IL303376A - TEAD inhibitors and their uses - Google Patents
TEAD inhibitors and their usesInfo
- Publication number
- IL303376A IL303376A IL303376A IL30337623A IL303376A IL 303376 A IL303376 A IL 303376A IL 303376 A IL303376 A IL 303376A IL 30337623 A IL30337623 A IL 30337623A IL 303376 A IL303376 A IL 303376A
- Authority
- IL
- Israel
- Prior art keywords
- increased
- cancer
- compound
- tead
- pharmaceutically acceptable
- Prior art date
Links
- 239000003112 inhibitor Substances 0.000 title description 142
- 150000001875 compounds Chemical class 0.000 claims description 346
- 206010028980 Neoplasm Diseases 0.000 claims description 158
- 101000653735 Homo sapiens Transcriptional enhancer factor TEF-1 Proteins 0.000 claims description 115
- 102100029898 Transcriptional enhancer factor TEF-1 Human genes 0.000 claims description 112
- 201000011510 cancer Diseases 0.000 claims description 110
- 230000000694 effects Effects 0.000 claims description 101
- 230000004655 Hippo pathway Effects 0.000 claims description 90
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 83
- -1 substituted Chemical class 0.000 claims description 81
- 230000001965 increasing effect Effects 0.000 claims description 77
- 150000003839 salts Chemical class 0.000 claims description 71
- 101000597043 Homo sapiens Transcriptional enhancer factor TEF-5 Proteins 0.000 claims description 58
- 102100035147 Transcriptional enhancer factor TEF-5 Human genes 0.000 claims description 56
- IJGRMHOSHXDMSA-UHFFFAOYSA-N nitrogen Substances N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 claims description 54
- 238000000034 method Methods 0.000 claims description 52
- 125000001931 aliphatic group Chemical group 0.000 claims description 50
- 230000002401 inhibitory effect Effects 0.000 claims description 49
- 101000597045 Homo sapiens Transcriptional enhancer factor TEF-3 Proteins 0.000 claims description 44
- 101000597035 Homo sapiens Transcriptional enhancer factor TEF-4 Proteins 0.000 claims description 44
- 230000014509 gene expression Effects 0.000 claims description 44
- 229920006395 saturated elastomer Polymers 0.000 claims description 43
- 102100035148 Transcriptional enhancer factor TEF-3 Human genes 0.000 claims description 42
- 102100035146 Transcriptional enhancer factor TEF-4 Human genes 0.000 claims description 42
- 201000010099 disease Diseases 0.000 claims description 42
- 229910052757 nitrogen Inorganic materials 0.000 claims description 42
- 208000035475 disorder Diseases 0.000 claims description 37
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical group [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 claims description 33
- 229910052717 sulfur Chemical group 0.000 claims description 33
- 239000011593 sulfur Chemical group 0.000 claims description 33
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical group [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 claims description 31
- 229910052760 oxygen Inorganic materials 0.000 claims description 31
- 239000001301 oxygen Chemical group 0.000 claims description 31
- 229910052736 halogen Inorganic materials 0.000 claims description 30
- 125000005842 heteroatom Chemical group 0.000 claims description 28
- QJGQUHMNIGDVPM-UHFFFAOYSA-N nitrogen group Chemical group [N] QJGQUHMNIGDVPM-UHFFFAOYSA-N 0.000 claims description 27
- 150000002367 halogens Chemical class 0.000 claims description 18
- 239000008194 pharmaceutical composition Substances 0.000 claims description 17
- 230000005764 inhibitory process Effects 0.000 claims description 15
- 230000002062 proliferating effect Effects 0.000 claims description 14
- 239000003981 vehicle Substances 0.000 claims description 9
- 230000001413 cellular effect Effects 0.000 claims description 8
- 239000003937 drug carrier Substances 0.000 claims description 8
- 125000000325 methylidene group Chemical group [H]C([H])=* 0.000 claims description 8
- 239000002671 adjuvant Substances 0.000 claims description 7
- 230000009286 beneficial effect Effects 0.000 claims description 6
- 125000006570 (C5-C6) heteroaryl group Chemical group 0.000 claims description 5
- 125000001183 hydrocarbyl group Chemical group 0.000 claims 2
- 108700038175 YAP-Signaling Proteins Proteins 0.000 description 115
- 108090000623 proteins and genes Proteins 0.000 description 101
- 239000003814 drug Substances 0.000 description 100
- 239000000203 mixture Substances 0.000 description 79
- 230000003993 interaction Effects 0.000 description 62
- 230000026792 palmitoylation Effects 0.000 description 55
- 229940124597 therapeutic agent Drugs 0.000 description 52
- 235000002639 sodium chloride Nutrition 0.000 description 47
- 102000004169 proteins and genes Human genes 0.000 description 42
- 235000018102 proteins Nutrition 0.000 description 41
- 229940045207 immuno-oncology agent Drugs 0.000 description 36
- 239000002584 immunological anticancer agent Substances 0.000 description 36
- 238000011282 treatment Methods 0.000 description 31
- 229940121647 egfr inhibitor Drugs 0.000 description 30
- 239000005557 antagonist Substances 0.000 description 27
- 210000004027 cell Anatomy 0.000 description 27
- 230000008685 targeting Effects 0.000 description 27
- 230000007423 decrease Effects 0.000 description 24
- 230000003247 decreasing effect Effects 0.000 description 24
- 102000005962 receptors Human genes 0.000 description 22
- 108020003175 receptors Proteins 0.000 description 22
- 230000035772 mutation Effects 0.000 description 21
- 239000003795 chemical substances by application Substances 0.000 description 20
- 125000003118 aryl group Chemical group 0.000 description 19
- 230000027455 binding Effects 0.000 description 19
- 125000001424 substituent group Chemical group 0.000 description 19
- 206010009944 Colon cancer Diseases 0.000 description 18
- 125000000623 heterocyclic group Chemical group 0.000 description 18
- 206010033128 Ovarian cancer Diseases 0.000 description 16
- 208000029974 neurofibrosarcoma Diseases 0.000 description 15
- 102000001301 EGF receptor Human genes 0.000 description 14
- 108060006698 EGF receptor Proteins 0.000 description 14
- 108091000080 Phosphotransferase Proteins 0.000 description 14
- 239000002552 dosage form Substances 0.000 description 14
- 230000004077 genetic alteration Effects 0.000 description 14
- 231100000118 genetic alteration Toxicity 0.000 description 14
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 14
- 125000001072 heteroaryl group Chemical group 0.000 description 14
- 102000020233 phosphotransferase Human genes 0.000 description 14
- 206010061535 Ovarian neoplasm Diseases 0.000 description 13
- 125000002619 bicyclic group Chemical group 0.000 description 13
- 230000001225 therapeutic effect Effects 0.000 description 13
- 102000003688 G-Protein-Coupled Receptors Human genes 0.000 description 12
- 108090000045 G-Protein-Coupled Receptors Proteins 0.000 description 12
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 12
- 102000040945 Transcription factor Human genes 0.000 description 12
- 108091023040 Transcription factor Proteins 0.000 description 12
- 239000000556 agonist Substances 0.000 description 12
- 125000000217 alkyl group Chemical group 0.000 description 12
- 208000018463 endometrial serous adenocarcinoma Diseases 0.000 description 12
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 12
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 11
- 239000000523 sample Substances 0.000 description 11
- 238000002560 therapeutic procedure Methods 0.000 description 11
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 10
- 208000000172 Medulloblastoma Diseases 0.000 description 10
- 206010060862 Prostate cancer Diseases 0.000 description 10
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 10
- 230000003042 antagnostic effect Effects 0.000 description 10
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 10
- 201000002528 pancreatic cancer Diseases 0.000 description 10
- 208000008443 pancreatic carcinoma Diseases 0.000 description 10
- 239000000243 solution Substances 0.000 description 10
- 239000000126 substance Substances 0.000 description 10
- 208000024891 symptom Diseases 0.000 description 10
- 229940121358 tyrosine kinase inhibitor Drugs 0.000 description 10
- 208000026310 Breast neoplasm Diseases 0.000 description 9
- 206010018338 Glioma Diseases 0.000 description 9
- 102100037106 Merlin Human genes 0.000 description 9
- 239000002829 mitogen activated protein kinase inhibitor Substances 0.000 description 9
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 9
- 239000002904 solvent Substances 0.000 description 9
- 239000000725 suspension Substances 0.000 description 9
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 9
- 108091006027 G proteins Proteins 0.000 description 8
- 102000034286 G proteins Human genes 0.000 description 8
- 208000032612 Glial tumor Diseases 0.000 description 8
- 102100024216 Programmed cell death 1 ligand 1 Human genes 0.000 description 8
- 125000004429 atom Chemical group 0.000 description 8
- 238000006731 degradation reaction Methods 0.000 description 8
- 238000009472 formulation Methods 0.000 description 8
- 230000004927 fusion Effects 0.000 description 8
- 208000005017 glioblastoma Diseases 0.000 description 8
- 150000002430 hydrocarbons Chemical group 0.000 description 8
- 201000001441 melanoma Diseases 0.000 description 8
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 8
- 229960003301 nivolumab Drugs 0.000 description 8
- 230000037361 pathway Effects 0.000 description 8
- 230000026731 phosphorylation Effects 0.000 description 8
- 238000006366 phosphorylation reaction Methods 0.000 description 8
- 102000016914 ras Proteins Human genes 0.000 description 8
- 230000002103 transcriptional effect Effects 0.000 description 8
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 8
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 7
- 206010052747 Adenocarcinoma pancreas Diseases 0.000 description 7
- 108010074708 B7-H1 Antigen Proteins 0.000 description 7
- 206010006187 Breast cancer Diseases 0.000 description 7
- 101150015280 Cel gene Proteins 0.000 description 7
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 7
- 108091000058 GTP-Binding Proteins 0.000 description 7
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 7
- 108010010914 Metabotropic glutamate receptors Proteins 0.000 description 7
- 102000016193 Metabotropic glutamate receptors Human genes 0.000 description 7
- 208000007571 Ovarian Epithelial Carcinoma Diseases 0.000 description 7
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 7
- 102100027548 WW domain-containing transcription regulator protein 1 Human genes 0.000 description 7
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 description 7
- 125000002947 alkylene group Chemical group 0.000 description 7
- 230000001028 anti-proliverative effect Effects 0.000 description 7
- 239000000427 antigen Substances 0.000 description 7
- 108091007433 antigens Proteins 0.000 description 7
- 102000036639 antigens Human genes 0.000 description 7
- 210000000988 bone and bone Anatomy 0.000 description 7
- 239000002775 capsule Substances 0.000 description 7
- 230000015556 catabolic process Effects 0.000 description 7
- 238000000576 coating method Methods 0.000 description 7
- XGALLCVXEZPNRQ-UHFFFAOYSA-N gefitinib Chemical compound C=12C=C(OCCCN3CCOCC3)C(OC)=CC2=NC=NC=1NC1=CC=C(F)C(Cl)=C1 XGALLCVXEZPNRQ-UHFFFAOYSA-N 0.000 description 7
- 125000005843 halogen group Chemical group 0.000 description 7
- 150000002632 lipids Chemical class 0.000 description 7
- 230000001404 mediated effect Effects 0.000 description 7
- 229960003278 osimertinib Drugs 0.000 description 7
- DUYJMQONPNNFPI-UHFFFAOYSA-N osimertinib Chemical group COC1=CC(N(C)CCN(C)C)=C(NC(=O)C=C)C=C1NC1=NC=CC(C=2C3=CC=CC=C3N(C)C=2)=N1 DUYJMQONPNNFPI-UHFFFAOYSA-N 0.000 description 7
- 201000008968 osteosarcoma Diseases 0.000 description 7
- 201000002094 pancreatic adenocarcinoma Diseases 0.000 description 7
- 229920001223 polyethylene glycol Polymers 0.000 description 7
- 230000001105 regulatory effect Effects 0.000 description 7
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 7
- 210000001908 sarcoplasmic reticulum Anatomy 0.000 description 7
- 230000011664 signaling Effects 0.000 description 7
- 206010042863 synovial sarcoma Diseases 0.000 description 7
- 239000003826 tablet Substances 0.000 description 7
- 210000004881 tumor cell Anatomy 0.000 description 7
- 229910001868 water Inorganic materials 0.000 description 7
- 102000040125 5-hydroxytryptamine receptor family Human genes 0.000 description 6
- 108091032151 5-hydroxytryptamine receptor family Proteins 0.000 description 6
- 208000001446 Anaplastic Thyroid Carcinoma Diseases 0.000 description 6
- 206010002240 Anaplastic thyroid cancer Diseases 0.000 description 6
- 206010003571 Astrocytoma Diseases 0.000 description 6
- 229940123711 Bcl2 inhibitor Drugs 0.000 description 6
- WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 6
- 102000011068 Cdc42 Human genes 0.000 description 6
- 108050001278 Cdc42 Proteins 0.000 description 6
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 6
- 102000004190 Enzymes Human genes 0.000 description 6
- 108090000790 Enzymes Proteins 0.000 description 6
- 201000001342 Fallopian tube cancer Diseases 0.000 description 6
- 208000013452 Fallopian tube neoplasm Diseases 0.000 description 6
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 6
- 102000003964 Histone deacetylase Human genes 0.000 description 6
- 108090000353 Histone deacetylase Proteins 0.000 description 6
- 206010025323 Lymphomas Diseases 0.000 description 6
- 229940124647 MEK inhibitor Drugs 0.000 description 6
- 208000030070 Malignant epithelial tumor of ovary Diseases 0.000 description 6
- 101100519207 Mus musculus Pdcd1 gene Proteins 0.000 description 6
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 6
- 206010061328 Ovarian epithelial cancer Diseases 0.000 description 6
- 208000008900 Pancreatic Ductal Carcinoma Diseases 0.000 description 6
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 6
- 208000015634 Rectal Neoplasms Diseases 0.000 description 6
- 208000006265 Renal cell carcinoma Diseases 0.000 description 6
- 208000000102 Squamous Cell Carcinoma of Head and Neck Diseases 0.000 description 6
- 210000001744 T-lymphocyte Anatomy 0.000 description 6
- 108700040558 Transcriptional Coactivator with PDZ-Binding Motif Proteins Proteins 0.000 description 6
- 230000001270 agonistic effect Effects 0.000 description 6
- 230000037396 body weight Effects 0.000 description 6
- 229910052799 carbon Inorganic materials 0.000 description 6
- 208000029742 colonic neoplasm Diseases 0.000 description 6
- 208000011588 combined hepatocellular carcinoma and cholangiocarcinoma Diseases 0.000 description 6
- 238000012217 deletion Methods 0.000 description 6
- 230000037430 deletion Effects 0.000 description 6
- 229940088598 enzyme Drugs 0.000 description 6
- AAKJLRGGTJKAMG-UHFFFAOYSA-N erlotinib Chemical compound C=12C=C(OCCOC)C(OCCOC)=CC2=NC=NC=1NC1=CC=CC(C#C)=C1 AAKJLRGGTJKAMG-UHFFFAOYSA-N 0.000 description 6
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 6
- 201000000459 head and neck squamous cell carcinoma Diseases 0.000 description 6
- 230000017945 hippo signaling cascade Effects 0.000 description 6
- 229940043355 kinase inhibitor Drugs 0.000 description 6
- 239000008101 lactose Substances 0.000 description 6
- 201000005202 lung cancer Diseases 0.000 description 6
- 208000020816 lung neoplasm Diseases 0.000 description 6
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 6
- 231100000252 nontoxic Toxicity 0.000 description 6
- 230000003000 nontoxic effect Effects 0.000 description 6
- 201000008129 pancreatic ductal adenocarcinoma Diseases 0.000 description 6
- 208000024641 papillary serous cystadenocarcinoma Diseases 0.000 description 6
- 239000000546 pharmaceutical excipient Substances 0.000 description 6
- 239000003757 phosphotransferase inhibitor Substances 0.000 description 6
- 230000035755 proliferation Effects 0.000 description 6
- 108010014186 ras Proteins Proteins 0.000 description 6
- 206010038038 rectal cancer Diseases 0.000 description 6
- 201000001275 rectum cancer Diseases 0.000 description 6
- 230000001603 reducing effect Effects 0.000 description 6
- CYOHGALHFOKKQC-UHFFFAOYSA-N selumetinib Chemical compound OCCONC(=O)C=1C=C2N(C)C=NC2=C(F)C=1NC1=CC=C(Br)C=C1Cl CYOHGALHFOKKQC-UHFFFAOYSA-N 0.000 description 6
- QZAYGJVTTNCVMB-UHFFFAOYSA-N serotonin Chemical compound C1=C(O)C=C2C(CCN)=CNC2=C1 QZAYGJVTTNCVMB-UHFFFAOYSA-N 0.000 description 6
- 210000004872 soft tissue Anatomy 0.000 description 6
- 230000004936 stimulating effect Effects 0.000 description 6
- 208000019179 thyroid gland undifferentiated (anaplastic) carcinoma Diseases 0.000 description 6
- 108091006108 transcriptional coactivators Proteins 0.000 description 6
- WAEXFXRVDQXREF-UHFFFAOYSA-N vorinostat Chemical group ONC(=O)CCCCCCC(=O)NC1=CC=CC=C1 WAEXFXRVDQXREF-UHFFFAOYSA-N 0.000 description 6
- 229960000237 vorinostat Drugs 0.000 description 6
- MMWCIQZXVOZEGG-UHFFFAOYSA-N 1,4,5-IP3 Natural products OC1C(O)C(OP(O)(O)=O)C(OP(O)(O)=O)C(O)C1OP(O)(O)=O MMWCIQZXVOZEGG-UHFFFAOYSA-N 0.000 description 5
- 102000004899 14-3-3 Proteins Human genes 0.000 description 5
- ZKHQWZAMYRWXGA-KQYNXXCUSA-J ATP(4-) Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](COP([O-])(=O)OP([O-])(=O)OP([O-])([O-])=O)[C@@H](O)[C@H]1O ZKHQWZAMYRWXGA-KQYNXXCUSA-J 0.000 description 5
- ZKHQWZAMYRWXGA-UHFFFAOYSA-N Adenosine triphosphate Natural products C1=NC=2C(N)=NC=NC=2N1C1OC(COP(O)(=O)OP(O)(=O)OP(O)(O)=O)C(O)C1O ZKHQWZAMYRWXGA-UHFFFAOYSA-N 0.000 description 5
- 102100022455 Adrenocorticotropic hormone receptor Human genes 0.000 description 5
- 239000012664 BCL-2-inhibitor Substances 0.000 description 5
- 101150013553 CD40 gene Proteins 0.000 description 5
- 229940045513 CTLA4 antagonist Drugs 0.000 description 5
- 108010067218 Guanine Nucleotide Exchange Factors Proteins 0.000 description 5
- 102000016285 Guanine Nucleotide Exchange Factors Human genes 0.000 description 5
- 101001137987 Homo sapiens Lymphocyte activation gene 3 protein Proteins 0.000 description 5
- 239000005517 L01XE01 - Imatinib Substances 0.000 description 5
- 239000005411 L01XE02 - Gefitinib Substances 0.000 description 5
- 239000005551 L01XE03 - Erlotinib Substances 0.000 description 5
- 206010027406 Mesothelioma Diseases 0.000 description 5
- 108091022875 Microtubule Proteins 0.000 description 5
- 102000029749 Microtubule Human genes 0.000 description 5
- 101100407308 Mus musculus Pdcd1lg2 gene Proteins 0.000 description 5
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 5
- 208000003019 Neurofibromatosis 1 Diseases 0.000 description 5
- 208000024834 Neurofibromatosis type 1 Diseases 0.000 description 5
- 108091008606 PDGF receptors Proteins 0.000 description 5
- 108090000430 Phosphatidylinositol 3-kinases Proteins 0.000 description 5
- 102000003993 Phosphatidylinositol 3-kinases Human genes 0.000 description 5
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 5
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 5
- 102000011653 Platelet-Derived Growth Factor Receptors Human genes 0.000 description 5
- 108700030875 Programmed Cell Death 1 Ligand 2 Proteins 0.000 description 5
- 102100024213 Programmed cell death 1 ligand 2 Human genes 0.000 description 5
- 229940079156 Proteasome inhibitor Drugs 0.000 description 5
- 108010016672 Syk Kinase Proteins 0.000 description 5
- 102100031873 Transcriptional coactivator YAP1 Human genes 0.000 description 5
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 5
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 5
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 description 5
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 description 5
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 5
- 102100038183 Tyrosine-protein kinase SYK Human genes 0.000 description 5
- 239000002253 acid Substances 0.000 description 5
- 229940100198 alkylating agent Drugs 0.000 description 5
- 239000002168 alkylating agent Substances 0.000 description 5
- 239000003886 aromatase inhibitor Substances 0.000 description 5
- VSRXQHXAPYXROS-UHFFFAOYSA-N azanide;cyclobutane-1,1-dicarboxylic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1 VSRXQHXAPYXROS-UHFFFAOYSA-N 0.000 description 5
- 230000004071 biological effect Effects 0.000 description 5
- 239000000969 carrier Substances 0.000 description 5
- 210000000805 cytoplasm Anatomy 0.000 description 5
- 239000002270 dispersing agent Substances 0.000 description 5
- 229960001433 erlotinib Drugs 0.000 description 5
- 230000006870 function Effects 0.000 description 5
- 229960002584 gefitinib Drugs 0.000 description 5
- 208000006359 hepatoblastoma Diseases 0.000 description 5
- 239000003276 histone deacetylase inhibitor Substances 0.000 description 5
- 229910052739 hydrogen Inorganic materials 0.000 description 5
- 239000001257 hydrogen Substances 0.000 description 5
- 125000004435 hydrogen atom Chemical group [H]* 0.000 description 5
- 229960002411 imatinib Drugs 0.000 description 5
- KTUFNOKKBVMGRW-UHFFFAOYSA-N imatinib Chemical compound C1CN(C)CCN1CC1=CC=C(C(=O)NC=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)C=C1 KTUFNOKKBVMGRW-UHFFFAOYSA-N 0.000 description 5
- 239000007788 liquid Substances 0.000 description 5
- 208000014018 liver neoplasm Diseases 0.000 description 5
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 5
- 210000004688 microtubule Anatomy 0.000 description 5
- BMGQWWVMWDBQGC-IIFHNQTCSA-N midostaurin Chemical compound CN([C@H]1[C@H]([C@]2(C)O[C@@H](N3C4=CC=CC=C4C4=C5C(=O)NCC5=C5C6=CC=CC=C6N2C5=C43)C1)OC)C(=O)C1=CC=CC=C1 BMGQWWVMWDBQGC-IIFHNQTCSA-N 0.000 description 5
- 229950010895 midostaurin Drugs 0.000 description 5
- 125000002950 monocyclic group Chemical group 0.000 description 5
- 239000003921 oil Substances 0.000 description 5
- 235000019198 oils Nutrition 0.000 description 5
- 239000006187 pill Substances 0.000 description 5
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Chemical group [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 5
- 238000002360 preparation method Methods 0.000 description 5
- 239000003207 proteasome inhibitor Substances 0.000 description 5
- 229960004641 rituximab Drugs 0.000 description 5
- 208000000587 small cell lung carcinoma Diseases 0.000 description 5
- 239000007909 solid dosage form Substances 0.000 description 5
- YJZSUCFGHXQWDM-UHFFFAOYSA-N 1-adamantyl 4-[(2,5-dihydroxyphenyl)methylamino]benzoate Chemical compound OC1=CC=C(O)C(CNC=2C=CC(=CC=2)C(=O)OC23CC4CC(CC(C4)C2)C3)=C1 YJZSUCFGHXQWDM-UHFFFAOYSA-N 0.000 description 4
- AILRADAXUVEEIR-UHFFFAOYSA-N 5-chloro-4-n-(2-dimethylphosphorylphenyl)-2-n-[2-methoxy-4-[4-(4-methylpiperazin-1-yl)piperidin-1-yl]phenyl]pyrimidine-2,4-diamine Chemical compound COC1=CC(N2CCC(CC2)N2CCN(C)CC2)=CC=C1NC(N=1)=NC=C(Cl)C=1NC1=CC=CC=C1P(C)(C)=O AILRADAXUVEEIR-UHFFFAOYSA-N 0.000 description 4
- 108010029445 Agammaglobulinaemia Tyrosine Kinase Proteins 0.000 description 4
- XKJMBINCVNINCA-UHFFFAOYSA-N Alfalone Chemical compound CON(C)C(=O)NC1=CC=C(Cl)C(Cl)=C1 XKJMBINCVNINCA-UHFFFAOYSA-N 0.000 description 4
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 4
- 229940122815 Aromatase inhibitor Drugs 0.000 description 4
- 208000003174 Brain Neoplasms Diseases 0.000 description 4
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 4
- 208000005243 Chondrosarcoma Diseases 0.000 description 4
- 208000009798 Craniopharyngioma Diseases 0.000 description 4
- 102000004127 Cytokines Human genes 0.000 description 4
- 108090000695 Cytokines Proteins 0.000 description 4
- MMWCIQZXVOZEGG-XJTPDSDZSA-N D-myo-Inositol 1,4,5-trisphosphate Chemical compound O[C@@H]1[C@H](O)[C@@H](OP(O)(O)=O)[C@H](OP(O)(O)=O)[C@@H](O)[C@@H]1OP(O)(O)=O MMWCIQZXVOZEGG-XJTPDSDZSA-N 0.000 description 4
- 108050002772 E3 ubiquitin-protein ligase Mdm2 Proteins 0.000 description 4
- 102000012199 E3 ubiquitin-protein ligase Mdm2 Human genes 0.000 description 4
- 206010014967 Ependymoma Diseases 0.000 description 4
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 4
- 102100025334 Guanine nucleotide-binding protein G(q) subunit alpha Human genes 0.000 description 4
- 101710113864 Heat shock protein 90 Proteins 0.000 description 4
- 102100034051 Heat shock protein HSP 90-alpha Human genes 0.000 description 4
- 101000857888 Homo sapiens Guanine nucleotide-binding protein G(q) subunit alpha Proteins 0.000 description 4
- 101000775102 Homo sapiens Transcriptional coactivator YAP1 Proteins 0.000 description 4
- 208000008839 Kidney Neoplasms Diseases 0.000 description 4
- 239000002118 L01XE12 - Vandetanib Substances 0.000 description 4
- 102100020862 Lymphocyte activation gene 3 protein Human genes 0.000 description 4
- 241001465754 Metazoa Species 0.000 description 4
- 101710181812 Methionine aminopeptidase Proteins 0.000 description 4
- 102100038243 Mitogen-activated protein kinase kinase kinase 10 Human genes 0.000 description 4
- 102000004473 OX40 Ligand Human genes 0.000 description 4
- 108010042215 OX40 Ligand Proteins 0.000 description 4
- MUBZPKHOEPUJKR-UHFFFAOYSA-N Oxalic acid Chemical compound OC(=O)C(O)=O MUBZPKHOEPUJKR-UHFFFAOYSA-N 0.000 description 4
- 229910019142 PO4 Inorganic materials 0.000 description 4
- 208000000453 Skin Neoplasms Diseases 0.000 description 4
- 206010041067 Small cell lung cancer Diseases 0.000 description 4
- 229920002472 Starch Polymers 0.000 description 4
- 230000006044 T cell activation Effects 0.000 description 4
- 108091008874 T cell receptors Proteins 0.000 description 4
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 4
- BPEGJWRSRHCHSN-UHFFFAOYSA-N Temozolomide Chemical compound O=C1N(C)N=NC2=C(C(N)=O)N=CN21 BPEGJWRSRHCHSN-UHFFFAOYSA-N 0.000 description 4
- 208000024313 Testicular Neoplasms Diseases 0.000 description 4
- 206010057644 Testis cancer Diseases 0.000 description 4
- MUMGGOZAMZWBJJ-DYKIIFRCSA-N Testostosterone Chemical compound O=C1CC[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 MUMGGOZAMZWBJJ-DYKIIFRCSA-N 0.000 description 4
- 102100029823 Tyrosine-protein kinase BTK Human genes 0.000 description 4
- 201000005969 Uveal melanoma Diseases 0.000 description 4
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 4
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 4
- 238000010521 absorption reaction Methods 0.000 description 4
- 230000003213 activating effect Effects 0.000 description 4
- 230000004913 activation Effects 0.000 description 4
- 239000012190 activator Substances 0.000 description 4
- 208000020990 adrenal cortex carcinoma Diseases 0.000 description 4
