KR20000020688A - Novel 2,5-diketo-d-gluconate reductase gene and production of 2-keto-l-glonate using the same - Google Patents

Novel 2,5-diketo-d-gluconate reductase gene and production of 2-keto-l-glonate using the same Download PDF

Info

Publication number
KR20000020688A
KR20000020688A KR1019980039405A KR19980039405A KR20000020688A KR 20000020688 A KR20000020688 A KR 20000020688A KR 1019980039405 A KR1019980039405 A KR 1019980039405A KR 19980039405 A KR19980039405 A KR 19980039405A KR 20000020688 A KR20000020688 A KR 20000020688A
Authority
KR
South Korea
Prior art keywords
gluconate
keto
diketo
reductase
gene
Prior art date
Application number
KR1019980039405A
Other languages
Korean (ko)
Other versions
KR100320370B1 (en
Inventor
염도영
이봉용
함대현
반재구
Original Assignee
박호군
한국과학기술연구원
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 박호군, 한국과학기술연구원 filed Critical 박호군
Priority to KR1019980039405A priority Critical patent/KR100320370B1/en
Publication of KR20000020688A publication Critical patent/KR20000020688A/en
Application granted granted Critical
Publication of KR100320370B1 publication Critical patent/KR100320370B1/en

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/0004—Oxidoreductases (1.)
    • C12N9/0012—Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.6, 1.7)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/70—Vectors or expression systems specially adapted for E. coli

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Molecular Biology (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Biochemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Enzymes And Modification Thereof (AREA)

Abstract

PURPOSE: A yafB gene that is a gene for 2-keto-D-gluconate producing 2,5-diketo-D-gluconate reductase is defected to prevent metabolism of 2,5-diketo-D-gluconate produced as an intermediate product in the production of 2-keto-L-glonate by transformation in E. coli, thereby production yield of 2-keto-L-glonate as a precursor of vitamin C is enhanced. CONSTITUTION: The yafB gene codes the 2,5-diketo-gluconate reductase gene for production of 2-keto-D-gluconate, which is originated from E. coli. The yafB gene is inserted into a recombinant plasmid pYAFB. The recombinant plasmid pYAFB with the yafB gene inserted thereinto is transformed in a coliform DH5alpha/pYAFB (KCTC 0509BP). In the production of 2-keto-L-glonate as a precursor of vitamin C from gluconate by glucose metabolism, the 2,5-diketo-D-gluconate reductive defective gene is introduced to a host cell to express a glucose reductive in a membrane-bound recombinant strain.

Description

신규한 2,5-다이케토-디-글루코네이트 환원효소 유전자 및 이를 이용한 2-케토-엘-글로네이트 생산Novel 2,5-diketo-di-gluconate reductase gene and 2-keto-el-glonate production using the same

본 발명은 신규한 대장균 유래의 2,5-다이케토-디-글루코네이트 환원 효소(2,5-diketo-D-gluconate reductase(DG)) 유전자 염기서열 및 이를 이용한 2-케토-엘-글로네이트의 생산에 관한 것이다. 더욱 상세하게는, 신규한 대장균 유래 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글로코네이트 환원효소의 유전자 조작에 의한 효율적인 2-케토-엘-글로네이트의 생물전환에 관한 것이다.The present invention provides a novel 2,5-diketo-D-gluconate reductase (DG) gene sequence derived from E. coli and 2-keto-L-glo using the same. Relates to the production of nates. More specifically, bioconversion of efficient 2-keto-el-glonate by genetic engineering of a novel E. coli-derived 2-keto-di-gluconate production 2,5-diketo-di-gloconate reductase It is about.

생물전환공정을 이용한 비타민 C 전구체인 2-케토-엘-글로네이트(2-keto-L-2-keto-L-Glonate, a vitamin C precursor using bioconversion process

gulonate)의 미생물에 의한 생물전환공정 경로는 포도당으로부터 글루코네이트(gluconate), 2-케토-디-글루코네이트 (2-keto-D-gluconate)를 거쳐 2,5-다이케토-디-글루코네이트 (2,5-diketo-D-gluconate)를 생산한 후 2-케토-엘-글로네이트로 전환하는 포도당 경로이다. 이 경로는 최근에서야 상업적인 시험생산에 들어갔을 뿐 관련정보는 일본의 시오노기(Shionogi)사와 겐넨테크(Genentech)사의 연구에 국한되어 있다. 이 연구는 원료가격이 솔비톨(sorbitol)에 비해 40% 수준이기 때문에 80년대 초 처음으로 재조합균주에 의한 1단계 생산에 대한 연구가 시작된 이래 지속적인 연구가 수행되고 있다. 포도당 경로의 생리 대사적인 측면을 관찰해 보면 포도당은 막결합 포도당 탈수소효소 (glucose dehydrogenase)에 의하여 페리프라즘 (periplasm)에서 산화되어 글루코네이트로 전환되고 다시 막결합 글루코네이트, 2-케토-디-글루코네이트 탈수소효소에 의하여 2,5-다이케토-디-글루코네이트로 전환된다. 이들 탈수소화 반응에 관여하는 효소들은 모두 막결합 효소로 알려져 있어 배지중의 포도당으로부터 2,5-다이케토-디-글루코네이트까지의 효소반응이 페리프라즘 (periplasm)에서 진행되므로 2,5-다이케토-디-글루코네이트가 높은 수율로 생산된다(Matsushita 등, Adv. Microb. Physiol., 26, 247-301, 1994). 이들 효소들의 조효소인 막결합 포도당 탈수소효소는 PQQ-의존성이고 글루코네이트, 2-케토-디-글루코네이트 탈수소효소는 FAD-의존성인 것으로 알려져 있다. 포도당으로부터 3단계의 탈수소 반응을 통하여 전환된 2,5-다이케토-디-글루코네이트는 세포질 2,5-다이케토-디-글루코네이트 환원효소를 통하여 2-케토-엘-글로네이트로 환원되어야 한다. 그러나 현재까지 2,5-다이케토-디-글루코네이트를 생산하는 미생물들은 2,5-다이케토-디-글루코네이트 환원효소 활성을 가지고 있지 않는 것으로 알려져 있으므로 이들 활성을 갖는 미생물을 이용하여 2-케토-엘-글로네이트로 전환시켜 주어야 한다. 이 경로가 2-케토-엘-글로네이트 생산에 이용될 수 있는 가능성은 1982년 소노야마(Sonoyama)가 코리네박테리아를 이용하여 2,5-다이케토-디-글루코네이트로부터 2-케토-엘-글로네이트를 생산하므로써 확인되었는데(Sonoyama 등, Appl. Environ. Microbiol., 43, 1064-1069, 1982; Sonoyama등, US patent 3,998,697), 이후 2,5-다이케토-디-글루코네이트를 2-케토-엘-글로네이트로 전환할 수 있는 다수의 미생물이 알려지게 되었다(Sonoyama 등, JP 4,543,331). 현재까지 알려진 2,5-다이케토-디-글루코네이트 환원효소는 NADPH-의존성으로 알려져 있다. 실제로 초산발효에 이용되고 있는 대부분의 초산균과 어위니아(Erwinia), 슈도모나스 (Pseudomonas) 등 다양한 미생물이 포도당으로부터 2,5-다이케토-디-글루코네이트를 생산할 수 있는 것으로 알려져 있으나 2,5-다이케토-디-글루코네이트 환원효소 활성을 가지고 있지 않기 때문에 2,5-다이케토-디-글루코네이트를 2-케토-엘-글로네이트로 전환할 수 있는 미생물의 확보가 포도당 경로를 통한 2-케토-엘-글로네이트 생산의 중요 관건이 된다(Sonoyama 등, Agric. Biol. Chem., 51, 2003-2004, 1987).bioconversion process by microorganisms of gulonate) from glucose to gluconate, 2-keto-D-gluconate and 2,5-diketo-di-gluconate Glucose pathway that produces (2,5-diketo-D-gluconate) and then converts to 2-keto-el-glonate. This route has only recently entered commercial pilot production, but the information is limited to the research of Shionogi and Genentech in Japan. Since the raw material price is 40% of sorbitol, the research has been conducted since the beginning of the first stage production by recombinant strains in the early 80s. Observing the physiological and metabolic aspects of the glucose pathway, glucose is oxidized in periplasm by glucose dehydrogenase to be converted into gluconate and then membrane-bound gluconate, 2-keto-di- Converted to 2,5-diketo-di-gluconate by gluconate dehydrogenase. All of the enzymes involved in these dehydrogenation reactions are known as membrane-bound enzymes. As the enzyme reaction from glucose in the medium to 2,5-diketo-di-gluconate proceeds in the periplasm, 2,5 -Diketo-di-gluconate is produced in high yield (Matsushita et al., Adv. Microb. Physiol., 26, 247-301, 1994). Membrane-bound glucose dehydrogenase, a coenzyme of these enzymes, is known to be PQQ-dependent and gluconate, 2-keto-di-gluconate dehydrogenase, is FAD-dependent. 2,5-diketo-di-gluconate converted from glucose through three stages of dehydrogenation was converted to 2-keto-el-glonate via cytoplasmic 2,5-diketo-di-gluconate reductase Must be reduced. However, until now, microorganisms producing 2,5-diketo-di-gluconate are known to have no 2,5-diketo-di-gluconate reductase activity. Conversion to 2-keto-L-glonate. The possibility that this pathway could be used for the production of 2-keto-L-glonate is described by Sonoyama in 1982 from 2-keto- from 2,5-diketo-di-gluconate using Corynebacteria. It was confirmed by producing L-glonate (Sonoyama et al., Appl. Environ. Microbiol., 43, 1064-1069, 1982; Sonoyama et al., US patent 3,998,697), followed by 2,5-diketo-di-gluconate. A number of microorganisms that can convert to 2-keto-el-glonate have been known (Sonoyama et al., JP 4,543,331). The 2,5-diketo-di-gluconate reductases known to date are known to be NADPH-dependent. In fact, most of the acetic acid bacteria used for acetic acid fermentation and various microorganisms such as Erwinia and Pseudomonas are known to produce 2,5-diketo-di-gluconate from glucose, but 2,5- Since it does not have a diketo-di-gluconate reductase activity, the acquisition of microorganisms capable of converting 2,5-diketo-di-gluconate to 2-keto-el-glonate is achieved through the glucose pathway. It is an important key for the production of 2-keto-L-glonate (Sonoyama et al., Agric. Biol. Chem., 51, 2003-2004, 1987).

