ의 생성을 보이는 펩타이드 중 E779 -93(LEDLLMGTLGIVCPI)과 E785 -98(GTLGIVCPICSQKP) 펩타이드를 처리한 실험군에서 양성대조군(positive control)과 동등하거나 더 높은 수준으로 IFN-γ의 생성수치가 나타나는 것을 알 수 있었다. 따라서, E779 -93(LEDLLMGTLGIVCPI)와 E785 -98(GTLGIVCPICSQKP) 펩타이드를 유력한 신규 HLA-A*0201 특이적 E7 에피토프으로 예측할 수 있었다.To select candidates for the E7 epitope that induces HLA-A * 0201 type-specific patient-specific cytotoxic T cell generation among 14 synthesized HPV type 16 E7 peptides, each peptide was treated with PBMCs of blood donor for 1 week. after seen by comparing the IL-2 (negative control), CMVpp65 495 -503 (control) each handle (NLVPMVATV, HLA-a * 0201 , positive control) culture. As shown in Figure 1, most of the 14 candidate peptides induced the production of IFN-γ higher than the control group treated with IL-2 only, and E7 among the peptides showing higher levels of IFN-γ production than the negative control. to 79 -93 (LEDLLMGTLGIVCPI) and E7 85 -98 (GTLGIVCPICSQKP) equal or higher level as the positive control (positive control) in the test group treated with the peptide was found to produce a level of IFN-γ appears. Therefore, it was predicted E7 79 -93 (LEDLLMGTLGIVCPI) and E7 85 -98 (GTLGIVCPICSQKP) peptides as potent novel HLA-A * 0201-specific E7 epitopes.

(2) HPV 타입 16 E7 에피토프 특이적인 CD8+ 세포독성 T 림프구의 자궁 경부암 세포 독성 실험(2) Cervical cancer cytotoxicity experiment of HPV type 16 E7 epitope specific CD8 + cytotoxic T lymphocytes

실제로 HLA-A*0201 타입 자궁 경부암 세포주에 작용하여 세포사멸을 시키는 지를 확인하기 위해 51Cr release assay 법을 이용해 분석해 보았다. 혈액 공여자의 PBMC에 IL-2, CMVpp65495 -503(NLVPMVATV, HLA-A*0201, 양성대조군), E779 -93(LEDLLMGTLGIVCPI) 그리고 E785 -98(GTLGIVCPICSQKP) 펩타이드를 각각 처리해 주고 1주일 후에 배양된 동일 환자의 수지상 세포와 함께 각각의 펩타이드를 다시 한번 처리해 준 뒤 다시 1주일간 배양 후, 51Cr이 표지된 HLA-A*0201 타입 자궁 경부암 세포주와 섞어 5시간 동안 배양하고 감마방사선 측정기를 이용하여 분석하였다. 분석한 결과를 살펴 보면, E785 -98(GTLGIVCPICSQKP) 펩타이드를 처리한 실험군의 자궁경부암세포 사멸효과가 IL-2를 처리한 음성대조군은 물론, 양성대조군인 CMVpp65495 -503(NLVPMVATV)을 처리한 것보다도 월등히 높은 수치의 세포 사멸 효과를 보였다. E779-93(LEDLLMGTLGIVCPI) 펩타이드를 처리한 실험군은 CMVpp65495 -503(NLVPMVATV)을 처리한 양성대조군에 근접한 사멸 효과 수치를 나타내었으나 E785 -98(GTLGIVCPICSQKP) 펩타이드의 효과 효과 보다는 다소 낮음을 알 수 있었다. (그림 2a, b) In order to confirm that HLA-A * 0201 type cervical cancer cell line acts on apoptosis, it was analyzed using 51 Cr release assay. PBMCs of blood donors were treated with IL-2, CMVpp65 495 -503 (NLVPMVATV, HLA-A * 0201, positive control), E7 79 -93 (LEDLLMGTLGIVCPI) and E7 85 -98 (GTLGIVCPICSQKP) peptides, and cultured one week later. Each peptide was treated with dendritic cells of the same patient once again, followed by incubation for one week, and then mixed with 51 Cr-labeled HLA-A * 0201 type cervical cancer cell line and incubated for 5 hours using a gamma radiation meter. Analyzed. The results of the analysis showed that the cervical cancer cell killing effect of the experimental group treated with the E7 85 -98 (GTLGIVCPICSQKP) peptide was treated with the positive control group CMVpp65 495 -503 (NLVPMVATV) as well as the negative control group treated with IL-2. The cell death effect was much higher than that. E7 79-93 (LEDLLMGTLGIVCPI) experimental groups treated with the peptides eoteuna indicate the close apoptotic effect levels in positive control group treated with CMVpp65 495 -503 (NLVPMVATV) E7 85 -98 (GTLGIVCPICSQKP) shows a rather low effect than the effect of the peptide there was. (Figure 2a, b)