- 208000007128 adrenocortical carcinoma Diseases 0.000 description 4
- 229960001686 afatinib Drugs 0.000 description 4
- ULXXDDBFHOBEHA-CWDCEQMOSA-N afatinib Chemical compound N1=CN=C2C=C(O[C@@H]3COCC3)C(NC(=O)/C=C/CN(C)C)=CC2=C1NC1=CC=C(F)C(Cl)=C1 ULXXDDBFHOBEHA-CWDCEQMOSA-N 0.000 description 4
- 125000003275 alpha amino acid group Chemical group 0.000 description 4
- 239000002246 antineoplastic agent Substances 0.000 description 4
- 125000001797 benzyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])* 0.000 description 4
- 229960000397 bevacizumab Drugs 0.000 description 4
- ACWZRVQXLIRSDF-UHFFFAOYSA-N binimetinib Chemical group OCCONC(=O)C=1C=C2N(C)C=NC2=C(F)C=1NC1=CC=C(Br)C=C1F ACWZRVQXLIRSDF-UHFFFAOYSA-N 0.000 description 4
- 229940126587 biotherapeutics Drugs 0.000 description 4
- GXJABQQUPOEUTA-RDJZCZTQSA-N bortezomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)B(O)O)NC(=O)C=1N=CC=NC=1)C1=CC=CC=C1 GXJABQQUPOEUTA-RDJZCZTQSA-N 0.000 description 4
- 229950004272 brigatinib Drugs 0.000 description 4
- 230000024245 cell differentiation Effects 0.000 description 4
- 230000004663 cell proliferation Effects 0.000 description 4
- 229960005395 cetuximab Drugs 0.000 description 4
- 229960002271 cobimetinib Drugs 0.000 description 4
- RESIMIUSNACMNW-BXRWSSRYSA-N cobimetinib fumarate Chemical compound OC(=O)\C=C\C(O)=O.C1C(O)([C@H]2NCCCC2)CN1C(=O)C1=CC=C(F)C(F)=C1NC1=CC=C(I)C=C1F.C1C(O)([C@H]2NCCCC2)CN1C(=O)C1=CC=C(F)C(F)=C1NC1=CC=C(I)C=C1F RESIMIUSNACMNW-BXRWSSRYSA-N 0.000 description 4
- 125000000753 cycloalkyl group Chemical group 0.000 description 4
- 230000007812 deficiency Effects 0.000 description 4
- 230000001419 dependent effect Effects 0.000 description 4
- 235000014113 dietary fatty acids Nutrition 0.000 description 4
- 239000003085 diluting agent Substances 0.000 description 4
- 239000003995 emulsifying agent Substances 0.000 description 4
- 229930195729 fatty acid Natural products 0.000 description 4
- 239000000194 fatty acid Substances 0.000 description 4
- 229960002949 fluorouracil Drugs 0.000 description 4
- 230000002496 gastric effect Effects 0.000 description 4
- 210000001035 gastrointestinal tract Anatomy 0.000 description 4
- XLXSAKCOAKORKW-AQJXLSMYSA-N gonadorelin Chemical compound C([C@@H](C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1[C@@H](CCC1)C(=O)NCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)C1=CC=C(O)C=C1 XLXSAKCOAKORKW-AQJXLSMYSA-N 0.000 description 4
- IFSDAJWBUCMOAH-HNNXBMFYSA-N idelalisib Chemical group C1([C@@H](NC=2C=3N=CNC=3N=CN=2)CC)=NC2=CC=CC(F)=C2C(=O)N1C1=CC=CC=C1 IFSDAJWBUCMOAH-HNNXBMFYSA-N 0.000 description 4
- 239000003701 inert diluent Substances 0.000 description 4
- 230000005865 ionizing radiation Effects 0.000 description 4
- BCFGMOOMADDAQU-UHFFFAOYSA-N lapatinib Chemical compound O1C(CNCCS(=O)(=O)C)=CC=C1C1=CC=C(N=CN=C2NC=3C=C(Cl)C(OCC=4C=C(F)C=CC=4)=CC=3)C2=C1 BCFGMOOMADDAQU-UHFFFAOYSA-N 0.000 description 4
- HPJKCIUCZWXJDR-UHFFFAOYSA-N letrozole Chemical compound C1=CC(C#N)=CC=C1C(N1N=CN=C1)C1=CC=C(C#N)C=C1 HPJKCIUCZWXJDR-UHFFFAOYSA-N 0.000 description 4
- 239000003446 ligand Substances 0.000 description 4
- 201000007270 liver cancer Diseases 0.000 description 4
- 229940124302 mTOR inhibitor Drugs 0.000 description 4
- 239000003628 mammalian target of rapamycin inhibitor Substances 0.000 description 4
- 238000004519 manufacturing process Methods 0.000 description 4
- 239000002609 medium Substances 0.000 description 4
- 238000013508 migration Methods 0.000 description 4
- 229960000513 necitumumab Drugs 0.000 description 4
- 229950008835 neratinib Drugs 0.000 description 4
- ZNHPZUKZSNBOSQ-BQYQJAHWSA-N neratinib Chemical compound C=12C=C(NC\C=C\CN(C)C)C(OCC)=CC2=NC=C(C#N)C=1NC(C=C1Cl)=CC=C1OCC1=CC=CC=N1 ZNHPZUKZSNBOSQ-BQYQJAHWSA-N 0.000 description 4
- 239000000346 nonvolatile oil Substances 0.000 description 4
- 239000002777 nucleoside Substances 0.000 description 4
- 229960003347 obinutuzumab Drugs 0.000 description 4
- 239000002674 ointment Substances 0.000 description 4
- 229960001972 panitumumab Drugs 0.000 description 4
- 229960002621 pembrolizumab Drugs 0.000 description 4
- 235000021317 phosphate Nutrition 0.000 description 4
- LHNIIDJUOCFXAP-UHFFFAOYSA-N pictrelisib Chemical compound C1CN(S(=O)(=O)C)CCN1CC1=CC2=NC(C=3C=4C=NNC=4C=CC=3)=NC(N3CCOCC3)=C2S1 LHNIIDJUOCFXAP-UHFFFAOYSA-N 0.000 description 4
- 229920000642 polymer Polymers 0.000 description 4
- 229940002612 prodrug Drugs 0.000 description 4
- 239000000651 prodrug Substances 0.000 description 4
- 125000000719 pyrrolidinyl group Chemical group 0.000 description 4
- 238000001959 radiotherapy Methods 0.000 description 4
- 125000006413 ring segment Chemical group 0.000 description 4
- OHRURASPPZQGQM-GCCNXGTGSA-N romidepsin Chemical compound O1C(=O)[C@H](C(C)C)NC(=O)C(=C/C)/NC(=O)[C@H]2CSSCC\C=C\[C@@H]1CC(=O)N[C@H](C(C)C)C(=O)N2 OHRURASPPZQGQM-GCCNXGTGSA-N 0.000 description 4
- OHRURASPPZQGQM-UHFFFAOYSA-N romidepsin Natural products O1C(=O)C(C(C)C)NC(=O)C(=CC)NC(=O)C2CSSCCC=CC1CC(=O)NC(C(C)C)C(=O)N2 OHRURASPPZQGQM-UHFFFAOYSA-N 0.000 description 4
- 108010091666 romidepsin Proteins 0.000 description 4
- 201000000849 skin cancer Diseases 0.000 description 4
- 102000030938 small GTPase Human genes 0.000 description 4
- 108060007624 small GTPase Proteins 0.000 description 4
- 150000003384 small molecules Chemical class 0.000 description 4
- 239000011780 sodium chloride Substances 0.000 description 4
- 239000007787 solid Substances 0.000 description 4
- 235000019698 starch Nutrition 0.000 description 4
- 230000004083 survival effect Effects 0.000 description 4
- 239000000375 suspending agent Substances 0.000 description 4
- AYUNIORJHRXIBJ-TXHRRWQRSA-N tanespimycin Chemical compound N1C(=O)\C(C)=C\C=C/[C@H](OC)[C@@H](OC(N)=O)\C(C)=C\[C@H](C)[C@@H](O)[C@@H](OC)C[C@H](C)CC2=C(NCC=C)C(=O)C=C1C2=O AYUNIORJHRXIBJ-TXHRRWQRSA-N 0.000 description 4
- 201000003120 testicular cancer Diseases 0.000 description 4
- 230000000699 topical effect Effects 0.000 description 4
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 4
- LIRYPHYGHXZJBZ-UHFFFAOYSA-N trametinib Chemical compound CC(=O)NC1=CC=CC(N2C(N(C3CC3)C(=O)C3=C(NC=4C(=CC(I)=CC=4)F)N(C)C(=O)C(C)=C32)=O)=C1 LIRYPHYGHXZJBZ-UHFFFAOYSA-N 0.000 description 4
- 239000005483 tyrosine kinase inhibitor Substances 0.000 description 4
- 241000701161 unidentified adenovirus Species 0.000 description 4
- VBEQCZHXXJYVRD-GACYYNSASA-N uroanthelone Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C(C)C)[C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CS)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O)C(C)C)[C@@H](C)CC)C1=CC=C(O)C=C1 VBEQCZHXXJYVRD-GACYYNSASA-N 0.000 description 4
- UHTHHESEBZOYNR-UHFFFAOYSA-N vandetanib Chemical compound COC1=CC(C(/N=CN2)=N/C=3C(=CC(Br)=CC=3)F)=C2C=C1OCC1CCN(C)CC1 UHTHHESEBZOYNR-UHFFFAOYSA-N 0.000 description 4
- 229960001183 venetoclax Drugs 0.000 description 4
- AQTQHPDCURKLKT-JKDPCDLQSA-N vincristine sulfate Chemical compound OS(O)(=O)=O.C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C=O)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 AQTQHPDCURKLKT-JKDPCDLQSA-N 0.000 description 4
- 239000001993 wax Substances 0.000 description 4
- 239000000080 wetting agent Substances 0.000 description 4
- XRASPMIURGNCCH-UHFFFAOYSA-N zoledronic acid Chemical compound OP(=O)(O)C(P(O)(O)=O)(O)CN1C=CN=C1 XRASPMIURGNCCH-UHFFFAOYSA-N 0.000 description 4
- ZADWXFSZEAPBJS-SNVBAGLBSA-N (2r)-2-amino-3-(1-methylindol-3-yl)propanoic acid Chemical compound C1=CC=C2N(C)C=C(C[C@@H](N)C(O)=O)C2=C1 ZADWXFSZEAPBJS-SNVBAGLBSA-N 0.000 description 3
- 102100033793 ALK tyrosine kinase receptor Human genes 0.000 description 3
- 108091006112 ATPases Proteins 0.000 description 3
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- 102000057290 Adenosine Triphosphatases Human genes 0.000 description 3
- 102000009346 Adenosine receptors Human genes 0.000 description 3
- 108050000203 Adenosine receptors Proteins 0.000 description 3
- 102000043902 Angiomotin Human genes 0.000 description 3
- 108700020509 Angiomotin Proteins 0.000 description 3
- 102100021569 Apoptosis regulator Bcl-2 Human genes 0.000 description 3
- BFYIZQONLCFLEV-DAELLWKTSA-N Aromasine Chemical compound O=C1C=C[C@]2(C)[C@H]3CC[C@](C)(C(CC4)=O)[C@@H]4[C@@H]3CC(=C)C2=C1 BFYIZQONLCFLEV-DAELLWKTSA-N 0.000 description 3
- MLDQJTXFUGDVEO-UHFFFAOYSA-N BAY-43-9006 Chemical compound C1=NC(C(=O)NC)=CC(OC=2C=CC(NC(=O)NC=3C=C(C(Cl)=CC=3)C(F)(F)F)=CC=2)=C1 MLDQJTXFUGDVEO-UHFFFAOYSA-N 0.000 description 3
- 229940122361 Bisphosphonate Drugs 0.000 description 3
- 206010005003 Bladder cancer Diseases 0.000 description 3
- 208000006386 Bone Resorption Diseases 0.000 description 3
- 206010006143 Brain stem glioma Diseases 0.000 description 3
- 102100025221 CD70 antigen Human genes 0.000 description 3
- LMMJFBMMJUMSJS-UHFFFAOYSA-N CH5126766 Chemical compound CNS(=O)(=O)NC1=NC=CC(CC=2C(OC3=CC(OC=4N=CC=CN=4)=CC=C3C=2C)=O)=C1F LMMJFBMMJUMSJS-UHFFFAOYSA-N 0.000 description 3
- 108010021064 CTLA-4 Antigen Proteins 0.000 description 3
- 102000008203 CTLA-4 Antigen Human genes 0.000 description 3
- GAGWJHPBXLXJQN-UORFTKCHSA-N Capecitabine Chemical compound C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](C)O1 GAGWJHPBXLXJQN-UORFTKCHSA-N 0.000 description 3
- 201000009030 Carcinoma Diseases 0.000 description 3
- 208000017897 Carcinoma of esophagus Diseases 0.000 description 3
- 102000009410 Chemokine receptor Human genes 0.000 description 3
- 108050000299 Chemokine receptor Proteins 0.000 description 3
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 description 3
- 108020004414 DNA Proteins 0.000 description 3
- ZBNZXTGUTAYRHI-UHFFFAOYSA-N Dasatinib Chemical compound C=1C(N2CCN(CCO)CC2)=NC(C)=NC=1NC(S1)=NC=C1C(=O)NC1=C(C)C=CC=C1Cl ZBNZXTGUTAYRHI-UHFFFAOYSA-N 0.000 description 3
- 102400001368 Epidermal growth factor Human genes 0.000 description 3
- 101800003838 Epidermal growth factor Proteins 0.000 description 3
- 208000007207 Epithelioid hemangioendothelioma Diseases 0.000 description 3
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 3
- 208000006168 Ewing Sarcoma Diseases 0.000 description 3
- OVBPIULPVIDEAO-LBPRGKRZSA-N Folic acid Natural products C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-LBPRGKRZSA-N 0.000 description 3
- 208000022072 Gallbladder Neoplasms Diseases 0.000 description 3
- 108010069236 Goserelin Proteins 0.000 description 3
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 3
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 3
- 208000017604 Hodgkin disease Diseases 0.000 description 3
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 3
- 101000723543 Homo sapiens 14-3-3 protein theta Proteins 0.000 description 3
- 101000971171 Homo sapiens Apoptosis regulator Bcl-2 Proteins 0.000 description 3
- 101001066435 Homo sapiens Hepatocyte growth factor-like protein Proteins 0.000 description 3
- 101000880431 Homo sapiens Serine/threonine-protein kinase 4 Proteins 0.000 description 3
- 101000666896 Homo sapiens V-type immunoglobulin domain-containing suppressor of T-cell activation Proteins 0.000 description 3
- 241000714260 Human T-lymphotropic virus 1 Species 0.000 description 3
- 102100034980 ICOS ligand Human genes 0.000 description 3
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 3
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 3
- 102000014150 Interferons Human genes 0.000 description 3
- 108010050904 Interferons Proteins 0.000 description 3
- 102000012011 Isocitrate Dehydrogenase Human genes 0.000 description 3
- 108010075869 Isocitrate Dehydrogenase Proteins 0.000 description 3
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 3
- 102000042838 JAK family Human genes 0.000 description 3
- 108091082332 JAK family Proteins 0.000 description 3
- 239000002136 L01XE07 - Lapatinib Substances 0.000 description 3
- 239000002177 L01XE27 - Ibrutinib Substances 0.000 description 3
- 102000001419 Melatonin receptor Human genes 0.000 description 3
- 108050009605 Melatonin receptor Proteins 0.000 description 3
- 206010027476 Metastases Diseases 0.000 description 3
- 229940122255 Microtubule inhibitor Drugs 0.000 description 3
- 102000014415 Muscarinic acetylcholine receptor Human genes 0.000 description 3
- 108050003473 Muscarinic acetylcholine receptor Proteins 0.000 description 3
- 201000003793 Myelodysplastic syndrome Diseases 0.000 description 3
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 3
- VIUAUNHCRHHYNE-JTQLQIEISA-N N-[(2S)-2,3-dihydroxypropyl]-3-(2-fluoro-4-iodoanilino)-4-pyridinecarboxamide Chemical compound OC[C@@H](O)CNC(=O)C1=CC=NC=C1NC1=CC=C(I)C=C1F VIUAUNHCRHHYNE-JTQLQIEISA-N 0.000 description 3
- 206010029260 Neuroblastoma Diseases 0.000 description 3
- 201000010133 Oligodendroglioma Diseases 0.000 description 3
- 239000012828 PI3K inhibitor Substances 0.000 description 3
- 229930012538 Paclitaxel Natural products 0.000 description 3
- OAICVXFJPJFONN-UHFFFAOYSA-N Phosphorus Chemical compound [P] OAICVXFJPJFONN-UHFFFAOYSA-N 0.000 description 3
- 208000007641 Pinealoma Diseases 0.000 description 3
- 206010035226 Plasma cell myeloma Diseases 0.000 description 3
- 108010038512 Platelet-Derived Growth Factor Proteins 0.000 description 3
- 102000010780 Platelet-Derived Growth Factor Human genes 0.000 description 3
- 239000002202 Polyethylene glycol Substances 0.000 description 3
- OFOBLEOULBTSOW-UHFFFAOYSA-N Propanedioic acid Natural products OC(=O)CC(O)=O OFOBLEOULBTSOW-UHFFFAOYSA-N 0.000 description 3
- 108090000708 Proteasome Endopeptidase Complex Proteins 0.000 description 3
- 102000004245 Proteasome Endopeptidase Complex Human genes 0.000 description 3
- 108010014608 Proto-Oncogene Proteins c-kit Proteins 0.000 description 3
- 102000016971 Proto-Oncogene Proteins c-kit Human genes 0.000 description 3
- 206010038389 Renal cancer Diseases 0.000 description 3
- 201000000582 Retinoblastoma Diseases 0.000 description 3
- 102000042463 Rho family Human genes 0.000 description 3
- 108091078243 Rho family Proteins 0.000 description 3
- 229940127395 Ribonucleotide Reductase Inhibitors Drugs 0.000 description 3
- 108091007047 SCF complex Proteins 0.000 description 3
- 102000036366 SCF complex Human genes 0.000 description 3
- 208000004337 Salivary Gland Neoplasms Diseases 0.000 description 3
- 206010061934 Salivary gland cancer Diseases 0.000 description 3
- 206010039491 Sarcoma Diseases 0.000 description 3
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 3
- 102100037629 Serine/threonine-protein kinase 4 Human genes 0.000 description 3
- 102100028904 Serine/threonine-protein kinase MARK2 Human genes 0.000 description 3
- 229930006000 Sucrose Natural products 0.000 description 3
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 3
- 230000005867 T cell response Effects 0.000 description 3
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 3
- 229940123237 Taxane Drugs 0.000 description 3
- 108010017842 Telomerase Proteins 0.000 description 3
- 208000024770 Thyroid neoplasm Diseases 0.000 description 3
- 102000004243 Tubulin Human genes 0.000 description 3
- 108090000704 Tubulin Proteins 0.000 description 3
- 102100022203 Tumor necrosis factor receptor superfamily member 25 Human genes 0.000 description 3
- 102000014384 Type C Phospholipases Human genes 0.000 description 3
- 108010079194 Type C Phospholipases Proteins 0.000 description 3
- 102400000757 Ubiquitin Human genes 0.000 description 3
- 108090000848 Ubiquitin Proteins 0.000 description 3
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 3
- 102100038282 V-type immunoglobulin domain-containing suppressor of T-cell activation Human genes 0.000 description 3
- 241000700618 Vaccinia virus Species 0.000 description 3
- 108010053096 Vascular Endothelial Growth Factor Receptor-1 Proteins 0.000 description 3
- 102000016548 Vascular Endothelial Growth Factor Receptor-1 Human genes 0.000 description 3
- 208000014070 Vestibular schwannoma Diseases 0.000 description 3
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 3
- 208000004064 acoustic neuroma Diseases 0.000 description 3
- 239000004480 active ingredient Substances 0.000 description 3
- 239000013543 active substance Substances 0.000 description 3
- 235000010443 alginic acid Nutrition 0.000 description 3
- 229920000615 alginic acid Polymers 0.000 description 3
- 229910052784 alkaline earth metal Inorganic materials 0.000 description 3
- 125000003342 alkenyl group Chemical group 0.000 description 3
- 125000004450 alkenylene group Chemical group 0.000 description 3
- KUFRQPKVAWMTJO-LMZWQJSESA-N alvespimycin Chemical compound N1C(=O)\C(C)=C\C=C/[C@H](OC)[C@@H](OC(N)=O)\C(C)=C\[C@H](C)[C@@H](O)[C@@H](OC)C[C@H](C)CC2=C(NCCN(C)C)C(=O)C=C1C2=O KUFRQPKVAWMTJO-LMZWQJSESA-N 0.000 description 3
- 235000001014 amino acid Nutrition 0.000 description 3
- 125000000539 amino acid group Chemical group 0.000 description 3
- 230000003321 amplification Effects 0.000 description 3
- 230000033115 angiogenesis Effects 0.000 description 3
- 230000001772 anti-angiogenic effect Effects 0.000 description 3
- 229940046836 anti-estrogen Drugs 0.000 description 3
- 230000001833 anti-estrogenic effect Effects 0.000 description 3
- 230000002927 anti-mitotic effect Effects 0.000 description 3
- 230000006907 apoptotic process Effects 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 108010005774 beta-Galactosidase Proteins 0.000 description 3
- 239000011230 binding agent Substances 0.000 description 3
- 239000012472 biological sample Substances 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 150000004663 bisphosphonates Chemical class 0.000 description 3
- 230000024279 bone resorption Effects 0.000 description 3
- 229960001467 bortezomib Drugs 0.000 description 3
- 229940022399 cancer vaccine Drugs 0.000 description 3
- 238000009566 cancer vaccine Methods 0.000 description 3
- 150000001721 carbon Chemical group 0.000 description 3
- 229960004562 carboplatin Drugs 0.000 description 3
- 239000001768 carboxy methyl cellulose Substances 0.000 description 3
- SZMJVTADHFNAIS-BJMVGYQFSA-N chidamide Chemical compound NC1=CC(F)=CC=C1NC(=O)C(C=C1)=CC=C1CNC(=O)\C=C\C1=CC=CN=C1 SZMJVTADHFNAIS-BJMVGYQFSA-N 0.000 description 3
- 229950009221 chidamide Drugs 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 125000004122 cyclic group Chemical group 0.000 description 3
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 3
- 230000003436 cytoskeletal effect Effects 0.000 description 3
- 230000001086 cytosolic effect Effects 0.000 description 3
- 229940127089 cytotoxic agent Drugs 0.000 description 3
- 230000002950 deficient Effects 0.000 description 3
- 230000003111 delayed effect Effects 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- 239000003534 dna topoisomerase inhibitor Substances 0.000 description 3
- 229960003668 docetaxel Drugs 0.000 description 3
- 229940079593 drug Drugs 0.000 description 3
- 229950009791 durvalumab Drugs 0.000 description 3
- 239000000839 emulsion Substances 0.000 description 3
- 239000003623 enhancer Substances 0.000 description 3
- INVTYAOGFAGBOE-UHFFFAOYSA-N entinostat Chemical compound NC1=CC=CC=C1NC(=O)C(C=C1)=CC=C1CNC(=O)OCC1=CC=CN=C1 INVTYAOGFAGBOE-UHFFFAOYSA-N 0.000 description 3
- 229940116977 epidermal growth factor Drugs 0.000 description 3
- 229940011871 estrogen Drugs 0.000 description 3
- 239000000262 estrogen Substances 0.000 description 3
- 239000000328 estrogen antagonist Substances 0.000 description 3
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 3
- 229960005420 etoposide Drugs 0.000 description 3
- 229960000255 exemestane Drugs 0.000 description 3
- 150000004665 fatty acids Chemical class 0.000 description 3
- 239000000945 filler Substances 0.000 description 3
- 235000013305 food Nutrition 0.000 description 3
- 201000010175 gallbladder cancer Diseases 0.000 description 3
- 239000008187 granular material Substances 0.000 description 3
- 230000012010 growth Effects 0.000 description 3
- 208000014829 head and neck neoplasm Diseases 0.000 description 3
- 229940121372 histone deacetylase inhibitor Drugs 0.000 description 3
- 102000054552 human TEAD1 Human genes 0.000 description 3
- 229960001507 ibrutinib Drugs 0.000 description 3
- XYFPWWZEPKGCCK-GOSISDBHSA-N ibrutinib Chemical compound C1=2C(N)=NC=NC=2N([C@H]2CN(CCC2)C(=O)C=C)N=C1C(C=C1)=CC=C1OC1=CC=CC=C1 XYFPWWZEPKGCCK-GOSISDBHSA-N 0.000 description 3
- 229960000908 idarubicin Drugs 0.000 description 3
- 229960003445 idelalisib Drugs 0.000 description 3
- 238000009169 immunotherapy Methods 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- 238000001727 in vivo Methods 0.000 description 3
- 108091008042 inhibitory receptors Proteins 0.000 description 3
- 229960004768 irinotecan Drugs 0.000 description 3
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 3
- 201000010982 kidney cancer Diseases 0.000 description 3
- YGPSJZOEDVAXAB-UHFFFAOYSA-N kynurenine Chemical compound OC(=O)C(N)CC(=O)C1=CC=CC=C1N YGPSJZOEDVAXAB-UHFFFAOYSA-N 0.000 description 3
- 229960004891 lapatinib Drugs 0.000 description 3
- 229960003881 letrozole Drugs 0.000 description 3
- 208000032839 leukemia Diseases 0.000 description 3
- 230000004777 loss-of-function mutation Effects 0.000 description 3
- 239000000314 lubricant Substances 0.000 description 3
- 235000019359 magnesium stearate Nutrition 0.000 description 3
- 230000014759 maintenance of location Effects 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 206010027191 meningioma Diseases 0.000 description 3
- 229960001428 mercaptopurine Drugs 0.000 description 3
- 239000002207 metabolite Substances 0.000 description 3
- 230000001394 metastastic effect Effects 0.000 description 3
- 206010061289 metastatic neoplasm Diseases 0.000 description 3
- 231100000782 microtubule inhibitor Toxicity 0.000 description 3
- 230000005012 migration Effects 0.000 description 3
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 3
- 229960001156 mitoxantrone Drugs 0.000 description 3
- RDSACQWTXKSHJT-NSHDSACASA-N n-[3,4-difluoro-2-(2-fluoro-4-iodoanilino)-6-methoxyphenyl]-1-[(2s)-2,3-dihydroxypropyl]cyclopropane-1-sulfonamide Chemical compound C1CC1(C[C@H](O)CO)S(=O)(=O)NC=1C(OC)=CC(F)=C(F)C=1NC1=CC=C(I)C=C1F RDSACQWTXKSHJT-NSHDSACASA-N 0.000 description 3
- 229950004847 navitoclax Drugs 0.000 description 3
- JLYAXFNOILIKPP-KXQOOQHDSA-N navitoclax Chemical compound C([C@@H](NC1=CC=C(C=C1S(=O)(=O)C(F)(F)F)S(=O)(=O)NC(=O)C1=CC=C(C=C1)N1CCN(CC1)CC1=C(CCC(C1)(C)C)C=1C=CC(Cl)=CC=1)CSC=1C=CC=CC=1)CN1CCOCC1 JLYAXFNOILIKPP-KXQOOQHDSA-N 0.000 description 3
- 208000007538 neurilemmoma Diseases 0.000 description 3
- HHZIURLSWUIHRB-UHFFFAOYSA-N nilotinib Chemical compound C1=NC(C)=CN1C1=CC(NC(=O)C=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)=CC(C(F)(F)F)=C1 HHZIURLSWUIHRB-UHFFFAOYSA-N 0.000 description 3
- 230000005937 nuclear translocation Effects 0.000 description 3
- 238000003199 nucleic acid amplification method Methods 0.000 description 3
- 150000003833 nucleoside derivatives Chemical class 0.000 description 3
- 229960002450 ofatumumab Drugs 0.000 description 3
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 3
- 230000002246 oncogenic effect Effects 0.000 description 3
- 230000000174 oncolytic effect Effects 0.000 description 3
- 229960001756 oxaliplatin Drugs 0.000 description 3
- DWAFYCQODLXJNR-BNTLRKBRSA-L oxaliplatin Chemical compound O1C(=O)C(=O)O[Pt]11N[C@@H]2CCCC[C@H]2N1 DWAFYCQODLXJNR-BNTLRKBRSA-L 0.000 description 3
- 229960001592 paclitaxel Drugs 0.000 description 3
- 230000001575 pathological effect Effects 0.000 description 3
- 239000000816 peptidomimetic Substances 0.000 description 3
- 229960002087 pertuzumab Drugs 0.000 description 3
- 235000019271 petrolatum Nutrition 0.000 description 3
- 229940043441 phosphoinositide 3-kinase inhibitor Drugs 0.000 description 3
- 229910052698 phosphorus Inorganic materials 0.000 description 3
- 239000011574 phosphorus Substances 0.000 description 3
- 208000024724 pineal body neoplasm Diseases 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 239000003755 preservative agent Substances 0.000 description 3
- 208000029340 primitive neuroectodermal tumor Diseases 0.000 description 3
- 230000001737 promoting effect Effects 0.000 description 3
- 229950004043 radotinib Drugs 0.000 description 3
- GZUITABIAKMVPG-UHFFFAOYSA-N raloxifene Chemical compound C1=CC(O)=CC=C1C1=C(C(=O)C=2C=CC(OCCN3CCCCC3)=CC=2)C2=CC=C(O)C=C2S1 GZUITABIAKMVPG-UHFFFAOYSA-N 0.000 description 3
- 229960003452 romidepsin Drugs 0.000 description 3
- 206010039667 schwannoma Diseases 0.000 description 3
- 239000000333 selective estrogen receptor modulator Substances 0.000 description 3
- QFJCIRLUMZQUOT-HPLJOQBZSA-N sirolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 QFJCIRLUMZQUOT-HPLJOQBZSA-N 0.000 description 3
- 239000008247 solid mixture Substances 0.000 description 3
- 239000008107 starch Substances 0.000 description 3
- 150000003431 steroids Chemical class 0.000 description 3
- 239000005720 sucrose Substances 0.000 description 3
- 239000000829 suppository Substances 0.000 description 3
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 3
- 229960004964 temozolomide Drugs 0.000 description 3
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 3
- 229960001278 teniposide Drugs 0.000 description 3
- 125000000147 tetrahydroquinolinyl group Chemical group N1(CCCC2=CC=CC=C12)* 0.000 description 3
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- 229940044693 topoisomerase inhibitor Drugs 0.000 description 3
- 229960000303 topotecan Drugs 0.000 description 3
- 229960004066 trametinib Drugs 0.000 description 3
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 3
- 238000013518 transcription Methods 0.000 description 3
- 230000035897 transcription Effects 0.000 description 3
- 229960000575 trastuzumab Drugs 0.000 description 3
- 238000010798 ubiquitination Methods 0.000 description 3
- 230000034512 ubiquitination Effects 0.000 description 3
- 229960000241 vandetanib Drugs 0.000 description 3
- LQBVNQSMGBZMKD-UHFFFAOYSA-N venetoclax Chemical compound C=1C=C(Cl)C=CC=1C=1CC(C)(C)CCC=1CN(CC1)CCN1C(C=C1OC=2C=C3C=CNC3=NC=2)=CC=C1C(=O)NS(=O)(=O)C(C=C1[N+]([O-])=O)=CC=C1NCC1CCOCC1 LQBVNQSMGBZMKD-UHFFFAOYSA-N 0.000 description 3
- 229960004528 vincristine Drugs 0.000 description 3
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 3
- 230000003612 virological effect Effects 0.000 description 3
- 229960004276 zoledronic acid Drugs 0.000 description 3
- DNXHEGUUPJUMQT-UHFFFAOYSA-N (+)-estrone Natural products OC1=CC=C2C3CCC(C)(C(CC4)=O)C4C3CCC2=C1 DNXHEGUUPJUMQT-UHFFFAOYSA-N 0.000 description 2
- PUPZLCDOIYMWBV-UHFFFAOYSA-N (+/-)-1,3-Butanediol Chemical compound CC(O)CCO PUPZLCDOIYMWBV-UHFFFAOYSA-N 0.000 description 2