1982년 소노야마(Sonoyama) 등은 어위니아속(Erwinia sp.)에서 2,5-다이케토-디-글루코네이트를 생산하고 코리네박테리아속 미생물의 변이주를 이용하여 2-케토-엘-글로네이트로 전환하는 2단계 생물전환공정을 확립하여 전체 발효 100시간 동안 약 85%의 수율로 106g/L의 2-케토-엘-글로네이트를 얻을 수 있다고 보고하였다(Sonoyama 등, Appl. Environ. Microbiol., 43, 1064-1069). 이들은 어위니아속 미생물과 코리네박테리아속 미생물의 혼합배양에 의한 공정과 새로운 2,5-다이케토-디-글루코네이트 생산균 탐색에 관한 연구를 하였다. 대부분의 2,5-다이케토-디-글루코네이트 생산균주와 2-케토-엘-글로네이트 전환균주들은 2,5-다이케토-디-글루코네이트의 대사능이 높고 생산된 2-케토-엘-글로네이트를 아이도네이트 (idonate)로 환원하여 다시 대사시킬 수 있기 때문에 이에 관련된 효소활성이 변이된 새로운 균주의 육종이 필요한 것으로 보고되고 있다. 1987년 소노야마(Sonoyama) 등은 코리네박테리아속 미생물을 이용하여 2,5-다이케토-디-글루코네이트를 2-케토-엘-글로네이트로 전환할 때 2-케토-엘-글로네이트의 광학적 이성질체인 2-케토-디-글루코네이트가 함께 축적되는 것을 해결하기 위하여 코리네박테리아속 미생물의 2,5-다이케토-디-글루코네이트의 대사경로를 분석하였다(Sonoyama 등, Agric. Biol. Chem., 51, 3039-3047, 1987). 이들의 결과에 따르면 2,5-다이케토-디-글루코네이트를 2-케토-엘-글로네이트로 전환할 때 발생될 수 있는 문제는 2,5-다이케토-디-글루코네이트가 2-케토알도네이트 환원효소(2-ketoaldonate reductase)와 2,5-다이케토-디-글루코네이트 환원효소의 작용을 받아 2-케토-디-글루코네이트와 2-케토-엘-글로네이트로 동시에 전환된다는 것이다. 또한 2,5-다이케토-디-글루코네이트로부터 전환된 2-케토-엘-글로네이트는 2-케토알도네이트 환원효소에 의하여 아이도네이트로 전환된 후 5-케토-디-글루코네이트(5KDG)를 거쳐 5-케토-디-글루코네이트 환원효소에 의해 글루코네이트로 전환, 대사될 수 있음이 확인되었다. 이러한 문제해결을 위하여 2-케토알도네이트 환원효소와 5-케토-디-글루코네이트 환원효소의 활성을 잃어버린 돌연 변이주를 유도하여 2,5-다이케토-디-글루코네이트로부터 2-케토-디-글루코네이트의 축적없이 2-케토-엘-글로네이트를 생산하는 변이주를 얻어 90.5 mole% 수율을 얻었으나 부산물인 아이도네이트의 생성은 막을 수 없었다.In 1982, Sonoyama et al. Produced 2,5-diketo-di-gluconate in Erwinia sp. And mutated 2-keto-el-glo using strains of Corynebacterial microorganisms. It was reported that a two-step bioconversion process to convert to Nate could yield 106 g / L 2-keto-L-glonate at a yield of about 85% for 100 hours of total fermentation (Sonoyama et al., Appl. Environ.Microbiol , 43, 1064-1069). They studied the process of mixed culture of Eurnia microorganisms and Corynebacteria microorganisms and searched for new 2,5-diketo-di-gluconate producing bacteria. Most 2,5-diketo-di-gluconate producing strains and 2-keto-el-glonate converting strains have high metabolism of 2,5-diketo-di-gluconate and produced 2-keto- Since el-glonate can be reduced and metabolized again by idonate, it is reported that breeding of a new strain having a related variation in enzymatic activity is required. In 1987, Sonoyama et al. Described 2-keto-l-glonate when converting 2,5-diketo-di-gluconate to 2-keto-l-glonate using a Corynebacterial microorganism. Metabolic pathways of 2,5-diketo-di-gluconate of the genus Corynebacteria were analyzed in order to solve the accumulation of 2-keto-di-gluconate, which is an optical isomer of (Sonoyama et al., Agric. Biol. Chem., 51, 3039-3047, 1987). According to their results, a problem that may occur when converting 2,5-diketo-di-gluconate to 2-keto-l-glonate is that 2,5-diketo-di-gluconate is 2 Under the action of 2-ketoaldonate reductase and 2,5-diketo-di-gluconate reductase, simultaneously with 2-keto-di-gluconate and 2-keto-el-glonate Is to be converted. In addition, 2-keto-L-glonate converted from 2,5-diketo-di-gluconate is converted to idonate by 2-ketoaldonate reductase and then 5-keto-di-gluconate ( 5KDG), it was confirmed that it can be converted to gluconate and metabolized by 5-keto-di-gluconate reductase. To solve this problem, 2-keto-di from 2,5-diketo-di-gluconate was induced by mutants that lost the activity of 2-ketoaldonate reductase and 5-keto-di-gluconate reductase. A mutant strain that produced 2-keto-L-glonate without the accumulation of -gluconate was obtained, yielding 90.5 mole% yield, but production of byproduct idonate could not be prevented.

앤더슨(Anderson) 등은 코리네박테리아속 미생물로부터 2,5-다이케토-디-글루코네이트 환원효소의 유전자를 분리하여 2,5-다이케토-디-글루코네이트 생산균인 어위니아 허비콜라 (Erwinia herbicola)에 도입하여 1단계 생산공정을 확립하였다(Anderson 등, Science, 230, 144-148, 1985). 초기의 수율은 아주 낮았지만 꾸준한 수율향상을 위한 실험결과 약 100시간에 100g/L의 2-케토-엘-글로네이트를 생산하였다. 유사한 특성을 지닌 효소를 같은 균주에서 클로닝하여 초기의 수율로 볼 때는 더 높은(20-30g/L) 공정을 그린들리(Glindley) 등도 발표하였다(Glindley 등, Appl. Environ. Microbiol., 54, 1770-1775, 19988). 포도당 경로를 이용한 위의 재조합 균주의 생산수율이 낮은 이유는 첫째, 세포내 2,5-다이케토-디-글루코네이트 환원효소에 필요한 NADPH 재생의 필요성, 둘째는 2,5-다이케토-디-글루코네이트의 세포내로 전송, 세째는 세포내에서 형성된 2-케토-엘-글로네이트의 분비, 네째는 2,5-다이케토-디-글루코네이트 및 2-케토-엘-글로네이트의 숙주세포에 의한 분해 등에 기인한 것으로 분석되고 있다. 수율 향상은 부산물인 아이도네이트 생성경로와 2,5-다이케토-디-글루코네이트와 2-케토-엘-글로네이트 분해 대사경로를 막는 쪽으로 시도되었다. 앤더슨(Anderson) 등은 어위니아의 2-케토알도네이트 환원효소가 2,5-다이케토-디-글루코네이트에서 5-케토-디-글루코네이트, 2-케토-디-글루코네이트에서 글루코네이트, 2-케토-엘-글로네이트에서 아이도네이트의 전환을 모두 촉매한다는 사실을 밝히고, 2-케토알도네이트 환원효소를 코딩하는 유전자를 결손시켜 부산물인 아이도네이트의 생산을 막으려고 시도하였으나 큰 진전을 보지 못하였다. 이는 어위니아 균주에 이미 밝혀진 2-케토알도네이트 환원효소이외에 같은 기능을 하는 효소 시스템이 존재하기 때문인 것으로 확인되었다.Anderson et al. Isolated the 2,5-diketo-di-gluconate reductase gene from Corynebacterial microorganisms (Erwinia herbicola) to establish a one-step production process (Anderson et al., Science, 230, 144-148, 1985). The initial yield was very low, but the experimental results for steady yield improvement yielded 100 g / L 2-keto-L-glonate in about 100 hours. An enzyme with similar properties was cloned from the same strain and published a higher (20-30 g / L) process in Greenley et al. (Glindley et al., Appl. Environ. Microbiol., 54, 1770) at an initial yield. -1775, 19988). The reason for the low yield of the above recombinant strains using the glucose pathway is firstly, the necessity of NADPH regeneration required for intracellular 2,5-diketo-di-gluconate reductase, and secondly, 2,5-diketo- Intracellular transfer of di-gluconate, third secretion of 2-keto-L-glonate formed intracellularly, fourth of 2,5-diketo-di-gluconate and 2-keto-el-glonate It is analyzed to be due to degradation by host cells. Yield improvement was attempted to block byproduct idonate production pathways and metabolic pathways of 2,5-diketo-di-gluconate and 2-keto-el-glonate degradation. Anderson et al. Found that the 2-ketoaldonate reductase of Erwinia is gluconate at 2-keto-di-gluconate at 2,5-diketo-di-gluconate and 2-keto-di-gluconate. Attempted to prevent the production of by-product idonate by depleting the gene encoding 2-ketoaldonate reductase, revealing that it catalyzes the conversion of all idonates in 2-keto-el-glonate. I didn't see any progress. This was confirmed to be due to the presence of an enzyme system that functions the same as the 2-ketoaldonate reductase already found in the Erwinia strain.

이상의 생물전환방법이나 대사공학적 방법의 가장 큰 문제점은 산화적 대사과정을 갖는 미생물은 반드시 세포내에 중간산물이나 최종산물을 이용하는 대사경로도 함께 갖는다는 것이다. 기존에 밝혀진 대사경로를 단순히 차단하므로써 부산물의 생성을 막을 수는 있으나 미생물의 성장이나 원활한 대사과정의 운용에는 많은 문제점을 야기하였다.The biggest problem of the above bioconversion method or metabolic method is that the microorganism with oxidative metabolic process must have metabolic pathway using intermediate or final product in the cell. By simply blocking the previously known metabolic pathways can prevent the production of by-products, but caused many problems in the growth of microorganisms and smooth metabolic processes.