(3) 기존에 밝혀진 HPV 타입 16 E7 에피토프과 신규 에피토프인 E779 -93(LEDLLMGTLGIVCPI)과 E785 -98(GTLGIVCPICSQKP)의 HLA-A*0201 타입 자궁 경부암 세포의 사멸 효과의 비교 측정(3) Comparative measurement of the killing effect of HLA-A * 0201 type cervical cancer cells of HPV type 16 E7 epitope and new epitopes E7 79 -93 (LEDLLMGTLGIVCPI) and E7 85 -98 (GTLGIVCPICSQKP)

다른 HPV 타입 16 E7 에피토프인 E782 -90(LLMGTLGIV;서열번호: 15)와 E786 -93(TLGIVCPI;서열번호: 16) 그리고 본 발명의 펩타이드인 E779 -93(LEDLLMGTLGIVCPI)과 E785-98(GTLGIVCPICSQKP)의 자궁 경부암 세포에 대한 직접적인 사멸 효과를 51Cr release assay 법을 이용해 비교 측정해 보았다. 혈액 증여자의 PBMC에 IL-2(음성대조군), CMVpp65495 -503(NLVPMVATV, HLA-A*0201, 양성대조군;서열번호: 17), E782 -90(LLMGTLGIV, 양성대조군), E786 -93(TLGIVCPI, 양성대조군), E779 -93(LEDLLMGTLGIVCPI) 그리고 E785 -98(GTLGIVCPICSQKP) 펩타이드를 각각 처리해 주고 1주일 후에 배양된 동일 환자의 수지상 세포와 함께 각각의 펩타이드를 다시 한번 처리해 준 뒤 1주일간 다시 배양 후, 51Cr이 표지된 HLA-A*0201 타입 자궁 경부암 세포와 5시간 동안 함께 배양한 후 감마방사선 측정기를 이용하여 분석하였다. 측정된 결과를 분석해 보면, 본 연구에서 선별한 E779 -93(LEDLLMGTLGIVCPI)와 E785 -98(GTLGIVCPICSQKP) 펩타이드가 기존에 알려진 E782 -90(LLMGTLGIV)이나 E786 -93(TLGIVCPI) 에피토프 보다 동일하거나 높은 자궁 경부암 세포 사멸 효과를 보였다. 그 중에서도 특히 E785 -98(GTLGIVCPICSQKP)가 가장 높은 암세포 사멸 효능을 가지고 있음을 확인할 수 있었다. (그림 3)Other HPV type 16 E7 epitopes E7 82 -90 (LLMGTLGIV; SEQ ID NO: 15) and E7 86 -93 (TLGIVCPI; SEQ ID NO: 16) and the peptides of the present invention E7 79 -93 (LEDLLMGTLGIVCPI) and E7 85-98 The direct killing effect of (GTLGIVCPICSQKP) on cervical cancer cells was compared using a 51 Cr release assay. IL-2 (negative control), CMVpp65 495 -503 (NLVPMVATV, HLA-A * 0201, positive control; SEQ ID NO: 17), E7 82 -90 (LLMGTLGIV, positive control), E7 86 -93 (TLGIVCPI, positive control), E7 79 -93 (LEDLLMGTLGIVCPI) and E7 85 -98 (GTLGIVCPICSQKP) peptides were treated separately and each peptide was again treated with dendritic cells of the same patient cultured one week later for one week. After incubation, the cells were incubated with 51 Cr labeled HLA-A * 0201 type cervical cancer cells for 5 hours and analyzed using a gamma radiation meter. Analysis of the measured results showed that the E7 79 -93 (LEDLLMGTLGIVCPI) and E7 85 -98 (GTLGIVCPICSQKP) peptides selected in this study were the same as the known E7 82 -90 (LLMGTLGIV) or E7 86 -93 (TLGIVCPI) epitopes. Or showed high cervical cancer cell killing effect. Among them, E7 85 -98 (GTLGIVCPICSQKP) was found to have the highest cancer cell killing effect. (Figure 3)