- YPBKTZBXSBLTDK-PKNBQFBNSA-N (3e)-3-[(3-bromo-4-fluoroanilino)-nitrosomethylidene]-4-[2-(sulfamoylamino)ethylamino]-1,2,5-oxadiazole Chemical group NS(=O)(=O)NCCNC1=NON\C1=C(N=O)/NC1=CC=C(F)C(Br)=C1 YPBKTZBXSBLTDK-PKNBQFBNSA-N 0.000 description 2
- CUKWUWBLQQDQAC-VEQWQPCFSA-N (3s)-3-amino-4-[[(2s)-1-[[(2s)-1-[[(2s)-1-[[(2s,3s)-1-[[(2s)-1-[(2s)-2-[[(1s)-1-carboxyethyl]carbamoyl]pyrrolidin-1-yl]-3-(1h-imidazol-5-yl)-1-oxopropan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-3-methyl-1-ox Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@@H](N)CC(O)=O)C(C)C)C1=CC=C(O)C=C1 CUKWUWBLQQDQAC-VEQWQPCFSA-N 0.000 description 2
- NBRQRXRBIHVLGI-OWXODZSWSA-N (4as,5ar,12ar)-1,10,11,12a-tetrahydroxy-3,12-dioxo-4a,5,5a,6-tetrahydro-4h-tetracene-2-carboxamide Chemical compound C1C2=CC=CC(O)=C2C(O)=C(C2=O)[C@@H]1C[C@@H]1[C@@]2(O)C(O)=C(C(=O)N)C(=O)C1 NBRQRXRBIHVLGI-OWXODZSWSA-N 0.000 description 2
- WRIDQFICGBMAFQ-UHFFFAOYSA-N (E)-8-Octadecenoic acid Natural products CCCCCCCCCC=CCCCCCCC(O)=O WRIDQFICGBMAFQ-UHFFFAOYSA-N 0.000 description 2
- UMGQVUWXNOJOSJ-KMHUVPDISA-N (e)-2-cyano-3-(3,4-dihydroxyphenyl)-n-[(1r)-1-phenylethyl]prop-2-enamide Chemical compound N([C@H](C)C=1C=CC=CC=1)C(=O)C(\C#N)=C\C1=CC=C(O)C(O)=C1 UMGQVUWXNOJOSJ-KMHUVPDISA-N 0.000 description 2
- VBICKXHEKHSIBG-UHFFFAOYSA-N 1-monostearoylglycerol Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(O)CO VBICKXHEKHSIBG-UHFFFAOYSA-N 0.000 description 2
- CNWINRVXAYPOMW-FCNJXWMTSA-N 1-stearoyl-2-arachidonoyl-sn-glycero-3-phospho-1D-myo-inositol 4,5-biphosphate Chemical compound CCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCC(=O)O[C@H](COC(=O)CCCCCCCCCCCCCCCCC)COP(O)(=O)O[C@@H]1[C@H](O)[C@H](O)[C@@H](OP(O)(O)=O)[C@H](OP(O)(O)=O)[C@H]1O CNWINRVXAYPOMW-FCNJXWMTSA-N 0.000 description 2
- 101710112812 14-3-3 protein Proteins 0.000 description 2
- PDGKHKMBHVFCMG-UHFFFAOYSA-N 2-[[5-(4-methylpiperazin-1-yl)pyridin-2-yl]amino]spiro[7,8-dihydropyrazino[5,6]pyrrolo[1,2-d]pyrimidine-9,1'-cyclohexane]-6-one Chemical compound C1CN(C)CCN1C(C=N1)=CC=C1NC1=NC=C(C=C2N3C4(CCCCC4)CNC2=O)C3=N1 PDGKHKMBHVFCMG-UHFFFAOYSA-N 0.000 description 2
- RGHYDLZMTYDBDT-UHFFFAOYSA-N 2-amino-8-ethyl-4-methyl-6-(1H-pyrazol-5-yl)-7-pyrido[2,3-d]pyrimidinone Chemical compound O=C1N(CC)C2=NC(N)=NC(C)=C2C=C1C=1C=CNN=1 RGHYDLZMTYDBDT-UHFFFAOYSA-N 0.000 description 2
- QINPEPAQOBZPOF-UHFFFAOYSA-N 2-amino-n-[3-[[3-(2-chloro-5-methoxyanilino)quinoxalin-2-yl]sulfamoyl]phenyl]-2-methylpropanamide Chemical compound COC1=CC=C(Cl)C(NC=2C(=NC3=CC=CC=C3N=2)NS(=O)(=O)C=2C=C(NC(=O)C(C)(C)N)C=CC=2)=C1 QINPEPAQOBZPOF-UHFFFAOYSA-N 0.000 description 2
- BEUQXVWXFDOSAQ-UHFFFAOYSA-N 2-methyl-2-[4-[2-(5-methyl-2-propan-2-yl-1,2,4-triazol-3-yl)-5,6-dihydroimidazo[1,2-d][1,4]benzoxazepin-9-yl]pyrazol-1-yl]propanamide Chemical compound CC(C)N1N=C(C)N=C1C1=CN(CCOC=2C3=CC=C(C=2)C2=CN(N=C2)C(C)(C)C(N)=O)C3=N1 BEUQXVWXFDOSAQ-UHFFFAOYSA-N 0.000 description 2
- LQJBNNIYVWPHFW-UHFFFAOYSA-N 20:1omega9c fatty acid Natural products CCCCCCCCCCC=CCCCCCCCC(O)=O LQJBNNIYVWPHFW-UHFFFAOYSA-N 0.000 description 2
- NHFDRBXTEDBWCZ-ZROIWOOFSA-N 3-[2,4-dimethyl-5-[(z)-(2-oxo-1h-indol-3-ylidene)methyl]-1h-pyrrol-3-yl]propanoic acid Chemical compound OC(=O)CCC1=C(C)NC(\C=C/2C3=CC=CC=C3NC\2=O)=C1C NHFDRBXTEDBWCZ-ZROIWOOFSA-N 0.000 description 2
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 2
- CLPFFLWZZBQMAO-UHFFFAOYSA-N 4-(5,6,7,8-tetrahydroimidazo[1,5-a]pyridin-5-yl)benzonitrile Chemical compound C1=CC(C#N)=CC=C1C1N2C=NC=C2CCC1 CLPFFLWZZBQMAO-UHFFFAOYSA-N 0.000 description 2
- BGLPECHZZQDNCD-UHFFFAOYSA-N 4-(cyclopropylamino)-2-[4-(4-ethylsulfonylpiperazin-1-yl)anilino]pyrimidine-5-carboxamide Chemical compound C1CN(S(=O)(=O)CC)CCN1C(C=C1)=CC=C1NC1=NC=C(C(N)=O)C(NC2CC2)=N1 BGLPECHZZQDNCD-UHFFFAOYSA-N 0.000 description 2
- 102000002627 4-1BB Ligand Human genes 0.000 description 2
- 108010082808 4-1BB Ligand Proteins 0.000 description 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- GUDJFFQZIISQJB-UHFFFAOYSA-N 4-cyano-5-(3,5-dichloropyridin-4-yl)sulfanyl-n-(4-methylsulfonylphenyl)thiophene-2-carboxamide Chemical compound C1=CC(S(=O)(=O)C)=CC=C1NC(=O)C(S1)=CC(C#N)=C1SC1=C(Cl)C=NC=C1Cl GUDJFFQZIISQJB-UHFFFAOYSA-N 0.000 description 2
- NMUSYJAQQFHJEW-KVTDHHQDSA-N 5-azacytidine Chemical compound O=C1N=C(N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 NMUSYJAQQFHJEW-KVTDHHQDSA-N 0.000 description 2
- 102100040385 5-hydroxytryptamine receptor 4 Human genes 0.000 description 2
- 101710150225 5-hydroxytryptamine receptor 4 Proteins 0.000 description 2
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 2
- SJVQHLPISAIATJ-ZDUSSCGKSA-N 8-chloro-2-phenyl-3-[(1S)-1-(7H-purin-6-ylamino)ethyl]-1-isoquinolinone Chemical compound C1([C@@H](NC=2C=3N=CNC=3N=CN=2)C)=CC2=CC=CC(Cl)=C2C(=O)N1C1=CC=CC=C1 SJVQHLPISAIATJ-ZDUSSCGKSA-N 0.000 description 2
- QSBYPNXLFMSGKH-UHFFFAOYSA-N 9-Heptadecensaeure Natural products CCCCCCCC=CCCCCCCCC(O)=O QSBYPNXLFMSGKH-UHFFFAOYSA-N 0.000 description 2
- 101150056293 AJUBA gene Proteins 0.000 description 2
- 108010022579 ATP dependent 26S protease Proteins 0.000 description 2
- 102000007469 Actins Human genes 0.000 description 2
- 108010085238 Actins Proteins 0.000 description 2
- 206010000830 Acute leukaemia Diseases 0.000 description 2
- 108060003345 Adrenergic Receptor Proteins 0.000 description 2
- 102000017910 Adrenergic receptor Human genes 0.000 description 2
- OGSPWJRAVKPPFI-UHFFFAOYSA-N Alendronic Acid Chemical compound NCCCC(O)(P(O)(O)=O)P(O)(O)=O OGSPWJRAVKPPFI-UHFFFAOYSA-N 0.000 description 2
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 2
- 206010061424 Anal cancer Diseases 0.000 description 2
- 102100032187 Androgen receptor Human genes 0.000 description 2
- 102400000345 Angiotensin-2 Human genes 0.000 description 2
- 101800000733 Angiotensin-2 Proteins 0.000 description 2
- 208000007860 Anus Neoplasms Diseases 0.000 description 2
- 102000004452 Arginase Human genes 0.000 description 2
- 108700024123 Arginases Proteins 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 2
- CWHUFRVAEUJCEF-UHFFFAOYSA-N BKM120 Chemical compound C1=NC(N)=CC(C(F)(F)F)=C1C1=CC(N2CCOCC2)=NC(N2CCOCC2)=N1 CWHUFRVAEUJCEF-UHFFFAOYSA-N 0.000 description 2
- 206010004146 Basal cell carcinoma Diseases 0.000 description 2
- 206010005949 Bone cancer Diseases 0.000 description 2
- 208000018084 Bone neoplasm Diseases 0.000 description 2
- 229940121697 CD27 agonist Drugs 0.000 description 2
- 102100027207 CD27 antigen Human genes 0.000 description 2
- 102100038078 CD276 antigen Human genes 0.000 description 2
- 229940123189 CD40 agonist Drugs 0.000 description 2
- 229940122551 CD40 antagonist Drugs 0.000 description 2
- 108010001789 Calcitonin Receptors Proteins 0.000 description 2
- 102100038520 Calcitonin receptor Human genes 0.000 description 2
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 2
- VTYYLEPIZMXCLO-UHFFFAOYSA-L Calcium carbonate Chemical compound [Ca+2].[O-]C([O-])=O VTYYLEPIZMXCLO-UHFFFAOYSA-L 0.000 description 2
- 108010050543 Calcium-Sensing Receptors Proteins 0.000 description 2
- GAGWJHPBXLXJQN-UHFFFAOYSA-N Capecitabine Natural products C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1C1C(O)C(O)C(C)O1 GAGWJHPBXLXJQN-UHFFFAOYSA-N 0.000 description 2
- 101710167800 Capsid assembly scaffolding protein Proteins 0.000 description 2
- 239000004215 Carbon black (E152) Substances 0.000 description 2
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 2
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 2
- 206010008342 Cervix carcinoma Diseases 0.000 description 2
- 108091006146 Channels Proteins 0.000 description 2
- 201000009047 Chordoma Diseases 0.000 description 2
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 2
- 208000027205 Congenital disease Diseases 0.000 description 2
- 108010074311 Corticotropin Receptors Proteins 0.000 description 2
- IVOMOUWHDPKRLL-KQYNXXCUSA-N Cyclic adenosine monophosphate Chemical compound C([C@H]1O2)OP(O)(=O)O[C@H]1[C@@H](O)[C@@H]2N1C(N=CN=C2N)=C2N=C1 IVOMOUWHDPKRLL-KQYNXXCUSA-N 0.000 description 2
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 2
- 102000005927 Cysteine Proteases Human genes 0.000 description 2
- 108010005843 Cysteine Proteases Proteins 0.000 description 2
- 230000006820 DNA synthesis Effects 0.000 description 2
- 229940123780 DNA topoisomerase I inhibitor Drugs 0.000 description 2
- 229940124087 DNA topoisomerase II inhibitor Drugs 0.000 description 2
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 2
- 102000015554 Dopamine receptor Human genes 0.000 description 2
- 108050004812 Dopamine receptor Proteins 0.000 description 2
- XXPXYPLPSDPERN-UHFFFAOYSA-N Ecteinascidin 743 Natural products COc1cc2C(NCCc2cc1O)C(=O)OCC3N4C(O)C5Cc6cc(C)c(OC)c(O)c6C(C4C(S)c7c(OC(=O)C)c(C)c8OCOc8c37)N5C XXPXYPLPSDPERN-UHFFFAOYSA-N 0.000 description 2
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 2
- DNXHEGUUPJUMQT-CBZIJGRNSA-N Estrone Chemical compound OC1=CC=C2[C@H]3CC[C@](C)(C(CC4)=O)[C@@H]4[C@@H]3CCC2=C1 DNXHEGUUPJUMQT-CBZIJGRNSA-N 0.000 description 2
- HKVAMNSJSFKALM-GKUWKFKPSA-N Everolimus Chemical compound C1C[C@@H](OCCO)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 HKVAMNSJSFKALM-GKUWKFKPSA-N 0.000 description 2
- 108010066805 F-Box Proteins Proteins 0.000 description 2
- 102000018700 F-Box Proteins Human genes 0.000 description 2
- 102100038576 F-box/WD repeat-containing protein 1A Human genes 0.000 description 2
- 108091008794 FGF receptors Proteins 0.000 description 2
- 108010060374 FSH Receptors Proteins 0.000 description 2
- 102000008175 FSH Receptors Human genes 0.000 description 2
- 102000044168 Fibroblast Growth Factor Receptor Human genes 0.000 description 2
- 201000008808 Fibrosarcoma Diseases 0.000 description 2
- VWUXBMIQPBEWFH-WCCTWKNTSA-N Fulvestrant Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3[C@H](CCCCCCCCCS(=O)CCCC(F)(F)C(F)(F)F)CC2=C1 VWUXBMIQPBEWFH-WCCTWKNTSA-N 0.000 description 2
- RFWVETIZUQEJEF-UHFFFAOYSA-N GDC-0623 Chemical compound OCCONC(=O)C=1C=CC2=CN=CN2C=1NC1=CC=C(I)C=C1F RFWVETIZUQEJEF-UHFFFAOYSA-N 0.000 description 2
- 206010051066 Gastrointestinal stromal tumour Diseases 0.000 description 2
- 201000010915 Glioblastoma multiforme Diseases 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 102000003886 Glycoproteins Human genes 0.000 description 2
- 108090000288 Glycoproteins Proteins 0.000 description 2
- 244000060234 Gmelina philippensis Species 0.000 description 2
- 102400000932 Gonadoliberin-1 Human genes 0.000 description 2
- 239000000579 Gonadotropin-Releasing Hormone Substances 0.000 description 2
- BLCLNMBMMGCOAS-URPVMXJPSA-N Goserelin Chemical compound C([C@@H](C(=O)N[C@H](COC(C)(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N1[C@@H](CCC1)C(=O)NNC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H]1NC(=O)CC1)C1=CC=C(O)C=C1 BLCLNMBMMGCOAS-URPVMXJPSA-N 0.000 description 2
- 101150112082 Gpnmb gene Proteins 0.000 description 2
- 108091006065 Gs proteins Proteins 0.000 description 2
- ZRALSGWEFCBTJO-UHFFFAOYSA-N Guanidine Chemical compound NC(N)=N ZRALSGWEFCBTJO-UHFFFAOYSA-N 0.000 description 2
- 102100036738 Guanine nucleotide-binding protein subunit alpha-11 Human genes 0.000 description 2
- 208000002250 Hematologic Neoplasms Diseases 0.000 description 2
- NTYJJOPFIAHURM-UHFFFAOYSA-N Histamine Chemical compound NCCC1=CN=CN1 NTYJJOPFIAHURM-UHFFFAOYSA-N 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101000678419 Homo sapiens Adrenocorticotropic hormone receptor Proteins 0.000 description 2
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 description 2
- 101000934356 Homo sapiens CD70 antigen Proteins 0.000 description 2
- 101500026183 Homo sapiens Gonadoliberin-1 Proteins 0.000 description 2
- 101001072407 Homo sapiens Guanine nucleotide-binding protein subunit alpha-11 Proteins 0.000 description 2
- 101001019455 Homo sapiens ICOS ligand Proteins 0.000 description 2
- 101001059454 Homo sapiens Serine/threonine-protein kinase MARK2 Proteins 0.000 description 2
- 101000716693 Homo sapiens Sodium/iodide cotransporter Proteins 0.000 description 2
- 101000610604 Homo sapiens Tumor necrosis factor receptor superfamily member 10B Proteins 0.000 description 2
- 101000679903 Homo sapiens Tumor necrosis factor receptor superfamily member 25 Proteins 0.000 description 2
- 101000679907 Homo sapiens Tumor necrosis factor receptor superfamily member 27 Proteins 0.000 description 2
- 101000679857 Homo sapiens Tumor necrosis factor receptor superfamily member 3 Proteins 0.000 description 2
- 101000920026 Homo sapiens Tumor necrosis factor receptor superfamily member EDAR Proteins 0.000 description 2
- 101001087426 Homo sapiens Tyrosine-protein phosphatase non-receptor type 14 Proteins 0.000 description 2
- 101000759994 Homo sapiens Ubiquitin carboxyl-terminal hydrolase 47 Proteins 0.000 description 2
- 101000807859 Homo sapiens Vasopressin V2 receptor Proteins 0.000 description 2
- 241000725303 Human immunodeficiency virus Species 0.000 description 2
- 241000701806 Human papillomavirus Species 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 2
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 2
- 108010031794 IGF Type 1 Receptor Proteins 0.000 description 2
- MPBVHIBUJCELCL-UHFFFAOYSA-N Ibandronate Chemical compound CCCCCN(C)CCC(O)(P(O)(O)=O)P(O)(O)=O MPBVHIBUJCELCL-UHFFFAOYSA-N 0.000 description 2
- VDJHFHXMUKFKET-UHFFFAOYSA-N Ingenol mebutate Natural products CC1CC2C(C)(C)C2C2C=C(CO)C(O)C3(O)C(OC(=O)C(C)=CC)C(C)=CC31C2=O VDJHFHXMUKFKET-UHFFFAOYSA-N 0.000 description 2
- 102100039688 Insulin-like growth factor 1 receptor Human genes 0.000 description 2
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 2
- 239000002147 L01XE04 - Sunitinib Substances 0.000 description 2
- 239000005511 L01XE05 - Sorafenib Substances 0.000 description 2
- 239000005536 L01XE08 - Nilotinib Substances 0.000 description 2
- 239000002144 L01XE18 - Ruxolitinib Substances 0.000 description 2
- 229930186657 Lat Natural products 0.000 description 2
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 2
- 241000712899 Lymphocytic choriomeningitis mammarenavirus Species 0.000 description 2
- 102000004083 Lymphotoxin-alpha Human genes 0.000 description 2
- 108090000542 Lymphotoxin-alpha Proteins 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- 108091054455 MAP kinase family Proteins 0.000 description 2
- 102000043136 MAP kinase family Human genes 0.000 description 2
- MVBPAIHFZZKRGD-UHFFFAOYSA-N MTIC Chemical compound CNN=NC=1NC=NC=1C(N)=O MVBPAIHFZZKRGD-UHFFFAOYSA-N 0.000 description 2
- 102100028198 Macrophage colony-stimulating factor 1 receptor Human genes 0.000 description 2
- 101710150918 Macrophage colony-stimulating factor 1 receptor Proteins 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 102000002274 Matrix Metalloproteinases Human genes 0.000 description 2
- 108010000684 Matrix Metalloproteinases Proteins 0.000 description 2
- 102100036837 Metabotropic glutamate receptor 2 Human genes 0.000 description 2
- 102100038354 Metabotropic glutamate receptor 4 Human genes 0.000 description 2
- 102100038294 Metabotropic glutamate receptor 7 Human genes 0.000 description 2
- 208000034578 Multiple myelomas Diseases 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 2
- OVBPIULPVIDEAO-UHFFFAOYSA-N N-Pteroyl-L-glutaminsaeure Natural products C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-UHFFFAOYSA-N 0.000 description 2
- 229910002651 NO3 Inorganic materials 0.000 description 2
- 206010067193 Naevus flammeus Diseases 0.000 description 2
- NHNBFGGVMKEFGY-UHFFFAOYSA-N Nitrate Chemical compound [O-][N+]([O-])=O NHNBFGGVMKEFGY-UHFFFAOYSA-N 0.000 description 2
- 239000005642 Oleic acid Substances 0.000 description 2
- ZQPPMHVWECSIRJ-UHFFFAOYSA-N Oleic acid Natural products CCCCCCCCC=CCCCCCCCC(O)=O ZQPPMHVWECSIRJ-UHFFFAOYSA-N 0.000 description 2
- 206010073338 Optic glioma Diseases 0.000 description 2
- SUDAHWBOROXANE-SECBINFHSA-N PD 0325901 Chemical compound OC[C@@H](O)CONC(=O)C1=CC=C(F)C(F)=C1NC1=CC=C(I)C=C1F SUDAHWBOROXANE-SECBINFHSA-N 0.000 description 2
- 229940124060 PD-1 antagonist Drugs 0.000 description 2
- 229940123751 PD-L1 antagonist Drugs 0.000 description 2
- HZLFFNCLTRVYJG-WWGOJCOQSA-N Patidegib Chemical compound C([C@@]1(CC(C)=C2C3)O[C@@H]4C[C@H](C)CN[C@H]4[C@H]1C)C[C@H]2[C@H]1[C@H]3[C@@]2(C)CC[C@@H](NS(C)(=O)=O)C[C@H]2CC1 HZLFFNCLTRVYJG-WWGOJCOQSA-N 0.000 description 2
- 208000027190 Peripheral T-cell lymphomas Diseases 0.000 description 2
- 239000004264 Petrolatum Substances 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 2
- 208000007913 Pituitary Neoplasms Diseases 0.000 description 2
- 102000012338 Poly(ADP-ribose) Polymerases Human genes 0.000 description 2
- 108010061844 Poly(ADP-ribose) Polymerases Proteins 0.000 description 2
- 229920000776 Poly(Adenosine diphosphate-ribose) polymerase Polymers 0.000 description 2
- 208000006787 Port-Wine Stain Diseases 0.000 description 2
- 101710130420 Probable capsid assembly scaffolding protein Proteins 0.000 description 2
- 108010050183 Prostaglandin Receptors Proteins 0.000 description 2
- 102000015433 Prostaglandin Receptors Human genes 0.000 description 2
- 108010029485 Protein Isoforms Proteins 0.000 description 2
- 102000001708 Protein Isoforms Human genes 0.000 description 2
- 108090000315 Protein Kinase C Proteins 0.000 description 2
- 102000003923 Protein Kinase C Human genes 0.000 description 2
- 102000009516 Protein Serine-Threonine Kinases Human genes 0.000 description 2
- 108010009341 Protein Serine-Threonine Kinases Proteins 0.000 description 2
- 102000014128 RANK Ligand Human genes 0.000 description 2
- 108010025832 RANK Ligand Proteins 0.000 description 2
- 102000000341 S-Phase Kinase-Associated Proteins Human genes 0.000 description 2
- 108010055623 S-Phase Kinase-Associated Proteins Proteins 0.000 description 2
- 108010040181 SF 1126 Proteins 0.000 description 2
- 101710204410 Scaffold protein Proteins 0.000 description 2
- 102100023085 Serine/threonine-protein kinase mTOR Human genes 0.000 description 2
- XUIMIQQOPSSXEZ-UHFFFAOYSA-N Silicon Chemical compound [Si] XUIMIQQOPSSXEZ-UHFFFAOYSA-N 0.000 description 2
- 102000013380 Smoothened Receptor Human genes 0.000 description 2
- 108010090739 Smoothened Receptor Proteins 0.000 description 2
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 2
- 108050001286 Somatostatin Receptor Proteins 0.000 description 2
- 102000011096 Somatostatin receptor Human genes 0.000 description 2
- 101000857870 Squalus acanthias Gonadoliberin Proteins 0.000 description 2
- 208000005718 Stomach Neoplasms Diseases 0.000 description 2
- 206010042265 Sturge-Weber Syndrome Diseases 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- 208000031672 T-Cell Peripheral Lymphoma Diseases 0.000 description 2
- 108010065917 TOR Serine-Threonine Kinases Proteins 0.000 description 2
- CBPNZQVSJQDFBE-FUXHJELOSA-N Temsirolimus Chemical compound C1C[C@@H](OC(=O)C(C)(CO)CO)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 CBPNZQVSJQDFBE-FUXHJELOSA-N 0.000 description 2
- 102000003938 Thromboxane Receptors Human genes 0.000 description 2
- 108090000300 Thromboxane Receptors Proteins 0.000 description 2
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 2
- 102000011923 Thyrotropin Human genes 0.000 description 2
- 108010061174 Thyrotropin Proteins 0.000 description 2
- DKJJVAGXPKPDRL-UHFFFAOYSA-N Tiludronic acid Chemical compound OP(O)(=O)C(P(O)(O)=O)SC1=CC=C(Cl)C=C1 DKJJVAGXPKPDRL-UHFFFAOYSA-N 0.000 description 2
- 239000000365 Topoisomerase I Inhibitor Substances 0.000 description 2
- 239000000317 Topoisomerase II Inhibitor Substances 0.000 description 2
- 102100040114 Trace amine-associated receptor 1 Human genes 0.000 description 2
- 108090000946 Trace amine-associated receptor 1 Proteins 0.000 description 2
- 102100040112 Tumor necrosis factor receptor superfamily member 10B Human genes 0.000 description 2
- 102100022202 Tumor necrosis factor receptor superfamily member 27 Human genes 0.000 description 2
- 102100022156 Tumor necrosis factor receptor superfamily member 3 Human genes 0.000 description 2
- 102100030810 Tumor necrosis factor receptor superfamily member EDAR Human genes 0.000 description 2
- 102100033015 Tyrosine-protein phosphatase non-receptor type 14 Human genes 0.000 description 2
- 102100025029 Ubiquitin carboxyl-terminal hydrolase 47 Human genes 0.000 description 2
- 108010091546 Ubiquitin-Activating Enzymes Proteins 0.000 description 2
- 102000018478 Ubiquitin-Activating Enzymes Human genes 0.000 description 2
- 102000018390 Ubiquitin-Specific Proteases Human genes 0.000 description 2
- 108010066496 Ubiquitin-Specific Proteases Proteins 0.000 description 2
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 2
- 208000002495 Uterine Neoplasms Diseases 0.000 description 2
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 description 2
- 102100037108 Vasopressin V2 receptor Human genes 0.000 description 2
- 241000711975 Vesicular stomatitis virus Species 0.000 description 2
- HGVNLRPZOWWDKD-UHFFFAOYSA-N ZSTK-474 Chemical compound FC(F)C1=NC2=CC=CC=C2N1C(N=1)=NC(N2CCOCC2)=NC=1N1CCOCC1 HGVNLRPZOWWDKD-UHFFFAOYSA-N 0.000 description 2
- IEDXPSOJFSVCKU-HOKPPMCLSA-N [4-[[(2S)-5-(carbamoylamino)-2-[[(2S)-2-[6-(2,5-dioxopyrrolidin-1-yl)hexanoylamino]-3-methylbutanoyl]amino]pentanoyl]amino]phenyl]methyl N-[(2S)-1-[[(2S)-1-[[(3R,4S,5S)-1-[(2S)-2-[(1R,2R)-3-[[(1S,2R)-1-hydroxy-1-phenylpropan-2-yl]amino]-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl]-3-methoxy-5-methyl-1-oxoheptan-4-yl]-methylamino]-3-methyl-1-oxobutan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]-N-methylcarbamate Chemical compound CC[C@H](C)[C@@H]([C@@H](CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C)[C@@H](O)c1ccccc1)OC)N(C)C(=O)[C@@H](NC(=O)[C@H](C(C)C)N(C)C(=O)OCc1ccc(NC(=O)[C@H](CCCNC(N)=O)NC(=O)[C@@H](NC(=O)CCCCCN2C(=O)CCC2=O)C(C)C)cc1)C(C)C IEDXPSOJFSVCKU-HOKPPMCLSA-N 0.000 description 2
- GZOSMCIZMLWJML-VJLLXTKPSA-N abiraterone Chemical compound C([C@H]1[C@H]2[C@@H]([C@]3(CC[C@H](O)CC3=CC2)C)CC[C@@]11C)C=C1C1=CC=CN=C1 GZOSMCIZMLWJML-VJLLXTKPSA-N 0.000 description 2
- 230000002159 abnormal effect Effects 0.000 description 2
- 102000035181 adaptor proteins Human genes 0.000 description 2
- 108091005764 adaptor proteins Proteins 0.000 description 2
- 208000009956 adenocarcinoma Diseases 0.000 description 2
- 108060000200 adenylate cyclase Proteins 0.000 description 2
- 102000030621 adenylate cyclase Human genes 0.000 description 2
- 210000002867 adherens junction Anatomy 0.000 description 2
- 229960004343 alendronic acid Drugs 0.000 description 2
- AWUCVROLDVIAJX-UHFFFAOYSA-N alpha-glycerophosphate Natural products OCC(O)COP(O)(O)=O AWUCVROLDVIAJX-UHFFFAOYSA-N 0.000 description 2
- 229960003437 aminoglutethimide Drugs 0.000 description 2
- ROBVIMPUHSLWNV-UHFFFAOYSA-N aminoglutethimide Chemical compound C=1C=C(N)C=CC=1C1(CC)CCC(=O)NC1=O ROBVIMPUHSLWNV-UHFFFAOYSA-N 0.000 description 2
- 229960002932 anastrozole Drugs 0.000 description 2
- YBBLVLTVTVSKRW-UHFFFAOYSA-N anastrozole Chemical compound N#CC(C)(C)C1=CC(C(C)(C#N)C)=CC(CN2N=CN=C2)=C1 YBBLVLTVTVSKRW-UHFFFAOYSA-N 0.000 description 2
- 108010080146 androgen receptors Proteins 0.000 description 2
- 229950006323 angiotensin ii Drugs 0.000 description 2
- 230000002280 anti-androgenic effect Effects 0.000 description 2
- 230000006909 anti-apoptosis Effects 0.000 description 2
- 239000000051 antiandrogen Substances 0.000 description 2
- 239000002814 antineoplastic antimetabolite Substances 0.000 description 2
- 201000011165 anus cancer Diseases 0.000 description 2
- 239000007900 aqueous suspension Substances 0.000 description 2
- 229940126313 avutometinib Drugs 0.000 description 2
- 229960002756 azacitidine Drugs 0.000 description 2
- ZAXCMPAWRCMABN-UHFFFAOYSA-N azane;2-hydroxyacetic acid;platinum Chemical compound N.N.[Pt].OCC(O)=O ZAXCMPAWRCMABN-UHFFFAOYSA-N 0.000 description 2
- 239000002585 base Substances 0.000 description 2
- NCNRHFGMJRPRSK-MDZDMXLPSA-N belinostat Chemical compound ONC(=O)\C=C\C1=CC=CC(S(=O)(=O)NC=2C=CC=CC=2)=C1 NCNRHFGMJRPRSK-MDZDMXLPSA-N 0.000 description 2
- XSCHRSMBECNVNS-UHFFFAOYSA-N benzopyrazine Natural products N1=CC=NC2=CC=CC=C21 XSCHRSMBECNVNS-UHFFFAOYSA-N 0.000 description 2
- 235000019445 benzyl alcohol Nutrition 0.000 description 2
- SESFRYSPDFLNCH-UHFFFAOYSA-N benzyl benzoate Chemical compound C=1C=CC=CC=1C(=O)OCC1=CC=CC=C1 SESFRYSPDFLNCH-UHFFFAOYSA-N 0.000 description 2
- WQZGKKKJIJFFOK-FPRJBGLDSA-N beta-D-galactose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-FPRJBGLDSA-N 0.000 description 2
- 125000002618 bicyclic heterocycle group Chemical group 0.000 description 2
- 229950003054 binimetinib Drugs 0.000 description 2
- 229920002988 biodegradable polymer Polymers 0.000 description 2
- 239000004621 biodegradable polymer Substances 0.000 description 2
- 230000008512 biological response Effects 0.000 description 2
- 229960003008 blinatumomab Drugs 0.000 description 2
- 229960000455 brentuximab vedotin Drugs 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 239000006172 buffering agent Substances 0.000 description 2
- 229950003628 buparlisib Drugs 0.000 description 2
- BMQGVNUXMIRLCK-OAGWZNDDSA-N cabazitaxel Chemical compound O([C@H]1[C@@H]2[C@]3(OC(C)=O)CO[C@@H]3C[C@@H]([C@]2(C(=O)[C@H](OC)C2=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=3C=CC=CC=3)C[C@]1(O)C2(C)C)C)OC)C(=O)C1=CC=CC=C1 BMQGVNUXMIRLCK-OAGWZNDDSA-N 0.000 description 2
- 229960001573 cabazitaxel Drugs 0.000 description 2
- 239000011575 calcium Substances 0.000 description 2
- 229910052791 calcium Inorganic materials 0.000 description 2
- 229960004117 capecitabine Drugs 0.000 description 2
- 125000002837 carbocyclic group Chemical group 0.000 description 2
- 125000004432 carbon atom Chemical group C* 0.000 description 2
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 2
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 2
- 108010021331 carfilzomib Proteins 0.000 description 2
- BLMPQMFVWMYDKT-NZTKNTHTSA-N carfilzomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)[C@]1(C)OC1)NC(=O)CN1CCOCC1)CC1=CC=CC=C1 BLMPQMFVWMYDKT-NZTKNTHTSA-N 0.000 description 2
- 229960002438 carfilzomib Drugs 0.000 description 2
- 239000012876 carrier material Substances 0.000 description 2
- 239000004359 castor oil Substances 0.000 description 2
- 229950006295 cerdulatinib Drugs 0.000 description 2
- 201000010881 cervical cancer Diseases 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- XDLYKKIQACFMJG-WKILWMFISA-N chembl1234354 Chemical compound C1=NC(OC)=CC=C1C(C1=O)=CC2=C(C)N=C(N)N=C2N1[C@@H]1CC[C@@H](OCCO)CC1 XDLYKKIQACFMJG-WKILWMFISA-N 0.000 description 2