본 발명자들은 어위니아 시프리페디 (Erwinia cypripedii)의 세개 서브유니트로 구성되어 있고 글루코네이트를 2-케토-디-글루코네이트로 전환시키는 막결합 글루코네이트 탈수소효소 (membrane-bound gluconate dehydrogenase; GADH) (Yum등, J. Bacteriol. 179, 6566-6572, 1997)를 코딩하는 유전자 클러스터를 클로닝하고 대장균에서 발현시켜 높은 수율로 전환시켰다. 그러나 재조합 대장균을 사용하여 글루코네이트로부터 2-케토-디-글루코네이트로의 전환실험을 수행하는 중 도 1에서 보여주는 바와 같이 글루코네이트가 배지에서 완전히 소모된 다음 글루코네이트로부터 전환된 2-케토-디-글루코네이트로가 조금씩 배양액에서 소실되었다. 물론 글루코네이트가 높은 수율로 빠르게 2-케토-디-글루코네이트로 전환되기 때문에 2-케토-디-글루코네이트 생물전환에는 문제가 없지만 상술한 바와 같이 포도당 대사과정을 이용한 비타민 C 전구체인 2-케토-엘-글로네이트 생물전환에 대장균을 숙주세포로 이용하기 위해서 그 원인을 검증하였다. 이 과정에서 본 발명자들 2-케토-디-글루코네이트가 대사되어 이용되었다면 2-케토-디-글루코네이트를 글루코네이트로 전환시켜 이용할 수 밖에 없으므로 대장균의 세포추출물을 조효소액으로 사용하여 2-케토-디-글루코네이트를 글루코네이트로 환원시키는 NADPH-의존성 환원효소 활성을 측정하였다. 그 결과 2-케토-디-글루코네이트를 글루코네이트로 환원시키는 효소활성을 관찰하였으며 이는 코리네박테리움 (Corynebacterium), 브레비박테리움 (Brevibacterium), 어위니아 (Erwinia), 아세토박터 (Acetobacter), 글루코노박터(Gluconobacter), 세라티아 (Serratia), 슈도모나스 (Pseudomonas) 등의 미생물(Sonoyama 등, Agric. Biol. Chem. 51, 3039-3047, 1987; Truesdell, 등, J. Bacteriol. 173, 6651-6656, 1991; Yum, 등, Biosci. Biotechnol. Biochem. 62, 154-156 1998)에서 보고된 케토글루코네이트에 관련된 대사과정이 대장균에도 존재할 수 있다는 가능성을 보여주었다. 어위니아, 아세토박터, 글루코노박터, 세라티아, 슈도모나스 등의 미생물에서는 포도당이 2-케토-디-글루코네이트, 5-케토-디-글루코네이트, 2,5-다이케토-디-글루코네이트 등의 케토글루코네이트로 산화되기 위해서는 앞서 설명한 바와 같이 전자전달 사슬과 연결되어 있는 막결합 탈수소효소에 의해 진행된다(Ameyama 등, Agric. Biol. Chem. 51, 2943-2950, 1987; Sonoyama 등, Agric. Biol. Chem. 52, 667-674, 1988). 케토글루코네이트 혹은 인산화된 케토글루코네이트가 대사과정에 들어가기 위해서는 NADPH-의존성 환원효소에 의해 환원된 후에만 가능하다 (Sonoyama 등, J. Ferment. Technol. 65, 311-317, 1987; Truesdell, 등, J. Bacteriol. 173, 6651-6656, 1991). 2-케토-디-글루코네이트를 글루코네이트로, 2,5-다이케토-디-글루코네이트를 5-케토-디-글루코네이트로, 2-케토-엘-글로네이트를 아이도네이트로 전환시키는 반응을 촉매하는 것으로 알려진 NADPH-의존성 2-케토알도네이트 환원 효소가 브레비박테리움 케토소레덕텀(Brevibacterium ketosoreductum)( Yum, 등, Biosci. Biotechnol. Biochem. 62, 154-156, 1998)과 어위니아 허비콜라 (Erwinia herbicola) ( Truesdell, 등, J. Bacteriol. 173, 6651-6656, 1991) 등에서 순수정제 혹은 부분정제를 통하여 생화학적 특성이 보고된 바 있다. 또한 2,5-다이케토-디-글루코네이트에 대한 기질특이성이 조사되지는 않았지만 초산균의 2-케토-디-글루코네이트 환원효소도 2-케토-엘-글로네이트를 아이도네이트, 2-케토-디-글루코네이트를 글루코네이트로 전환시키는 것으로 알려져 있다 (Ameyama와 Adachi, CARBOHYDRATE METABOLISM. PART D. Wood, W.A. ed. 89, 198-202, 1982). 보다 세부적인 케토글루코네이트의 이용에 관련된 대사경로는 코리네박테리움(Sonoyama 등, Agric. Biol. Chem. 51, 3039-3047, 1987)과 어위니아속(Truesdell, 등, J. Bacteriol. 173, 6651-6656, 1991)에서만 연구되었다. 이들 두 미생물의 케토글루코네이트 대사경로는, 2,5-다이케토-디-글루코네이트가 어위니아속에서는 5-케토-디-글루코네이트로 전환되지만, 코리네박테리움속 미생물에서는 글루코네이트로 전환되기 전에 2-케토-디-글루코네이트로 전환된다는 것을 제외하고는 상당한 유사성을 갖는다. 케토글루코네이트를 연속적으로 글루코네이트로 전환하는 것은 용성 NAD(P)H-의존성 환원효소들에 의하여 이루어지며, 글루코네이트는 인산화되어 6-포스포글루코네이트 (6-phosphogluconate)가 된 뒤 펜토스 포스페이트 경로(pentose phosphate pathway)를 통해 대사된다.We consist of three subunits of Erwinia cypripedii and convert membrane gluconate dehydrogenase (GADH) to convert gluconate into 2-keto-di-gluconate (GADH) ( Yum et al., J. Bacteriol. 179, 6566-6572, 1997) were cloned and expressed in E. coli and converted to high yield. However, during the conversion experiment from gluconate to 2-keto-di-gluconate using recombinant E. coli, 2-keto-di converted to gluconate after gluconate was completely consumed in the medium as shown in FIG. Gluconate little by little disappeared from the culture. Of course, there is no problem in 2-keto-di-gluconate bioconversion since gluconate is rapidly converted to 2-keto-di-gluconate in high yield, but as mentioned above, 2-keto, a vitamin C precursor using glucose metabolism The cause of the E. coli was used as a host cell in the L-glonate bioconversion. In this process, if the present inventors 2-keto-di-gluconate was metabolized and used, 2-keto-di-gluconate could not be converted to gluconate, so the extract of E. coli was used as a coenzyme solution. NADPH-dependent reductase activity of reducing di-gluconate to gluconate was measured. As a result, the enzymatic activity of reducing 2-keto-di-gluconate to gluconate was observed, which was corynebacterium, Brevibacterium, Erwinia, acetobacter, Microorganisms such as Gluconobacter, Serratia, Pseudomonas, etc. (Sonoyama et al., Agric. Biol. Chem. 51, 3039-3047, 1987; Truesdell, et al., J. Bacteriol. 173, 6651- 6656, 1991; Yum, et al., Biosci. Biotechnol. Biochem. 62, 154-156 1998) showed that the metabolic processes related to ketogluconate may also be present in E. coli. In microorganisms such as Erwinia, Acetobacter, Gluconobacter, Serratia and Pseudomonas, glucose is 2-keto-di-gluconate, 5-keto-di-gluconate, 2,5-diketo-di-gluconate To be oxidized to ketogluconate, the reaction proceeds by a membrane bound dehydrogenase linked to an electron transport chain as described above (Ameyama et al., Agric. Biol. Chem. 51, 2943-2950, 1987; Sonoyama et al., Agric Biol.Chem. 52, 667-674, 1988). Ketogluconate or phosphorylated ketogluconate is only possible after it has been reduced by NADPH-dependent reductase to enter the metabolic process (Sonoyama et al., J. Ferment. Technol. 65, 311-317, 1987; Truesdell, et al., J. Bacteriol. 173, 6651-6656, 1991). Convert 2-keto-di-gluconate to gluconate, 2,5-diketo-di-gluconate to 5-keto-di-gluconate, and 2-keto-l-glonate to idonate NADPH-dependent 2-ketoaldonate reductases, known to catalyze the reaction of scavenging reactions, have been described with Brevibacterium ketosoreductum (Yerm et al., Biosci. Biotechnol. Biochem. 62, 154-156, 1998). Biochemical properties have been reported by pure or partial purification in Erwinia herbicola (Truesdell, et al., J. Bacteriol. 173, 6651-6656, 1991). In addition, although the substrate specificity to 2,5-diketo-di-gluconate was not investigated, acetic acid 2-keto-di-gluconate reductase also reacted to 2-keto-L-glonate, iodonate, 2- It is known to convert keto-di-gluconate to gluconate (Ameyama and Adachi, CARBOHYDRATE METABOLISM. PART D. Wood, WA ed. 89, 198-202, 1982). Metabolic pathways related to the use of more detailed ketogluconate are Corynebacterium (Sonoyama et al., Agric. Biol. Chem. 51, 3039-3047, 1987) and Trusdell, et al., J. Bacteriol. 173, 6651-6656, 1991). Ketogluconate metabolic pathways of these two microorganisms convert 2,5-diketo-di-gluconate into 5-keto-di-gluconate in the genus of Erwinia, but to gluconate in the corynebacterium microorganisms. It has considerable similarity, except that it is converted to 2-keto-di-gluconate before it is. Continuous conversion of ketogluconate to gluconate is achieved by soluble NAD (P) H-dependent reductases, which are phosphorylated to become 6-phosphogluconate followed by pentose phosphate Metabolized via the pentose phosphate pathway.

본 발명자들은 대장균내에 케토글루코네이트 환원효소가 존재할 수 있으므로 1997년 완결된 대장균의 게놈 염기 데이터베이스를 이용하여 관련 효소를 그 산물이 아직 밝혀져 있지않은 유전자중에서 검색하여 가능성이 있는 유전자를 PCR로 분리하고 그 유전자 산물을 정제한 후 그 기질 특이성을 검토하여 2,5-다이케토-디-글루코네이트를 2-케토-디-글루코네이트로 전환하는 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소, 2,5-다이케토-디-글루코네이트를 2-케토-엘-글로네이트로 전환하는 2,5-다이케토-디-글루코네이트 환원효소, 5-케토-디-글루코네이트를 글루코네이트로 전환하는 5-케토-디-글루코네이트 환원효소를 코딩하는 유전자를 대장균에서 발견하였다. 이들 중 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소는 포도당 대사경로를 대장균에 도입할 경우 중간 전환산물이 대사되는데 관여하여 최종수율에 영향을 줄 수 있는 효소이다.The present inventors used the genome base database of Escherichia coli, which was completed in 1997, so that ketogluconate reductase may be present in Escherichia coli, so that related enzymes can be searched among genes whose products are not yet identified, and the potential genes are separated by PCR. 2-keto-di-gluconate production 2,5-da converting 2,5-diketo-di-gluconate to 2-keto-di-gluconate after purifying the gene product and examining its substrate specificity Iketo-di-gluconate reductase, 2,5-diketo-di-gluconate reductase, 5 to convert 2,5-diketo-di-gluconate to 2-keto-el-glonate Genes encoding 5-keto-di-gluconate reductase that converts -keto-di-gluconate to gluconate have been found in E. coli. Of these, 2-keto-di-gluconate-producing 2,5-diketo-di-gluconate reductase may affect the final yield by inducing metabolism of intermediate conversion products when glucose metabolism is introduced into E. coli. Is an enzyme.

따라서, 본 발명은 상기 언급한 종래의 문제점을 해결하고자 안출한 것으로서 본 발명의 목적은 신규한 대장균 유래 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소의 유전자 염기서열을 제공함에 있다. 본 발명의 다른 목적은 상기 신규한 대장균 유래 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소의 유전자를 결손시켜 포도당 대사에 의한 비타민 C 제조시 중간산물인 2,5-다이케토-디-글루코네이트의 세포내 대사를 저해하여 고수율로 비타민 C 전구체인 2-케토-엘-글로네이트를 생산함에 있다. 본 발명의 또 다른 목적은 상기 신규한 대장균 유래 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소 유전자를 결손시킨 결손 유전자로 균주를 형질전환시키므로써 세포내에서 포도당을 비타민 C 전구체인 2-케토-엘-글루타네이트로 전환하는 형질전환된 숙주세포를 제공함에 있다.Accordingly, the present invention has been made to solve the above-mentioned problems, and an object of the present invention is to provide a novel 2,5-diketo-di-gluconate reductase derived from E. coli-derived 2-keto-di-gluconate. In providing the gene sequence. Another object of the present invention is to delete the gene of the novel E. coli-derived 2-keto-di-gluconate-producing 2,5-diketo-di-gluconate reductase, which is an intermediate in the production of vitamin C by glucose metabolism. It inhibits intracellular metabolism of 2,5-diketo-di-gluconate to produce 2-keto-L-glonate, a vitamin C precursor, in high yield. Another object of the present invention is to intracellularly transform the strain with a deletion gene which has deleted the novel E. coli-derived 2-keto-di-gluconate producing 2,5-diketo-di-gluconate reductase gene. To provide a transformed host cell for converting glucose to 2-keto-L- glutanate, a vitamin C precursor.