도 1은 유체 세포측정법을 이용한 HPV type 16 E7 후보 에피토프에 의해 유도되는 HLA-A*0201 type 특이적인 CD8+ T 세포내의 IFN-γ 발현 정도의 측정. 1 is a measure of the degree of IFN-γ expression in HLA-A * 0201 type specific CD8 + T cells induced by HPV type 16 E7 candidate epitopes using fluid cytometry.

도 1a는 HLA-A*0201/2401 타입의 환자로부터 추출한 말초혈액 단핵구를 HPV type 16 E7 후보 펩타이드들과 음성 및 양성 대조군 펩타이드로 자극한 후 유도되는 HLA-A*0201 타입 특이적인 CD8+ T 세포내의 IFN-γ 발현 정도의 측정한 것임. IL-2(음성대조군), A02; CMVpp65495-493 (HLA-A*0201, NLVPMVATV, 양성대조군), A24; CMVpp65328-336(HLA-A*2402, QYDPVAALF, 양성대조군), A33; CMVpp6591-100(HLA-A*3303, SVNVHNPTGR, 음성대조군),FIG. 1A shows that HLA-A * 0201 type specific CD8 + T cells induced after stimulation of peripheral blood monocytes extracted from HLA-A * 0201/2401 type patients with HPV type 16 E7 candidate peptides and negative and positive control peptides. It is a measure of the degree of IFN-γ expression. IL-2 (negative control), A02; CMVpp65 495-493 (HLA-A * 0201, NLVPMVATV, positive control), A24; CMVpp65 328-336 (HLA-A * 2402, QYDPVAALF, positive control), A33; CMVpp65 91-100 (HLA-A * 3303, SVNVHNPTGR, Negative Control),

도 1b는 HLA-A*0201/3303 타입의 환자로부터 추출한 말초혈액 단핵구를 HPV type 16 E7 후보 펩타이드들과 음성 및 양성 대조군 펩타이드로 자극한 후 유도되는 HLA-A*3303 타입 특이적인 CD8+ T 세포내의 IFN-γ 발현 정도의 측정한 것임. IL-2(음성대조군), A02; CMVpp65495-493 (HLA-A*0201, NLVPMVATV, 양성대조군), A24; CMVpp65328-336(HLA-A*2402, QYDPVAALF, 음성대조군), A33; CMVpp6591-100(HLA-A*3303, SVNVHNPTGR, 양성대조군).FIG. 1B shows HLA-A * 0203 type specific CD8 + T cells induced after stimulation of peripheral blood monocytes extracted from HLA-A * 0201/3303 type patients with HPV type 16 E7 candidate peptides and negative and positive control peptides. It is a measure of the degree of IFN-γ expression. IL-2 (negative control), A02; CMVpp65 495-493 (HLA-A * 0201, NLVPMVATV, positive control), A24; CMVpp65 328-336 (HLA-A * 2402, QYDPVAALF, negative control), A33; CMVpp65 91-100 (HLA-A * 3303, SVNVHNPTGR, positive control).

도 2는 51Cr release assay 기법을 이용한 HPV type 16 E779 -93(LEDLLMGTLGIVCPI)과 E785 -98(GTLGIVCPICSQKP) 에피토프 특이 CD8+ 세포독성 T 림프구에 의한 HLA-A*0201 type 자궁 경부암 세포의 사멸 효과의 측정한 것임.Figure 2 shows the killing effect of HLA-A * 0201 type cervical cancer cells by HPV type 16 E7 79 -93 (LEDLLMGTLGIVCPI) and E7 85 -98 (GTLGIVCPICSQKP) epitope specific CD8 + cytotoxic T lymphocytes using 51 Cr release assay technique. It is measured.