- HWGQMRYQVZSGDQ-HZPDHXFCSA-N chembl3137320 Chemical compound CN1N=CN=C1[C@H]([C@H](N1)C=2C=CC(F)=CC=2)C2=NNC(=O)C3=C2C1=CC(F)=C3 HWGQMRYQVZSGDQ-HZPDHXFCSA-N 0.000 description 2
- 208000024207 chronic leukemia Diseases 0.000 description 2
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 2
- 229960004316 cisplatin Drugs 0.000 description 2
- 229960002286 clodronic acid Drugs 0.000 description 2
- 230000003081 coactivator Effects 0.000 description 2
- 239000011248 coating agent Substances 0.000 description 2
- 229940110456 cocoa butter Drugs 0.000 description 2
- 235000019868 cocoa butter Nutrition 0.000 description 2
- 201000010989 colorectal carcinoma Diseases 0.000 description 2
- 230000001276 controlling effect Effects 0.000 description 2
- 239000006071 cream Substances 0.000 description 2
- VFLDPWHFBUODDF-FCXRPNKRSA-N curcumin Chemical compound C1=C(O)C(OC)=CC(\C=C\C(=O)CC(=O)\C=C\C=2C=C(OC)C(O)=CC=2)=C1 VFLDPWHFBUODDF-FCXRPNKRSA-N 0.000 description 2
- 239000002875 cyclin dependent kinase inhibitor Substances 0.000 description 2
- 229940043378 cyclin-dependent kinase inhibitor Drugs 0.000 description 2
- 229960004397 cyclophosphamide Drugs 0.000 description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- UHDGCWIWMRVCDJ-ZAKLUEHWSA-N cytidine Chemical class O=C1N=C(N)C=CN1[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-ZAKLUEHWSA-N 0.000 description 2
- LVXJQMNHJWSHET-AATRIKPKSA-N dacomitinib Chemical compound C=12C=C(NC(=O)\C=C\CN3CCCCC3)C(OC)=CC2=NC=NC=1NC1=CC=C(F)C(Cl)=C1 LVXJQMNHJWSHET-AATRIKPKSA-N 0.000 description 2
- 229950002205 dacomitinib Drugs 0.000 description 2
- 229950006418 dactolisib Drugs 0.000 description 2
- JOGKUKXHTYWRGZ-UHFFFAOYSA-N dactolisib Chemical compound O=C1N(C)C2=CN=C3C=CC(C=4C=C5C=CC=CC5=NC=4)=CC3=C2N1C1=CC=C(C(C)(C)C#N)C=C1 JOGKUKXHTYWRGZ-UHFFFAOYSA-N 0.000 description 2
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 2
- 229960000975 daunorubicin Drugs 0.000 description 2
- 229960003957 dexamethasone Drugs 0.000 description 2
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 2
- 150000001982 diacylglycerols Chemical class 0.000 description 2
- 235000005911 diet Nutrition 0.000 description 2
- 230000037213 diet Effects 0.000 description 2
- ZUOUZKKEUPVFJK-UHFFFAOYSA-N diphenyl Chemical compound C1=CC=CC=C1C1=CC=CC=C1 ZUOUZKKEUPVFJK-UHFFFAOYSA-N 0.000 description 2
- AUZONCFQVSMFAP-UHFFFAOYSA-N disulfiram Chemical compound CCN(CC)C(=S)SSC(=S)N(CC)CC AUZONCFQVSMFAP-UHFFFAOYSA-N 0.000 description 2
- MOTZDAYCYVMXPC-UHFFFAOYSA-N dodecyl hydrogen sulfate Chemical compound CCCCCCCCCCCCOS(O)(=O)=O MOTZDAYCYVMXPC-UHFFFAOYSA-N 0.000 description 2
- 229940043264 dodecyl sulfate Drugs 0.000 description 2
- 229960004679 doxorubicin Drugs 0.000 description 2
- 239000008298 dragée Substances 0.000 description 2
- 230000001804 emulsifying effect Effects 0.000 description 2
- 239000002702 enteric coating Substances 0.000 description 2
- 238000009505 enteric coating Methods 0.000 description 2
- 229950006370 epacadostat Drugs 0.000 description 2
- 229960001904 epirubicin Drugs 0.000 description 2
- 229940082789 erbitux Drugs 0.000 description 2
- 150000002148 esters Chemical class 0.000 description 2
- 102000015694 estrogen receptors Human genes 0.000 description 2
- 108010038795 estrogen receptors Proteins 0.000 description 2
- 229960003399 estrone Drugs 0.000 description 2
- 235000019441 ethanol Nutrition 0.000 description 2
- 229960005167 everolimus Drugs 0.000 description 2
- 230000029142 excretion Effects 0.000 description 2
- 229950011548 fadrozole Drugs 0.000 description 2
- 208000002026 familial multiple nevi flammei Diseases 0.000 description 2
- 239000000796 flavoring agent Substances 0.000 description 2
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 2
- IJJVMEJXYNJXOJ-UHFFFAOYSA-N fluquinconazole Chemical compound C=1C=C(Cl)C=C(Cl)C=1N1C(=O)C2=CC(F)=CC=C2N=C1N1C=NC=N1 IJJVMEJXYNJXOJ-UHFFFAOYSA-N 0.000 description 2
- 229960000304 folic acid Drugs 0.000 description 2
- 235000019152 folic acid Nutrition 0.000 description 2
- 239000011724 folic acid Substances 0.000 description 2
- 229960004421 formestane Drugs 0.000 description 2
- OSVMTWJCGUFAOD-KZQROQTASA-N formestane Chemical compound O=C1CC[C@]2(C)[C@H]3CC[C@](C)(C(CC4)=O)[C@@H]4[C@@H]3CCC2=C1O OSVMTWJCGUFAOD-KZQROQTASA-N 0.000 description 2
- 239000012634 fragment Substances 0.000 description 2
- 229960002258 fulvestrant Drugs 0.000 description 2
- 206010017758 gastric cancer Diseases 0.000 description 2
- 201000011243 gastrointestinal stromal tumor Diseases 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 239000007903 gelatin capsule Substances 0.000 description 2
- QTQAWLPCGQOSGP-GBTDJJJQSA-N geldanamycin Chemical class N1C(=O)\C(C)=C/C=C\[C@@H](OC)[C@H](OC(N)=O)\C(C)=C/[C@@H](C)[C@@H](O)[C@H](OC)C[C@@H](C)CC2=C(OC)C(=O)C=C1C2=O QTQAWLPCGQOSGP-GBTDJJJQSA-N 0.000 description 2
- 229960005277 gemcitabine Drugs 0.000 description 2
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 2
- 125000005456 glyceride group Chemical group 0.000 description 2
- 229960001442 gonadorelin Drugs 0.000 description 2
- 229940035638 gonadotropin-releasing hormone Drugs 0.000 description 2
- 229960002913 goserelin Drugs 0.000 description 2
- 239000003102 growth factor Substances 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 239000003481 heat shock protein 90 inhibitor Substances 0.000 description 2
- 201000002222 hemangioblastoma Diseases 0.000 description 2
- 125000004475 heteroaralkyl group Chemical group 0.000 description 2
- 229940088597 hormone Drugs 0.000 description 2
- 239000005556 hormone Substances 0.000 description 2
- 102000055609 human TEAD2 Human genes 0.000 description 2
- 102000047205 human TEAD3 Human genes 0.000 description 2
- 102000056515 human TEAD4 Human genes 0.000 description 2
- 229930195733 hydrocarbon Natural products 0.000 description 2
- JYGXADMDTFJGBT-VWUMJDOOSA-N hydrocortisone Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 JYGXADMDTFJGBT-VWUMJDOOSA-N 0.000 description 2
- FDGQSTZJBFJUBT-UHFFFAOYSA-N hypoxanthine Chemical compound O=C1NC=NC2=C1NC=N2 FDGQSTZJBFJUBT-UHFFFAOYSA-N 0.000 description 2
- 229960005236 ibandronic acid Drugs 0.000 description 2
- 229950007440 icotinib Drugs 0.000 description 2
- QQLKULDARVNMAL-UHFFFAOYSA-N icotinib Chemical compound C#CC1=CC=CC(NC=2C3=CC=4OCCOCCOCCOC=4C=C3N=CN=2)=C1 QQLKULDARVNMAL-UHFFFAOYSA-N 0.000 description 2
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 2
- 229960001101 ifosfamide Drugs 0.000 description 2
- 230000002519 immonomodulatory effect Effects 0.000 description 2
- 230000028993 immune response Effects 0.000 description 2
- 239000000367 immunologic factor Substances 0.000 description 2
- 238000000099 in vitro assay Methods 0.000 description 2
- 229950009034 indoximod Drugs 0.000 description 2
- 238000001802 infusion Methods 0.000 description 2
- VDJHFHXMUKFKET-WDUFCVPESA-N ingenol mebutate Chemical compound C[C@@H]1C[C@H]2C(C)(C)[C@H]2[C@@H]2C=C(CO)[C@@H](O)[C@]3(O)[C@@H](OC(=O)C(\C)=C/C)C(C)=C[C@]31C2=O VDJHFHXMUKFKET-WDUFCVPESA-N 0.000 description 2
- 239000007972 injectable composition Substances 0.000 description 2
- 229940102223 injectable solution Drugs 0.000 description 2
- 229940102213 injectable suspension Drugs 0.000 description 2
- 229940047124 interferons Drugs 0.000 description 2
- 229960005386 ipilimumab Drugs 0.000 description 2
- 229940084651 iressa Drugs 0.000 description 2
- 230000002427 irreversible effect Effects 0.000 description 2
- QXJSBBXBKPUZAA-UHFFFAOYSA-N isooleic acid Natural products CCCCCCCC=CCCCCCCCCC(O)=O QXJSBBXBKPUZAA-UHFFFAOYSA-N 0.000 description 2
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 2
- FABUFPQFXZVHFB-PVYNADRNSA-N ixabepilone Chemical compound C/C([C@@H]1C[C@@H]2O[C@]2(C)CCC[C@@H]([C@@H]([C@@H](C)C(=O)C(C)(C)[C@@H](O)CC(=O)N1)O)C)=C\C1=CSC(C)=N1 FABUFPQFXZVHFB-PVYNADRNSA-N 0.000 description 2
- MXAYKZJJDUDWDS-LBPRGKRZSA-N ixazomib Chemical compound CC(C)C[C@@H](B(O)O)NC(=O)CNC(=O)C1=CC(Cl)=CC=C1Cl MXAYKZJJDUDWDS-LBPRGKRZSA-N 0.000 description 2
- 229940025735 jevtana Drugs 0.000 description 2
- 239000008297 liquid dosage form Substances 0.000 description 2
- 239000003202 long acting thyroid stimulator Substances 0.000 description 2
- 239000006210 lotion Substances 0.000 description 2
- KHPKQFYUPIUARC-UHFFFAOYSA-N lumiracoxib Chemical compound OC(=O)CC1=CC(C)=CC=C1NC1=C(F)C=CC=C1Cl KHPKQFYUPIUARC-UHFFFAOYSA-N 0.000 description 2
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 2
- 201000009020 malignant peripheral nerve sheath tumor Diseases 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 229940121386 matrix metalloproteinase inhibitor Drugs 0.000 description 2
- 239000003771 matrix metalloproteinase inhibitor Substances 0.000 description 2
- 208000020968 mature T-cell and NK-cell non-Hodgkin lymphoma Diseases 0.000 description 2
- 229950008001 matuzumab Drugs 0.000 description 2
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical compound ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 2
- 229940083118 mekinist Drugs 0.000 description 2
- 230000002503 metabolic effect Effects 0.000 description 2
- 108010038421 metabotropic glutamate receptor 2 Proteins 0.000 description 2
- 108010038422 metabotropic glutamate receptor 4 Proteins 0.000 description 2
- 108010038449 metabotropic glutamate receptor 7 Proteins 0.000 description 2
- 230000009401 metastasis Effects 0.000 description 2
- 239000004530 micro-emulsion Substances 0.000 description 2
- 239000002480 mineral oil Substances 0.000 description 2
- 235000010446 mineral oil Nutrition 0.000 description 2
- 150000007522 mineralic acids Chemical class 0.000 description 2
- 229940071539 mirdametinib Drugs 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- XGXNTJHZPBRBHJ-UHFFFAOYSA-N n-phenylpyrimidin-2-amine Chemical class N=1C=CC=NC=1NC1=CC=CC=C1 XGXNTJHZPBRBHJ-UHFFFAOYSA-N 0.000 description 2
- 239000007922 nasal spray Substances 0.000 description 2
- 210000000822 natural killer cell Anatomy 0.000 description 2
- 229950010203 nimotuzumab Drugs 0.000 description 2
- 229950011068 niraparib Drugs 0.000 description 2
- 231100000344 non-irritating Toxicity 0.000 description 2
- 230000030648 nucleus localization Effects 0.000 description 2
- 229960000435 oblimersen Drugs 0.000 description 2
- MIMNFCVQODTQDP-NDLVEFNKSA-N oblimersen Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](COP(S)(=O)O[C@@H]2[C@H](O[C@H](C2)N2C3=NC=NC(N)=C3N=C2)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C3=NC=NC(N)=C3N=C2)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)CO)[C@@H](O)C1 MIMNFCVQODTQDP-NDLVEFNKSA-N 0.000 description 2
- 229950008516 olaratumab Drugs 0.000 description 2
- JLPDBLFIVFSOCC-XYXFTTADSA-N oleandrin Chemical compound O1[C@@H](C)[C@H](O)[C@@H](OC)C[C@@H]1O[C@@H]1C[C@@H](CC[C@H]2[C@]3(C[C@@H]([C@@H]([C@@]3(C)CC[C@H]32)C=2COC(=O)C=2)OC(C)=O)O)[C@]3(C)CC1 JLPDBLFIVFSOCC-XYXFTTADSA-N 0.000 description 2
- 239000004006 olive oil Substances 0.000 description 2
- CGBJSGAELGCMKE-UHFFFAOYSA-N omipalisib Chemical compound COC1=NC=C(C=2C=C3C(C=4C=NN=CC=4)=CC=NC3=CC=2)C=C1NS(=O)(=O)C1=CC=C(F)C=C1F CGBJSGAELGCMKE-UHFFFAOYSA-N 0.000 description 2
- 231100000590 oncogenic Toxicity 0.000 description 2
- 208000008511 optic nerve glioma Diseases 0.000 description 2
- 210000000056 organ Anatomy 0.000 description 2
- 150000007524 organic acids Chemical class 0.000 description 2
- 235000005985 organic acids Nutrition 0.000 description 2
- AHJRHEGDXFFMBM-UHFFFAOYSA-N palbociclib Chemical group N1=C2N(C3CCCC3)C(=O)C(C(=O)C)=C(C)C2=CN=C1NC(N=C1)=CC=C1N1CCNCC1 AHJRHEGDXFFMBM-UHFFFAOYSA-N 0.000 description 2
- WRUUGTRCQOWXEG-UHFFFAOYSA-N pamidronate Chemical compound NCCC(O)(P(O)(O)=O)P(O)(O)=O WRUUGTRCQOWXEG-UHFFFAOYSA-N 0.000 description 2
- 229960003978 pamidronic acid Drugs 0.000 description 2
- FPOHNWQLNRZRFC-ZHACJKMWSA-N panobinostat Chemical compound CC=1NC2=CC=CC=C2C=1CCNCC1=CC=C(\C=C\C(=O)NO)C=C1 FPOHNWQLNRZRFC-ZHACJKMWSA-N 0.000 description 2
- 229960005184 panobinostat Drugs 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 229960005547 pelareorep Drugs 0.000 description 2
- 229960005079 pemetrexed Drugs 0.000 description 2
- QOFFJEBXNKRSPX-ZDUSSCGKSA-N pemetrexed Chemical compound C1=N[C]2NC(N)=NC(=O)C2=C1CCC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 QOFFJEBXNKRSPX-ZDUSSCGKSA-N 0.000 description 2
- VLTRZXGMWDSKGL-UHFFFAOYSA-N perchloric acid Chemical compound OCl(=O)(=O)=O VLTRZXGMWDSKGL-UHFFFAOYSA-N 0.000 description 2
- 229940066842 petrolatum Drugs 0.000 description 2
- 125000004934 phenanthridinyl group Chemical group C1(=CC=CC2=NC=C3C=CC=CC3=C12)* 0.000 description 2
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 2
- 238000002428 photodynamic therapy Methods 0.000 description 2
- LFSXCDWNBUNEEM-UHFFFAOYSA-N phthalazine Chemical compound C1=NN=CC2=CC=CC=C21 LFSXCDWNBUNEEM-UHFFFAOYSA-N 0.000 description 2
- 229950010773 pidilizumab Drugs 0.000 description 2
- 229950002592 pimasertib Drugs 0.000 description 2
- 201000004123 pineal gland cancer Diseases 0.000 description 2
- 229960004403 pixantrone Drugs 0.000 description 2
- 229910052697 platinum Inorganic materials 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 108090000765 processed proteins & peptides Proteins 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 229960004063 propylene glycol Drugs 0.000 description 2
- 239000002599 prostaglandin synthase inhibitor Substances 0.000 description 2
- 230000007319 proteasomal degradation pathway Effects 0.000 description 2
- 239000002718 pyrimidine nucleoside Substances 0.000 description 2
- DUPWHXBITIZIKZ-UHFFFAOYSA-N radotinib Chemical compound C1=NC(C)=CN1C1=CC(NC(=O)C=2C=C(NC=3N=C(C=CN=3)C=3N=CC=NC=3)C(C)=CC=2)=CC(C(F)(F)F)=C1 DUPWHXBITIZIKZ-UHFFFAOYSA-N 0.000 description 2
- 229960004622 raloxifene Drugs 0.000 description 2
- BKXVVCILCIUCLG-UHFFFAOYSA-N raloxifene hydrochloride Chemical compound [H+].[Cl-].C1=CC(O)=CC=C1C1=C(C(=O)C=2C=CC(OCCN3CCCCC3)=CC=2)C2=CC=C(O)C=C2S1 BKXVVCILCIUCLG-UHFFFAOYSA-N 0.000 description 2
- 229960002119 raloxifene hydrochloride Drugs 0.000 description 2
- 229960002633 ramucirumab Drugs 0.000 description 2
- 229940099538 rapamune Drugs 0.000 description 2
- ZAHRKKWIAAJSAO-UHFFFAOYSA-N rapamycin Natural products COCC(O)C(=C/C(C)C(=O)CC(OC(=O)C1CCCCN1C(=O)C(=O)C2(O)OC(CC(OC)C(=CC=CC=CC(C)CC(C)C(=O)C)C)CCC2C)C(C)CC3CCC(O)C(C3)OC)C ZAHRKKWIAAJSAO-UHFFFAOYSA-N 0.000 description 2
- 102000027426 receptor tyrosine kinases Human genes 0.000 description 2
- 108091008598 receptor tyrosine kinases Proteins 0.000 description 2
- 210000000664 rectum Anatomy 0.000 description 2
- FNHKPVJBJVTLMP-UHFFFAOYSA-N regorafenib Chemical compound C1=NC(C(=O)NC)=CC(OC=2C=C(F)C(NC(=O)NC=3C=C(C(Cl)=CC=3)C(F)(F)F)=CC=2)=C1 FNHKPVJBJVTLMP-UHFFFAOYSA-N 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 229950003687 ribociclib Drugs 0.000 description 2
- 102220094755 rs876660673 Human genes 0.000 description 2
- 229950004707 rucaparib Drugs 0.000 description 2
- 229960000215 ruxolitinib Drugs 0.000 description 2
- HFNKQEVNSGCOJV-OAHLLOKOSA-N ruxolitinib Chemical compound C1([C@@H](CC#N)N2N=CC(=C2)C=2C=3C=CNC=3N=CN=2)CCCC1 HFNKQEVNSGCOJV-OAHLLOKOSA-N 0.000 description 2
- 229960005569 saridegib Drugs 0.000 description 2
- 229940095743 selective estrogen receptor modulator Drugs 0.000 description 2
- 229950010746 selumetinib Drugs 0.000 description 2
- 230000009919 sequestration Effects 0.000 description 2
- 230000007781 signaling event Effects 0.000 description 2
- 229910052710 silicon Inorganic materials 0.000 description 2
- 239000010703 silicon Substances 0.000 description 2
- 229960002930 sirolimus Drugs 0.000 description 2
- 210000003491 skin Anatomy 0.000 description 2
- 239000012453 solvate Substances 0.000 description 2
- 229960005325 sonidegib Drugs 0.000 description 2
- VZZJRYRQSPEMTK-CALCHBBNSA-N sonidegib Chemical compound C1[C@@H](C)O[C@@H](C)CN1C(N=C1)=CC=C1NC(=O)C1=CC=CC(C=2C=CC(OC(F)(F)F)=CC=2)=C1C VZZJRYRQSPEMTK-CALCHBBNSA-N 0.000 description 2
- 229960003787 sorafenib Drugs 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 238000001228 spectrum Methods 0.000 description 2
- 239000007921 spray Substances 0.000 description 2
- 206010041823 squamous cell carcinoma Diseases 0.000 description 2
- HKSZLNNOFSGOKW-FYTWVXJKSA-N staurosporine Chemical class C12=C3N4C5=CC=CC=C5C3=C3CNC(=O)C3=C2C2=CC=CC=C2N1[C@H]1C[C@@H](NC)[C@@H](OC)[C@]4(C)O1 HKSZLNNOFSGOKW-FYTWVXJKSA-N 0.000 description 2
- 210000002784 stomach Anatomy 0.000 description 2
- 201000011549 stomach cancer Diseases 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 2
- KDYFGRWQOYBRFD-UHFFFAOYSA-N succinic acid Chemical compound OC(=O)CCC(O)=O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 description 2
- VDLGAZDAHPLOIR-VAZUXJHFSA-N sulanemadlin Chemical compound CC(C)C[C@H](NC(C)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@]2(C)CCCCCC\C=C\CCC[C@](C)(NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CC3=CNC4=CC=CC=C34)NC(=O)[C@H](CC5=CC=C(O)C=C5)NC(=O)[C@H](CCC(O)=O)NC2=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@H](C)C(N)=O VDLGAZDAHPLOIR-VAZUXJHFSA-N 0.000 description 2
- 239000003765 sweetening agent Substances 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 229960001603 tamoxifen Drugs 0.000 description 2
- 229950001269 taselisib Drugs 0.000 description 2
- 239000003277 telomerase inhibitor Substances 0.000 description 2
- 229960000235 temsirolimus Drugs 0.000 description 2
- 125000000999 tert-butyl group Chemical group [H]C([H])([H])C(*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 229960003604 testosterone Drugs 0.000 description 2
- 125000003039 tetrahydroisoquinolinyl group Chemical group C1(NCCC2=CC=CC=C12)* 0.000 description 2
- RZWIIPASKMUIAC-VQTJNVASSA-N thromboxane Chemical compound CCCCCCCC[C@H]1OCCC[C@@H]1CCCCCCC RZWIIPASKMUIAC-VQTJNVASSA-N 0.000 description 2
- 201000002510 thyroid cancer Diseases 0.000 description 2
- 229960005324 tiludronic acid Drugs 0.000 description 2
- WYWHKKSPHMUBEB-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 2
- PKVRCIRHQMSYJX-AIFWHQITSA-N trabectedin Chemical group C([C@@]1(C(OC2)=O)NCCC3=C1C=C(C(=C3)O)OC)S[C@@H]1C3=C(OC(C)=O)C(C)=C4OCOC4=C3[C@H]2N2[C@@H](O)[C@H](CC=3C4=C(O)C(OC)=C(C)C=3)N(C)[C@H]4[C@@H]21 PKVRCIRHQMSYJX-AIFWHQITSA-N 0.000 description 2
- 229960001612 trastuzumab emtansine Drugs 0.000 description 2
- 238000011269 treatment regimen Methods 0.000 description 2
- 229950007217 tremelimumab Drugs 0.000 description 2
- 125000002023 trifluoromethyl group Chemical group FC(F)(F)* 0.000 description 2
- 238000011144 upstream manufacturing Methods 0.000 description 2
- 201000005112 urinary bladder cancer Diseases 0.000 description 2
- 206010046766 uterine cancer Diseases 0.000 description 2
- 230000002792 vascular Effects 0.000 description 2
- 229950011257 veliparib Drugs 0.000 description 2
- JNAHVYVRKWKWKQ-CYBMUJFWSA-N veliparib Chemical compound N=1C2=CC=CC(C(N)=O)=C2NC=1[C@@]1(C)CCCN1 JNAHVYVRKWKWKQ-CYBMUJFWSA-N 0.000 description 2
- 229960003048 vinblastine Drugs 0.000 description 2
- 229960004982 vinblastine sulfate Drugs 0.000 description 2
- KDQAABAKXDWYSZ-PNYVAJAMSA-N vinblastine sulfate Chemical compound OS(O)(=O)=O.C([C@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 KDQAABAKXDWYSZ-PNYVAJAMSA-N 0.000 description 2
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 2
- 229960002110 vincristine sulfate Drugs 0.000 description 2
- 229960004449 vismodegib Drugs 0.000 description 2
- BPQMGSKTAYIVFO-UHFFFAOYSA-N vismodegib Chemical compound ClC1=CC(S(=O)(=O)C)=CC=C1C(=O)NC1=CC=C(Cl)C(C=2N=CC=CC=2)=C1 BPQMGSKTAYIVFO-UHFFFAOYSA-N 0.000 description 2
- 229910052727 yttrium Inorganic materials 0.000 description 2
- 229950008250 zalutumumab Drugs 0.000 description 2
- LSPHULWDVZXLIL-UHFFFAOYSA-N (+/-)-Camphoric acid Chemical compound CC1(C)C(C(O)=O)CCC1(C)C(O)=O LSPHULWDVZXLIL-UHFFFAOYSA-N 0.000 description 1
- DENYZIUJOTUUNY-MRXNPFEDSA-N (2R)-14-fluoro-2-methyl-6,9,10,19-tetrazapentacyclo[14.2.1.02,6.08,18.012,17]nonadeca-1(18),8,12(17),13,15-pentaen-11-one Chemical compound FC=1C=C2C=3C=4C(CN5[C@@](C4NC3C1)(CCC5)C)=NNC2=O DENYZIUJOTUUNY-MRXNPFEDSA-N 0.000 description 1
- STUWGJZDJHPWGZ-LBPRGKRZSA-N (2S)-N1-[4-methyl-5-[2-(1,1,1-trifluoro-2-methylpropan-2-yl)-4-pyridinyl]-2-thiazolyl]pyrrolidine-1,2-dicarboxamide Chemical compound S1C(C=2C=C(N=CC=2)C(C)(C)C(F)(F)F)=C(C)N=C1NC(=O)N1CCC[C@H]1C(N)=O STUWGJZDJHPWGZ-LBPRGKRZSA-N 0.000 description 1
- RNEACARJKXYVND-KQGZCTBQSA-N (2r)-2-[[(5z)-5-[(5-ethylfuran-2-yl)methylidene]-4-oxo-1,3-thiazol-2-yl]amino]-2-(4-fluorophenyl)acetic acid Chemical compound O1C(CC)=CC=C1\C=C/1C(=O)N=C(N[C@@H](C(O)=O)C=2C=CC(F)=CC=2)S\1 RNEACARJKXYVND-KQGZCTBQSA-N 0.000 description 1
- ASUGUQWIHMTFJL-QGZVFWFLSA-N (2r)-2-methyl-2-[[2-(1h-pyrrolo[2,3-b]pyridin-3-yl)pyrimidin-4-yl]amino]-n-(2,2,2-trifluoroethyl)butanamide Chemical compound FC(F)(F)CNC(=O)[C@@](C)(CC)NC1=CC=NC(C=2C3=CC=CN=C3NC=2)=N1 ASUGUQWIHMTFJL-QGZVFWFLSA-N 0.000 description 1
- JNYAEWCLZODPBN-JGWLITMVSA-N (2r,3r,4s)-2-[(1r)-1,2-dihydroxyethyl]oxolane-3,4-diol Chemical compound OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O JNYAEWCLZODPBN-JGWLITMVSA-N 0.000 description 1
- SVNJBEMPMKWDCO-KCHLEUMXSA-N (2s)-2-[[(2s)-3-carboxy-2-[[2-[[(2s)-5-(diaminomethylideneamino)-2-[[4-oxo-4-[[4-(4-oxo-8-phenylchromen-2-yl)morpholin-4-ium-4-yl]methoxy]butanoyl]amino]pentanoyl]amino]acetyl]amino]propanoyl]amino]-3-hydroxypropanoate Chemical compound C=1C(=O)C2=CC=CC(C=3C=CC=CC=3)=C2OC=1[N+]1(COC(=O)CCC(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C([O-])=O)CCOCC1 SVNJBEMPMKWDCO-KCHLEUMXSA-N 0.000 description 1
- NTQVODZUQIATFS-WAUHAFJUSA-N (2s)-2-[[(2s)-6-amino-2-[[2-[[(2s,3s)-2-[[(2s)-2-[[(2s)-2-amino-3-hydroxypropanoyl]amino]-4-methylpentanoyl]amino]-3-methylpentanoyl]amino]acetyl]amino]hexanoyl]amino]-3-methylbutanoic acid Chemical compound OC[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(O)=O NTQVODZUQIATFS-WAUHAFJUSA-N 0.000 description 1
- JPSHPWJJSVEEAX-OWPBQMJCSA-N (2s)-2-amino-4-fluoranylpentanedioic acid Chemical compound OC(=O)[C@@H](N)CC([18F])C(O)=O JPSHPWJJSVEEAX-OWPBQMJCSA-N 0.000 description 1
- CVCLJVVBHYOXDC-IAZSKANUSA-N (2z)-2-[(5z)-5-[(3,5-dimethyl-1h-pyrrol-2-yl)methylidene]-4-methoxypyrrol-2-ylidene]indole Chemical compound COC1=C\C(=C/2N=C3C=CC=CC3=C\2)N\C1=C/C=1NC(C)=CC=1C CVCLJVVBHYOXDC-IAZSKANUSA-N 0.000 description 1
- KCOYQXZDFIIGCY-CZIZESTLSA-N (3e)-4-amino-5-fluoro-3-[5-(4-methylpiperazin-1-yl)-1,3-dihydrobenzimidazol-2-ylidene]quinolin-2-one Chemical compound C1CN(C)CCN1C1=CC=C(N\C(N2)=C/3C(=C4C(F)=CC=CC4=NC\3=O)N)C2=C1 KCOYQXZDFIIGCY-CZIZESTLSA-N 0.000 description 1
- FDSDDLLOMXWXRY-JAQKLANPSA-N (3s)-4-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-3-[[2-[[(2s)-5-(diaminomethylideneamino)-2-[[4-oxo-4-[[4-(4-oxo-8-phenylchromen-2-yl)morpholin-4-ium-4-yl]methoxy]butanoyl]amino]pentanoyl]amino]acetyl]amino]-4-oxobutanoic acid;acetate Chemical compound CC([O-])=O.C=1C(=O)C2=CC=CC(C=3C=CC=CC=3)=C2OC=1[N+]1(COC(=O)CCC(=O)N[C@@H](CCCN=C(N)N)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(O)=O)CCOCC1 FDSDDLLOMXWXRY-JAQKLANPSA-N 0.000 description 1
- SRSHBZRURUNOSM-DEOSSOPVSA-N (4-chlorophenyl) (1s)-6-chloro-1-(4-methoxyphenyl)-1,3,4,9-tetrahydropyrido[3,4-b]indole-2-carboxylate Chemical compound C1=CC(OC)=CC=C1[C@H]1C(NC=2C3=CC(Cl)=CC=2)=C3CCN1C(=O)OC1=CC=C(Cl)C=C1 SRSHBZRURUNOSM-DEOSSOPVSA-N 0.000 description 1
- DCGDPJCUIKLTDU-SUNYJGFJSA-N (4r)-4-[(1s)-1-fluoroethyl]-3-[2-[[(1s)-1-[4-methyl-5-[2-(trifluoromethyl)pyridin-4-yl]pyridin-2-yl]ethyl]amino]pyrimidin-4-yl]-1,3-oxazolidin-2-one Chemical compound C[C@H](F)[C@H]1COC(=O)N1C1=CC=NC(N[C@@H](C)C=2N=CC(=C(C)C=2)C=2C=C(N=CC=2)C(F)(F)F)=N1 DCGDPJCUIKLTDU-SUNYJGFJSA-N 0.000 description 1
- DEQANNDTNATYII-OULOTJBUSA-N (4r,7s,10s,13r,16s,19r)-10-(4-aminobutyl)-19-[[(2r)-2-amino-3-phenylpropanoyl]amino]-16-benzyl-n-[(2r,3r)-1,3-dihydroxybutan-2-yl]-7-[(1r)-1-hydroxyethyl]-13-(1h-indol-3-ylmethyl)-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentazacycloicosane-4-carboxa Chemical compound C([C@@H](N)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](CC=2C3=CC=CC=C3NC=2)NC(=O)[C@H](CC=2C=CC=CC=2)NC1=O)C(=O)N[C@H](CO)[C@H](O)C)C1=CC=CC=C1 DEQANNDTNATYII-OULOTJBUSA-N 0.000 description 1
- FPVKHBSQESCIEP-UHFFFAOYSA-N (8S)-3-(2-deoxy-beta-D-erythro-pentofuranosyl)-3,6,7,8-tetrahydroimidazo[4,5-d][1,3]diazepin-8-ol Natural products C1C(O)C(CO)OC1N1C(NC=NCC2O)=C2N=C1 FPVKHBSQESCIEP-UHFFFAOYSA-N 0.000 description 1
- LKJPYSCBVHEWIU-KRWDZBQOSA-N (R)-bicalutamide Chemical compound C([C@@](O)(C)C(=O)NC=1C=C(C(C#N)=CC=1)C(F)(F)F)S(=O)(=O)C1=CC=C(F)C=C1 LKJPYSCBVHEWIU-KRWDZBQOSA-N 0.000 description 1
- GSQOBTOAOGXIFL-LFIBNONCSA-N (e)-2-cyano-3-(3,4-dihydroxyphenyl)-n-(3-phenylpropyl)prop-2-enamide Chemical compound C1=C(O)C(O)=CC=C1\C=C(/C#N)C(=O)NCCCC1=CC=CC=C1 GSQOBTOAOGXIFL-LFIBNONCSA-N 0.000 description 1
- GWCNJMUSWLTSCW-SFQUDFHCSA-N (e)-2-cyano-3-(3,4-dihydroxyphenyl)-n-(4-phenylbutyl)prop-2-enamide Chemical compound C1=C(O)C(O)=CC=C1\C=C(/C#N)C(=O)NCCCCC1=CC=CC=C1 GWCNJMUSWLTSCW-SFQUDFHCSA-N 0.000 description 1
- 229940058015 1,3-butylene glycol Drugs 0.000 description 1
- SOJJMSYMCLIQCZ-CYBMUJFWSA-N 1-[(2r)-4-[2-(2-aminopyrimidin-5-yl)-6-morpholin-4-yl-9-(2,2,2-trifluoroethyl)purin-8-yl]-2-methylpiperazin-1-yl]ethanone Chemical compound C1CN(C(C)=O)[C@H](C)CN1C1=NC2=C(N3CCOCC3)N=C(C=3C=NC(N)=NC=3)N=C2N1CC(F)(F)F SOJJMSYMCLIQCZ-CYBMUJFWSA-N 0.000 description 1
- SPMVMDHWKHCIDT-UHFFFAOYSA-N 1-[2-chloro-4-[(6,7-dimethoxy-4-quinolinyl)oxy]phenyl]-3-(5-methyl-3-isoxazolyl)urea Chemical compound C=12C=C(OC)C(OC)=CC2=NC=CC=1OC(C=C1Cl)=CC=C1NC(=O)NC=1C=C(C)ON=1 SPMVMDHWKHCIDT-UHFFFAOYSA-N 0.000 description 1
- BJHCYTJNPVGSBZ-YXSASFKJSA-N 1-[4-[6-amino-5-[(Z)-methoxyiminomethyl]pyrimidin-4-yl]oxy-2-chlorophenyl]-3-ethylurea Chemical compound CCNC(=O)Nc1ccc(Oc2ncnc(N)c2\C=N/OC)cc1Cl BJHCYTJNPVGSBZ-YXSASFKJSA-N 0.000 description 1
- UHDGCWIWMRVCDJ-UHFFFAOYSA-N 1-beta-D-Xylofuranosyl-NH-Cytosine Natural products O=C1N=C(N)C=CN1C1C(O)C(O)C(CO)O1 UHDGCWIWMRVCDJ-UHFFFAOYSA-N 0.000 description 1
- WRGQSWVCFNIUNZ-GDCKJWNLSA-N 1-oleoyl-sn-glycerol 3-phosphate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@@H](O)COP(O)(O)=O WRGQSWVCFNIUNZ-GDCKJWNLSA-N 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- ZESRJSPZRDMNHY-YFWFAHHUSA-N 11-deoxycorticosterone Chemical compound O=C1CC[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 ZESRJSPZRDMNHY-YFWFAHHUSA-N 0.000 description 1
- WHBHBVVOGNECLV-OBQKJFGGSA-N 11-deoxycortisol Chemical compound O=C1CC[C@]2(C)[C@H]3CC[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 WHBHBVVOGNECLV-OBQKJFGGSA-N 0.000 description 1