본 발명의 상기 목적은 대장균으로부터 코리레박테리움속 미생물의 2,5-다이케토-디-글루코네이트 환원효소와 글루코노박터 옥시단스의 5-케토-디-글루코네이트 환원효소의 아미노산 배열과 유사성을 보이는 단백질의 유전자인 yqhE, yafB 및 yjgU를 클로닝한 후 이들 유전자 산물의 효소 단백질을 정제한 후 효소활성을 측정하여 상기 yqhE 유전자는 2,5-다이케토-디-글루코네이트 환원효소를 코딩하고 yafB 유전자는 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소를 코딩하며 yjgU 유전자는 5-케토-디-글루코네이트 환원효소를 코딩하는 유전자임을 검증하고 상기 환원효소들의 기질특이성을 바탕으로 대장균내에서의 케토글루코네이트 대사경로를 작성하므로써 달성하였다.The above object of the present invention is to provide the amino acid sequence of the 2,5-diketo-di-gluconate reductase of the genus Correbacterium microorganisms and the 5-keto-di-gluconate reductase of Gluconobacter oxidans from E. coli. After cloning yqhE, yafB and yjgU, which are the genes of similar proteins, the enzyme protein of these gene products was purified and the enzyme activity was measured. The yqhE gene was a 2,5-diketo-di-gluconate reductase. Coding and the yafB gene encodes 2-keto-di-gluconate producing 2,5-diketo-di-gluconate reductase and the yjgU gene is a gene encoding 5-keto-di-gluconate reductase And by preparing a ketogluconate metabolic pathway in E. coli based on the substrate specificity of the reductases.

도 1은 클로닝된 막결합 글루코네이트 탈수소효소 유전자를 갖는 재조합 대장균을 이용하여 글루코네이트를 2-케토-디-글루코네이트로 전환하는 효소활성을 나타낸 그래프이다.1 is a graph showing the enzymatic activity of converting gluconate into 2-keto-di-gluconate using recombinant E. coli with the cloned membrane-bound gluconate dehydrogenase gene.

도 2a와 도 2b는 대장균으로부터 유래하는 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네트 환원효소 유전자의 염기서열 및 아미노산 서열을 나타낸다.Figures 2a and 2b shows the nucleotide sequence and amino acid sequence of the 2-keto-di-gluconate production 2,5-diketo-di-gluconet reductase gene derived from E. coli.

도 3은 대장균을 비롯한 다른 균주내에서의 케토글루코네이트의 대사과정을 나타낸다.Figure 3 shows the metabolic process of ketogluconate in other strains, including E. coli.

본 발명은 글루코박터 옥시단스의 5-케토-디-글루코네이트 환원효소와 코리네박테리움 속의 2,5-다이케토-디-글루코네이트 환원효소의 아미노산 서열과 유사성을 보이는 단백질을 검색하여 yqhE와 yafB 유전자가 코딩하는 2개의 가상적인 산화환원효소(hypothetical oxidoreductase)와 5-케토-디-글루코네이트 환원효소와 유사성을 보이는 yjgU 유전자가 코딩하는 1개의 가상적인 산화환원효소를 얻은 단계; 상기 얻어진 yqhE, yafB 및 yjgU 유전자가 클로닝된 재조합 플라스미드로 대장균을 각각 형질전환시키고 배양하여 정제된 효소를 얻은 후 효소의 기질특이성을 조사하는 단계를 실시하여 대장균이 생산하는 2,5-다이케토-디-글루코네이트 환원효소를 코딩하는 유전자인 yqhE, 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소를 코딩하는 유전자인 yafB 및 5-케토-디-글루코네이트 환원효소를 코딩하는 유전자인 yigU를 얻고 상기 효소들의 기질특이성을 바탕으로 케토글루코네이트 대사경로를 작성하였다.The present invention searches for proteins showing similarities with amino acid sequences of 5-keto-di-gluconate reductase of glucobacter oxydans and 2,5-diketo-di-gluconate reductase in Corynebacterium. And obtaining one hypothetical oxidoreductase encoded by two hypothetical oxidoreductases encoded by the yafB gene and the yjgU gene showing similarity with 5-keto-di-gluconate reductase; E. coli is produced by transforming Escherichia coli with the recombinant plasmid cloned with the obtained yqhE, yafB and yjgU genes, and then purifying the purified substrate. YqhE, a gene encoding di-gluconate reductase, 2-keto-di-gluconate production, yafB and 5-keto-di-, genes encoding 2,5-diketo-di-gluconate reductase YigU, a gene encoding gluconate reductase, was obtained and a ketogluconate metabolic pathway was prepared based on the substrate specificity of the enzymes.

이하, 본 발명의 상세한 설명을 실시예를 들어 단계별로 설명하고자 하지만 본 발명의 권리범위는 이들 실시예에만 한정되는 것은 아니다.Hereinafter, the detailed description of the present invention will be described step by step with reference to Examples, but the scope of the present invention is not limited only to these Examples.

실시예 1: 대장균 유래의 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소를 코딩하는 유전자 검출Example 1: Gene Detection of 2-keto-di-Gluconate Derived from Escherichia Coli 2,5-diketo-di-gluconate Reductase

제 1단계: 유전자 클로닝Step 1: Gene Cloning

본 발명자들은 대장균내 5-케토-디-글루코네이트 환원효소나 2,5-다이케토-디-글루코네이트 환원효소와 같은 케토글루코네이트 환원효소 유전자 및 이들 효소와 관련된 케토글루코네이트 대사과정을 가지고 있을 가능성을 나타내는 대장균에서 케토글루코네이트 환원효소 유전자를 찾기 위한 방법으로 글리코노박터 옥시단스(Gluconobacter oxydans)의 5-케토-디-글루코네이트 환원효소(SP:P50199)(Klasen 등, J. Bacteriol. 177, 2637-43, 1995)와 코리네박테리움 속(Corynebacterium sp.)의 2,5-다이케토-디-글루코네이트 환원효소 (PIR:I40838) (Anderson 등, Science 230, 144-149, 1985)의 아미노산 서열을 이용, FASTA탐색을 하여 단백질 데이터 베이스상에 아미노산서열상이 유사한 단백질을 검색하였다. 실험결과, 표 1에 나타낸 바와 같이 본 발명자들은 2,5-다이케토-디-글루코네이트 환원효소와 각각 49.8%와 42% 유사성을 보인 yqhE와 yafB 유전자가 코딩(coding)하는 두개의 가상적인 산화환원효소(hypothetical oxidoreductases)(SP:Q46857과 SP:P30863)와 5-케토-디-글루코네이트 환원효소와 56% 유사성을 보인 yjgU 유전자가 코딩하는 한 개의 가상적인 산화환원효소(hypothetical oxidoreductase) (SP:P39345)를 검출하였다. 이들 yqhE, yafB, yjgU 유전자가 코딩하는 3개의 가상적인 산화환원효소(hypothetical oxidoreductase)의 기능을 알아보기 위하여 이들 유전자를 PCR로 증폭하고 벡터 플라스미드 pUC19에 클로닝하였다. 이때 PCR에 사용된 프라이머들을 표 2에 나타냈다. 유전자은행(GeneBank)에 등록된 yqhE, yafB, 그리고 yjgU의 염기서열(nucleotide sequences)(각각 accession No. AE000383, AE000129, 그리고 AE000497) (Blattner, et al., 1997)를 이용하여 프라이머들(yqhE-5, yqhE-3, yafB-5, yafB-3, yjgU-5, 와 yjgU-3)을 고안하였다. 5'와 3' 말단에 XbaI 제한효소 인식부위를 인위적으로 만들기 위하여 몇 개의 염기를 치환하였다. PCR은 GeneAmp PCR system 2400 (Perkin Elmer)을 사용하여 95℃에서 30 초간 변성, 65℃에서 30 초간 어닐링(annealing), 72℃에서 1분간 중합반응의 조건으로 30회 반복하였고 72℃에서 3분 동안 신장기간(extension period)를 두었다. 생성된 PCR 산물들을 XbaI으로 자른 플라스미드 pUC19에 클론(clone)하여 플라스미드(plasmid) pYQHE, pYAFB 그리고 pYJGU를 만들고 대장균 DH5α에 도입하고 배양하였다. 이때 yqhE, yafB, yjgU 유전자들이 바르게 삽입되어 있는지는 시퀀싱을 통하여 확인하였고 유전자은행에 등록된 yafB 유전자의 염기서열은 도 2a와 도 2b에 나타낸 바와 같으며 상기 플라스미드 pYAFB가 도입된 대장균 DH5α/pYAFB는 1998년 8월 7일 한국과학기술원 생명공학연구소내 유전자 은행에 기탁번호 KCTC 0509BP로 기탁하였다.We have ketogluconate reductase genes such as 5-keto-di-gluconate reductase or 2,5-diketo-di-gluconate reductase in Escherichia coli and ketogluconate metabolism associated with these enzymes. 5-keto-di-gluconate reductase (SP: P50199) of Gluconobacter oxydans (Klasen et al., J. Bacteriol. 177, 2637-43, 1995) and 2,5-diketo-di-gluconate reductase (PIR: I40838) of Corynebacterium sp. (Anderson et al., Science 230, 144-149, Using the amino acid sequence of 1985), a FASTA search was performed to search for proteins with similar amino acid sequences on the protein database. As a result, as shown in Table 1, the present inventors identified two hypothetical sequences encoded by the yqhE and yafB genes, which showed 49.8% and 42% similarity with 2,5-diketo-di-gluconate reductase, respectively. One hypothetical oxidoreductase (coded by the yjgU gene with 56% similarity to hypothetical oxidoreductases (SP: Q46857 and SP: P30863) and 5-keto-di-gluconate reductase ( SP: P39345) was detected. To investigate the function of the three hypothetical oxidoreductases encoded by these yqhE, yafB and yjgU genes, these genes were amplified by PCR and cloned into the vector plasmid pUC19. The primers used for PCR are shown in Table 2. Primers (yqhE-) using the nucleotide sequences of yqhE, yafB, and yjgU (accession No. AE000383, AE000129, and AE000497, respectively) (Blattner, et al., 1997) registered in the GeneBank. 5, yqhE-3, yafB-5, yafB-3, yjgU-5, and yjgU-3). Several bases were substituted to artificially create the XbaI restriction enzyme recognition sites at the 5 'and 3' ends. PCR was repeated 30 times under conditions of denaturation at 95 ° C. for 30 seconds, annealing at 65 ° C. for 30 seconds, and polymerization at 72 ° C. for 1 minute using GeneAmp PCR system 2400 (Perkin Elmer) for 3 minutes at 72 ° C. An extension period was placed. The resulting PCR products were cloned into plasmid pUC19 cut with XbaI to make plasmids pYQHE, pYAFB and pYJGU, introduced into E. coli DH5α, and cultured. The yqhE, yafB, and yjgU genes were correctly inserted through sequencing, and the nucleotide sequence of the yafB gene registered in the gene bank is shown in FIGS. 2A and 2B. It was deposited on the 7th day of August, 2014 with the deposit number KCTC 0509BP to the Gene Bank within the Institute of Biotechnology, Korea Advanced Institute of Science and Technology.