도 2a는 HLA-A*0201/3303 타입의 환자로부터 추출한 말초혈액 단핵구를 HPV type 16 E7 후보 펩타이드들과 음성 및 양성 대조군 펩타이드로 자극한 후 측정한 HLA-A*0201 타입 자궁 경부암 세포의 사멸 효과임. IL-2(음성대조군), A02; CMVpp65495-493 (HLA-A*0201, NLVPMVATV, 양성대조군), 2a shows the killing effect of HLA-A * 0201 type cervical cancer cells measured after stimulation of peripheral blood monocytes extracted from HLA-A * 0201/3303 type patients with HPV type 16 E7 candidate peptides and negative and positive control peptides. being. IL-2 (negative control), A02; CMVpp65 495-493 (HLA-A * 0201, NLVPMVATV, positive control),

도 2b는 HLA-A*0201/2402 타입의 환자로부터 추출한 말초혈액 단핵구를 HPV type 16 E7 후보 펩타이드들과 음성 및 양성 대조군 펩타이드로 자극한 후 측정한 HLA-A*0201 타입 자궁 경부암 세포의 사멸 효과임. IL-2(음성대조군), A02; CMVpp65495-493 (HLA-A*0201, NLVPMVATV, 양성대조군).Figure 2b shows the killing effect of HLA-A * 0201 type cervical cancer cells measured after stimulating peripheral blood monocytes extracted from HLA-A * 0201/2402 type patients with HPV type 16 E7 candidate peptides and negative and positive control peptides. being. IL-2 (negative control), A02; CMVpp65 495-493 (HLA-A * 0201, NLVPMVATV, positive control).

도 3은 51Cr release assay 기법을 이용한 기존에 밝혀진 HPV type 16 E782 -90(LLMGTLGIV), E786 -93(TLGIVCPI) 에피토프와 신규 E779 -93(LEDLLMGTLGIVCPI), E785 -98(GTLGIVCPICSQKP) 간의 HLA-A*0201 type 자궁 경부암 세포의 사멸 효과의 비교 측정.Figure 3 shows the existing HPV type 16 E7 82 -90 (LLMGTLGIV), E7 86 -93 (TLGIVCPI) epitope and new E7 79 -93 (LEDLLMGTLGIVCPI), E7 85 -98 (GTLGIVCPICSQKP) using a 51 Cr release assay technique. Comparative measurement of the killing effect of HLA-A * 0201 type cervical cancer cells.