- DBPWSSGDRRHUNT-CEGNMAFCSA-N 17α-hydroxyprogesterone Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(=O)C)(O)[C@@]1(C)CC2 DBPWSSGDRRHUNT-CEGNMAFCSA-N 0.000 description 1
- VOXZDWNPVJITMN-ZBRFXRBCSA-N 17β-estradiol Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 VOXZDWNPVJITMN-ZBRFXRBCSA-N 0.000 description 1
- IHWDSEPNZDYMNF-UHFFFAOYSA-N 1H-indol-2-amine Chemical group C1=CC=C2NC(N)=CC2=C1 IHWDSEPNZDYMNF-UHFFFAOYSA-N 0.000 description 1
- YKBGVTZYEHREMT-KVQBGUIXSA-N 2'-deoxyguanosine Chemical class C1=NC=2C(=O)NC(N)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)O1 YKBGVTZYEHREMT-KVQBGUIXSA-N 0.000 description 1
- CKTSBUTUHBMZGZ-SHYZEUOFSA-N 2'‐deoxycytidine Chemical class O=C1N=C(N)C=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 CKTSBUTUHBMZGZ-SHYZEUOFSA-N 0.000 description 1
- CHHHXKFHOYLYRE-UHFFFAOYSA-M 2,4-Hexadienoic acid, potassium salt (1:1), (2E,4E)- Chemical compound [K+].CC=CC=CC([O-])=O CHHHXKFHOYLYRE-UHFFFAOYSA-M 0.000 description 1
- UEJJHQNACJXSKW-UHFFFAOYSA-N 2-(2,6-dioxopiperidin-3-yl)-1H-isoindole-1,3(2H)-dione Chemical compound O=C1C2=CC=CC=C2C(=O)N1C1CCC(=O)NC1=O UEJJHQNACJXSKW-UHFFFAOYSA-N 0.000 description 1
- PXBFMLJZNCDSMP-UHFFFAOYSA-N 2-Aminobenzamide Chemical class NC(=O)C1=CC=CC=C1N PXBFMLJZNCDSMP-UHFFFAOYSA-N 0.000 description 1
- VHVPQPYKVGDNFY-DFMJLFEVSA-N 2-[(2r)-butan-2-yl]-4-[4-[4-[4-[[(2r,4s)-2-(2,4-dichlorophenyl)-2-(1,2,4-triazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy]phenyl]piperazin-1-yl]phenyl]-1,2,4-triazol-3-one Chemical compound O=C1N([C@H](C)CC)N=CN1C1=CC=C(N2CCN(CC2)C=2C=CC(OC[C@@H]3O[C@](CN4N=CN=C4)(OC3)C=3C(=CC(Cl)=CC=3)Cl)=CC=2)C=C1 VHVPQPYKVGDNFY-DFMJLFEVSA-N 0.000 description 1
- VTJXFTPMFYAJJU-UHFFFAOYSA-N 2-[(3,4-dihydroxyphenyl)methylidene]propanedinitrile Chemical compound OC1=CC=C(C=C(C#N)C#N)C=C1O VTJXFTPMFYAJJU-UHFFFAOYSA-N 0.000 description 1
- TXGKRVFSSHPBAJ-JKSUJKDBSA-N 2-[[(1r,2s)-2-aminocyclohexyl]amino]-4-[3-(triazol-2-yl)anilino]pyrimidine-5-carboxamide Chemical compound N[C@H]1CCCC[C@H]1NC1=NC=C(C(N)=O)C(NC=2C=C(C=CC=2)N2N=CC=N2)=N1 TXGKRVFSSHPBAJ-JKSUJKDBSA-N 0.000 description 1
- RTQWWZBSTRGEAV-PKHIMPSTSA-N 2-[[(2s)-2-[bis(carboxymethyl)amino]-3-[4-(methylcarbamoylamino)phenyl]propyl]-[2-[bis(carboxymethyl)amino]propyl]amino]acetic acid Chemical compound CNC(=O)NC1=CC=C(C[C@@H](CN(CC(C)N(CC(O)=O)CC(O)=O)CC(O)=O)N(CC(O)=O)CC(O)=O)C=C1 RTQWWZBSTRGEAV-PKHIMPSTSA-N 0.000 description 1
- FSPQCTGGIANIJZ-UHFFFAOYSA-N 2-[[(3,4-dimethoxyphenyl)-oxomethyl]amino]-4,5,6,7-tetrahydro-1-benzothiophene-3-carboxamide Chemical compound C1=C(OC)C(OC)=CC=C1C(=O)NC1=C(C(N)=O)C(CCCC2)=C2S1 FSPQCTGGIANIJZ-UHFFFAOYSA-N 0.000 description 1
- BGFTWECWAICPDG-UHFFFAOYSA-N 2-[bis(4-chlorophenyl)methyl]-4-n-[3-[bis(4-chlorophenyl)methyl]-4-(dimethylamino)phenyl]-1-n,1-n-dimethylbenzene-1,4-diamine Chemical compound C1=C(C(C=2C=CC(Cl)=CC=2)C=2C=CC(Cl)=CC=2)C(N(C)C)=CC=C1NC(C=1)=CC=C(N(C)C)C=1C(C=1C=CC(Cl)=CC=1)C1=CC=C(Cl)C=C1 BGFTWECWAICPDG-UHFFFAOYSA-N 0.000 description 1
- LIOLIMKSCNQPLV-UHFFFAOYSA-N 2-fluoro-n-methyl-4-[7-(quinolin-6-ylmethyl)imidazo[1,2-b][1,2,4]triazin-2-yl]benzamide Chemical compound C1=C(F)C(C(=O)NC)=CC=C1C1=NN2C(CC=3C=C4C=CC=NC4=CC=3)=CN=C2N=C1 LIOLIMKSCNQPLV-UHFFFAOYSA-N 0.000 description 1
- 125000000954 2-hydroxyethyl group Chemical group [H]C([*])([H])C([H])([H])O[H] 0.000 description 1
- 125000004200 2-methoxyethyl group Chemical group [H]C([H])([H])OC([H])([H])C([H])([H])* 0.000 description 1
- 229940080296 2-naphthalenesulfonate Drugs 0.000 description 1
- LEACJMVNYZDSKR-UHFFFAOYSA-N 2-octyldodecan-1-ol Chemical compound CCCCCCCCCCC(CO)CCCCCCCC LEACJMVNYZDSKR-UHFFFAOYSA-N 0.000 description 1
- UZFPOOOQHWICKY-UHFFFAOYSA-N 3-[13-[1-[1-[8,12-bis(2-carboxyethyl)-17-(1-hydroxyethyl)-3,7,13,18-tetramethyl-21,24-dihydroporphyrin-2-yl]ethoxy]ethyl]-18-(2-carboxyethyl)-8-(1-hydroxyethyl)-3,7,12,17-tetramethyl-22,23-dihydroporphyrin-2-yl]propanoic acid Chemical compound N1C(C=C2C(=C(CCC(O)=O)C(C=C3C(=C(C)C(C=C4N5)=N3)CCC(O)=O)=N2)C)=C(C)C(C(C)O)=C1C=C5C(C)=C4C(C)OC(C)C1=C(N2)C=C(N3)C(C)=C(C(O)C)C3=CC(C(C)=C3CCC(O)=O)=NC3=CC(C(CCC(O)=O)=C3C)=NC3=CC2=C1C UZFPOOOQHWICKY-UHFFFAOYSA-N 0.000 description 1
- RNMAUIMMNAHKQR-QFBILLFUSA-N 3-[2-[4-(trifluoromethoxy)anilino]-1-[(1R,5R)-3,3,5-trimethylcyclohexyl]benzimidazol-5-yl]propanoic acid Chemical compound FC(OC1=CC=C(C=C1)NC1=NC2=C(N1[C@H]1CC(C[C@H](C1)C)(C)C)C=CC(=C2)CCC(=O)O)(F)F RNMAUIMMNAHKQR-QFBILLFUSA-N 0.000 description 1
- BMYNFMYTOJXKLE-UHFFFAOYSA-N 3-azaniumyl-2-hydroxypropanoate Chemical compound NCC(O)C(O)=O BMYNFMYTOJXKLE-UHFFFAOYSA-N 0.000 description 1
- ZRPLANDPDWYOMZ-UHFFFAOYSA-N 3-cyclopentylpropionic acid Chemical compound OC(=O)CCC1CCCC1 ZRPLANDPDWYOMZ-UHFFFAOYSA-N 0.000 description 1
- PBJKWGWHZVXBGU-UHFFFAOYSA-N 3-methyl-5-propan-2-yl-2-(1,6,7-trihydroxy-3-methyl-5-propan-2-ylnaphthalen-2-yl)naphthalene-1,6,7-triol Chemical compound CC(C)C1=C(O)C(O)=CC2=C(O)C(C=3C(O)=C4C=C(O)C(O)=C(C4=CC=3C)C(C)C)=C(C)C=C21 PBJKWGWHZVXBGU-UHFFFAOYSA-N 0.000 description 1
- XMIIGOLPHOKFCH-UHFFFAOYSA-M 3-phenylpropionate Chemical compound [O-]C(=O)CCC1=CC=CC=C1 XMIIGOLPHOKFCH-UHFFFAOYSA-M 0.000 description 1
- ZHSKUOZOLHMKEA-UHFFFAOYSA-N 4-[5-[bis(2-chloroethyl)amino]-1-methylbenzimidazol-2-yl]butanoic acid;hydron;chloride Chemical compound Cl.ClCCN(CCCl)C1=CC=C2N(C)C(CCCC(O)=O)=NC2=C1 ZHSKUOZOLHMKEA-UHFFFAOYSA-N 0.000 description 1
- CKTSBUTUHBMZGZ-ULQXZJNLSA-N 4-amino-1-[(2r,4s,5r)-4-hydroxy-5-(hydroxymethyl)oxolan-2-yl]-5-tritiopyrimidin-2-one Chemical compound O=C1N=C(N)C([3H])=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 CKTSBUTUHBMZGZ-ULQXZJNLSA-N 0.000 description 1
- 125000002471 4H-quinolizinyl group Chemical group C=1(C=CCN2C=CC=CC12)* 0.000 description 1
- ADGGYDAFIHSYFI-UHFFFAOYSA-N 5-(4,6-dimorpholin-4-yl-1,3,5-triazin-2-yl)-4-(trifluoromethyl)pyridin-2-amine Chemical compound C1=NC(N)=CC(C(F)(F)F)=C1C1=NC(N2CCOCC2)=NC(N2CCOCC2)=N1 ADGGYDAFIHSYFI-UHFFFAOYSA-N 0.000 description 1
- NMUSYJAQQFHJEW-UHFFFAOYSA-N 5-Azacytidine Natural products O=C1N=C(N)N=CN1C1C(O)C(O)C(CO)O1 NMUSYJAQQFHJEW-UHFFFAOYSA-N 0.000 description 1
- XAUDJQYHKZQPEU-KVQBGUIXSA-N 5-aza-2'-deoxycytidine Chemical compound O=C1N=C(N)N=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 XAUDJQYHKZQPEU-KVQBGUIXSA-N 0.000 description 1
- PDOQBOJDRPLBQU-QMMMGPOBSA-N 5-chloro-2-n-[(1s)-1-(5-fluoropyrimidin-2-yl)ethyl]-4-n-(5-methyl-1h-pyrazol-3-yl)pyrimidine-2,4-diamine Chemical compound N([C@@H](C)C=1N=CC(F)=CN=1)C(N=1)=NC=C(Cl)C=1NC=1C=C(C)NN=1 PDOQBOJDRPLBQU-QMMMGPOBSA-N 0.000 description 1
- FHVDTGUDJYJELY-UHFFFAOYSA-N 6-{[2-carboxy-4,5-dihydroxy-6-(phosphanyloxy)oxan-3-yl]oxy}-4,5-dihydroxy-3-phosphanyloxane-2-carboxylic acid Chemical compound O1C(C(O)=O)C(P)C(O)C(O)C1OC1C(C(O)=O)OC(OP)C(O)C1O FHVDTGUDJYJELY-UHFFFAOYSA-N 0.000 description 1
- VVIAGPKUTFNRDU-UHFFFAOYSA-N 6S-folinic acid Natural products C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-UHFFFAOYSA-N 0.000 description 1
- RHXHGRAEPCAFML-UHFFFAOYSA-N 7-cyclopentyl-n,n-dimethyl-2-[(5-piperazin-1-ylpyridin-2-yl)amino]pyrrolo[2,3-d]pyrimidine-6-carboxamide Chemical compound N1=C2N(C3CCCC3)C(C(=O)N(C)C)=CC2=CN=C1NC(N=C1)=CC=C1N1CCNCC1 RHXHGRAEPCAFML-UHFFFAOYSA-N 0.000 description 1
- PBCZSGKMGDDXIJ-HQCWYSJUSA-N 7-hydroxystaurosporine Chemical compound N([C@H](O)C1=C2C3=CC=CC=C3N3C2=C24)C(=O)C1=C2C1=CC=CC=C1N4[C@H]1C[C@@H](NC)[C@@H](OC)[C@]3(C)O1 PBCZSGKMGDDXIJ-HQCWYSJUSA-N 0.000 description 1
- PBCZSGKMGDDXIJ-UHFFFAOYSA-N 7beta-hydroxystaurosporine Natural products C12=C3N4C5=CC=CC=C5C3=C3C(O)NC(=O)C3=C2C2=CC=CC=C2N1C1CC(NC)C(OC)C4(C)O1 PBCZSGKMGDDXIJ-UHFFFAOYSA-N 0.000 description 1
- JJTNLWSCFYERCK-UHFFFAOYSA-N 7h-pyrrolo[2,3-d]pyrimidine Chemical class N1=CN=C2NC=CC2=C1 JJTNLWSCFYERCK-UHFFFAOYSA-N 0.000 description 1
- HPLNQCPCUACXLM-PGUFJCEWSA-N ABT-737 Chemical compound C([C@@H](CCN(C)C)NC=1C(=CC(=CC=1)S(=O)(=O)NC(=O)C=1C=CC(=CC=1)N1CCN(CC=2C(=CC=CC=2)C=2C=CC(Cl)=CC=2)CC1)[N+]([O-])=O)SC1=CC=CC=C1 HPLNQCPCUACXLM-PGUFJCEWSA-N 0.000 description 1
- 101710168331 ALK tyrosine kinase receptor Proteins 0.000 description 1
- 108091008803 APLNR Proteins 0.000 description 1
- 101150028385 ATG2 gene Proteins 0.000 description 1
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 1
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 1
- 206010000871 Acute monocytic leukaemia Diseases 0.000 description 1
- 206010000890 Acute myelomonocytic leukaemia Diseases 0.000 description 1
- 208000036762 Acute promyelocytic leukaemia Diseases 0.000 description 1
- 102100022089 Acyl-[acyl-carrier-protein] hydrolase Human genes 0.000 description 1
- 208000003200 Adenoma Diseases 0.000 description 1
- 206010001233 Adenoma benign Diseases 0.000 description 1
- 102100031934 Adhesion G-protein coupled receptor G1 Human genes 0.000 description 1
- 208000006468 Adrenal Cortex Neoplasms Diseases 0.000 description 1
- 208000009888 Adrenocortical Adenoma Diseases 0.000 description 1
- 208000009746 Adult T-Cell Leukemia-Lymphoma Diseases 0.000 description 1
- 208000016683 Adult T-cell leukemia/lymphoma Diseases 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 108010012934 Albumin-Bound Paclitaxel Proteins 0.000 description 1
- 239000005995 Aluminium silicate Substances 0.000 description 1
- 229940097396 Aminopeptidase inhibitor Drugs 0.000 description 1
- YUWPMEXLKGOSBF-GACAOOTBSA-N Anecortave acetate Chemical compound O=C1CC[C@]2(C)C3=CC[C@]4(C)[C@](C(=O)COC(=O)C)(O)CC[C@H]4[C@@H]3CCC2=C1 YUWPMEXLKGOSBF-GACAOOTBSA-N 0.000 description 1
- 201000003076 Angiosarcoma Diseases 0.000 description 1
- 108050009086 Angiotensin II receptor type 1 Proteins 0.000 description 1
- 102000001838 Angiotensin II receptor type 1 Human genes 0.000 description 1
- 108090000644 Angiozyme Proteins 0.000 description 1
- 102100036822 Ankyrin repeat and KH domain-containing protein 1 Human genes 0.000 description 1
- 108020000948 Antisense Oligonucleotides Proteins 0.000 description 1
- 102000016555 Apelin receptors Human genes 0.000 description 1
- 235000003276 Apios tuberosa Nutrition 0.000 description 1
- 108010063104 Apoptosis Regulatory Proteins Proteins 0.000 description 1
- 102000010565 Apoptosis Regulatory Proteins Human genes 0.000 description 1
- 108091023037 Aptamer Proteins 0.000 description 1
- 244000105624 Arachis hypogaea Species 0.000 description 1
- 235000010777 Arachis hypogaea Nutrition 0.000 description 1
- 235000010744 Arachis villosulicarpa Nutrition 0.000 description 1
- 229940080328 Arginase inhibitor Drugs 0.000 description 1
- 102000015790 Asparaginase Human genes 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 206010065869 Astrocytoma, low grade Diseases 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 108010092778 Autophagy-Related Protein 7 Proteins 0.000 description 1
- 102100029822 B- and T-lymphocyte attenuator Human genes 0.000 description 1
- 102000006942 B-Cell Maturation Antigen Human genes 0.000 description 1
- 108010008014 B-Cell Maturation Antigen Proteins 0.000 description 1
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 1
- 208000003950 B-cell lymphoma Diseases 0.000 description 1
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 1
- 102100028519 B2 bradykinin receptor Human genes 0.000 description 1
- 101710085045 B2 bradykinin receptor Proteins 0.000 description 1
- 229940124290 BCR-ABL tyrosine kinase inhibitor Drugs 0.000 description 1
- QULDDKSCVCJTPV-UHFFFAOYSA-N BIIB021 Chemical compound COC1=C(C)C=NC(CN2C3=NC(N)=NC(Cl)=C3N=C2)=C1C QULDDKSCVCJTPV-UHFFFAOYSA-N 0.000 description 1
- 229940125565 BMS-986016 Drugs 0.000 description 1
- 229940124291 BTK inhibitor Drugs 0.000 description 1
- 102100021663 Baculoviral IAP repeat-containing protein 5 Human genes 0.000 description 1
- 229940122035 Bcl-XL inhibitor Drugs 0.000 description 1
- 206010060999 Benign neoplasm Diseases 0.000 description 1
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 1
- 102100026189 Beta-galactosidase Human genes 0.000 description 1
- 206010004593 Bile duct cancer Diseases 0.000 description 1
- 102000004506 Blood Proteins Human genes 0.000 description 1
- 108010017384 Blood Proteins Proteins 0.000 description 1
- 108010073466 Bombesin Receptors Proteins 0.000 description 1
- BTBUEUYNUDRHOZ-UHFFFAOYSA-N Borate Chemical compound [O-]B([O-])[O-] BTBUEUYNUDRHOZ-UHFFFAOYSA-N 0.000 description 1
- ZOXJGFHDIHLPTG-UHFFFAOYSA-N Boron Chemical compound [B] ZOXJGFHDIHLPTG-UHFFFAOYSA-N 0.000 description 1
- 101000964894 Bos taurus 14-3-3 protein zeta/delta Proteins 0.000 description 1
- FERIUCNNQQJTOY-UHFFFAOYSA-M Butyrate Chemical compound CCCC([O-])=O FERIUCNNQQJTOY-UHFFFAOYSA-M 0.000 description 1
- FERIUCNNQQJTOY-UHFFFAOYSA-N Butyric acid Natural products CCCC(O)=O FERIUCNNQQJTOY-UHFFFAOYSA-N 0.000 description 1
- 108091008927 CC chemokine receptors Proteins 0.000 description 1
- 102100031168 CCN family member 2 Human genes 0.000 description 1
- 101150042405 CCN1 gene Proteins 0.000 description 1
- 102000005674 CCR Receptors Human genes 0.000 description 1
- 108010046080 CD27 Ligand Proteins 0.000 description 1
- 101710185679 CD276 antigen Proteins 0.000 description 1
- 108010029697 CD40 Ligand Proteins 0.000 description 1
- 102100032937 CD40 ligand Human genes 0.000 description 1
- 102100036008 CD48 antigen Human genes 0.000 description 1
- 229940124297 CDK 4/6 inhibitor Drugs 0.000 description 1
- 229940124638 COX inhibitor Drugs 0.000 description 1
- 108010061299 CXCR4 Receptors Proteins 0.000 description 1
- 102000012000 CXCR4 Receptors Human genes 0.000 description 1
- 102000000905 Cadherin Human genes 0.000 description 1
- 108050007957 Cadherin Proteins 0.000 description 1
- 101000741929 Caenorhabditis elegans Serine/threonine-protein phosphatase 2A catalytic subunit Proteins 0.000 description 1
- 108010078311 Calcitonin Gene-Related Peptide Receptors Proteins 0.000 description 1
- 102000014468 Calcitonin Gene-Related Peptide Receptors Human genes 0.000 description 1
- 102000013830 Calcium-Sensing Receptors Human genes 0.000 description 1
- KLWPJMFMVPTNCC-UHFFFAOYSA-N Camptothecin Natural products CCC1(O)C(=O)OCC2=C1C=C3C4Nc5ccccc5C=C4CN3C2=O KLWPJMFMVPTNCC-UHFFFAOYSA-N 0.000 description 1
- 101100164184 Candida albicans (strain SC5314 / ATCC MYA-2876) SPO72 gene Proteins 0.000 description 1
- 102000018208 Cannabinoid Receptor Human genes 0.000 description 1
- 108050007331 Cannabinoid receptor Proteins 0.000 description 1
- 101710132601 Capsid protein Proteins 0.000 description 1
- 208000005623 Carcinogenesis Diseases 0.000 description 1
- 102000019034 Chemokines Human genes 0.000 description 1
- 108010012236 Chemokines Proteins 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 1
- 101800001982 Cholecystokinin Proteins 0.000 description 1
- 102100025841 Cholecystokinin Human genes 0.000 description 1
- 208000006332 Choriocarcinoma Diseases 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- PTOAARAWEBMLNO-KVQBGUIXSA-N Cladribine Chemical compound C1=NC=2C(N)=NC(Cl)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)O1 PTOAARAWEBMLNO-KVQBGUIXSA-N 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 102000029816 Collagenase Human genes 0.000 description 1
- 108060005980 Collagenase Proteins 0.000 description 1
- 108010039419 Connective Tissue Growth Factor Proteins 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- OMFXVFTZEKFJBZ-UHFFFAOYSA-N Corticosterone Natural products O=C1CCC2(C)C3C(O)CC(C)(C(CC4)C(=O)CO)C4C3CCC2=C1 OMFXVFTZEKFJBZ-UHFFFAOYSA-N 0.000 description 1
- 108010056643 Corticotropin-Releasing Hormone Receptors Proteins 0.000 description 1
- 241000242741 Cubozoa Species 0.000 description 1
- 101710093674 Cyclic nucleotide-gated cation channel beta-1 Proteins 0.000 description 1
- 108010025464 Cyclin-Dependent Kinase 4 Proteins 0.000 description 1
- 108010025468 Cyclin-Dependent Kinase 6 Proteins 0.000 description 1
- 102100036252 Cyclin-dependent kinase 4 Human genes 0.000 description 1
- 102100026804 Cyclin-dependent kinase 6 Human genes 0.000 description 1
- 102000003903 Cyclin-dependent kinases Human genes 0.000 description 1
- 108090000266 Cyclin-dependent kinases Proteins 0.000 description 1
- 229940122204 Cyclooxygenase inhibitor Drugs 0.000 description 1
- QASFUMOKHFSJGL-LAFRSMQTSA-N Cyclopamine Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H](CC2=C3C)[C@@H]1[C@@H]2CC[C@@]13O[C@@H]2C[C@H](C)CN[C@H]2[C@H]1C QASFUMOKHFSJGL-LAFRSMQTSA-N 0.000 description 1
- UHDGCWIWMRVCDJ-PSQAKQOGSA-N Cytidine Natural products O=C1N=C(N)C=CN1[C@@H]1[C@@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-PSQAKQOGSA-N 0.000 description 1
- 102000000311 Cytosine Deaminase Human genes 0.000 description 1
- 108010080611 Cytosine Deaminase Proteins 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- RGHNJXZEOKUKBD-SQOUGZDYSA-M D-gluconate Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O RGHNJXZEOKUKBD-SQOUGZDYSA-M 0.000 description 1
- 230000004536 DNA copy number loss Effects 0.000 description 1
- 230000033616 DNA repair Effects 0.000 description 1
- 108010093668 Deubiquitinating Enzymes Proteins 0.000 description 1
- 102000001477 Deubiquitinating Enzymes Human genes 0.000 description 1
- YZCKVEUIGOORGS-OUBTZVSYSA-N Deuterium Chemical compound [2H] YZCKVEUIGOORGS-OUBTZVSYSA-N 0.000 description 1
- 235000019739 Dicalciumphosphate Nutrition 0.000 description 1
- 102000016680 Dioxygenases Human genes 0.000 description 1
- 108010028143 Dioxygenases Proteins 0.000 description 1
- 206010061818 Disease progression Diseases 0.000 description 1
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 1
- 102100031480 Dual specificity mitogen-activated protein kinase kinase 1 Human genes 0.000 description 1
- 101710146526 Dual specificity mitogen-activated protein kinase kinase 1 Proteins 0.000 description 1
- 102100023266 Dual specificity mitogen-activated protein kinase kinase 2 Human genes 0.000 description 1
- 101710146529 Dual specificity mitogen-activated protein kinase kinase 2 Proteins 0.000 description 1
- CUDVHEFYRIWYQD-UHFFFAOYSA-N E-3810 free base Chemical compound C=1C=C2C(C(=O)NC)=CC=CC2=CC=1OC(C1=CC=2OC)=CC=NC1=CC=2OCC1(N)CC1 CUDVHEFYRIWYQD-UHFFFAOYSA-N 0.000 description 1
- 102100023877 E3 ubiquitin-protein ligase RBX1 Human genes 0.000 description 1
- 101710095156 E3 ubiquitin-protein ligase RBX1 Proteins 0.000 description 1
- 229940122558 EGFR antagonist Drugs 0.000 description 1
- 101150029707 ERBB2 gene Proteins 0.000 description 1
- 102100025137 Early activation antigen CD69 Human genes 0.000 description 1
- 102100037354 Ectodysplasin-A Human genes 0.000 description 1
- 201000009051 Embryonal Carcinoma Diseases 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 102000002045 Endothelin Human genes 0.000 description 1
- 108050009340 Endothelin Proteins 0.000 description 1
- 241000792859 Enema Species 0.000 description 1
- QXRSDHAAWVKZLJ-OXZHEXMSSA-N Epothilone B Natural products O=C1[C@H](C)[C@H](O)[C@@H](C)CCC[C@@]2(C)O[C@H]2C[C@@H](/C(=C\c2nc(C)sc2)/C)OC(=O)C[C@H](O)C1(C)C QXRSDHAAWVKZLJ-OXZHEXMSSA-N 0.000 description 1
- 102000056372 ErbB-3 Receptor Human genes 0.000 description 1
- 102000044591 ErbB-4 Receptor Human genes 0.000 description 1
- 208000031637 Erythroblastic Acute Leukemia Diseases 0.000 description 1
- 208000036566 Erythroleukaemia Diseases 0.000 description 1
- 102100035650 Extracellular calcium-sensing receptor Human genes 0.000 description 1
- 101710109905 F-box/WD repeat-containing protein 1A Proteins 0.000 description 1
- 101150089023 FASLG gene Proteins 0.000 description 1
- 241000272186 Falco columbarius Species 0.000 description 1
- 108090000386 Fibroblast Growth Factor 1 Proteins 0.000 description 1
- 102000003971 Fibroblast Growth Factor 1 Human genes 0.000 description 1
- 239000004606 Fillers/Extenders Substances 0.000 description 1
- BDAGIHXWWSANSR-UHFFFAOYSA-M Formate Chemical compound [O-]C=O BDAGIHXWWSANSR-UHFFFAOYSA-M 0.000 description 1
- 108010076288 Formyl peptide receptors Proteins 0.000 description 1
- 102000011652 Formyl peptide receptors Human genes 0.000 description 1
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 1
- 101150037782 GAL2 gene Proteins 0.000 description 1
- WMBWREPUVVBILR-UHFFFAOYSA-N GCG Natural products C=1C(O)=C(O)C(O)=CC=1C1OC2=CC(O)=CC(O)=C2CC1OC(=O)C1=CC(O)=C(O)C(O)=C1 WMBWREPUVVBILR-UHFFFAOYSA-N 0.000 description 1
- 102000009596 GDP-dissociation inhibitor activity proteins Human genes 0.000 description 1
- 108040001987 GDP-dissociation inhibitor activity proteins Proteins 0.000 description 1
- 108010082772 GFB 111 Proteins 0.000 description 1
- 229940126656 GS-4224 Drugs 0.000 description 1
- 102000013446 GTP Phosphohydrolases Human genes 0.000 description 1
- 101710113436 GTPase KRas Proteins 0.000 description 1
- 102100039788 GTPase NRas Human genes 0.000 description 1
- 108091006109 GTPases Proteins 0.000 description 1
- 102000011392 Galanin receptor Human genes 0.000 description 1
- 108050001605 Galanin receptor Proteins 0.000 description 1
- 108010001498 Galectin 1 Proteins 0.000 description 1
- 102100021736 Galectin-1 Human genes 0.000 description 1
- 102100021735 Galectin-2 Human genes 0.000 description 1
- 102100031351 Galectin-9 Human genes 0.000 description 1
- 101710121810 Galectin-9 Proteins 0.000 description 1
- 102100039997 Gastric inhibitory polypeptide receptor Human genes 0.000 description 1
- 206010017993 Gastrointestinal neoplasms Diseases 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 102000013382 Gelatinases Human genes 0.000 description 1
- 108010026132 Gelatinases Proteins 0.000 description 1
- JRZJKWGQFNTSRN-UHFFFAOYSA-N Geldanamycin Natural products C1C(C)CC(OC)C(O)C(C)C=C(C)C(OC(N)=O)C(OC)CCC=C(C)C(=O)NC2=CC(=O)C(OC)=C1C2=O JRZJKWGQFNTSRN-UHFFFAOYSA-N 0.000 description 1
- 241000206672 Gelidium Species 0.000 description 1
- 108091006101 Gi proteins Proteins 0.000 description 1
- 102000034354 Gi proteins Human genes 0.000 description 1
- 108010063919 Glucagon Receptors Proteins 0.000 description 1
- 102100040890 Glucagon receptor Human genes 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 102000018899 Glutamate Receptors Human genes 0.000 description 1
- 108010027915 Glutamate Receptors Proteins 0.000 description 1
- 102000009127 Glutaminase Human genes 0.000 description 1
- 108010073324 Glutaminase Proteins 0.000 description 1
- 229940121727 Glutaminase inhibitor Drugs 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- AEMRFAOFKBGASW-UHFFFAOYSA-N Glycolic acid Polymers OCC(O)=O AEMRFAOFKBGASW-UHFFFAOYSA-N 0.000 description 1
- 108091006068 Gq proteins Proteins 0.000 description 1
- 102000052606 Gq-G11 GTP-Binding Protein alpha Subunits Human genes 0.000 description 1
- 102100034155 Guanine nucleotide-binding protein G(i) subunit alpha-1 Human genes 0.000 description 1
- 102100034154 Guanine nucleotide-binding protein G(i) subunit alpha-2 Human genes 0.000 description 1
- 102100034264 Guanine nucleotide-binding protein G(i) subunit alpha-3 Human genes 0.000 description 1
- 102100032610 Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas Human genes 0.000 description 1
- 102100039261 Guanine nucleotide-binding protein G(t) subunit alpha-1 Human genes 0.000 description 1
- 102100039214 Guanine nucleotide-binding protein G(t) subunit alpha-2 Human genes 0.000 description 1
- 102100039215 Guanine nucleotide-binding protein G(t) subunit alpha-3 Human genes 0.000 description 1
- 102100039874 Guanine nucleotide-binding protein G(z) subunit alpha Human genes 0.000 description 1
- 102100036733 Guanine nucleotide-binding protein subunit alpha-12 Human genes 0.000 description 1
- 102100036703 Guanine nucleotide-binding protein subunit alpha-13 Human genes 0.000 description 1
- 102100023952 Guanine nucleotide-binding protein subunit alpha-14 Human genes 0.000 description 1
- 102100023954 Guanine nucleotide-binding protein subunit alpha-15 Human genes 0.000 description 1
- 229940125497 HER2 kinase inhibitor Drugs 0.000 description 1
- 238000004965 Hartree-Fock calculation Methods 0.000 description 1
- 102000003693 Hedgehog Proteins Human genes 0.000 description 1
- 108090000031 Hedgehog Proteins Proteins 0.000 description 1
- 208000001258 Hemangiosarcoma Diseases 0.000 description 1
- 229920002971 Heparan sulfate Polymers 0.000 description 1
- 102100024025 Heparanase Human genes 0.000 description 1
- 229940122588 Heparanase inhibitor Drugs 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 108010007712 Hepatitis A Virus Cellular Receptor 1 Proteins 0.000 description 1
- 102100034459 Hepatitis A virus cellular receptor 1 Human genes 0.000 description 1
- 239000004705 High-molecular-weight polyethylene Substances 0.000 description 1
- 102000003710 Histamine H2 Receptors Human genes 0.000 description 1
- 108090000050 Histamine H2 Receptors Proteins 0.000 description 1
- 102000004384 Histamine H3 receptors Human genes 0.000 description 1
- 108090000981 Histamine H3 receptors Proteins 0.000 description 1
- 102000004187 Histamine H4 receptors Human genes 0.000 description 1
- 108090000796 Histamine H4 receptors Proteins 0.000 description 1
- 102000000543 Histamine Receptors Human genes 0.000 description 1
- 108010002059 Histamine Receptors Proteins 0.000 description 1
- 102100032827 Homeodomain-interacting protein kinase 2 Human genes 0.000 description 1
- 101000600756 Homo sapiens 3-phosphoinositide-dependent protein kinase 1 Proteins 0.000 description 1
- 101000824278 Homo sapiens Acyl-[acyl-carrier-protein] hydrolase Proteins 0.000 description 1
- 101000775042 Homo sapiens Adhesion G-protein coupled receptor G1 Proteins 0.000 description 1
- 101000928335 Homo sapiens Ankyrin repeat and KH domain-containing protein 1 Proteins 0.000 description 1
- 101000864344 Homo sapiens B- and T-lymphocyte attenuator Proteins 0.000 description 1
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 1
- 101000884279 Homo sapiens CD276 antigen Proteins 0.000 description 1
- 101000716130 Homo sapiens CD48 antigen Proteins 0.000 description 1
- 101001095815 Homo sapiens E3 ubiquitin-protein ligase RING2 Proteins 0.000 description 1
- 101000934374 Homo sapiens Early activation antigen CD69 Proteins 0.000 description 1
- 101000880080 Homo sapiens Ectodysplasin-A Proteins 0.000 description 1
- 101001030691 Homo sapiens F-box/WD repeat-containing protein 1A Proteins 0.000 description 1
- 101000744505 Homo sapiens GTPase NRas Proteins 0.000 description 1
- 101001070526 Homo sapiens Guanine nucleotide-binding protein G(i) subunit alpha-1 Proteins 0.000 description 1
- 101001070508 Homo sapiens Guanine nucleotide-binding protein G(i) subunit alpha-2 Proteins 0.000 description 1