다른 단백질과 케토글루코네이트 환원효소의 유사성Similarity of ketogluconate reductase with other proteins 조회서열View Sequence 크기(aa)Size (aa) 서열 유사성Sequence similarity FASTAscoreFASTAscore match %match% 크기(aa)Size (aa) 코리네박테리움 속.2,5-다이케토-디-글루코네이트 환원효소(PIR:140838)Genus Corynebacterium. 2,5-diketo-di-gluconate reductase (PIR: 140838) 276276 SP:Q46857:YQHE_ECOLI, Esscherichia.coli metC-sufl내의 가상적인 산화환원효소SP: Q46857: YQHE_ECOLI, a hypothetical oxidoreductase in Esscherichia. Coli metC-sufl 10911091 49.849.8 274274 PIR:A32950:P100_LEIMA, Leishmania major예상되는 환원효소PIR: A32950: P100_LEIMA, Leishmania major Anticipated Reductase 958958 44.644.6 284284 SP:P15339:2DKG_CORSP, Corynebacterium sp. 2,5-다이케토-디-글루코네이트 환원효소SP: P15339: 2DKG_CORSP, Corynebacterium sp. 2,5-diketo-di-gluconate reductase 817817 40.540.5 277277 SP:P30836:YAFB_ECOLI, Escherichia.coliaspU-mltD내의 가상적인 산화환원효소SP: P30836: YAFB_ECOLI, a hypothetical redox enzyme in Escherichia. ColiaspU-mltD 772772 42.042.0 267267 SP:Q02198:MORA_PSEPU, Pseudomonas putida morphine 6-dehydrogenaseSP: Q02198: MORA_PSEPU, Pseudomonas putida morphine 6-dehydrogenase 616616 43.443.4 295295 글루코노박터 옥시단스5-케토-디-글루코네이트 환원효소(SP:P50199)Gluconobacter oxydans5-keto-di-gluconate reductase (SP: P50199) 256256 SP:P39345:YJGU_ECOLI Escherichia.colipepA-gntV내의 가상적인 산화환원효소SP: P39345: hypothetical oxidoreductase in YJGU_ECOLI Escherichia. ColipepA-gntV 11251125 56.056.0 254254 SP:P50842:KDUD_BACSU, Bacillus subtilis 2-데옥시-디-글루코네이트 3-디하이드로젼나아제SP: P50842: KDUD_BACSU, Bacillus subtilis 2-deoxy-di-gluconate 3-dihydrogenase 759759 42.942.9 254254 SP:P37769:KDUD_ECOLI, Escherichia.coli2-데옥시-디-글루코네이트 3-디하이드로젼나아제SP: P37769: KDUD_ECOLI, Escherichia. Coli 2-deoxy-di-gluconate 3-dihydrogenase 712712 43.043.0 253253 SP:Q05528:KDUD_ERWCH, Erwinia chrysanthemi 2-데옥시-디-글루코네이트 3-디하이드젼나아제SP: Q05528: KDUD_ERWCH, Erwinia chrysanthemi 2-deoxy-di-gluconate 3-dihydrase 694694 40.540.5 253253 SP:P76633:YGCW_ECOLI, Escherichia.colicysJ-eno내의 가상적인 산화환원효소SP: P76633: YGCW_ECOLI, a hypothetical redox enzyme in Escherichia.colicys J-eno 683683 38.038.0 261261

PCR에 사용한 프라이머Primer used for PCR 유전자gene 올리고뉴클레오타이드Oligonucleotides 절단부위Cutting area 프라이머 염기서열a Primer sequence a yqhEyqhE yqhE-5yqhE-5 XbaIXbaI 5-TGAACGCGTCTAGAACATCACTG-35-TGAACGCGTCTAGAACATCACTG-3 yqhE-3yqhE-3 XbaIXbaI 5-CTTCCGGCTCTAGATGATGATGT-35-CTTCCGGCTCTAGATGATGATGT-3 yqhE-NdeyqhE-Nde NdeINdeI 5-AGGAACATATGGCTAATCCAACCGTTTATTAAG-35-AGGAACATATGGCTAATCCAACCGTTTATTAAG-3 yqhE-SapyqhE-Sap SapISapI 5-GAGAAGCTCTTCCGCAGCCGCCGAACTGGTCAGGATC-35-GAGAAGCTCTTCCGCAGCCGCCGAACTGGTCAGGATC-3 yafByafB yafB-5yafB-5 XbaIXbaI 5-TCGCGGGTTCTAGACCCGTCCGT-35-TCGCGGGTTCTAGACCCGTCCGT-3 yafB-3yafB-3 XbaIXbaI 5-GTGTTTGTCCGTCTAGATGATCGACA-35-GTGTTTGTCCGTCTAGATGATCGACA-3 yjgUyjgU yjgU-5yjgU-5 XbaIXbaI 5-AATACCTGTCTAGAGGTCACTCGT-35-AATACCTGTCTAGAGGTCACTCGT-3 yjgU-3yjgU-3 XbaIXbaI 5-ATACCATTTTGTCTAGAGTGCAGG-35-ATACCATTTTGTCTAGAGTGCAGG-3 yjgU-5-BamyjgU-5-Bam BamHIBamHI 5'-GAATAAGGATCCGAACGATCTATTTTCACTGGCAGGAA-3'5'-GAATAAGGATCCGAACGATCTATTTTCACTGGCAGGAA-3 ' yjgU-3-HinyjgU-3-Hin HindⅢHindⅢ 5'-GTAGGGGGGAAGCTTAAACAGCCAC-3'5'-GTAGGGGGGAAGCTTAAACAGCCAC-3 ' [주] a 밑줄친 부분은 제한효소 인식부위를 나타내고 진한 글씨체는 제한효소 인 식부위를 만들기위하여 인위적으로 치환된 염기를 나타낸다.Note: The underlined part represents the restriction enzyme recognition site and the bold type indicates the artificially substituted base to make the restriction enzyme recognition site.

제 2단계: yqhE, yafB, yjgU 유전자가 클로닝된 대장균 배양세포 추출물의 환원효소활성 측정Step 2: Determination of Reductase Activity of Escherichia Coli Culture Cell Extract Cloned with yqhE, yafB, and yjgU Genes

본 단계에서는 각각의 yqhE, yafB, yjgU 유전자가 클로닝된 대장균의 배양세포 추출물을 조효소액으로 해서 NADPH를 조효소로 사용하여 2-케토-디-글루코네이트, 5-케토-디-글루코네이트, 2-케토-엘-글로네이트, 2,5-다이케토-디-글루코네이트 등에 대한 환원효소 활성을 측정하였다. 실험결과, yqhE와 yafB 유전자를 갖는 대장균 pYQHE와 대장균 pYAFB는 기질 2,5-다이케토-디-글루코네이트에 대한 효소비활성이 10배이상 증가하였고 반응산물은 각각 2-케토-엘-글로네이트와 2-케토-디-글루코네이트로 나타났다. 이는 yqhE 유전자가 2-케토-엘-글로네이트를 만드는 2,5-다이케토-디-글루코네이트 환원효소를 코딩하고 yafB 유전자는 2-케토-디-글루코네이트를 만드는 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소 (25DKG reductase (DG))임을 나타낸다. 또 현재까지 2,5-다이케토-디-글루코네이트를 2-케토-디-글루코네이트로 환원시키는 효소와 그 유전자는 보고된 바 없으므로 본 발명에서 밝혀진 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소는 신규한 효소이다. yjgU 유전자를 갖는 대장균(pYJGU)는 5-케토-디-글루코네이트를 글루코네이트로 전환 시키는 5-케토-디-글루코네이트 환원효소 활성을 10배이상 증가시켜 yjgU 유전자 산물은 5-케토-디-글루코네이트 환원효소임을 확인 할 수 있었다.In this step, 2-keto-di-gluconate, 5-keto-di-gluconate, 2-, using NADPH as a coenzyme using the culture cell extract of Escherichia coli cloned with each of the yqhE, yafB, and yjgU genes as coenzyme solution Reductase activity against keto-L-glonate, 2,5-diketo-di-gluconate and the like was measured. As a result, E. coli pYQHE and E. coli pYAFB with yqhE and yafB genes increased enzyme inactivation to substrate 2,5-diketo-di-gluconate by more than 10-fold and the reaction products were 2-keto-el-glonate, respectively. And 2-keto-di-gluconate. This means that the yqhE gene encodes a 2,5-diketo-di-gluconate reductase that produces 2-keto-el-glonate and the yafB gene produces 2-keto-di-gluconate. Gluconate production 2,5-diketo-di-gluconate reductase (25DKG reductase (DG)). In addition, to date, enzymes for reducing 2,5-diketo-di-gluconate to 2-keto-di-gluconate and their genes have not been reported, so 2-keto-di-gluconate production 2 has been found in the present invention. , 5-diketo-di-gluconate reductase is a novel enzyme. E. coli with the yjgU gene (pYJGU) increased the 5-keto-di-gluconate reductase activity that converts 5-keto-di-gluconate to gluconate by more than 10-fold, resulting in an yjgU gene product of 5-keto-di- Gluconate reductase could be confirmed.

제 3단계: yqhE, yafB, yjgU 유전자가 클로닝된 대장균 배양세포 추출물의 환원효소활성 측정Step 3: Measurement of Reductase Activity of Escherichia Coli Culture Cell Extract Cloned with yqhE, yafB, and yjgU Genes

본 단계에서는 상기 제 2단계를 더욱 확실히 증명하기 위하여 이들 환원효소의 순수 분리를 시도하였고 그 기질 특이성을 검토하였다.In this step, pure separation of these reductases was attempted and the substrate specificity was examined to more clearly prove the second step.