<110> BIOCORE CO.,LTD. <120> Immunogenic Peptide and Composition for preventing or treating HPV-related diseases <160> 20 <170> KopatentIn 1.71 <210> 1 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 1 Met His Gly Asp Thr Pro Thr Leu His Glu Tyr Met Leu Asp Leu 1 5 10 15 <210> 2 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 2 Thr Leu His Glu Tyr Met Leu Asp Leu Gln Pro Glu Thr Thr Asp 1 5 10 15 <210> 3 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 3 Leu Asp Leu Gln Pro Glu Thr Thr Asp Leu Tyr Cys Tyr Glu Gln 1 5 10 15 <210> 4 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 4 Thr Thr Asp Leu Tyr Cys Tyr Glu Gln Leu Asn Asp Ser Ser Glu 1 5 10 15 <210> 5 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 5 Tyr Glu Gln Leu Asn Asp Ser Ser Glu Glu Glu Asp Glu Ile Asp 1 5 10 15 <210> 6 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 6 Ser Ser Glu Glu Glu Asp Glu Ile Asp Gly Pro Ala Gly Gln Ala 1 5 10 15 <210> 7 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 7 Glu Ile Asp Gly Pro Ala Gly Gln Ala Glu Pro Asp Arg Ala His 1 5 10 15 <210> 8 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 8 Gly Gln Ala Glu Pro Asp Arg Ala His Tyr Asn Ile Val Thr Phe 1 5 10 15 <210> 9 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 9 Arg Ala His Tyr Asn Ile Val Thr Phe Cys Cys Lys Cys Asp Ser 1 5 10 15 <210> 10 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 10 Cys Asp Ser Thr Leu Arg Leu Cys Val Gln Ser Thr His Val Asp 1 5 10 15 <210> 11 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 11 Leu Cys Val Gln Ser Thr His Val Asp Ile Arg Thr Leu Glu Asp 1 5 10 15 <210> 12 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 12 His Val Asp Ile Arg Thr Leu Glu Asp Leu Leu Met Gly Thr Leu 1 5 10 15 <210> 13 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 13 Leu Glu Asp Leu Leu Met Gly Thr Leu Gly Ile Val Cys Pro Ile 1 5 10 15 <210> 14 <211> 14 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 14 Gly Thr Leu Gly Ile Val Cys Pro Ile Cys Ser Gln Lys Pro 1 5 10 <210> 15 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> Positive control <400> 15 Leu Leu Met Gly Thr Leu Gly Ile Val 1 5 <210> 16 <211> 8 <212> PRT <213> Artificial Sequence <220> <223> Positive control <400> 16 Thr Leu Gly Ile Val Cys Pro Ile 1 5 <210> 17 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> Positive control <400> 17 Asn Leu Val Pro Met Val Ala Thr Val 1 5 <210> 18 <211> 45 <212> DNA <213> Artificial Sequence <220> <223> Nucleic acid <400> 18 ttggaagacc tgttaatggg cacactagga attgtgtgcc ccatc 45 <210> 19 <211> 42 <212> DNA <213> Artificial Sequence <220> <223> Nucleic acid <400> 19 ggcacactag gaattgtgtg ccccatctgt tctcagaaac ca 42 <210> 20 <211> 25 <212> PRT <213> Artificial Sequence <220> <223> Signal sequence <400> 20 Met Ala Ile Ser Gly Val Pro Val Leu Gly Phe Phe Ile Ile Ala Val 1 5 10 15 Leu Met Ser Ala Gln Glu Ser Trp Ala 20 25 <110> BIOCORE CO., LTD. <120> Immunogenic Peptide and Composition for preventing or treating          HPV-related diseases <160> 20 <170> KopatentIn 1.71 <210> 1 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 1 Met His Gly Asp Thr Pro Thr Leu His Glu Tyr Met Leu Asp Leu   1 5 10 15 <210> 2 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 2 Thr Leu His Glu Tyr Met Leu Asp Leu Gln Pro Glu Thr Thr Asp   1 5 10 15 <210> 3 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 3 Leu Asp Leu Gln Pro Glu Thr Thr Asp Leu Tyr Cys Tyr Glu Gln   1 5 10 15 <210> 4 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 4 Thr Thr Asp Leu Tyr Cys Tyr Glu Gln Leu Asn Asp Ser Ser Glu   1 5 10 15 <210> 5 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 5 Tyr Glu Gln Leu Asn Asp Ser Ser Glu Glu Glu Asp Glu Ile Asp   1 5 10 15 <210> 6 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 6 Ser Ser Glu Glu Glu Asp Glu Ile Asp Gly Pro Ala Gly Gln Ala   1 5 10 15 <210> 7 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 7 Glu Ile Asp Gly Pro Ala Gly Gln Ala Glu Pro Asp Arg Ala His   1 5 10 15 <210> 8 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 8 Gly Gln Ala Glu Pro Asp Arg Ala His Tyr Asn Ile Val Thr Phe   1 5 10 15 <210> 9 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 9 Arg Ala His Tyr Asn Ile Val Thr Phe Cys Cys Lys Cys Asp Ser   1 5 10 15 <210> 10 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 10 Cys Asp Ser Thr Leu Arg Leu Cys Val Gln Ser Thr His Val Asp   1 5 10 15 <210> 11 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 11 Leu Cys Val Gln Ser Thr His Val Asp Ile Arg Thr Leu Glu Asp   1 5 10 15 <210> 12 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 12 His Val Asp Ile Arg Thr Leu Glu Asp Leu Leu Met Gly Thr Leu   1 5 10 15 <210> 13 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 13 Leu Glu Asp Leu Leu Met Gly Thr Leu Gly Ile Val Cys Pro Ile   1 5 10 15 <210> 14 <211> 14 <212> PRT <213> Artificial Sequence <220> <223> Peptide <400> 14 Gly Thr Leu Gly Ile Val Cys Pro Ile Cys Ser Gln Lys Pro   1 5 10 <210> 15 <211> 9 <212> PRT <213> Artificial Sequence <220> Positive control <400> 15 Leu Leu Met Gly Thr Leu Gly Ile Val   1 5 <210> 16 <211> 8 <212> PRT <213> Artificial Sequence <220> Positive control <400> 16 Thr Leu Gly Ile Val Cys Pro Ile   1 5 <210> 17 <211> 9 <212> PRT <213> Artificial Sequence <220> Positive control <400> 17 Asn Leu Val Pro Met Val Ala Thr Val   1 5 <210> 18 <211> 45 <212> DNA <213> Artificial Sequence <220> <223> Nucleic acid <400> 18 ttggaagacc tgttaatggg cacactagga attgtgtgcc ccatc 45 <210> 19 <211> 42 <212> DNA <213> Artificial Sequence <220> <223> Nucleic acid <400> 19 ggcacactag gaattgtgtg ccccatctgt tctcagaaac ca 42 <210> 20 <211> 25 <212> PRT <213> Artificial Sequence <220> <223> Signal sequence <400> 20 Met Ala Ile Ser Gly Val Pro Val Leu Gly Phe Phe Ile Ile Ala Val   1 5 10 15 Leu Met Ser Ala Gln Glu Ser Trp Ala              20 25  