- 101000997034 Homo sapiens Guanine nucleotide-binding protein G(i) subunit alpha-3 Proteins 0.000 description 1
- 101001014590 Homo sapiens Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas Proteins 0.000 description 1
- 101001014594 Homo sapiens Guanine nucleotide-binding protein G(s) subunit alpha isoforms short Proteins 0.000 description 1
- 101000888178 Homo sapiens Guanine nucleotide-binding protein G(t) subunit alpha-1 Proteins 0.000 description 1
- 101000888142 Homo sapiens Guanine nucleotide-binding protein G(t) subunit alpha-2 Proteins 0.000 description 1
- 101000888145 Homo sapiens Guanine nucleotide-binding protein G(t) subunit alpha-3 Proteins 0.000 description 1
- 101000887490 Homo sapiens Guanine nucleotide-binding protein G(z) subunit alpha Proteins 0.000 description 1
- 101001072398 Homo sapiens Guanine nucleotide-binding protein subunit alpha-12 Proteins 0.000 description 1
- 101001072481 Homo sapiens Guanine nucleotide-binding protein subunit alpha-13 Proteins 0.000 description 1
- 101000904077 Homo sapiens Guanine nucleotide-binding protein subunit alpha-14 Proteins 0.000 description 1
- 101000904080 Homo sapiens Guanine nucleotide-binding protein subunit alpha-15 Proteins 0.000 description 1
- 101100177268 Homo sapiens HCAR3 gene Proteins 0.000 description 1
- 101001021491 Homo sapiens HERV-H LTR-associating protein 2 Proteins 0.000 description 1
- 101001066401 Homo sapiens Homeodomain-interacting protein kinase 2 Proteins 0.000 description 1
- 101000843809 Homo sapiens Hydroxycarboxylic acid receptor 2 Proteins 0.000 description 1
- 101001039035 Homo sapiens Lutropin-choriogonadotropic hormone receptor Proteins 0.000 description 1
- 101000966782 Homo sapiens Lysophosphatidic acid receptor 1 Proteins 0.000 description 1
- 101001038001 Homo sapiens Lysophosphatidic acid receptor 2 Proteins 0.000 description 1
- 101001038006 Homo sapiens Lysophosphatidic acid receptor 3 Proteins 0.000 description 1
- 101000624643 Homo sapiens M-phase inducer phosphatase 3 Proteins 0.000 description 1
- 101000969581 Homo sapiens MOB kinase activator 1A Proteins 0.000 description 1
- 101001115744 Homo sapiens MOB kinase activator 1B Proteins 0.000 description 1
- 101000978431 Homo sapiens Melanocortin receptor 3 Proteins 0.000 description 1
- 101000978418 Homo sapiens Melanocortin receptor 4 Proteins 0.000 description 1
- 101001134060 Homo sapiens Melanocyte-stimulating hormone receptor Proteins 0.000 description 1
- 101001057193 Homo sapiens Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 Proteins 0.000 description 1
- 101000644718 Homo sapiens NEDD8-conjugating enzyme UBE2F Proteins 0.000 description 1
- 101000644669 Homo sapiens NEDD8-conjugating enzyme Ubc12 Proteins 0.000 description 1
- 101000978734 Homo sapiens Nephrocystin-3 Proteins 0.000 description 1
- 101001014610 Homo sapiens Neuroendocrine secretory protein 55 Proteins 0.000 description 1
- 101000844245 Homo sapiens Non-receptor tyrosine-protein kinase TYK2 Proteins 0.000 description 1
- 101000605630 Homo sapiens Phosphatidylinositol 3-kinase catalytic subunit type 3 Proteins 0.000 description 1
- 101001117317 Homo sapiens Programmed cell death 1 ligand 1 Proteins 0.000 description 1
- 101000579300 Homo sapiens Prostaglandin F2-alpha receptor Proteins 0.000 description 1
- 101000797903 Homo sapiens Protein ALEX Proteins 0.000 description 1
- 101000579425 Homo sapiens Proto-oncogene tyrosine-protein kinase receptor Ret Proteins 0.000 description 1
- 101000580039 Homo sapiens Ras-specific guanine nucleotide-releasing factor 1 Proteins 0.000 description 1
- 101000693367 Homo sapiens SUMO-activating enzyme subunit 1 Proteins 0.000 description 1
- 101001094146 Homo sapiens SUMO-activating enzyme subunit 2 Proteins 0.000 description 1
- 101000939246 Homo sapiens SUMO-conjugating enzyme UBC9 Proteins 0.000 description 1
- 101000831007 Homo sapiens T-cell immunoreceptor with Ig and ITIM domains Proteins 0.000 description 1
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 1
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 1
- 101100207070 Homo sapiens TNFSF8 gene Proteins 0.000 description 1
- 101000764622 Homo sapiens Transmembrane and immunoglobulin domain-containing protein 2 Proteins 0.000 description 1
- 101000611183 Homo sapiens Tumor necrosis factor Proteins 0.000 description 1
- 101000830596 Homo sapiens Tumor necrosis factor ligand superfamily member 15 Proteins 0.000 description 1
- 101000764263 Homo sapiens Tumor necrosis factor ligand superfamily member 4 Proteins 0.000 description 1
- 101000610602 Homo sapiens Tumor necrosis factor receptor superfamily member 10C Proteins 0.000 description 1
- 101000610609 Homo sapiens Tumor necrosis factor receptor superfamily member 10D Proteins 0.000 description 1
- 101000798130 Homo sapiens Tumor necrosis factor receptor superfamily member 11B Proteins 0.000 description 1
- 101000795167 Homo sapiens Tumor necrosis factor receptor superfamily member 13B Proteins 0.000 description 1
- 101000795169 Homo sapiens Tumor necrosis factor receptor superfamily member 13C Proteins 0.000 description 1
- 101000801227 Homo sapiens Tumor necrosis factor receptor superfamily member 19 Proteins 0.000 description 1
- 101000679921 Homo sapiens Tumor necrosis factor receptor superfamily member 21 Proteins 0.000 description 1
- 101000611023 Homo sapiens Tumor necrosis factor receptor superfamily member 6 Proteins 0.000 description 1
- 101000597785 Homo sapiens Tumor necrosis factor receptor superfamily member 6B Proteins 0.000 description 1
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 1
- 101000997835 Homo sapiens Tyrosine-protein kinase JAK1 Proteins 0.000 description 1
- 101000997832 Homo sapiens Tyrosine-protein kinase JAK2 Proteins 0.000 description 1
- 101000934996 Homo sapiens Tyrosine-protein kinase JAK3 Proteins 0.000 description 1
- 101000740048 Homo sapiens Ubiquitin carboxyl-terminal hydrolase BAP1 Proteins 0.000 description 1
- 101000807344 Homo sapiens Ubiquitin-conjugating enzyme E2 A Proteins 0.000 description 1
- 101000807337 Homo sapiens Ubiquitin-conjugating enzyme E2 B Proteins 0.000 description 1
- 101000807354 Homo sapiens Ubiquitin-conjugating enzyme E2 C Proteins 0.000 description 1
- 101000772901 Homo sapiens Ubiquitin-conjugating enzyme E2 D2 Proteins 0.000 description 1
- 101000772913 Homo sapiens Ubiquitin-conjugating enzyme E2 D3 Proteins 0.000 description 1
- 101000644655 Homo sapiens Ubiquitin-conjugating enzyme E2 E1 Proteins 0.000 description 1
- 101000644653 Homo sapiens Ubiquitin-conjugating enzyme E2 E2 Proteins 0.000 description 1
- 101000644661 Homo sapiens Ubiquitin-conjugating enzyme E2 E3 Proteins 0.000 description 1
- 101000761646 Homo sapiens Ubiquitin-conjugating enzyme E2 G2 Proteins 0.000 description 1
- 101000644682 Homo sapiens Ubiquitin-conjugating enzyme E2 H Proteins 0.000 description 1
- 101000761725 Homo sapiens Ubiquitin-conjugating enzyme E2 J1 Proteins 0.000 description 1
- 101000761723 Homo sapiens Ubiquitin-conjugating enzyme E2 J2 Proteins 0.000 description 1
- 101000644689 Homo sapiens Ubiquitin-conjugating enzyme E2 K Proteins 0.000 description 1
- 101000761737 Homo sapiens Ubiquitin-conjugating enzyme E2 L3 Proteins 0.000 description 1
- 101000644684 Homo sapiens Ubiquitin-conjugating enzyme E2 N Proteins 0.000 description 1
- 101000761741 Homo sapiens Ubiquitin-conjugating enzyme E2 Q1 Proteins 0.000 description 1
- 101000808785 Homo sapiens Ubiquitin-conjugating enzyme E2 Q2 Proteins 0.000 description 1
- 101000808784 Homo sapiens Ubiquitin-conjugating enzyme E2 R1 Proteins 0.000 description 1
- 101000808789 Homo sapiens Ubiquitin-conjugating enzyme E2 R2 Proteins 0.000 description 1
- 101000837565 Homo sapiens Ubiquitin-conjugating enzyme E2 S Proteins 0.000 description 1
- 101000837581 Homo sapiens Ubiquitin-conjugating enzyme E2 T Proteins 0.000 description 1
- 101000837580 Homo sapiens Ubiquitin-conjugating enzyme E2 U Proteins 0.000 description 1
- 101000772891 Homo sapiens Ubiquitin-conjugating enzyme E2 Z Proteins 0.000 description 1
- 101000808753 Homo sapiens Ubiquitin-conjugating enzyme E2 variant 1 Proteins 0.000 description 1
- 101000940063 Homo sapiens Ubiquitin-conjugating enzyme E2 variant 2 Proteins 0.000 description 1
- 101000809090 Homo sapiens Ubiquitin-fold modifier-conjugating enzyme 1 Proteins 0.000 description 1
- 101000807306 Homo sapiens Ubiquitin-like modifier-activating enzyme 1 Proteins 0.000 description 1
- 101000662026 Homo sapiens Ubiquitin-like modifier-activating enzyme 7 Proteins 0.000 description 1
- 101000761740 Homo sapiens Ubiquitin/ISG15-conjugating enzyme E2 L6 Proteins 0.000 description 1
- 101000650162 Homo sapiens WW domain-containing transcription regulator protein 1 Proteins 0.000 description 1
- 101001117146 Homo sapiens [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial Proteins 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- 102100030643 Hydroxycarboxylic acid receptor 2 Human genes 0.000 description 1
- 102100039356 Hydroxycarboxylic acid receptor 3 Human genes 0.000 description 1
- VSNHCAURESNICA-UHFFFAOYSA-N Hydroxyurea Chemical compound NC(=O)NO VSNHCAURESNICA-UHFFFAOYSA-N 0.000 description 1
- UGQMRVRMYYASKQ-UHFFFAOYSA-N Hypoxanthine nucleoside Natural products OC1C(O)C(CO)OC1N1C(NC=NC2=O)=C2N=C1 UGQMRVRMYYASKQ-UHFFFAOYSA-N 0.000 description 1
- 101710093458 ICOS ligand Proteins 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 102000037984 Inhibitory immune checkpoint proteins Human genes 0.000 description 1
- 108091008026 Inhibitory immune checkpoint proteins Proteins 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 206010061252 Intraocular melanoma Diseases 0.000 description 1
- 241000764238 Isis Species 0.000 description 1
- 208000011200 Kawasaki disease Diseases 0.000 description 1
- 102000010638 Kinesin Human genes 0.000 description 1
- 108010063296 Kinesin Proteins 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- 239000002067 L01XE06 - Dasatinib Substances 0.000 description 1
- 239000003798 L01XE11 - Pazopanib Substances 0.000 description 1
- 239000002145 L01XE14 - Bosutinib Substances 0.000 description 1
- 239000002146 L01XE16 - Crizotinib Substances 0.000 description 1
- 239000002138 L01XE21 - Regorafenib Substances 0.000 description 1
- 239000002137 L01XE24 - Ponatinib Substances 0.000 description 1
- 102000017578 LAG3 Human genes 0.000 description 1
- JVTAAEKCZFNVCJ-UHFFFAOYSA-M Lactate Chemical compound CC(O)C([O-])=O JVTAAEKCZFNVCJ-UHFFFAOYSA-M 0.000 description 1
- 101000740049 Latilactobacillus curvatus Bioactive peptide 1 Proteins 0.000 description 1
- 208000018142 Leiomyosarcoma Diseases 0.000 description 1
- 240000007472 Leucaena leucocephala Species 0.000 description 1
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 1
- 102000003960 Ligases Human genes 0.000 description 1
- 108090000364 Ligases Proteins 0.000 description 1
- WHXSMMKQMYFTQS-UHFFFAOYSA-N Lithium Chemical compound [Li] WHXSMMKQMYFTQS-UHFFFAOYSA-N 0.000 description 1
- GQYIWUVLTXOXAJ-UHFFFAOYSA-N Lomustine Chemical compound ClCCN(N=O)C(=O)NC1CCCCC1 GQYIWUVLTXOXAJ-UHFFFAOYSA-N 0.000 description 1
- 102100040788 Lutropin-choriogonadotropic hormone receptor Human genes 0.000 description 1
- 102000008072 Lymphokines Human genes 0.000 description 1
- 108010074338 Lymphokines Proteins 0.000 description 1
- 102100040607 Lysophosphatidic acid receptor 1 Human genes 0.000 description 1
- 102100040387 Lysophosphatidic acid receptor 2 Human genes 0.000 description 1
- 102100040388 Lysophosphatidic acid receptor 3 Human genes 0.000 description 1
- 102100023330 M-phase inducer phosphatase 3 Human genes 0.000 description 1
- 229940124761 MMP inhibitor Drugs 0.000 description 1
- 102100021437 MOB kinase activator 1A Human genes 0.000 description 1
- 102100024997 MOB kinase activator 1B Human genes 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- OFOBLEOULBTSOW-UHFFFAOYSA-L Malonate Chemical compound [O-]C(=O)CC([O-])=O OFOBLEOULBTSOW-UHFFFAOYSA-L 0.000 description 1
- 240000003183 Manihot esculenta Species 0.000 description 1
- 235000016735 Manihot esculenta subsp esculenta Nutrition 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 102100027754 Mast/stem cell growth factor receptor Kit Human genes 0.000 description 1
- 101710087603 Mast/stem cell growth factor receptor Kit Proteins 0.000 description 1
- 208000007054 Medullary Carcinoma Diseases 0.000 description 1
- 102000030612 Melanocortin 5 receptor Human genes 0.000 description 1
- 108010088565 Melanocortin 5 receptor Proteins 0.000 description 1
- 108090000950 Melanocortin Receptors Proteins 0.000 description 1
- 102000004378 Melanocortin Receptors Human genes 0.000 description 1
- 102100023726 Melanocortin receptor 3 Human genes 0.000 description 1
- 102100023724 Melanocortin receptor 4 Human genes 0.000 description 1
- 102100034216 Melanocyte-stimulating hormone receptor Human genes 0.000 description 1
- YJPIGAIKUZMOQA-UHFFFAOYSA-N Melatonin Natural products COC1=CC=C2N(C(C)=O)C=C(CCN)C2=C1 YJPIGAIKUZMOQA-UHFFFAOYSA-N 0.000 description 1
- 108010061593 Member 14 Tumor Necrosis Factor Receptors Proteins 0.000 description 1
- 102100027240 Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 Human genes 0.000 description 1
- 208000002030 Merkel cell carcinoma Diseases 0.000 description 1
- 102000005741 Metalloproteases Human genes 0.000 description 1
- 108010006035 Metalloproteases Proteins 0.000 description 1
- 206010051676 Metastases to peritoneum Diseases 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 102000004232 Mitogen-Activated Protein Kinase Kinases Human genes 0.000 description 1
- 108090000744 Mitogen-Activated Protein Kinase Kinases Proteins 0.000 description 1
- 208000035489 Monocytic Acute Leukemia Diseases 0.000 description 1
- 102000007474 Multiprotein Complexes Human genes 0.000 description 1
- 108010085220 Multiprotein Complexes Proteins 0.000 description 1
- 101100335081 Mus musculus Flt3 gene Proteins 0.000 description 1
- 101100207071 Mus musculus Tnfsf8 gene Proteins 0.000 description 1
- 101000597780 Mus musculus Tumor necrosis factor ligand superfamily member 18 Proteins 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 208000033835 Myelomonocytic Acute Leukemia Diseases 0.000 description 1
- FBKMWOJEPMPVTQ-UHFFFAOYSA-N N'-(3-bromo-4-fluorophenyl)-N-hydroxy-4-[2-(sulfamoylamino)ethylamino]-1,2,5-oxadiazole-3-carboximidamide Chemical compound NS(=O)(=O)NCCNC1=NON=C1C(=NO)NC1=CC=C(F)C(Br)=C1 FBKMWOJEPMPVTQ-UHFFFAOYSA-N 0.000 description 1
- RRMJMHOQSALEJJ-UHFFFAOYSA-N N-[5-[[4-[4-[(dimethylamino)methyl]-3-phenylpyrazol-1-yl]pyrimidin-2-yl]amino]-4-methoxy-2-morpholin-4-ylphenyl]prop-2-enamide Chemical compound CN(C)CC=1C(=NN(C=1)C1=NC(=NC=C1)NC=1C(=CC(=C(C=1)NC(C=C)=O)N1CCOCC1)OC)C1=CC=CC=C1 RRMJMHOQSALEJJ-UHFFFAOYSA-N 0.000 description 1
- PRQROPMIIGLWRP-UHFFFAOYSA-N N-formyl-methionyl-leucyl-phenylalanin Chemical compound CSCCC(NC=O)C(=O)NC(CC(C)C)C(=O)NC(C(O)=O)CC1=CC=CC=C1 PRQROPMIIGLWRP-UHFFFAOYSA-N 0.000 description 1
- CHJJGSNFBQVOTG-UHFFFAOYSA-N N-methyl-guanidine Natural products CNC(N)=N CHJJGSNFBQVOTG-UHFFFAOYSA-N 0.000 description 1
- 150000001204 N-oxides Chemical class 0.000 description 1
- JOOXLOJCABQBSG-UHFFFAOYSA-N N-tert-butyl-3-[[5-methyl-2-[4-[2-(1-pyrrolidinyl)ethoxy]anilino]-4-pyrimidinyl]amino]benzenesulfonamide Chemical compound N1=C(NC=2C=C(C=CC=2)S(=O)(=O)NC(C)(C)C)C(C)=CN=C1NC(C=C1)=CC=C1OCCN1CCCC1 JOOXLOJCABQBSG-UHFFFAOYSA-N 0.000 description 1
- CXQHYVUVSFXTMY-UHFFFAOYSA-N N1'-[3-fluoro-4-[[6-methoxy-7-[3-(4-morpholinyl)propoxy]-4-quinolinyl]oxy]phenyl]-N1-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=CN=C2C=C(OCCCN3CCOCC3)C(OC)=CC2=C1OC(C(=C1)F)=CC=C1NC(=O)C1(C(=O)NC=2C=CC(F)=CC=2)CC1 CXQHYVUVSFXTMY-UHFFFAOYSA-N 0.000 description 1
- 108091007791 NAE1 Proteins 0.000 description 1
- 102100029781 NEDD8-activating enzyme E1 regulatory subunit Human genes 0.000 description 1
- 102100020694 NEDD8-conjugating enzyme UBE2F Human genes 0.000 description 1
- 102100020710 NEDD8-conjugating enzyme Ubc12 Human genes 0.000 description 1
- GPVKLYONJSSZFL-UHFFFAOYSA-N NSC 750259 Natural products CCC(C)C=CC(O)C(O)C(O)C(OC)C(=O)NC1CCCCNC1=O GPVKLYONJSSZFL-UHFFFAOYSA-N 0.000 description 1
- 208000002454 Nasopharyngeal Carcinoma Diseases 0.000 description 1
- 206010061306 Nasopharyngeal cancer Diseases 0.000 description 1
- 102100023188 Nephrocystin-3 Human genes 0.000 description 1
- 108010032605 Nerve Growth Factor Receptors Proteins 0.000 description 1
- 206010029266 Neuroendocrine carcinoma of the skin Diseases 0.000 description 1
- 208000009905 Neurofibromatoses Diseases 0.000 description 1
- 101100380548 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) apg-2 gene Proteins 0.000 description 1
- PVNIIMVLHYAWGP-UHFFFAOYSA-N Niacin Chemical compound OC(=O)C1=CC=CN=C1 PVNIIMVLHYAWGP-UHFFFAOYSA-N 0.000 description 1
- 108700010041 Nicotinic acid receptor Proteins 0.000 description 1
- 102100028646 Nociceptin receptor Human genes 0.000 description 1
- 102100032028 Non-receptor tyrosine-protein kinase TYK2 Human genes 0.000 description 1
- 108020004485 Nonsense Codon Proteins 0.000 description 1
- MSHZHSPISPJWHW-UHFFFAOYSA-N O-(chloroacetylcarbamoyl)fumagillol Chemical compound O1C(CC=C(C)C)C1(C)C1C(OC)C(OC(=O)NC(=O)CCl)CCC21CO2 MSHZHSPISPJWHW-UHFFFAOYSA-N 0.000 description 1
- 108010064641 ONX 0912 Proteins 0.000 description 1
- YGACXVRLDHEXKY-WXRXAMBDSA-N O[C@H](C[C@H]1c2c(cccc2F)-c2cncn12)[C@H]1CC[C@H](O)CC1 Chemical compound O[C@H](C[C@H]1c2c(cccc2F)-c2cncn12)[C@H]1CC[C@H](O)CC1 YGACXVRLDHEXKY-WXRXAMBDSA-N 0.000 description 1
- 108010016076 Octreotide Proteins 0.000 description 1
- 240000007817 Olea europaea Species 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 102000003840 Opioid Receptors Human genes 0.000 description 1
- 108090000137 Opioid Receptors Proteins 0.000 description 1
- 102100037600 P2Y purinoceptor 1 Human genes 0.000 description 1
- 108050008996 P2Y purinoceptor 1 Proteins 0.000 description 1
- 102100028045 P2Y purinoceptor 2 Human genes 0.000 description 1
- 101710096700 P2Y purinoceptor 2 Proteins 0.000 description 1
- 102100028070 P2Y purinoceptor 4 Human genes 0.000 description 1
- 108050009478 P2Y purinoceptor 4 Proteins 0.000 description 1
- 102100028074 P2Y purinoceptor 6 Human genes 0.000 description 1
- 101710096702 P2Y purinoceptor 6 Proteins 0.000 description 1
- 239000012661 PARP inhibitor Substances 0.000 description 1
- 102000038030 PI3Ks Human genes 0.000 description 1
- 108091007960 PI3Ks Proteins 0.000 description 1
- 108010067372 Pancreatic elastase Proteins 0.000 description 1
- 102000016387 Pancreatic elastase Human genes 0.000 description 1
- 108010058828 Parathyroid Hormone Receptors Proteins 0.000 description 1
- 208000000821 Parathyroid Neoplasms Diseases 0.000 description 1
- 102100032256 Parathyroid hormone/parathyroid hormone-related peptide receptor Human genes 0.000 description 1
- 208000034038 Pathologic Neovascularization Diseases 0.000 description 1
- 208000002471 Penile Neoplasms Diseases 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 208000012896 Peritoneal disease Diseases 0.000 description 1
- 101100237801 Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) MLNS gene Proteins 0.000 description 1
- 102100030919 Phosphatidylcholine:ceramide cholinephosphotransferase 1 Human genes 0.000 description 1
- 102100038329 Phosphatidylinositol 3-kinase catalytic subunit type 3 Human genes 0.000 description 1
- 102000017343 Phosphatidylinositol kinases Human genes 0.000 description 1
- 108050005377 Phosphatidylinositol kinases Proteins 0.000 description 1
- 201000007286 Pilocytic astrocytoma Diseases 0.000 description 1
- 201000005746 Pituitary adenoma Diseases 0.000 description 1
- 206010061538 Pituitary tumour benign Diseases 0.000 description 1
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 1
- 229940121906 Poly ADP ribose polymerase inhibitor Drugs 0.000 description 1
- 229920002732 Polyanhydride Polymers 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 229920001710 Polyorthoester Polymers 0.000 description 1
- 229920001214 Polysorbate 60 Polymers 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 1
- 208000033826 Promyelocytic Acute Leukemia Diseases 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-M Propionate Chemical compound CCC([O-])=O XBDQKXXYIPTUBI-UHFFFAOYSA-M 0.000 description 1
- 102100035842 Prostaglandin E2 receptor EP1 subtype Human genes 0.000 description 1
- 101710097690 Prostaglandin E2 receptor EP1 subtype Proteins 0.000 description 1
- 102100024447 Prostaglandin E2 receptor EP3 subtype Human genes 0.000 description 1
- 101710125002 Prostaglandin E2 receptor EP3 subtype Proteins 0.000 description 1
- 102100028248 Prostaglandin F2-alpha receptor Human genes 0.000 description 1
- 108010007568 Protamines Proteins 0.000 description 1
- 102000007327 Protamines Human genes 0.000 description 1
- 102000002020 Protease-activated receptors Human genes 0.000 description 1
- 108050009310 Protease-activated receptors Proteins 0.000 description 1
- 102100022309 Protein KIBRA Human genes 0.000 description 1
- 101710145046 Protein kibra Proteins 0.000 description 1
- 229940123573 Protein synthesis inhibitor Drugs 0.000 description 1
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 1
- 102100037132 Proteinase-activated receptor 2 Human genes 0.000 description 1
- 101710121435 Proteinase-activated receptor 2 Proteins 0.000 description 1
- 102100028286 Proto-oncogene tyrosine-protein kinase receptor Ret Human genes 0.000 description 1
- 102100022095 Protocadherin Fat 1 Human genes 0.000 description 1
- 101710095128 Protocadherin Fat 1 Proteins 0.000 description 1
- 102000000033 Purinergic Receptors Human genes 0.000 description 1
- 108010080192 Purinergic Receptors Proteins 0.000 description 1
- CZPWVGJYEJSRLH-UHFFFAOYSA-N Pyrimidine Chemical compound C1=CN=CN=C1 CZPWVGJYEJSRLH-UHFFFAOYSA-N 0.000 description 1
- 102000018795 RELT Human genes 0.000 description 1
- 108010052562 RELT Proteins 0.000 description 1
- 101710178916 RING-box protein 1 Proteins 0.000 description 1
- 239000005464 Radotinib Substances 0.000 description 1
- 108091005682 Receptor kinases Proteins 0.000 description 1
- 101710100969 Receptor tyrosine-protein kinase erbB-3 Proteins 0.000 description 1
- 101710100963 Receptor tyrosine-protein kinase erbB-4 Proteins 0.000 description 1
- 102100020718 Receptor-type tyrosine-protein kinase FLT3 Human genes 0.000 description 1
- 101710151245 Receptor-type tyrosine-protein kinase FLT3 Proteins 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 229940123934 Reductase inhibitor Drugs 0.000 description 1
- 241000702263 Reovirus sp. Species 0.000 description 1
- 206010038934 Retinopathy proliferative Diseases 0.000 description 1
- 208000008938 Rhabdoid tumor Diseases 0.000 description 1
- 206010073334 Rhabdoid tumour Diseases 0.000 description 1
- 108010041388 Ribonucleotide Reductases Proteins 0.000 description 1
- 102000000505 Ribonucleotide Reductases Human genes 0.000 description 1
- PYMYPHUHKUWMLA-LMVFSUKVSA-N Ribose Natural products OC[C@@H](O)[C@@H](O)[C@@H](O)C=O PYMYPHUHKUWMLA-LMVFSUKVSA-N 0.000 description 1
- 235000004443 Ricinus communis Nutrition 0.000 description 1
- IIDJRNMFWXDHID-UHFFFAOYSA-N Risedronic acid Chemical compound OP(=O)(O)C(P(O)(O)=O)(O)CC1=CC=CN=C1 IIDJRNMFWXDHID-UHFFFAOYSA-N 0.000 description 1
- 102000001332 SRC Human genes 0.000 description 1
- 108060006706 SRC Proteins 0.000 description 1
- 102100025809 SUMO-activating enzyme subunit 1 Human genes 0.000 description 1
- 102100035250 SUMO-activating enzyme subunit 2 Human genes 0.000 description 1
- 102100029807 SUMO-conjugating enzyme UBC9 Human genes 0.000 description 1
- 102100028927 Secretin receptor Human genes 0.000 description 1
- 201000010208 Seminoma Diseases 0.000 description 1
- 102100026715 Serine/threonine-protein kinase STK11 Human genes 0.000 description 1
- 101710181599 Serine/threonine-protein kinase STK11 Proteins 0.000 description 1
- 102100030403 Signal peptide peptidase-like 2A Human genes 0.000 description 1
- 108050005900 Signal peptide peptidase-like 2a Proteins 0.000 description 1
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 1
- 108091027967 Small hairpin RNA Proteins 0.000 description 1
- 108020004459 Small interfering RNA Proteins 0.000 description 1
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 1
- 208000021712 Soft tissue sarcoma Diseases 0.000 description 1
- 244000061456 Solanum tuberosum Species 0.000 description 1
- 235000002595 Solanum tuberosum Nutrition 0.000 description 1
- 102000004584 Somatomedin Receptors Human genes 0.000 description 1
- 108010017622 Somatomedin Receptors Proteins 0.000 description 1
- 102000005157 Somatostatin Human genes 0.000 description 1
- 108010056088 Somatostatin Proteins 0.000 description 1
- 229940121856 Somatostatin receptor antagonist Drugs 0.000 description 1
- HVUMOYIDDBPOLL-XWVZOOPGSA-N Sorbitan monostearate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O HVUMOYIDDBPOLL-XWVZOOPGSA-N 0.000 description 1
- 102100025749 Sphingosine 1-phosphate receptor 2 Human genes 0.000 description 1
- 101710155462 Sphingosine 1-phosphate receptor 2 Proteins 0.000 description 1
- 102100025747 Sphingosine 1-phosphate receptor 3 Human genes 0.000 description 1
- 101710155457 Sphingosine 1-phosphate receptor 3 Proteins 0.000 description 1
- 102100029803 Sphingosine 1-phosphate receptor 4 Human genes 0.000 description 1
- 101710155458 Sphingosine 1-phosphate receptor 4 Proteins 0.000 description 1
- 102100029802 Sphingosine 1-phosphate receptor 5 Human genes 0.000 description 1
- 101710155451 Sphingosine 1-phosphate receptor 5 Proteins 0.000 description 1
- SSZBUIDZHHWXNJ-UHFFFAOYSA-N Stearinsaeure-hexadecylester Natural products CCCCCCCCCCCCCCCCCC(=O)OCCCCCCCCCCCCCCCC SSZBUIDZHHWXNJ-UHFFFAOYSA-N 0.000 description 1
- 208000001662 Subependymal Glioma Diseases 0.000 description 1
- 108010002687 Survivin Proteins 0.000 description 1
- 102100024834 T-cell immunoreceptor with Ig and ITIM domains Human genes 0.000 description 1
- 208000000389 T-cell leukemia Diseases 0.000 description 1
- 208000028530 T-cell lymphoblastic leukemia/lymphoma Diseases 0.000 description 1
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 1
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 1
- 108700040013 TEA Domain Transcription Factors Proteins 0.000 description 1
- 102000042834 TEC family Human genes 0.000 description 1
- 108091082333 TEC family Proteins 0.000 description 1
- 108091005735 TGF-beta receptors Proteins 0.000 description 1