첫 번째로 2,5-다이케토-디-글루코네이트 환원효소는 NEB사의 IMPACTTM(Intein Mediated Purification with an Affinity Chitin-binding Tag) 단단계-단백질 정제 시스템(one-step protein purification system)을 사용하여 분리하였다. yqhE 유전자의 코딩 부위를 포함하는 DNA 단편은 제 1단계 표 4의 프라이머 yqhE-Nde 와 yqhE-Sap을 사용하여 합성하였고 합성된 DNA단편을 제한효소 NdeI과 SapI으로 처리한 후, 이소프로필-β-D-치오갈락토피라노시드(isopropyl-β-D-thiogalactopyranoside;IPTG)-인두시블(inducible) T7 프로모터(promoter)를 가진 벡터 pTYB1에 클론하였다. yqhE 유전자에 인테인(intein) 유전자가 연결된 플라스미드 pTY-YQH로 대장균 ER2566를 형질전환시켰다. 재조합 단백질정제를 위하여 재조합 대장균 ER2566 (pTY-YQH)을 LB 배지에서 600nm에서 OD 값이 0.5되게 배양하여 IPTG를 농도가 1 mM되게 첨가하여 4 시간 동안 단백질을 발현시켰다. 배양세포를 완충액 (20 mM Tris-HCl [pH 8.0], 500 mM NaCl, 0.1 mM EDTA, 0.1% Triton X-100)에 현탁시켜 초음파 파쇄하고 파쇄되지 않은 세포와 세포조각을 원심분리로 제거하여 얻은 상징액을 키틴(chitin)수지에 흡착 시킨 후 상기 완충액으로 2회 세척하였다. 단백질을 30 mM DTT로 절단한 후 절단 완충액 (20 mM Tris-HCl [pH 8.0], 50 mM NaCl, 0.1 mM EDTA)으로 용출시켰다.D-gluconate reductase is NEB's IMPACT TM (Intein Mediated Purification with an Affinity Tag Chitin-binding) single phase - using the protein purification system (one-step protein purification system) 2,5- the pond Sat first Separated. DNA fragments containing the coding region of the yqhE gene were synthesized using the primers yqhE-Nde and yqhE-Sap of Table 4 in the first step. It was cloned into the vector pTYB1 with the isopropyl-β-D-thiogalactopyranoside (IPTG) -inducible T7 promoter. E. coli ER2566 was transformed with the plasmid pTY-YQH linked to an intein gene to the yqhE gene. For recombinant protein purification, recombinant E. coli ER2566 (pTY-YQH) was cultured in LB medium at an OD value of 0.5 at 600 nm, and IPTG was added at a concentration of 1 mM to express the protein for 4 hours. Cultured cells were suspended in buffer (20 mM Tris-HCl [pH 8.0], 500 mM NaCl, 0.1 mM EDTA, 0.1% Triton X-100), sonicated and obtained by centrifugation of unbroken cells and cell fragments. The supernatant was adsorbed onto chitin resin and washed twice with the buffer. Proteins were cleaved with 30 mM DTT and then eluted with cleavage buffer (20 mM Tris-HCl [pH 8.0], 50 mM NaCl, 0.1 mM EDTA).

두 번째로 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소의 정제는 재조합 플라스미드 pYAFB를 가지고 있는 재조합 대장균에서 발현하여 행하였다. 모든 정제 과정은 4℃에서 수행하였다. 배양세포를 원심분리하고 20mM 인산완충액 (pH 7.5)로 2회 세척한 후, 0.1 mM 페닐메틸설포닐 프로라이드(phenylmethylsulfonyl fluoride;PMSF)와 스트렙토마이신(streptomycin)(0.1 mg/ml)이 포함된 동일 완충액에 현탁시켜 초음파 파쇄하였다. 세포파쇄액을 15,000 X g 에서 30 분 동안 원심분리 하여 얻은 상징액을 조효소액으로 하여 효소 정제에 사용하였다. 이 조효소액에 유안을 25%로 포화되게 첨가하여 7 시간 동안 서서히 교반 시킨 후, 원심분리하여 침전물을 제거하였다. 얻어진 상징액에 유안을 60%로 포화되도록 더 첨가하여 용액을 하룻밤 방치하였다. 원심분리하여 침전물을 모아 완충액에 녹이고 2리터 20 mM 인산 완충액에서 3회에 걸쳐 투석하였다. 투석한 단백질 용액을 20 mM 인산 완충액 (pH 7.5)으로 평형화 시킨 DEAE-Toyopearl 컬럼 (2.5 by 7 cm)에 흡착시켜, 동일 인산 완충액으로 세척한 후 1.19 ml/min 유속으로 0-1.0 M NaCl 농도구배로 단백질을 용출시켰다. 기질로 2,5-다이케토-디-글루코네이트와 보효소로서 NADH를 사용하여 측정한 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소 활성이 DEAE-Toyopearl 크로마토그라피(chromatography)에서 용출 되었다. 활성 분획을 모아 최종 농도 1M이 되게 유안을 첨가한 후, 1M 유안이 포함된 20mM 인산 완충액 (pH 7.5)으로 평형화 시킨 phenyl-Toyopearl 컬럼(2.5 by 8.2 cm) 크로마토그라피를 행하였다. 1M 유안이 포함된 동일 완충액으로 컬럼을 세척하고, 1.19 ml/min의 유속에서 1-0 M 유안 농도구배로 단백질을 용출시켰다. 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소 활성을 갖는 분획을 모아 20 mM 인산 완충액(pH 7.5)에 대해 하룻밤 투석을 행하였다. 투석된 단백질을 20mM 인산 완충액 (pH 7.5)으로 평형화 시킨 블루-세파로스(Blue-Sepharose) CL-6B (2.5 by 4.8 cm)에 흡착시켜, 0-1.0 M NaCl 농도구배로 단백질을 용출시켰다. 효소 활성 부분을 센트리프렙(Centriprep) 10 (Amicon)으로 2.0 ml로 농축한 후, 미리 0.15 M NaCl이 포함된 50 mM 인산 완충액 (pH 7.0)으로 평형화시킨 세파크릴(Sephacryl) S-200 겔 여과 컬럼(gel filtration column ;1.5 by 93 cm) 크로마토그라피를 행하고, 활성 분획(15 ml)을 모아 4℃에 보관하였다.Second, 2-keto-di-gluconate production Purification of 2,5-diketo-di-gluconate reductase was performed by expression in recombinant E. coli carrying the recombinant plasmid pYAFB. All purification procedures were performed at 4 ° C. The cultured cells were centrifuged and washed twice with 20 mM phosphate buffer (pH 7.5), followed by the same containing 0.1 mM phenylmethylsulfonyl fluoride (PMSF) and streptomycin (0.1 mg / ml). Ultrasonic disruption was suspended in buffer. The supernatant obtained by centrifuging the cell lysate at 15,000 X g for 30 minutes was used as a crude enzyme solution to purify the enzyme. The crude enzyme solution was added to the crude enzyme solution at 25% saturation and stirred slowly for 7 hours, followed by centrifugation to remove the precipitate. The supernatant was further added to the supernatant so as to saturate to 60%, and the solution was left overnight. The precipitates were collected by centrifugation to dissolve in buffer and dialyzed three times in 2 liter 20 mM phosphate buffer. The dialyzed protein solution was adsorbed onto a DEAE-Toyopearl column (2.5 by 7 cm) equilibrated with 20 mM phosphate buffer (pH 7.5), washed with the same phosphate buffer, and then gradientd to 0-1.0 M NaCl at 1.19 ml / min flow rate. Protein was eluted. 2-keto-di-gluconate-producing 2,5-diketo-di-gluconate reductase activity measured using 2,5-diketo-di-gluconate as substrate and NADH as coenzyme is DEAE- It was eluted by toyopearl chromatography. The active fractions were collected and added to the final concentration of 1M, and then chromatographed with a phenyl-Toyopearl column (2.5 by 8.2 cm) equilibrated with 20 mM phosphate buffer (pH 7.5) containing 1M oil. The column was washed with the same buffer containing 1M oil and the protein was eluted with a 1-0 M oil gradient at a flow rate of 1.19 ml / min. 2-keto-di-gluconate production Fractions with 2,5-diketo-di-gluconate reductase activity were pooled and dialyzed overnight against 20 mM phosphate buffer (pH 7.5). The dialyzed protein was adsorbed to Blue-Sepharose CL-6B (2.5 by 4.8 cm) equilibrated with 20 mM phosphate buffer (pH 7.5) to elute the protein with 0-1.0 M NaCl gradient. Sephacryl S-200 gel filtration, concentrated to 2.0 ml with Centriprep 10 (Amicon) and then equilibrated with 50 mM phosphate buffer (pH 7.0) containing 0.15 M NaCl. Gel filtration column (1.5 by 93 cm) chromatography was performed and the active fractions (15 ml) were collected and stored at 4 ° C.

세 번째로 5-케토-디-글루코네이트 환원효소는 아미노 말단에 6개의 His을 붙여 Ni-NTA 레진을 사용하여 정제하였다. 우선 재조합 플라스미드(plasmid) pQE-YJG를 만들기 위하여 주형(template)로서 대장균 크로모좀 DNA(E. coli chromosomal DNA)와 BamHI 과 HindⅢ 제한효소 인식부위를 yjgU에 도입하기 위하여 고안된 프라이머, yjgU-5-Bam과 yjgU-3-Hin (표 2)를 가지고 PCR로 yjgU 유전자를 증폭하였다. 생성된 DNA 단편을 플라스미드 pQE31(QIAGEN)의 BamHI 과 HindⅢ 제한효소 인식부위에 삽입시켜 플라스미드 pQE-YJG를 제조하였다. 이 플라스미드(plasmid)에서 yjgU는 아미노 말단쪽이 플라스미드 pQE31의 six-His tag-코딩부위(coding region)과 융합(fusion)되었으며, IPTG-유인 프로모터(inducible promoter)의 조절하에서 발현되도록 하였다. 5-케토-디-글루코네이트 환원효소는 대장균 ER2566 (pQE-YJG)에서 1mM IPTG로 대량 유도발현하였다. 정제를 위하여, IPTG로 4시간 발현유도시킨 세포를 모았다. 6His-tag 융합단백질은 Ni-NTA 레진 (QIAGEN)을 사용하여 재조합 대장균으로부터 정제하였다. 5-케토-디-글루코네이트 환원효소를 정제하기 위하여 대장균ER2566 (pQE-YJG) 500ml 배양액으로부터 얻은 배양세포를 20ml의 50 mM 인산완충액 (pH 8.0), 0.3 M NaCl에 현탁시켜 얼음에서 초음파 파쇄하였다. 세포분쇄물(cell lyste)를 16,000g에서 원심분리하여 직접 1.6 ml 의 Ni-NTA 레진(QIAGEN) 컬럼에 통과시켰다. 컬럼을 30ml의 50 mM 인산완충액 (pH8.0), 0.3M NaCl, 10% 글리세롤(glycerol)로 세척하고, N-terminal 6His-tagged 5-케토-디-글루코네이트 환원효소를 4ml 의 50 mM Na-시트레이트 버퍼(citrate buffer)(pH 6.0)로 용출시켰다. 상기와 같이 정제한 3가지 효소 2,5-다이케토-디-글루코네이트 환원효소, 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소 및 2-케토-디-글루코네이트 환원효소의 기질특이성을 표 3에 정리하였으며 이 표에 나타낸 바와 같이 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소와 2,5-다이케토-디-글루코네이트 환원효소는 2,5-다이케토-디-글루코네이트에 특이적이고 다른 기질과는 기질특이성을 보이지 않았다. 또한 정제된 2,5-다이케토-디-글루코네이트 환원효소와 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소의 2,5-다이케토-디-글루코네이트와의 반응산물도 각각 2-케토-엘-글로네이트와 2-케토-디-글루코네이트로 앞서의 결과와 일치하였다. 5-케토-디-글루코네이트 환원효소도 기질 5-케토-디-글루코네이트에만 특이적으로 반응하였고반응산물은 글루코네이트였다. 조효소는 2,5-다이케토-디-글루코네이트 환원효소의 경우 NADPH에 특이적이였고 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소와 5-케토-디-글루코네이트 환원효소의 경우 NADPH 보다 NADH에 특이적이였다.Third, 5-keto-di-gluconate reductase was purified using Ni-NTA resin by attaching 6 His to the amino terminus. First, yjgU-5-Bam, a primer designed to introduce E. coli chromosomal DNA and BamHI and HindIII restriction enzyme recognition sites into yjgU as a template for making recombinant plasmid pQE-YJG. And yjgU-3-Hin (Table 2) were used to amplify the yjgU gene by PCR. The resulting DNA fragment was inserted into BamHI and HindIII restriction enzyme recognition sites of plasmid pQE31 (QIAGEN) to prepare plasmid pQE-YJG. In this plasmid, yjgU was fused with the six-His tag-coding region of plasmid pQE31 at its amino terminus and expressed under the control of the IPTG-inducible promoter. 5-keto-di-gluconate reductase was massively induced by 1 mM IPTG in Escherichia coli ER2566 (pQE-YJG). For purification, cells induced expression for 4 hours with IPTG were collected. 6His-tag fusion protein was purified from recombinant E. coli using Ni-NTA resin (QIAGEN). To purify 5-keto-di-gluconate reductase, cultured cells obtained from 500 ml of E. coli ER2566 (pQE-YJG) were suspended in 20 ml of 50 mM phosphate buffer (pH 8.0), 0.3 M NaCl and sonicated on ice. . The cell lyste was centrifuged at 16,000 g and passed directly through 1.6 ml of Ni-NTA resin (QIAGEN) column. The column was washed with 30 ml of 50 mM phosphate buffer (pH8.0), 0.3 M NaCl, 10% glycerol, and N-terminal 6His-tagged 5-keto-di-gluconate reductase was added with 4 ml of 50 mM Na. Eluted with citrate buffer (pH 6.0). Three enzymes 2,5-diketo-di-gluconate reductase purified as described above, 2-keto-di-gluconate production 2,5-diketo-di-gluconate reductase and 2-keto The substrate specificity of -di-gluconate reductase is summarized in Table 3, and as shown in this table, 2-keto-di-gluconate production 2,5-diketo-di-gluconate reductase and 2,5- Diketo-di-gluconate reductase is specific for 2,5-diketo-di-gluconate and shows no substrate specificity with other substrates. Also, purified 2,5-diketo-di-gluconate reductase and 2,5-diketo-di-gluconate reductase produced 2,5-diketo-di-gluconate reductase Reaction products with di-gluconate were also in agreement with the previous results with 2-keto-L-glonate and 2-keto-di-gluconate, respectively. 5-keto-di-gluconate reductase also reacted specifically with the substrate 5-keto-di-gluconate and the reaction product was gluconate. The coenzyme was specific for NADPH for 2,5-diketo-di-gluconate reductase and produced 2-keto-di-gluconate 2,5-diketo-di-gluconate reductase and 5-keto -Di-gluconate reductase was more specific to NADH than NADPH.