Claims (8)

서열번호 13의 LEDLLMGTLGIVCPI 또는 서열번호 14의 GTLGIVCPICSQKP 아미노산 서열을 함유하는 펩타이드.A peptide containing the LEDLLMGTLGIVCPI of SEQ ID NO: 13 or the GTLGIVCPICSQKP amino acid sequence of SEQ ID NO: 14. 제 1항의 서열번호 13의 펩타이드 또는 서열번호 14의 펩타이드를 각각 코딩하는 핵산.A nucleic acid encoding each of the peptide of SEQ ID NO: 13 or the peptide of SEQ ID NO: 14. 제 2항에 있어서, 상기 핵산 서열은 서열번호 13의 펩타이드에 대해서는 서열번호 18이고 서열번호 14의 펩타이드에 대해서는 서열번호 19인 것을 특징으로 하는 핵산.The nucleic acid according to claim 2, wherein the nucleic acid sequence is SEQ ID NO: 18 for the peptide of SEQ ID NO: 13 and SEQ ID NO: 19 for the peptide of SEQ ID NO: 14. (a)제1항의 펩타이드 및 (b)약학적으로 수용가능한 담체를 포함하는 HPV 감염 관련 질환의 예방 또는 치료용 조성물.A composition for preventing or treating a disease associated with HPV infection, comprising (a) the peptide of claim 1 and (b) a pharmaceutically acceptable carrier. 제 4항에 있어서, 상기의 HPV 감염 관련 질환은 보웬성 구진(bowenoid papulosis), 항문 이형성(anal dysplasia), 호흡기 또는 결막 유두종, 자궁 경부 이형성증, 자궁경부암, 외음암(vulval cancer), 또는 전립선암인 것을 특징으로 하는 조성물.The method of claim 4, wherein the HPV infection-related disease is bowenoid papulosis, anal dysplasia, respiratory or conjunctival papilloma, cervical dysplasia, cervical cancer, vulval cancer, or prostate cancer. The composition characterized in that the. 제1항의 펩타이드를 유효성분으로 포함하는 미세입자, 리포좀, 또는 면역 자극 복합체(ISCOM).Microparticles, liposomes, or immune stimulating complex (ISCOM) comprising the peptide of claim 1 as an active ingredient. 제2항 또는 제3항 중 어느 한 항의 핵산을 유효성분으로 포함하는 미세입자, 리포좀, 또는 면역 자극 복합체(ISCOM).Microparticles, liposomes, or immune stimulating complexes (ISCOM) comprising the nucleic acid of any one of claims 2 or 3 as an active ingredient. 제 4항 또는 제5항에 있어서, 상기의 조성물은 HLA-A*0201 타입 환자 특이적인 것을 특징으로 하는 조성물.6. A composition according to claim 4 or 5, wherein said composition is HLA-A * 0201 type patient specific.
KR1020080051833A 2008-06-02 2008-06-02 Immunogenic peptide and composition for preventing or treating hpv-related diseases KR20090125629A (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
KR1020080051833A KR20090125629A (en) 2008-06-02 2008-06-02 Immunogenic peptide and composition for preventing or treating hpv-related diseases
PCT/KR2009/002713 WO2009148229A2 (en) 2008-06-02 2009-05-22 Immunogenic peptide and composition containing the peptide for preventing or treating hpv-related diseases

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
KR1020080051833A KR20090125629A (en) 2008-06-02 2008-06-02 Immunogenic peptide and composition for preventing or treating hpv-related diseases

Publications (1)

Publication Number Publication Date
KR20090125629A true KR20090125629A (en) 2009-12-07