- 101150082530 TJP1 gene Proteins 0.000 description 1
- 108700012920 TNF Proteins 0.000 description 1
- 102000016946 TWEAK Receptor Human genes 0.000 description 1
- 108010014401 TWEAK Receptor Proteins 0.000 description 1
- 108010072901 Tachykinin Receptors Proteins 0.000 description 1
- 102000007124 Tachykinin Receptors Human genes 0.000 description 1
- JXAGDPXECXQWBC-LJQANCHMSA-N Tanomastat Chemical compound C([C@H](C(=O)O)CC(=O)C=1C=CC(=CC=1)C=1C=CC(Cl)=CC=1)SC1=CC=CC=C1 JXAGDPXECXQWBC-LJQANCHMSA-N 0.000 description 1
- FEWJPZIEWOKRBE-UHFFFAOYSA-N Tartaric acid Natural products [H+].[H+].[O-]C(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-N 0.000 description 1
- 229940123582 Telomerase inhibitor Drugs 0.000 description 1
- 108091033399 Telomestatin Proteins 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- ZMZDMBWJUHKJPS-UHFFFAOYSA-M Thiocyanate anion Chemical compound [S-]C#N ZMZDMBWJUHKJPS-UHFFFAOYSA-M 0.000 description 1
- 108090000190 Thrombin Proteins 0.000 description 1
- 229940122020 Thymidine phosphorylase inhibitor Drugs 0.000 description 1
- 229940122149 Thymidylate synthase inhibitor Drugs 0.000 description 1
- 102100029337 Thyrotropin receptor Human genes 0.000 description 1
- 239000004012 Tofacitinib Substances 0.000 description 1
- 102100025173 Trace amine-associated receptor 8 Human genes 0.000 description 1
- 101710116434 Trace amine-associated receptor 8 Proteins 0.000 description 1
- 101710193680 Transcriptional coactivator YAP1 Proteins 0.000 description 1
- 229940123468 Transferase inhibitor Drugs 0.000 description 1
- 102000016715 Transforming Growth Factor beta Receptors Human genes 0.000 description 1
- 102100025946 Transforming growth factor beta activator LRRC32 Human genes 0.000 description 1
- 101710169732 Transforming growth factor beta activator LRRC32 Proteins 0.000 description 1
- 102100026224 Transmembrane and immunoglobulin domain-containing protein 2 Human genes 0.000 description 1
- RTKIYFITIVXBLE-UHFFFAOYSA-N Trichostatin A Natural products ONC(=O)C=CC(C)=CC(C)C(=O)C1=CC=C(N(C)C)C=C1 RTKIYFITIVXBLE-UHFFFAOYSA-N 0.000 description 1
- YZCKVEUIGOORGS-NJFSPNSNSA-N Tritium Chemical compound [3H] YZCKVEUIGOORGS-NJFSPNSNSA-N 0.000 description 1
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 description 1
- 102100040247 Tumor necrosis factor Human genes 0.000 description 1
- 102100024584 Tumor necrosis factor ligand superfamily member 12 Human genes 0.000 description 1
- 101710097155 Tumor necrosis factor ligand superfamily member 12 Proteins 0.000 description 1
- 102100024587 Tumor necrosis factor ligand superfamily member 15 Human genes 0.000 description 1
- 102100035283 Tumor necrosis factor ligand superfamily member 18 Human genes 0.000 description 1
- 102100026890 Tumor necrosis factor ligand superfamily member 4 Human genes 0.000 description 1
- 102100031988 Tumor necrosis factor ligand superfamily member 6 Human genes 0.000 description 1
- 102100032100 Tumor necrosis factor ligand superfamily member 8 Human genes 0.000 description 1
- 102100040115 Tumor necrosis factor receptor superfamily member 10C Human genes 0.000 description 1
- 102100040110 Tumor necrosis factor receptor superfamily member 10D Human genes 0.000 description 1
- 102100032236 Tumor necrosis factor receptor superfamily member 11B Human genes 0.000 description 1
- 102100029675 Tumor necrosis factor receptor superfamily member 13B Human genes 0.000 description 1
- 102100029690 Tumor necrosis factor receptor superfamily member 13C Human genes 0.000 description 1
- 102100028785 Tumor necrosis factor receptor superfamily member 14 Human genes 0.000 description 1
- 102100033725 Tumor necrosis factor receptor superfamily member 16 Human genes 0.000 description 1
- 102100033760 Tumor necrosis factor receptor superfamily member 19 Human genes 0.000 description 1
- 102100033732 Tumor necrosis factor receptor superfamily member 1A Human genes 0.000 description 1
- 101710187743 Tumor necrosis factor receptor superfamily member 1A Proteins 0.000 description 1
- 101710187830 Tumor necrosis factor receptor superfamily member 1B Proteins 0.000 description 1
- 102100033733 Tumor necrosis factor receptor superfamily member 1B Human genes 0.000 description 1
- 102100022205 Tumor necrosis factor receptor superfamily member 21 Human genes 0.000 description 1
- 102100035284 Tumor necrosis factor receptor superfamily member 6B Human genes 0.000 description 1
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 1
- 108010021430 Type 2 Melanocortin Receptor Proteins 0.000 description 1
- 102100033438 Tyrosine-protein kinase JAK1 Human genes 0.000 description 1
- 102100033444 Tyrosine-protein kinase JAK2 Human genes 0.000 description 1
- 102100025387 Tyrosine-protein kinase JAK3 Human genes 0.000 description 1
- 102100037236 Tyrosine-protein kinase receptor UFO Human genes 0.000 description 1
- 108060008744 UBA3 Proteins 0.000 description 1
- 102000003436 UBA3 Human genes 0.000 description 1
- 102000003431 Ubiquitin-Conjugating Enzyme Human genes 0.000 description 1
- 108060008747 Ubiquitin-Conjugating Enzyme Proteins 0.000 description 1
- 102000006275 Ubiquitin-Protein Ligases Human genes 0.000 description 1
- 108010083111 Ubiquitin-Protein Ligases Proteins 0.000 description 1
- 101710132695 Ubiquitin-conjugating enzyme E2 Proteins 0.000 description 1
- 102100037261 Ubiquitin-conjugating enzyme E2 A Human genes 0.000 description 1
- 102100037262 Ubiquitin-conjugating enzyme E2 B Human genes 0.000 description 1
- 102100037256 Ubiquitin-conjugating enzyme E2 C Human genes 0.000 description 1
- 102100030439 Ubiquitin-conjugating enzyme E2 D2 Human genes 0.000 description 1
- 102100030425 Ubiquitin-conjugating enzyme E2 D3 Human genes 0.000 description 1
- 102100020711 Ubiquitin-conjugating enzyme E2 E1 Human genes 0.000 description 1
- 102100020704 Ubiquitin-conjugating enzyme E2 E2 Human genes 0.000 description 1
- 102100020709 Ubiquitin-conjugating enzyme E2 E3 Human genes 0.000 description 1
- 102100024870 Ubiquitin-conjugating enzyme E2 G2 Human genes 0.000 description 1
- 102100020698 Ubiquitin-conjugating enzyme E2 H Human genes 0.000 description 1
- 102100024860 Ubiquitin-conjugating enzyme E2 J1 Human genes 0.000 description 1
- 102100024863 Ubiquitin-conjugating enzyme E2 J2 Human genes 0.000 description 1
- 102100020696 Ubiquitin-conjugating enzyme E2 K Human genes 0.000 description 1
- 102100024861 Ubiquitin-conjugating enzyme E2 L3 Human genes 0.000 description 1
- 102100020695 Ubiquitin-conjugating enzyme E2 N Human genes 0.000 description 1
- 102100024846 Ubiquitin-conjugating enzyme E2 Q1 Human genes 0.000 description 1
- 102100038500 Ubiquitin-conjugating enzyme E2 Q2 Human genes 0.000 description 1
- 102100038466 Ubiquitin-conjugating enzyme E2 R1 Human genes 0.000 description 1
- 102100038499 Ubiquitin-conjugating enzyme E2 R2 Human genes 0.000 description 1
- 102100028718 Ubiquitin-conjugating enzyme E2 S Human genes 0.000 description 1
- 102100028705 Ubiquitin-conjugating enzyme E2 T Human genes 0.000 description 1
- 102100028710 Ubiquitin-conjugating enzyme E2 U Human genes 0.000 description 1
- 102100030441 Ubiquitin-conjugating enzyme E2 Z Human genes 0.000 description 1
- 102100038467 Ubiquitin-conjugating enzyme E2 variant 1 Human genes 0.000 description 1
- 102100031122 Ubiquitin-conjugating enzyme E2 variant 2 Human genes 0.000 description 1
- 102100038483 Ubiquitin-fold modifier-conjugating enzyme 1 Human genes 0.000 description 1
- 102100037160 Ubiquitin-like modifier-activating enzyme 1 Human genes 0.000 description 1
- 102100037938 Ubiquitin-like modifier-activating enzyme 7 Human genes 0.000 description 1
- 102100022979 Ubiquitin-like modifier-activating enzyme ATG7 Human genes 0.000 description 1
- 102100024843 Ubiquitin/ISG15-conjugating enzyme E2 L6 Human genes 0.000 description 1
- 208000023915 Ureteral Neoplasms Diseases 0.000 description 1
- 206010046458 Urethral neoplasms Diseases 0.000 description 1
- 208000008385 Urogenital Neoplasms Diseases 0.000 description 1
- 108010079206 V-Set Domain-Containing T-Cell Activation Inhibitor 1 Proteins 0.000 description 1
- 102100038929 V-set domain-containing T-cell activation inhibitor 1 Human genes 0.000 description 1
- 108091008605 VEGF receptors Proteins 0.000 description 1
- 229940091171 VEGFR-2 tyrosine kinase inhibitor Drugs 0.000 description 1
- 101800003344 Vaccinia growth factor Proteins 0.000 description 1
- 201000003761 Vaginal carcinoma Diseases 0.000 description 1
- 108010053099 Vascular Endothelial Growth Factor Receptor-2 Proteins 0.000 description 1
- 108010053100 Vascular Endothelial Growth Factor Receptor-3 Proteins 0.000 description 1
- 102100033179 Vascular endothelial growth factor receptor 3 Human genes 0.000 description 1
- GXBMIBRIOWHPDT-UHFFFAOYSA-N Vasopressin Natural products N1C(=O)C(CC=2C=C(O)C=CC=2)NC(=O)C(N)CSSCC(C(=O)N2C(CCC2)C(=O)NC(CCCN=C(N)N)C(=O)NCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(CCC(N)=O)NC(=O)C1CC1=CC=CC=C1 GXBMIBRIOWHPDT-UHFFFAOYSA-N 0.000 description 1
- 102000004136 Vasopressin Receptors Human genes 0.000 description 1
- 108090000643 Vasopressin Receptors Proteins 0.000 description 1
- 108010004977 Vasopressins Proteins 0.000 description 1
- 102000002852 Vasopressins Human genes 0.000 description 1
- 229940122803 Vinca alkaloid Drugs 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 206010047741 Vulval cancer Diseases 0.000 description 1
- 208000004354 Vulvar Neoplasms Diseases 0.000 description 1
- 208000008383 Wilms tumor Diseases 0.000 description 1
- 208000027418 Wounds and injury Diseases 0.000 description 1
- VWQVUPCCIRVNHF-OUBTZVSYSA-N Yttrium-90 Chemical compound [90Y] VWQVUPCCIRVNHF-OUBTZVSYSA-N 0.000 description 1
- 240000008042 Zea mays Species 0.000 description 1
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 description 1
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 1
- 239000001089 [(2R)-oxolan-2-yl]methanol Substances 0.000 description 1
- MQTBAGAVFDZXKF-UHFFFAOYSA-N [2-fluoro-4-(trifluoromethyl)phenyl]methanamine Chemical compound NCC1=CC=C(C(F)(F)F)C=C1F MQTBAGAVFDZXKF-UHFFFAOYSA-N 0.000 description 1
- 102100024148 [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial Human genes 0.000 description 1
- 229950005186 abagovomab Drugs 0.000 description 1
- 108010023617 abarelix Proteins 0.000 description 1
- AIWRTTMUVOZGPW-HSPKUQOVSA-N abarelix Chemical compound C([C@@H](C(=O)N[C@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCNC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@H](C)C(N)=O)N(C)C(=O)[C@H](CO)NC(=O)[C@@H](CC=1C=NC=CC=1)NC(=O)[C@@H](CC=1C=CC(Cl)=CC=1)NC(=O)[C@@H](CC=1C=C2C=CC=CC2=CC=1)NC(C)=O)C1=CC=C(O)C=C1 AIWRTTMUVOZGPW-HSPKUQOVSA-N 0.000 description 1
- 229960002184 abarelix Drugs 0.000 description 1
- 229950001573 abemaciclib Drugs 0.000 description 1
- 229960000853 abiraterone Drugs 0.000 description 1
- 229940028652 abraxane Drugs 0.000 description 1
- 239000002250 absorbent Substances 0.000 description 1
- 230000002745 absorbent Effects 0.000 description 1
- 239000003655 absorption accelerator Substances 0.000 description 1
- 229940124532 absorption promoter Drugs 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- 108010052004 acetyl-2-naphthylalanyl-3-chlorophenylalanyl-1-oxohexadecyl-seryl-4-aminophenylalanyl(hydroorotyl)-4-aminophenylalanyl(carbamoyl)-leucyl-ILys-prolyl-alaninamide Proteins 0.000 description 1
- 208000017733 acquired polycythemia vera Diseases 0.000 description 1
- 125000000641 acridinyl group Chemical group C1(=CC=CC2=NC3=CC=CC=C3C=C12)* 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 208000021841 acute erythroid leukemia Diseases 0.000 description 1
- 208000011912 acute myelomonocytic leukemia M4 Diseases 0.000 description 1
- 229950009084 adecatumumab Drugs 0.000 description 1
- WNLRTRBMVRJNCN-UHFFFAOYSA-L adipate(2-) Chemical compound [O-]C(=O)CCCCC([O-])=O WNLRTRBMVRJNCN-UHFFFAOYSA-L 0.000 description 1
- 238000009098 adjuvant therapy Methods 0.000 description 1
- 208000015234 adrenal cortex adenoma Diseases 0.000 description 1
- 201000003354 adrenal cortical adenoma Diseases 0.000 description 1
- 208000024447 adrenal gland neoplasm Diseases 0.000 description 1
- 230000001780 adrenocortical effect Effects 0.000 description 1
- 229940009456 adriamycin Drugs 0.000 description 1
- 201000006966 adult T-cell leukemia Diseases 0.000 description 1
- 229940042992 afinitor Drugs 0.000 description 1
- 108010081667 aflibercept Proteins 0.000 description 1
- 235000010419 agar Nutrition 0.000 description 1
- 229960001611 alectinib Drugs 0.000 description 1
- KDGFLJKFZUIJMX-UHFFFAOYSA-N alectinib Chemical compound CCC1=CC=2C(=O)C(C3=CC=C(C=C3N3)C#N)=C3C(C)(C)C=2C=C1N(CC1)CCC1N1CCOCC1 KDGFLJKFZUIJMX-UHFFFAOYSA-N 0.000 description 1
- 229960000548 alemtuzumab Drugs 0.000 description 1
- 229940072056 alginate Drugs 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 229940110282 alimta Drugs 0.000 description 1
- 239000003513 alkali Substances 0.000 description 1
- 229910052783 alkali metal Inorganic materials 0.000 description 1
- 150000001340 alkali metals Chemical class 0.000 description 1
- 150000001342 alkaline earth metals Chemical class 0.000 description 1
- 229930013930 alkaloid Natural products 0.000 description 1
- 230000002152 alkylating effect Effects 0.000 description 1
- 125000000304 alkynyl group Chemical group 0.000 description 1
- 125000004419 alkynylene group Chemical group 0.000 description 1
- SHGAZHPCJJPHSC-YCNIQYBTSA-N all-trans-retinoic acid Chemical compound OC(=O)\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-YCNIQYBTSA-N 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- 229950010482 alpelisib Drugs 0.000 description 1
- 102000030619 alpha-1 Adrenergic Receptor Human genes 0.000 description 1
- 108020004102 alpha-1 Adrenergic Receptor Proteins 0.000 description 1
- HMFHBZSHGGEWLO-UHFFFAOYSA-N alpha-D-Furanose-Ribose Natural products OCC1OC(O)C(O)C1O HMFHBZSHGGEWLO-UHFFFAOYSA-N 0.000 description 1
- PNEYBMLMFCGWSK-UHFFFAOYSA-N aluminium oxide Inorganic materials [O-2].[O-2].[O-2].[Al+3].[Al+3] PNEYBMLMFCGWSK-UHFFFAOYSA-N 0.000 description 1
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 1
- 235000012211 aluminium silicate Nutrition 0.000 description 1
- CEGOLXSVJUTHNZ-UHFFFAOYSA-K aluminium tristearate Chemical compound [Al+3].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O CEGOLXSVJUTHNZ-UHFFFAOYSA-K 0.000 description 1
- 229940063655 aluminum stearate Drugs 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 206010002224 anaplastic astrocytoma Diseases 0.000 description 1
- 229950006061 anatumomab mafenatox Drugs 0.000 description 1
- 239000003098 androgen Substances 0.000 description 1
- 230000001548 androgenic effect Effects 0.000 description 1
- AEMFNILZOJDQLW-QAGGRKNESA-N androst-4-ene-3,17-dione Chemical compound O=C1CC[C@]2(C)[C@H]3CC[C@](C)(C(CC4)=O)[C@@H]4[C@@H]3CCC2=C1 AEMFNILZOJDQLW-QAGGRKNESA-N 0.000 description 1
- 229960005471 androstenedione Drugs 0.000 description 1
- AEMFNILZOJDQLW-UHFFFAOYSA-N androstenedione Natural products O=C1CCC2(C)C3CCC(C)(C(CC4)=O)C4C3CCC2=C1 AEMFNILZOJDQLW-UHFFFAOYSA-N 0.000 description 1
- 229960001232 anecortave Drugs 0.000 description 1
- 230000000964 angiostatic effect Effects 0.000 description 1
- 229940045799 anthracyclines and related substance Drugs 0.000 description 1
- 150000004056 anthraquinones Chemical class 0.000 description 1
- 238000011122 anti-angiogenic therapy Methods 0.000 description 1
- 230000002424 anti-apoptotic effect Effects 0.000 description 1
- 230000000719 anti-leukaemic effect Effects 0.000 description 1
- 230000001399 anti-metabolic effect Effects 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 230000006023 anti-tumor response Effects 0.000 description 1
- 229940030495 antiandrogen sex hormone and modulator of the genital system Drugs 0.000 description 1
- 239000000074 antisense oligonucleotide Substances 0.000 description 1
- 238000012230 antisense oligonucleotides Methods 0.000 description 1
- 229950003145 apolizumab Drugs 0.000 description 1
- 230000001640 apoptogenic effect Effects 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 150000008209 arabinosides Chemical class 0.000 description 1
- KBZOIRJILGZLEJ-LGYYRGKSSA-N argipressin Chemical compound C([C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CSSC[C@@H](C(N[C@@H](CC=2C=CC(O)=CC=2)C(=O)N1)=O)N)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCN=C(N)N)C(=O)NCC(N)=O)C1=CC=CC=C1 KBZOIRJILGZLEJ-LGYYRGKSSA-N 0.000 description 1
- 229940078010 arimidex Drugs 0.000 description 1
- 229940087620 aromasin Drugs 0.000 description 1
- 229940046844 aromatase inhibitors Drugs 0.000 description 1
- 229940014583 arranon Drugs 0.000 description 1
- 125000003710 aryl alkyl group Chemical group 0.000 description 1
- 125000005160 aryl oxy alkyl group Chemical group 0.000 description 1
- 125000005228 aryl sulfonate group Chemical group 0.000 description 1
- 229940072107 ascorbate Drugs 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 229940102797 asparaginase erwinia chrysanthemi Drugs 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229940009098 aspartate Drugs 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 229950004810 atamestane Drugs 0.000 description 1
- PEPMWUSGRKINHX-TXTPUJOMSA-N atamestane Chemical compound C1C[C@@H]2[C@@]3(C)C(C)=CC(=O)C=C3CC[C@H]2[C@@H]2CCC(=O)[C@]21C PEPMWUSGRKINHX-TXTPUJOMSA-N 0.000 description 1
- 229940120638 avastin Drugs 0.000 description 1
- 229950002916 avelumab Drugs 0.000 description 1
- 229960003005 axitinib Drugs 0.000 description 1
- RITAVMQDGBJQJZ-FMIVXFBMSA-N axitinib Chemical compound CNC(=O)C1=CC=CC=C1SC1=CC=C(C(\C=C\C=2N=CC=CC=2)=NN2)C2=C1 RITAVMQDGBJQJZ-FMIVXFBMSA-N 0.000 description 1
- 108010023337 axl receptor tyrosine kinase Proteins 0.000 description 1
- XUZMWHLSFXCVMG-UHFFFAOYSA-N baricitinib Chemical compound C1N(S(=O)(=O)CC)CC1(CC#N)N1N=CC(C=2C=3C=CNC=3N=CN=2)=C1 XUZMWHLSFXCVMG-UHFFFAOYSA-N 0.000 description 1
- 229950000971 baricitinib Drugs 0.000 description 1
- XFILPEOLDIKJHX-QYZOEREBSA-N batimastat Chemical compound C([C@@H](C(=O)NC)NC(=O)[C@H](CC(C)C)[C@H](CSC=1SC=CC=1)C(=O)NO)C1=CC=CC=C1 XFILPEOLDIKJHX-QYZOEREBSA-N 0.000 description 1
- 229950001858 batimastat Drugs 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 235000013871 bee wax Nutrition 0.000 description 1
- 239000012166 beeswax Substances 0.000 description 1
- 229940077840 beleodaq Drugs 0.000 description 1
- 229960003094 belinostat Drugs 0.000 description 1
- 229960002707 bendamustine Drugs 0.000 description 1
- YTKUWDBFDASYHO-UHFFFAOYSA-N bendamustine Chemical compound ClCCN(CCCl)C1=CC=C2N(C)C(CCCC(O)=O)=NC2=C1 YTKUWDBFDASYHO-UHFFFAOYSA-N 0.000 description 1
- 229930195545 bengamide Natural products 0.000 description 1
- 239000000440 bentonite Substances 0.000 description 1
- 229910000278 bentonite Inorganic materials 0.000 description 1
- SVPXDRXYRYOSEX-UHFFFAOYSA-N bentoquatam Chemical compound O.O=[Si]=O.O=[Al]O[Al]=O SVPXDRXYRYOSEX-UHFFFAOYSA-N 0.000 description 1
- 229940077388 benzenesulfonate Drugs 0.000 description 1
- SRSXLGNVWSONIS-UHFFFAOYSA-M benzenesulfonate Chemical compound [O-]S(=O)(=O)C1=CC=CC=C1 SRSXLGNVWSONIS-UHFFFAOYSA-M 0.000 description 1
- ABSXPNGWJFAPRT-UHFFFAOYSA-N benzenesulfonic acid;n-[3-[[5-fluoro-2-[4-(2-methoxyethoxy)anilino]pyrimidin-4-yl]amino]phenyl]prop-2-enamide Chemical compound OS(=O)(=O)C1=CC=CC=C1.C1=CC(OCCOC)=CC=C1NC1=NC=C(F)C(NC=2C=C(NC(=O)C=C)C=CC=2)=N1 ABSXPNGWJFAPRT-UHFFFAOYSA-N 0.000 description 1
- 125000003785 benzimidazolyl group Chemical group N1=C(NC2=C1C=CC=C2)* 0.000 description 1
- 229940050390 benzoate Drugs 0.000 description 1
- 125000000499 benzofuranyl group Chemical group O1C(=CC2=C1C=CC=C2)* 0.000 description 1
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 1
- 125000001164 benzothiazolyl group Chemical group S1C(=NC2=C1C=CC=C2)* 0.000 description 1
- 125000004196 benzothienyl group Chemical group S1C(=CC2=C1C=CC=C2)* 0.000 description 1
- 229960002903 benzyl benzoate Drugs 0.000 description 1
- 125000000649 benzylidene group Chemical group [H]C(=[*])C1=C([H])C([H])=C([H])C([H])=C1[H] 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 1
- XMIIGOLPHOKFCH-UHFFFAOYSA-N beta-phenylpropanoic acid Natural products OC(=O)CCC1=CC=CC=C1 XMIIGOLPHOKFCH-UHFFFAOYSA-N 0.000 description 1
- 229960000997 bicalutamide Drugs 0.000 description 1
- 230000001588 bifunctional effect Effects 0.000 description 1
- 201000007180 bile duct carcinoma Diseases 0.000 description 1
- 238000004166 bioassay Methods 0.000 description 1
- 230000008436 biogenesis Effects 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 239000004305 biphenyl Substances 0.000 description 1
- 235000010290 biphenyl Nutrition 0.000 description 1
- 201000001531 bladder carcinoma Diseases 0.000 description 1
- 229940101815 blincyto Drugs 0.000 description 1
- 239000002981 blocking agent Substances 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 230000036760 body temperature Effects 0.000 description 1
- 229910052796 boron Inorganic materials 0.000 description 1
- 229940083476 bosulif Drugs 0.000 description 1
- 229960003736 bosutinib Drugs 0.000 description 1
- UBPYILGKFZZVDX-UHFFFAOYSA-N bosutinib Chemical compound C1=C(Cl)C(OC)=CC(NC=2C3=CC(OC)=C(OCCCN4CCN(C)CC4)C=C3N=CC=2C#N)=C1Cl UBPYILGKFZZVDX-UHFFFAOYSA-N 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 229910052794 bromium Inorganic materials 0.000 description 1
- 208000003362 bronchogenic carcinoma Diseases 0.000 description 1
- 229960005539 bryostatin 1 Drugs 0.000 description 1
- MJQUEDHRCUIRLF-TVIXENOKSA-N bryostatin 1 Chemical compound C([C@@H]1CC(/[C@@H]([C@@](C(C)(C)/C=C/2)(O)O1)OC(=O)/C=C/C=C/CCC)=C\C(=O)OC)[C@H]([C@@H](C)O)OC(=O)C[C@H](O)C[C@@H](O1)C[C@H](OC(C)=O)C(C)(C)[C@]1(O)C[C@@H]1C\C(=C\C(=O)OC)C[C@H]\2O1 MJQUEDHRCUIRLF-TVIXENOKSA-N 0.000 description 1
- 235000019437 butane-1,3-diol Nutrition 0.000 description 1
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 229910000019 calcium carbonate Inorganic materials 0.000 description 1
- 235000010216 calcium carbonate Nutrition 0.000 description 1
- FATUQANACHZLRT-KMRXSBRUSA-L calcium glucoheptonate Chemical compound [Ca+2].OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(O)C([O-])=O.OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(O)C([O-])=O FATUQANACHZLRT-KMRXSBRUSA-L 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- CJZGTCYPCWQAJB-UHFFFAOYSA-L calcium stearate Chemical compound [Ca+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O CJZGTCYPCWQAJB-UHFFFAOYSA-L 0.000 description 1
- 239000008116 calcium stearate Substances 0.000 description 1
- 235000013539 calcium stearate Nutrition 0.000 description 1
- MIOPJNTWMNEORI-UHFFFAOYSA-N camphorsulfonic acid Chemical compound C1CC2(CS(O)(=O)=O)C(=O)CC1C2(C)C MIOPJNTWMNEORI-UHFFFAOYSA-N 0.000 description 1
- 229940127093 camptothecin Drugs 0.000 description 1
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical compound C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 description 1
- 230000036952 cancer formation Effects 0.000 description 1
- 229940056434 caprelsa Drugs 0.000 description 1
- 125000000609 carbazolyl group Chemical group C1(=CC=CC=2C3=CC=CC=C3NC12)* 0.000 description 1
- 150000007942 carboxylates Chemical class 0.000 description 1
- 231100000504 carcinogenesis Toxicity 0.000 description 1
- 235000019438 castor oil Nutrition 0.000 description 1
- 229960000419 catumaxomab Drugs 0.000 description 1
- 229960000590 celecoxib Drugs 0.000 description 1
- RZEKVGVHFLEQIL-UHFFFAOYSA-N celecoxib Chemical compound C1=CC(C)=CC=C1C1=CC(C(F)(F)F)=NN1C1=CC=C(S(N)(=O)=O)C=C1 RZEKVGVHFLEQIL-UHFFFAOYSA-N 0.000 description 1
- 230000006369 cell cycle progression Effects 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000032823 cell division Effects 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 230000012292 cell migration Effects 0.000 description 1
- 230000017455 cell-cell adhesion Effects 0.000 description 1
- 230000033077 cellular process Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- AEULIVPVIDOLIN-UHFFFAOYSA-N cep-11981 Chemical compound C1=C2C3=C4CNC(=O)C4=C4C5=CN(C)N=C5CCC4=C3N(CC(C)C)C2=CC=C1NC1=NC=CC=N1 AEULIVPVIDOLIN-UHFFFAOYSA-N 0.000 description 1
- DSRNKUZOWRFQFO-UHFFFAOYSA-N cephalotaxine Natural products COC1=CC23CCCN2CCc4cc5OCOc5cc4C3=C1O DSRNKUZOWRFQFO-UHFFFAOYSA-N 0.000 description 1
- 229960001602 ceritinib Drugs 0.000 description 1
- VERWOWGGCGHDQE-UHFFFAOYSA-N ceritinib Chemical compound CC=1C=C(NC=2N=C(NC=3C(=CC=CC=3)S(=O)(=O)C(C)C)C(Cl)=CN=2)C(OC(C)C)=CC=1C1CCNCC1 VERWOWGGCGHDQE-UHFFFAOYSA-N 0.000 description 1
- 208000019065 cervical carcinoma Diseases 0.000 description 1
- 229940081733 cetearyl alcohol Drugs 0.000 description 1
- 229960000541 cetyl alcohol Drugs 0.000 description 1
- NNXDIGHYPZHXTR-ONEGZZNKSA-N chembl2035185 Chemical compound C=1C=C(C=2)NC(N=3)=NC=CC=3C(O3)=CC=C3COC\C=C\COCC=2C=1OCCN1CCCC1 NNXDIGHYPZHXTR-ONEGZZNKSA-N 0.000 description 1
- PIQCTGMSNWUMAF-UHFFFAOYSA-N chembl522892 Chemical compound C1CN(C)CCN1C1=CC=C(NC(=N2)C=3C(NC4=CC=CC(F)=C4C=3N)=O)C2=C1 PIQCTGMSNWUMAF-UHFFFAOYSA-N 0.000 description 1
- ZGHQGWOETPXKLY-XVNBXDOJSA-N chembl77030 Chemical compound NC(=S)C(\C#N)=C\C1=CC=C(O)C(O)=C1 ZGHQGWOETPXKLY-XVNBXDOJSA-N 0.000 description 1
- 229910052729 chemical element Inorganic materials 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 230000002113 chemopreventative effect Effects 0.000 description 1
- 230000000973 chemotherapeutic effect Effects 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 229910052801 chlorine Inorganic materials 0.000 description 1
- ZPEIMTDSQAKGNT-UHFFFAOYSA-N chlorpromazine Chemical compound C1=C(Cl)C=C2N(CCCN(C)C)C3=CC=CC=C3SC2=C1 ZPEIMTDSQAKGNT-UHFFFAOYSA-N 0.000 description 1
- 229960001076 chlorpromazine Drugs 0.000 description 1
- 208000006990 cholangiocarcinoma Diseases 0.000 description 1
- 229940107137 cholecystokinin Drugs 0.000 description 1
- 125000003016 chromanyl group Chemical group O1C(CCC2=CC=CC=C12)* 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 1
- 125000000259 cinnolinyl group Chemical group N1=NC(=CC2=CC=CC=C12)* 0.000 description 1
- 229960002436 cladribine Drugs 0.000 description 1
- 239000004927 clay Substances 0.000 description 1
- ACSIXWWBWUQEHA-UHFFFAOYSA-N clodronic acid Chemical compound OP(O)(=O)C(Cl)(Cl)P(O)(O)=O ACSIXWWBWUQEHA-UHFFFAOYSA-N 0.000 description 1
- 229940103380 clolar Drugs 0.000 description 1
- 230000035602 clotting Effects 0.000 description 1