2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소, 2,5-다이케토-디-글루코네이트 환원효소, 5-케토-디-글루코네이트 환원효소의 기질특이성2-keto-di-gluconate production of 2,5-diketo-di-gluconate reductase, 2,5-diketo-di-gluconate reductase, 5-keto-di-gluconate reductase Substrate specificity 기 질Quality 상대활성(%)Relative activity (%) 25DKGR(25DKG→2KLG)25DKGR (25DKG → 2KLG) 25DKGR(DG)(25DKG→2KDG)25DKGR (DG) (25DKG → 2KDG) 5KDGR(5DKG→GA)5KDGR (5DKG → GA) 2-케토-디-글루코네이트(2KDG)2-keto-di-gluconate (2KDG) 00 00 00 2,5-다이케토-디-글루코네이트(25DKG)2,5-diketo-di-gluconate (25DKG) 100100 100100 00 2-케토-엘-글로네이트(2KLG)2-keto-l-glonate (2KLG) 00 00 00 5-케토-디-글루코네이트(5KDG)5-keto-di-gluconate (5KDG) 00 00 100100 과당(D-프럭토스)Fructose (D-fructose) 00 00 00 솔보즈(L-솔보즈)Solvoise (L-Solvoze) 00 00 00 [주] 25DKGR: 2,5-다이케토-디-글루코네이트 환원효소5KDGR: 5-케토-디-글루코네이트 환원효소25DKGR: 2,5-diketo-di-gluconate reductase 5KDGR: 5-keto-di-gluconate reductase

실시예 2: 케토글루코네이트 대사경로Example 2: Ketogluconate Metabolism Pathway

상기 실시예 1에서 서술한 바와 같이 본 발명에서는 yqhE, yafB, yjgU 유전자를 검출하고 이 유전자 산물이 케토글루코네이트 환원효소임을 증명하였으며 효소의 기질과 반응산물을 확인하였다. 따라서, 이와같은 사실을 바탕으로 대장균의 케토글루코네이트 대사경로를 도 3에 나타냈다. 즉 2,5-다이케토-디-글루코네이트 환원효소는 어위니아속 미생물에서는 5-케토-디-글루코네이트로 전환된 후 대사되고 코리네박테리움속 미생물에서는 2-케토-디-글루코네이트로 전환된 후 대사되나 본 발명 대장균의 경우는 2-케토-디-글루코네이트, 5-케토-디-글루코네이트, 2-케토-엘-글로네이트를 거쳐 글루코네이트로 전환 될 수 있다. 위의 경로를 거쳐 생성된 글루코네이트는 Entner-Doudoroff (ED) 경로를 거쳐 완전히 대사된다. 2,5-다이케토-디-글루코네이트의 2-케토-엘-글로네이트, 아이도네이트, 5-케토-디-글루코네이트를 거친 경로는 최근 Bausch 등(Bausch 등, J Bacteriol 180, 3704-3710, 1998)이 아이도네이트 탈수소 효소 (IA dehydrogenase (5KR(I))의 존재를 밝힌 바 있으므로 그 경로가 가능하다고 할 수 있다. 결국 대장균을 생산 숙주미생물로 하여 막결합 글루코네이트 탈수소효소나 막결합 2-케토-디-글루코네이트 탈수소 효소를 이용하여 2-케토-디-글루코네이트나 2,5-다이케토-디-글루코네이트를 생산할 경우 케토글루코네이트가 세포내로 대사되지 않도록 하기 위해서는 yafB 유전자를 결손시킴으로써 가능한 것이 확인되었다.As described in Example 1, in the present invention, the yqhE, yafB, and yjgU genes were detected, and the gene product was proved to be a ketogluconate reductase, and the substrate and the reaction product of the enzyme were confirmed. Therefore, based on this fact, the metabolic pathway of E. coli ketogluconate is shown in FIG. That is, 2,5-diketo-di-gluconate reductase is metabolized after conversion to 5-keto-di-gluconate in the genus Erwinia and 2-keto-di-gluconate in the genus Corynebacterium. It is metabolized after conversion to the present invention E. coli can be converted to gluconate via 2-keto-di- gluconate, 5-keto-di- gluconate, 2-keto-L- gluconate. Gluconate produced via the above pathway is fully metabolized via the Entner-Doudoroff (ED) pathway. Routes through 2-keto-el-glonate, iodonate, 5-keto-di-gluconate of 2,5-diketo-di-gluconate have recently been described by Bausch et al. (Bausch et al., J Bacteriol 180, 3704). -3710, 1998) revealed the presence of IA dehydrogenase (5KR (I)), and thus the route is possible. Finally, membrane-bound gluconate dehydrogenase (E. coli) is used as a production host microorganism. When the 2-keto-di-gluconate or 2,5-diketo-di-gluconate is produced using membrane-bound 2-keto-di-gluconate dehydrogenase, It was confirmed that this was possible by deleting the yafB gene.

본 발명은 상기 실시예와 실험예를 통하여 설명한 바와 같이 대장균으로부터 유래되는 2,5-다이케토-디-글루코네이트 환원효소, 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소 및 5-케토-디-글루코네이트 환원효소의 유전자를 클로닝하고 이중 2-케토-디-글루코네이트 생산 2,5-다이케토-디 글루코네이트 환원효소를 코딩하는 yafB 유전자 염기서열을 결정하여 제공하는 효과가 있고 또 이들 효소들의 대사경로에 기초하여 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소의 유전자인 yafB 유전자를 결손시키므로써 대장균내 생물전환에 의한 2-케토-엘-글로네이트의 생산시 중간산물인 2,5-다이케토-디-글루코네이트의 세포내 대사를 방지하여 비타민 C 전구체인 2-케토-엘-글로네이트의 생산수율을 향상시키는 뛰어난 효과가 있으므로 생물산업상 매우 유용한 발명인 것이다.The present invention is a 2,5-diketo-di-gluconate reductase, 2-keto-di-gluconate production 2,5-diketo- derived from E. coli as described in the above Examples and Experimental Examples A yafB gene that clones the genes of di-gluconate reductase and 5-keto-di-gluconate reductase and encodes a double 2-keto-di-gluconate production 2,5-diketo-digluconate reductase It has the effect of determining and providing sequencing, and based on the metabolic pathways of these enzymes, it deletes the yafB gene, which is the gene for 2-keto-di-gluconate production 2,5-diketo-di-gluconate reductase. By preventing intracellular metabolism of the intermediate 2,5-diketo-di-gluconate during the production of 2-keto-el-glonate by E. coli bioconversion, 2-keto-el- is a vitamin C precursor. Improved production yield of glonate So the effect will be very useful inventions the bioindustry.

Claims (8)