Family

ID=41398643

Family Applications (1)

Application Number Title Priority Date Filing Date
KR1020080051833A KR20090125629A (en) 2008-06-02 2008-06-02 Immunogenic peptide and composition for preventing or treating hpv-related diseases

Country Status (2)

Country Link
KR (1) KR20090125629A (en)
WO (1) WO2009148229A2 (en)

Families Citing this family (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN117018170A (en) 2016-06-20 2023-11-10 Isa制药有限公司 Peptide vaccine formulations
MX2019003768A (en) 2016-10-03 2019-06-24 Juno Therapeutics Inc Hpv-specific binding molecules.
US11311613B2 (en) 2016-11-07 2022-04-26 The United States of Americans represented by the Secretary, Department of Health and Human Services Development of agonist epitopes of the human papillomavirus
MX2020003536A (en) 2017-10-03 2020-09-14 Juno Therapeutics Inc Hpv-specific binding molecules.
MA52193A (en) 2018-04-05 2021-02-17 Juno Therapeutics Inc T-LYMPHOCYTE RECEPTORS AND MODIFIED CELLS EXPRESSING THEM

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1578432A4 (en) * 2002-10-03 2008-07-30 Epimmune Inc Hla binding peptides and their uses
KR20090103571A (en) * 2008-03-28 2009-10-01 바이오코아 주식회사 Immunogenic Peptide and Composition for preventing or treating HPV-related diseases

Also Published As

Publication number Publication date
WO2009148229A3 (en) 2010-03-04
WO2009148229A2 (en) 2009-12-10

Similar Documents

Publication Publication Date Title
CA2305683C (en) Immunogenic peptides from the hpv e7 protein
KR102190890B1 (en) Method for activating T cells to treat cancer
US20010006639A1 (en) Immunogenic peptides from the HPV E7 protein
US20100266611A1 (en) Enhancement of Immune Responses By 4-1BB-Binding Agents
KR20190071689A (en) Generation of HPV-specific T-cells
CA2496384C (en) Lectin compositions and methods for modulating an immune response to an antigen
KR20090125629A (en) Immunogenic peptide and composition for preventing or treating hpv-related diseases
JPH10505339A (en) Live vaccines for the treatment of tumor diseases
Li et al. Local mucosal immunization of self-assembled nanofibers elicits robust antitumor effects in an orthotopic model of mouse genital tumors
KR20090103571A (en) Immunogenic Peptide and Composition for preventing or treating HPV-related diseases
EP0770624B1 (en) Peptide capable of inducing immune response to human gastric cancer and agent containing it for preventing or treating human gastric cancer
WO2017177907A1 (en) Anti-immune checkpoint pd-l1 and pd-l2 tumor vaccines
KR101415554B1 (en) Immunogenic Peptide and Composition for preventing or treating HPV-related diseases
KR20090125628A (en) Immunogenic peptide and composition for preventing or treating hpv-related diseases
Lin et al. The efficacy of a novel vaccine approach using tumor cells that ectopically express a codon-optimized murine GM-CSF in a murine tumor model
Freyschmidt et al. Activation of dendritic cells and induction of T cell responses by HPV 16 L1/E7 chimeric virus-like particles are enhanced by CpG ODN or sorbitol
CN115286690B (en) Use of antigen short peptide for screening medicine for treating HPV related diseases and screened TCR thereof
CN114949189A (en) Application of nano tumor specific antigen and ICD (acute transient adhesion) -generated tumor cell combination in preparation of therapeutic tumor vaccine
Gérard et al. Recombinant human papillomavirus type 16 E7 protein as a model antigen to study the vaccine potential in control and E7 transgenic mice
CN103288931A (en) Immunogenic polypeptides for human papillomavirus as well as preparation method and application of same
JP2003519240A (en) How to transfer proteins
WO2019144607A1 (en) Multi-epitope combinatorial peptide for treating and/or preventing human papillomavirus-related disease and use thereof
CN113597430A (en) Methods of activating T cells for cancer treatment
CN110639013A (en) HPV nano vaccine composition with IL-33 as adjuvant and preparation method thereof
JPWO2005011723A1 (en) Preventive and / or therapeutic agent for hematopoietic tumor

Legal Events

Date Code Title Description
WITN Application deemed withdrawn, e.g. because no request for examination was filed or no examination fee was paid