대장균으로부터 유래된 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소 유전자를 코딩하는 yafB 유전자.A yafB gene encoding a 2-keto-di-gluconate producing 2,5-diketo-di-gluconate reductase gene derived from E. coli. 제 1항에 있어서, 상기 유전자가 하기 염기서열을 갖는 것을 특징으로 하는 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소를 코딩하는 yafB 유전자.The yafB gene encoding 2-keto-di-gluconate producing 2,5-diketo-di-gluconate reductase according to claim 1, wherein the gene has the following nucleotide sequence. ATGGCTATCCCTGCATTTGGTTTAGGTACTTTCCGTCTGAAAGACGACGTTGTTATTTCA 60ATGGCTATCCCTGCATTTGGTTTAGGTACTTTCCGTCTGAAAGACGACGTTGTTATTTCA 60 TCTGTGATAACGGCGCTTGAACTTGGTTATCGCGCAATTGATACCGCACAAATCTATGAT 120TCTGTGATAACGGCGCTTGAACTTGGTTATCGCGCAATTGATACCGCACAAATCTATGAT 120 AACGAAGCCGCAGTAGGTCAGGCGATTGCAGAAAGTGGCGTGCCACGTCATGAACTCTAC 180AACGAAGCCGCAGTAGGTCAGGCGATTGCAGAAAGTGGCGTGCCACGTCATGAACTCTAC 180 ATCACCACTAAAATCTGGATTGAAAATCTCAGCAAAGACAAATTGATCCCAAGTCTGAAA 240ATCACCACTAAAATCTGGATTGAAAATCTCAGCAAAGACAAATTGATCCCAAGTCTGAAA 240 GAGAGCCTGCAAAAATTGCGTACCGATTATGTTGATCTGACGCTAATCCACTGGCCGTCA 300GAGAGCCTGCAAAAATTGCGTACCGATTATGTTGATCTGACGCTAATCCACTGGCCGTCA 300 CCAAACGATGAAGTCTCTGTTGAAGAGTTTATGCAGGCGCTGCTGGAAGCCAAAAAACAA 360CCAAACGATGAAGTCTCTGTTGAAGAGTTTATGCAGGCGCTGCTGGAAGCCAAAAAACAA 360 GGGCTGACGCGTGAGATCGGTATTTCCAACTTCACGATCCCGTTGATGGAAAAAGCGATT 420GGGCTGACGCGTGAGATCGGTATTTCCAACTTCACGATCCCGTTGATGGAAAAAGCGATT 420 GCTGCTGTTGGTGCTGAAAACATCGCTACTAACCAGATTGAACTCTCTCCTTATCTGCAA 480GCTGCTGTTGGTGCTGAAAACATCGCTACTAACCAGATTGAACTCTCTCCTTATCTGCAA 480 AACCGTAAAGTGGTTGCCTGGGCTAAACAGCACGGCATCCATATTACTTCCTATATGACG 540AACCGTAAAGTGGTTGCCTGGGCTAAACAGCACGGCATCCATATTACTTCCTATATGACG 540 CTGGCGTATGGTAAGGCCCTGAAAGATGAGGTTATTGCTCGTATCGCAGCTAAACACAAT 600CTGGCGTATGGTAAGGCCCTGAAAGATGAGGTTATTGCTCGTATCGCAGCTAAACACAAT 600 GCGACTCCGGCACAAGTGATTCTGGCGTGGGCTATGGGGGAAGGTTACTCAGTAATTCCT 660GCGACTCCGGCACAAGTGATTCTGGCGTGGGCTATGGGGGAAGGTTACTCAGTAATTCCT 660 TCTTCTACTAAACGTAAAAACCTGGAAAGTAATCTTAAGGCACAAAATTTACAGCTTGAT 720TCTTCTACTAAACGTAAAAACCTGGAAAGTAATCTTAAGGCACAAAATTTACAGCTTGAT 720 GCCGAAGATAAAAAAGCGATCGCCGCACTGGATTGCAACGACCGCCTGGTTAGCCCGGAA 780GCCGAAGATAAAAAAGCGATCGCCGCACTGGATTGCAACGACCGCCTGGTTAGCCCGGAA 780 GGTCTGGCTCCTGAATGGGATTAA 804GGTCTGGCTCCTGAATGGGATTAA 804 제 1항에 있어서, 상기 유전자가 하기 아미노산 서열을 갖는 것을 특징으로 하는 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소를 코딩하는 yafB 유전자.The yafB gene encoding 2-keto-di-gluconate producing 2,5-diketo-di-gluconate reductase according to claim 1, wherein the gene has the following amino acid sequence. MAIPAFGLGTFRLKDDVVISSVITALELGYRAIDTAQIYDNEAAVGQAIAESGVPRHELY 60MAIPAFGLGTFRLKDDVVISSVITALELGYRAIDTAQIYDNEAAVGQAIAESGVPRHELY 60 ITTKIWIENLSKDKLIPSLKESLQKLRTDYVDLTLIHWPSPNDEVSVEEFMQALLEAKKQ 120ITTKIWIENLSKDKLIPSLKESLQKLRTDYVDLTLIHWPSPNDEVSVEEFMQALLEAKKQ 120 GLTREIGISNFTIPLMEKAIAAVGAENIATNQIELSPYLQNRKVVAWAKQHGIHITSYMT 180GLTREIGISNFTIPLMEKAIAAVGAENIATNQIELSPYLQNRKVVAWAKQHGIHITSYMT 180 LAYGKALKDEVIARIAAKHNATPAQVILAWAMGEGYSVIPSSTKRKNLESNLKAQNLQLD 240LAYGKALKDEVIARIAAKHNATPAQVILAWAMGEGYSVIPSSTKRKNLESNLKAQNLQLD 240 AEDKKAIAALDCNDRLVSPEGLAPEWD 267AEDKKAIAALDCNDRLVSPEGLAPEWD 267 대장균으로부터 유래된 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소 유전자를 코딩하는 yafB 유전자가 삽입된 재조합 플라스미드 pYAFB.Recombinant plasmid pYAFB with a yafB gene encoding a 2-keto-di-gluconate producing 2,5-diketo-di-gluconate reductase gene derived from E. coli. 대장균으로부터 유래된 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소 유전자를 코딩하는 yafB 유전자가 삽입된 재조합 플라스미드 pYAFB가 도입되어 형질전환된 대장균 DH5α/pYAFB 균주(기탁번호 KCTC 0509BP).E. coli DH5α / pYAFB strain transformed by introducing a recombinant plasmid pYAFB inserted with a yafB gene encoding a 2-keto-di-gluconate-producing 2,5-diketo-di-gluconate reductase gene derived from E. coli (Accession No. KCTC 0509BP). 대장균으로부터 유래된 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소 유전자를 결손시킨 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소의 결손 유전자.2-keto-di-gluconate production derived from E. coli 2-keto-di-gluconate production 2,5-diketo-di- lacking the 2,5-diketo-di-gluconate reductase gene Deletions of Gluconate Reductase. 대장균으로부터 유래된 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소 유전자를 결손시킨 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소의 결손 유전자를 숙주세포에 도입하여 재조합한 균주.2-keto-di-gluconate production derived from E. coli 2-keto-di-gluconate production 2,5-diketo-di- lacking the 2,5-diketo-di-gluconate reductase gene A strain in which a gluconate reductase deficiency gene is introduced into a host cell and recombined. 포도당 대사에 의해 비타민 C 전구체인 2-케토-엘-글로네이트를 제조하는 방법에 있어서, 2-케토-디-글루코네이트 생산 2,5-다이케토-디-글루코네이트 환원효소 결손 유전자를 숙주세포에 도입하여 재조합한 균주에서 막결합 글루코네이트 환원효소를 발현시켜 글루코네이트로부터 2-케토-디-글루코네이트를 제조하는 방법.A method for preparing 2-keto-L-glonate, a vitamin C precursor by glucose metabolism, wherein the 2-keto-di-gluconate producing 2,5-diketo-di-gluconate reductase deletion gene is host A method of preparing 2-keto-di-gluconate from gluconate by expressing membrane-bound gluconate reductase in a recombinant strain introduced into a cell.
KR1019980039405A 1998-09-23 1998-09-23 Novel 2,5-diketo-di-gluconate Reductase Gene and 2-Keto-L-Glonate Production Using It KR100320370B1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
KR1019980039405A KR100320370B1 (en) 1998-09-23 1998-09-23 Novel 2,5-diketo-di-gluconate Reductase Gene and 2-Keto-L-Glonate Production Using It

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
KR1019980039405A KR100320370B1 (en) 1998-09-23 1998-09-23 Novel 2,5-diketo-di-gluconate Reductase Gene and 2-Keto-L-Glonate Production Using It

Publications (2)

Publication Number Publication Date
KR20000020688A true KR20000020688A (en) 2000-04-15
KR100320370B1 KR100320370B1 (en) 2002-03-21

Family

ID=19551594

Family Applications (1)

Application Number Title Priority Date Filing Date
KR1019980039405A KR100320370B1 (en) 1998-09-23 1998-09-23 Novel 2,5-diketo-di-gluconate Reductase Gene and 2-Keto-L-Glonate Production Using It

Country Status (1)

Country Link
KR (1) KR100320370B1 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2003042052A1 (en) * 2001-11-13 2003-05-22 Sung-Mo Kang Double cup separable into upper and lower sections
JP2013541942A (en) * 2010-10-08 2013-11-21 カディラ ヘルスケア リミティド Methods for producing sitagliptin intermediates by enzymatic conversion

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2003042052A1 (en) * 2001-11-13 2003-05-22 Sung-Mo Kang Double cup separable into upper and lower sections
JP2013541942A (en) * 2010-10-08 2013-11-21 カディラ ヘルスケア リミティド Methods for producing sitagliptin intermediates by enzymatic conversion

Also Published As

Publication number Publication date
KR100320370B1 (en) 2002-03-21

Similar Documents

Publication Publication Date Title
Blanke et al. Active-site mutations of the diphtheria toxin catalytic domain: role of histidine-21 in nicotinamide adenine dinucleotide binding and ADP-ribosylation of elongation factor 2
US5304723A (en) Biologically pure culture of maltopentaose forming amylase producing alkalophilic bacteria
US7575910B2 (en) Method for producing L-fuculose and method for producing L-fucose
Yum et al. Identification of the yqhE and yafB genes encoding two 2, 5-diketo-D-gluconate reductases in Escherichia coli
JPH0573387B2 (en)
KR20190007403A (en) Method of producing 2-hydroxy gamma butyrolactone or 2,4-dihydroxybutanoic acid
Ashiuchi et al. Biochemical evidence that Escherichia coli hyi (orf b0508, gip) gene encodes hydroxypyruvate isomerase
KR100320370B1 (en) Novel 2,5-diketo-di-gluconate Reductase Gene and 2-Keto-L-Glonate Production Using It
JP4216719B2 (en) Halogen compound-resistant novel formate dehydrogenase and method for producing the same
Yum et al. The yiaE gene, located at 80.1 minutes on the Escherichia coli chromosome, encodes a 2-ketoaldonate reductase
JP4146095B2 (en) Thermostable glucokinase gene, recombinant vector containing the same, transformant containing the recombinant vector, and method for producing thermostable glucokinase using the transformant
US5416012A (en) Process for producing NADH oxidase
JP2971218B2 (en) Uricase gene and method for producing uricase
Tonouchi et al. Coenzyme specificity of enzymes in the oxidative pentose phosphate pathway of Gluconobacter oxydans
Chakraborty et al. Cloning and expression of a Clostridium kluyveri gene responsible for diaphorase activity
JP4287144B2 (en) Novel formate dehydrogenase and production method thereof
KR100320269B1 (en) New 2-Ketoaldonate Reductase Gene and 2-Keto-L-Glonate Production Using It
JP5115708B2 (en) Novel hydrogen peroxide-generating NADH oxidase and DNA encoding the same
US7713718B1 (en) Process for producing glucose dehydrogenases
US6337199B1 (en) Membrane-bound gluconate dehydrogenase, gene sequence encoding the same and production of 2-keto-D-gluconate using transformed recombinant E-coli
US20020098562A1 (en) Novel gene and transformant carrying the same
KR100320371B1 (en) New 2,5-diketo-di-gluconate reductase and its gene and method for preparing 2-keto-L-glonate using E. coli transformed
JP2000069971A (en) New thermostable formate dehydrogenase
JP2005102511A (en) New alcohol dehydrogenase and its gene
JP4415247B2 (en) Novel glycerol kinase, gene and method for producing glycerol kinase using the gene

Legal Events

Date Code Title Description
A201 Request for examination
E902 Notification of reason for refusal
E701 Decision to grant or registration of patent right
GRNT Written decision to grant
FPAY Annual fee payment

Payment date: 20101229

Year of fee payment: 10

LAPS Lapse due to unpaid annual fee