- 238000011260 co-administration Methods 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 239000008119 colloidal silica Substances 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 229940034568 cometriq Drugs 0.000 description 1
- 230000002860 competitive effect Effects 0.000 description 1
- 230000001268 conjugating effect Effects 0.000 description 1
- 230000006552 constitutive activation Effects 0.000 description 1
- 239000013068 control sample Substances 0.000 description 1
- 229950002550 copanlisib Drugs 0.000 description 1
- PZBCKZWLPGJMAO-UHFFFAOYSA-N copanlisib Chemical compound C1=CC=2C3=NCCN3C(NC(=O)C=3C=NC(N)=NC=3)=NC=2C(OC)=C1OCCCN1CCOCC1 PZBCKZWLPGJMAO-UHFFFAOYSA-N 0.000 description 1
- 235000005822 corn Nutrition 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 229940099112 cornstarch Drugs 0.000 description 1
- 239000003246 corticosteroid Substances 0.000 description 1
- 229960001334 corticosteroids Drugs 0.000 description 1
- OMFXVFTZEKFJBZ-HJTSIMOOSA-N corticosterone Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@H](CC4)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 OMFXVFTZEKFJBZ-HJTSIMOOSA-N 0.000 description 1
- 108091008034 costimulatory receptors Proteins 0.000 description 1
- 235000012343 cottonseed oil Nutrition 0.000 description 1
- 229960005061 crizotinib Drugs 0.000 description 1
- KTEIFNKAUNYNJU-GFCCVEGCSA-N crizotinib Chemical compound O([C@H](C)C=1C(=C(F)C=CC=1Cl)Cl)C(C(=NC=1)N)=CC=1C(=C1)C=NN1C1CCNCC1 KTEIFNKAUNYNJU-GFCCVEGCSA-N 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 229940109262 curcumin Drugs 0.000 description 1
- 239000004148 curcumin Substances 0.000 description 1
- 235000012754 curcumin Nutrition 0.000 description 1
- 208000030381 cutaneous melanoma Diseases 0.000 description 1
- 208000017763 cutaneous neuroendocrine carcinoma Diseases 0.000 description 1
- 125000000392 cycloalkenyl group Chemical group 0.000 description 1
- QASFUMOKHFSJGL-UHFFFAOYSA-N cyclopamine Natural products C1C=C2CC(O)CCC2(C)C(CC2=C3C)C1C2CCC13OC2CC(C)CNC2C1C QASFUMOKHFSJGL-UHFFFAOYSA-N 0.000 description 1
- 125000001559 cyclopropyl group Chemical group [H]C1([H])C([H])([H])C1([H])* 0.000 description 1
- 208000031513 cyst Diseases 0.000 description 1
- 208000002445 cystadenocarcinoma Diseases 0.000 description 1
- 229940034075 cytarabine injection Drugs 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 239000002254 cytotoxic agent Substances 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- GVJHHUAWPYXKBD-UHFFFAOYSA-N d-alpha-tocopherol Natural products OC1=C(C)C(C)=C2OC(CCCC(C)CCCC(C)CCCC(C)C)(C)CCC2=C1C GVJHHUAWPYXKBD-UHFFFAOYSA-N 0.000 description 1
- 229960002465 dabrafenib Drugs 0.000 description 1
- BFSMGDJOXZAERB-UHFFFAOYSA-N dabrafenib Chemical compound S1C(C(C)(C)C)=NC(C=2C(=C(NS(=O)(=O)C=3C(=CC=CC=3F)F)C=CC=2)F)=C1C1=CC=NC(N)=N1 BFSMGDJOXZAERB-UHFFFAOYSA-N 0.000 description 1
- 229950007409 dacetuzumab Drugs 0.000 description 1
- 229960002806 daclizumab Drugs 0.000 description 1
- 230000002354 daily effect Effects 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000000254 damaging effect Effects 0.000 description 1
- 229960002204 daratumumab Drugs 0.000 description 1
- 229940094732 darzalex Drugs 0.000 description 1
- 229960002448 dasatinib Drugs 0.000 description 1
- ZESRJSPZRDMNHY-UHFFFAOYSA-N de-oxy corticosterone Natural products O=C1CCC2(C)C3CCC(C)(C(CC4)C(=O)CO)C4C3CCC2=C1 ZESRJSPZRDMNHY-UHFFFAOYSA-N 0.000 description 1
- 125000004856 decahydroquinolinyl group Chemical group N1(CCCC2CCCCC12)* 0.000 description 1
- 229960003603 decitabine Drugs 0.000 description 1
- AUTFSFUMNFDPLH-KYMMNHPFSA-N degarelix acetate Chemical compound CC(O)=O.C([C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCNC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@H](C)C(N)=O)NC(=O)[C@H](CC=1C=CC(NC(=O)[C@H]2NC(=O)NC(=O)C2)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@@H](CC=1C=NC=CC=1)NC(=O)[C@@H](CC=1C=CC(Cl)=CC=1)NC(=O)[C@@H](CC=1C=C2C=CC=CC2=CC=1)NC(C)=O)C1=CC=C(NC(N)=O)C=C1 AUTFSFUMNFDPLH-KYMMNHPFSA-N 0.000 description 1
- 230000000593 degrading effect Effects 0.000 description 1
- SJFBTAPEPRWNKH-CCKFTAQKSA-N delanzomib Chemical compound CC(C)C[C@@H](B(O)O)NC(=O)[C@H]([C@@H](C)O)NC(=O)C1=CC=CC(C=2C=CC=CC=2)=N1 SJFBTAPEPRWNKH-CCKFTAQKSA-N 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 230000001335 demethylating effect Effects 0.000 description 1
- 229960001251 denosumab Drugs 0.000 description 1
- 230000030609 dephosphorylation Effects 0.000 description 1
- 238000006209 dephosphorylation reaction Methods 0.000 description 1
- 229960003654 desoxycortone Drugs 0.000 description 1
- 230000000368 destabilizing effect Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 230000009504 deubiquitination Effects 0.000 description 1
- 229910052805 deuterium Inorganic materials 0.000 description 1
- 125000004431 deuterium atom Chemical group 0.000 description 1
- 125000002576 diazepinyl group Chemical group N1N=C(C=CC=C1)* 0.000 description 1
- NEFBYIFKOOEVPA-UHFFFAOYSA-K dicalcium phosphate Chemical compound [Ca+2].[Ca+2].[O-]P([O-])([O-])=O NEFBYIFKOOEVPA-UHFFFAOYSA-K 0.000 description 1
- 229940038472 dicalcium phosphate Drugs 0.000 description 1
- 229910000390 dicalcium phosphate Inorganic materials 0.000 description 1
- VFLDPWHFBUODDF-UHFFFAOYSA-N diferuloylmethane Natural products C1=C(O)C(OC)=CC(C=CC(=O)CC(=O)C=CC=2C=C(OC)C(O)=CC=2)=C1 VFLDPWHFBUODDF-UHFFFAOYSA-N 0.000 description 1
- OTKJDMGTUTTYMP-UHFFFAOYSA-N dihydrosphingosine Natural products CCCCCCCCCCCCCCCC(O)C(N)CO OTKJDMGTUTTYMP-UHFFFAOYSA-N 0.000 description 1
- GXGAKHNRMVGRPK-UHFFFAOYSA-N dimagnesium;dioxido-bis[[oxido(oxo)silyl]oxy]silane Chemical compound [Mg+2].[Mg+2].[O-][Si](=O)O[Si]([O-])([O-])O[Si]([O-])=O GXGAKHNRMVGRPK-UHFFFAOYSA-N 0.000 description 1
- SWSQBOPZIKWTGO-UHFFFAOYSA-N dimethylaminoamidine Natural products CN(C)C(N)=N SWSQBOPZIKWTGO-UHFFFAOYSA-N 0.000 description 1
- 229960004497 dinutuximab Drugs 0.000 description 1
- 125000000532 dioxanyl group Chemical group 0.000 description 1
- 125000005879 dioxolanyl group Chemical group 0.000 description 1
- XPPKVPWEQAFLFU-UHFFFAOYSA-J diphosphate(4-) Chemical compound [O-]P([O-])(=O)OP([O-])([O-])=O XPPKVPWEQAFLFU-UHFFFAOYSA-J 0.000 description 1
- 235000011180 diphosphates Nutrition 0.000 description 1
- ZPWVASYFFYYZEW-UHFFFAOYSA-L dipotassium hydrogen phosphate Chemical compound [K+].[K+].OP([O-])([O-])=O ZPWVASYFFYYZEW-UHFFFAOYSA-L 0.000 description 1
- 229910000396 dipotassium phosphate Inorganic materials 0.000 description 1
- 235000019797 dipotassium phosphate Nutrition 0.000 description 1
- 230000005750 disease progression Effects 0.000 description 1
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- 229960002563 disulfiram Drugs 0.000 description 1
- VSJKWCGYPAHWDS-UHFFFAOYSA-N dl-camptothecin Natural products C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-UHFFFAOYSA-N 0.000 description 1
- 229940065910 docefrez Drugs 0.000 description 1
- POULHZVOKOAJMA-UHFFFAOYSA-M dodecanoate Chemical compound CCCCCCCCCCCC([O-])=O POULHZVOKOAJMA-UHFFFAOYSA-M 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 229950005778 dovitinib Drugs 0.000 description 1
- 230000002222 downregulating effect Effects 0.000 description 1
- 239000006196 drop Substances 0.000 description 1
- 239000000890 drug combination Substances 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 230000002183 duodenal effect Effects 0.000 description 1
- 229950004949 duvelisib Drugs 0.000 description 1
- 239000003221 ear drop Substances 0.000 description 1
- 229940047652 ear drops Drugs 0.000 description 1
- 229950006700 edatrexate Drugs 0.000 description 1
- FSIRXIHZBIXHKT-MHTVFEQDSA-N edatrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CC(CC)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FSIRXIHZBIXHKT-MHTVFEQDSA-N 0.000 description 1
- 239000003792 electrolyte Substances 0.000 description 1
- 229940073038 elspar Drugs 0.000 description 1
- 239000008387 emulsifying waxe Substances 0.000 description 1
- 229950002830 enadenotucirev Drugs 0.000 description 1
- 210000000750 endocrine system Anatomy 0.000 description 1
- 201000003914 endometrial carcinoma Diseases 0.000 description 1
- ZUBDGKVDJUIMQQ-UBFCDGJISA-N endothelin-1 Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(O)=O)NC(=O)[C@H]1NC(=O)[C@H](CC=2C=CC=CC=2)NC(=O)[C@@H](CC=2C=CC(O)=CC=2)NC(=O)[C@H](C(C)C)NC(=O)[C@H]2CSSC[C@@H](C(N[C@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N2)=O)NC(=O)[C@@H](CO)NC(=O)[C@H](N)CSSC1)C1=CNC=N1 ZUBDGKVDJUIMQQ-UBFCDGJISA-N 0.000 description 1
- 239000007920 enema Substances 0.000 description 1
- 229940095399 enema Drugs 0.000 description 1
- 229950005837 entinostat Drugs 0.000 description 1
- 229960004671 enzalutamide Drugs 0.000 description 1
- WXCXUHSOUPDCQV-UHFFFAOYSA-N enzalutamide Chemical compound C1=C(F)C(C(=O)NC)=CC=C1N1C(C)(C)C(=O)N(C=2C=C(C(C#N)=CC=2)C(F)(F)F)C1=S WXCXUHSOUPDCQV-UHFFFAOYSA-N 0.000 description 1
- 102000012803 ephrin Human genes 0.000 description 1
- 108060002566 ephrin Proteins 0.000 description 1
- 208000037828 epithelial carcinoma Diseases 0.000 description 1
- 229930013356 epothilone Natural products 0.000 description 1
- HESCAJZNRMSMJG-HGYUPSKWSA-N epothilone A Natural products O=C1[C@H](C)[C@H](O)[C@H](C)CCC[C@H]2O[C@H]2C[C@@H](/C(=C\c2nc(C)sc2)/C)OC(=O)C[C@H](O)C1(C)C HESCAJZNRMSMJG-HGYUPSKWSA-N 0.000 description 1
- HESCAJZNRMSMJG-KKQRBIROSA-N epothilone A Chemical class C/C([C@@H]1C[C@@H]2O[C@@H]2CCC[C@@H]([C@@H]([C@@H](C)C(=O)C(C)(C)[C@@H](O)CC(=O)O1)O)C)=C\C1=CSC(C)=N1 HESCAJZNRMSMJG-KKQRBIROSA-N 0.000 description 1
- QXRSDHAAWVKZLJ-PVYNADRNSA-N epothilone B Chemical compound C/C([C@@H]1C[C@@H]2O[C@]2(C)CCC[C@@H]([C@@H]([C@@H](C)C(=O)C(C)(C)[C@@H](O)CC(=O)O1)O)C)=C\C1=CSC(C)=N1 QXRSDHAAWVKZLJ-PVYNADRNSA-N 0.000 description 1
- 229950009760 epratuzumab Drugs 0.000 description 1
- QAMYWGZHLCQOOJ-WRNBYXCMSA-N eribulin mesylate Chemical compound CS(O)(=O)=O.C([C@H]1CC[C@@H]2O[C@@H]3[C@H]4O[C@@H]5C[C@](O[C@H]4[C@H]2O1)(O[C@@H]53)CC[C@@H]1O[C@H](C(C1)=C)CC1)C(=O)C[C@@H]2[C@@H](OC)[C@@H](C[C@H](O)CN)O[C@H]2C[C@@H]2C(=C)[C@H](C)C[C@H]1O2 QAMYWGZHLCQOOJ-WRNBYXCMSA-N 0.000 description 1
- 229960000439 eribulin mesylate Drugs 0.000 description 1
- 229940014684 erivedge Drugs 0.000 description 1
- GTTBEUCJPZQMDZ-UHFFFAOYSA-N erlotinib hydrochloride Chemical compound [H+].[Cl-].C=12C=C(OCCOC)C(OCCOC)=CC2=NC=NC=1NC1=CC=CC(C#C)=C1 GTTBEUCJPZQMDZ-UHFFFAOYSA-N 0.000 description 1
- 229940051398 erwinaze Drugs 0.000 description 1
- 229960005309 estradiol Drugs 0.000 description 1
- 229930182833 estradiol Natural products 0.000 description 1
- CCIVGXIOQKPBKL-UHFFFAOYSA-M ethanesulfonate Chemical compound CCS([O-])(=O)=O CCIVGXIOQKPBKL-UHFFFAOYSA-M 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- 235000019439 ethyl acetate Nutrition 0.000 description 1
- 229940093499 ethyl acetate Drugs 0.000 description 1
- 229960004945 etoricoxib Drugs 0.000 description 1
- MNJVRJDLRVPLFE-UHFFFAOYSA-N etoricoxib Chemical compound C1=NC(C)=CC=C1C1=NC=C(Cl)C=C1C1=CC=C(S(C)(=O)=O)C=C1 MNJVRJDLRVPLFE-UHFFFAOYSA-N 0.000 description 1
- 229940085363 evista Drugs 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000003889 eye drop Substances 0.000 description 1
- 229940012356 eye drops Drugs 0.000 description 1
- 201000001343 fallopian tube carcinoma Diseases 0.000 description 1
- 235000019197 fats Nutrition 0.000 description 1
- 229940087476 femara Drugs 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 229960000556 fingolimod Drugs 0.000 description 1
- KKGQTZUTZRNORY-UHFFFAOYSA-N fingolimod Chemical compound CCCCCCCCC1=CC=C(CCC(N)(CO)CO)C=C1 KKGQTZUTZRNORY-UHFFFAOYSA-N 0.000 description 1
- 229940002006 firmagon Drugs 0.000 description 1
- XRECTZIEBJDKEO-UHFFFAOYSA-N flucytosine Chemical compound NC1=NC(=O)NC=C1F XRECTZIEBJDKEO-UHFFFAOYSA-N 0.000 description 1
- 229960004413 flucytosine Drugs 0.000 description 1
- 229960000390 fludarabine Drugs 0.000 description 1
- 229960005304 fludarabine phosphate Drugs 0.000 description 1
- 229940043075 fluocinolone Drugs 0.000 description 1
- FEBLZLNTKCEFIT-VSXGLTOVSA-N fluocinolone acetonide Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@H]3OC(C)(C)O[C@@]3(C(=O)CO)[C@@]2(C)C[C@@H]1O FEBLZLNTKCEFIT-VSXGLTOVSA-N 0.000 description 1
- 229910052731 fluorine Inorganic materials 0.000 description 1
- 230000004907 flux Effects 0.000 description 1
- 239000004052 folic acid antagonist Substances 0.000 description 1
- 125000003929 folic acid group Chemical group 0.000 description 1
- 235000008191 folinic acid Nutrition 0.000 description 1
- 239000011672 folinic acid Substances 0.000 description 1
- VVIAGPKUTFNRDU-ABLWVSNPSA-N folinic acid Chemical compound C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-ABLWVSNPSA-N 0.000 description 1
- 229950008692 foretinib Drugs 0.000 description 1
- 229950005309 fostamatinib Drugs 0.000 description 1
- GKDRMWXFWHEQQT-UHFFFAOYSA-N fostamatinib Chemical compound COC1=C(OC)C(OC)=CC(NC=2N=C(NC=3N=C4N(COP(O)(O)=O)C(=O)C(C)(C)OC4=CC=3)C(F)=CN=2)=C1 GKDRMWXFWHEQQT-UHFFFAOYSA-N 0.000 description 1
- 230000037433 frameshift Effects 0.000 description 1
- 229950004003 fresolimumab Drugs 0.000 description 1
- 125000002541 furyl group Chemical group 0.000 description 1
- 108010036598 gastric inhibitory polypeptide receptor Proteins 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 229940087158 gilotrif Drugs 0.000 description 1
- UIVFUQKYVFCEKJ-OPTOVBNMSA-N gimatecan Chemical compound C1=CC=C2C(\C=N\OC(C)(C)C)=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UIVFUQKYVFCEKJ-OPTOVBNMSA-N 0.000 description 1
- 229950009073 gimatecan Drugs 0.000 description 1
- 229940080856 gleevec Drugs 0.000 description 1
- 229950000918 glembatumumab Drugs 0.000 description 1
- 229940110231 gleostine Drugs 0.000 description 1
- 229940084910 gliadel Drugs 0.000 description 1
- 238000003881 globally optimized alternating phase rectangular pulse Methods 0.000 description 1
- 229940050410 gluconate Drugs 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 235000001727 glucose Nutrition 0.000 description 1
- 230000004190 glucose uptake Effects 0.000 description 1
- YQEMORVAKMFKLG-UHFFFAOYSA-N glycerine monostearate Natural products CCCCCCCCCCCCCCCCCC(=O)OC(CO)CO YQEMORVAKMFKLG-UHFFFAOYSA-N 0.000 description 1
- SVUQHVRAGMNPLW-UHFFFAOYSA-N glycerol monostearate Natural products CCCCCCCCCCCCCCCCC(=O)OCC(O)CO SVUQHVRAGMNPLW-UHFFFAOYSA-N 0.000 description 1
- ZEMPKEQAKRGZGQ-XOQCFJPHSA-N glycerol triricinoleate Natural products CCCCCC[C@@H](O)CC=CCCCCCCCC(=O)OC[C@@H](COC(=O)CCCCCCCC=CC[C@@H](O)CCCCCC)OC(=O)CCCCCCCC=CC[C@H](O)CCCCCC ZEMPKEQAKRGZGQ-XOQCFJPHSA-N 0.000 description 1
- 229960002449 glycine Drugs 0.000 description 1
- 150000002334 glycols Chemical class 0.000 description 1
- 229960003690 goserelin acetate Drugs 0.000 description 1
- 229940118951 halaven Drugs 0.000 description 1
- 150000004820 halides Chemical class 0.000 description 1
- 125000001188 haloalkyl group Chemical group 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 208000025750 heavy chain disease Diseases 0.000 description 1
- 230000002489 hematologic effect Effects 0.000 description 1
- 108010037536 heparanase Proteins 0.000 description 1
- 230000002440 hepatic effect Effects 0.000 description 1
- MNWFXJYAOYHMED-UHFFFAOYSA-N heptanoic acid Chemical compound CCCCCCC(O)=O MNWFXJYAOYHMED-UHFFFAOYSA-N 0.000 description 1
- 229940022353 herceptin Drugs 0.000 description 1
- 125000004415 heterocyclylalkyl group Chemical group 0.000 description 1
- 108091006093 heterotrimeric G proteins Proteins 0.000 description 1
- 102000034345 heterotrimeric G proteins Human genes 0.000 description 1
- BXWNKGSJHAJOGX-UHFFFAOYSA-N hexadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCO BXWNKGSJHAJOGX-UHFFFAOYSA-N 0.000 description 1
- IPCSVZSSVZVIGE-UHFFFAOYSA-M hexadecanoate Chemical compound CCCCCCCCCCCCCCCC([O-])=O IPCSVZSSVZVIGE-UHFFFAOYSA-M 0.000 description 1
- FUZZWVXGSFPDMH-UHFFFAOYSA-N hexanoic acid Chemical compound CCCCCC(O)=O FUZZWVXGSFPDMH-UHFFFAOYSA-N 0.000 description 1
- 229960001340 histamine Drugs 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- HYFHYPWGAURHIV-UHFFFAOYSA-N homoharringtonine Natural products C1=C2CCN3CCCC43C=C(OC)C(OC(=O)C(O)(CCCC(C)(C)O)CC(=O)OC)C4C2=CC2=C1OCO2 HYFHYPWGAURHIV-UHFFFAOYSA-N 0.000 description 1
- 230000003054 hormonal effect Effects 0.000 description 1
- 108091008039 hormone receptors Proteins 0.000 description 1
- 239000003906 humectant Substances 0.000 description 1
- 229940088013 hycamtin Drugs 0.000 description 1
- 229960000890 hydrocortisone Drugs 0.000 description 1
- XMBWDFGMSWQBCA-UHFFFAOYSA-N hydrogen iodide Chemical compound I XMBWDFGMSWQBCA-UHFFFAOYSA-N 0.000 description 1
- ZMZDMBWJUHKJPS-UHFFFAOYSA-N hydrogen thiocyanate Natural products SC#N ZMZDMBWJUHKJPS-UHFFFAOYSA-N 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-M hydrogensulfate Chemical compound OS([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-M 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-M hydroxide Chemical compound [OH-] XLYOFNOQVPJJNP-UHFFFAOYSA-M 0.000 description 1
- 229960001330 hydroxycarbamide Drugs 0.000 description 1
- 230000037417 hyperactivation Effects 0.000 description 1
- 229940061301 ibrance Drugs 0.000 description 1
- 229960001001 ibritumomab tiuxetan Drugs 0.000 description 1
- 229960003685 imatinib mesylate Drugs 0.000 description 1
- YLMAHDNUQAMNNX-UHFFFAOYSA-N imatinib methanesulfonate Chemical compound CS(O)(=O)=O.C1CN(C)CCN1CC1=CC=C(C(=O)NC=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)C=C1 YLMAHDNUQAMNNX-UHFFFAOYSA-N 0.000 description 1
- 125000002883 imidazolyl group Chemical group 0.000 description 1
- 229940091204 imlygic Drugs 0.000 description 1
- 230000005934 immune activation Effects 0.000 description 1
- 230000008629 immune suppression Effects 0.000 description 1
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 description 1
- 230000006028 immune-suppresssive effect Effects 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 230000003308 immunostimulating effect Effects 0.000 description 1
- 230000001506 immunosuppresive effect Effects 0.000 description 1
- 229960003444 immunosuppressant agent Drugs 0.000 description 1
- 239000003018 immunosuppressive agent Substances 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 125000003392 indanyl group Chemical group C1(CCC2=CC=CC=C12)* 0.000 description 1
- 125000003453 indazolyl group Chemical group N1N=C(C2=C1C=CC=C2)* 0.000 description 1
- 125000003387 indolinyl group Chemical group N1(CCC2=CC=CC=C12)* 0.000 description 1
- 125000003406 indolizinyl group Chemical group C=1(C=CN2C=CC=CC12)* 0.000 description 1
- 125000001041 indolyl group Chemical group 0.000 description 1
- 208000027866 inflammatory disease Diseases 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 229960002993 ingenol mebutate Drugs 0.000 description 1
- 229940090044 injection Drugs 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 208000014674 injury Diseases 0.000 description 1
- 229940005319 inlyta Drugs 0.000 description 1
- 229950004101 inotuzumab ozogamicin Drugs 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 239000000543 intermediate Substances 0.000 description 1
- 230000031146 intracellular signal transduction Effects 0.000 description 1
- 238000007917 intracranial administration Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000007919 intrasynovial administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000005342 ion exchange Methods 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- KLEAIHJJLUAXIQ-JDRGBKBRSA-N irinotecan hydrochloride hydrate Chemical compound O.O.O.Cl.C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 KLEAIHJJLUAXIQ-JDRGBKBRSA-N 0.000 description 1
- 230000007794 irritation Effects 0.000 description 1
- 229950007752 isatuximab Drugs 0.000 description 1
- SUMDYPCJJOFFON-UHFFFAOYSA-N isethionic acid Chemical compound OCCS(O)(=O)=O SUMDYPCJJOFFON-UHFFFAOYSA-N 0.000 description 1
- 125000000959 isobutyl group Chemical group [H]C([H])([H])C([H])(C([H])([H])[H])C([H])([H])* 0.000 description 1
- 125000000904 isoindolyl group Chemical group C=1(NC=C2C=CC=CC12)* 0.000 description 1
- 150000002537 isoquinolines Chemical class 0.000 description 1
- 125000005956 isoquinolyl group Chemical group 0.000 description 1
- 125000001786 isothiazolyl group Chemical group 0.000 description 1
- 125000000842 isoxazolyl group Chemical group 0.000 description 1
- 229940011083 istodax Drugs 0.000 description 1
- 229960004130 itraconazole Drugs 0.000 description 1
- 229960002014 ixabepilone Drugs 0.000 description 1
- 229960003648 ixazomib Drugs 0.000 description 1
- 229940111707 ixempra Drugs 0.000 description 1
- 229940045773 jakafi Drugs 0.000 description 1
- 201000000573 juvenile pilocytic astrocytoma Diseases 0.000 description 1
- NLYAJNPCOHFWQQ-UHFFFAOYSA-N kaolin Chemical compound O.O.O=[Al]O[Si](=O)O[Si](=O)O[Al]=O NLYAJNPCOHFWQQ-UHFFFAOYSA-N 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 229940000764 kyprolis Drugs 0.000 description 1
- 229940001447 lactate Drugs 0.000 description 1
- 150000003893 lactate salts Chemical class 0.000 description 1
- 229940099584 lactobionate Drugs 0.000 description 1
- JYTUSYBCFIZPBE-AMTLMPIISA-N lactobionic acid Chemical compound OC(=O)[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O JYTUSYBCFIZPBE-AMTLMPIISA-N 0.000 description 1
- 229940070765 laurate Drugs 0.000 description 1
- 229950009640 lazertinib Drugs 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- VHOGYURTWQBHIL-UHFFFAOYSA-N leflunomide Chemical compound O1N=CC(C(=O)NC=2C=CC(=CC=2)C(F)(F)F)=C1C VHOGYURTWQBHIL-UHFFFAOYSA-N 0.000 description 1
- 229960004942 lenalidomide Drugs 0.000 description 1
- GOTYRUGSSMKFNF-UHFFFAOYSA-N lenalidomide Chemical compound C1C=2C(N)=CC=CC=2C(=O)N1C1CCC(=O)NC1=O GOTYRUGSSMKFNF-UHFFFAOYSA-N 0.000 description 1
- 229960003784 lenvatinib Drugs 0.000 description 1
- WOSKHXYHFSIKNG-UHFFFAOYSA-N lenvatinib Chemical compound C=12C=C(C(N)=O)C(OC)=CC2=NC=CC=1OC(C=C1Cl)=CC=C1NC(=O)NC1CC1 WOSKHXYHFSIKNG-UHFFFAOYSA-N 0.000 description 1
- 229940064847 lenvima Drugs 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 229960001691 leucovorin Drugs 0.000 description 1
- 229950002216 linifanib Drugs 0.000 description 1
- MPVGZUGXCQEXTM-UHFFFAOYSA-N linifanib Chemical compound CC1=CC=C(F)C(NC(=O)NC=2C=CC(=CC=2)C=2C=3C(N)=NNC=3C=CC=2)=C1 MPVGZUGXCQEXTM-UHFFFAOYSA-N 0.000 description 1
- 206010024627 liposarcoma Diseases 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 239000006194 liquid suspension Substances 0.000 description 1
- 229950011263 lirilumab Drugs 0.000 description 1
- 229910052744 lithium Inorganic materials 0.000 description 1
- 229960002247 lomustine Drugs 0.000 description 1
- 238000012153 long-term therapy Methods 0.000 description 1
- 229940024740 lonsurf Drugs 0.000 description 1
- 229950008745 losoxantrone Drugs 0.000 description 1
- YROQEQPFUCPDCP-UHFFFAOYSA-N losoxantrone Chemical compound OCCNCCN1N=C2C3=CC=CC(O)=C3C(=O)C3=C2C1=CC=C3NCCNCCO YROQEQPFUCPDCP-UHFFFAOYSA-N 0.000 description 1
- 208000022080 low-grade astrocytoma Diseases 0.000 description 1
- 229950004563 lucatumumab Drugs 0.000 description 1
- 229950004231 lucitanib Drugs 0.000 description 1
- 229960000994 lumiracoxib Drugs 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 201000005296 lung carcinoma Diseases 0.000 description 1
- 208000037829 lymphangioendotheliosarcoma Diseases 0.000 description 1
- 208000012804 lymphangiosarcoma Diseases 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 229940100352 lynparza Drugs 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 239000000391 magnesium silicate Substances 0.000 description 1
- 229910000386 magnesium trisilicate Inorganic materials 0.000 description 1
- 235000019793 magnesium trisilicate Nutrition 0.000 description 1
- 229940099273 magnesium trisilicate Drugs 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 230000031852 maintenance of location in cell Effects 0.000 description 1
- 229940049920 malate Drugs 0.000 description 1
- 239000011976 maleic acid Substances 0.000 description 1
- BJEPYKJPYRNKOW-UHFFFAOYSA-N malic acid Chemical compound OC(=O)C(O)CC(O)=O BJEPYKJPYRNKOW-UHFFFAOYSA-N 0.000 description 1
- 208000006178 malignant mesothelioma Diseases 0.000 description 1
- 208000026037 malignant tumor of neck Diseases 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- OCSMOTCMPXTDND-OUAUKWLOSA-N marimastat Chemical compound CNC(=O)[C@H](C(C)(C)C)NC(=O)[C@H](CC(C)C)[C@H](O)C(=O)NO OCSMOTCMPXTDND-OUAUKWLOSA-N 0.000 description 1
- 229950002736 marizomib Drugs 0.000 description 1
- 229940034322 marqibo Drugs 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 229960004961 mechlorethamine Drugs 0.000 description 1
- 208000023356 medullary thyroid gland carcinoma Diseases 0.000 description 1
- 229960003987 melatonin Drugs 0.000 description 1
- DRLFMBDRBRZALE-UHFFFAOYSA-N melatonin Chemical compound COC1=CC=C2NC=C(CCNC(C)=O)C2=C1 DRLFMBDRBRZALE-UHFFFAOYSA-N 0.000 description 1
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 1
- 229960001924 melphalan Drugs 0.000 description 1
- 229960005558 mertansine Drugs 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 229940042472 mineral oil Drugs 0.000 description 1
- 201000004058 mixed glioma Diseases 0.000 description 1
- 239000003607 modifier Substances 0.000 description 1
- 229950007699 mogamulizumab Drugs 0.000 description 1
- 229950008814 momelotinib Drugs 0.000 description 1
- ZVHNDZWQTBEVRY-UHFFFAOYSA-N momelotinib Chemical compound C1=CC(C(NCC#N)=O)=CC=C1C1=CC=NC(NC=2C=CC(=CC=2)N2CCOCC2)=N1 ZVHNDZWQTBEVRY-UHFFFAOYSA-N 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- CQDGTJPVBWZJAZ-UHFFFAOYSA-N monoethyl carbonate Chemical compound CCOC(O)=O CQDGTJPVBWZJAZ-UHFFFAOYSA-N 0.000 description 1
- 108091006026 monomeric small GTPases Proteins 0.000 description 1
- VYGYNVZNSSTDLJ-HKCOAVLJSA-N monorden Natural products CC1CC2OC2C=C/C=C/C(=O)CC3C(C(=CC(=C3Cl)O)O)C(=O)O1 VYGYNVZNSSTDLJ-HKCOAVLJSA-N 0.000 description 1
- 125000002757 morpholinyl group Chemical group 0.000 description 1
- 229950003968 motesanib Drugs 0.000 description 1
- RAHBGWKEPAQNFF-UHFFFAOYSA-N motesanib Chemical compound C=1C=C2C(C)(C)CNC2=CC=1NC(=O)C1=CC=CN=C1NCC1=CC=NC=C1 RAHBGWKEPAQNFF-UHFFFAOYSA-N 0.000 description 1
- 208000001725 mucocutaneous lymph node syndrome Diseases 0.000 description 1
- 229940124303 multikinase inhibitor Drugs 0.000 description 1
- 210000000663 muscle cell Anatomy 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 208000001611 myxosarcoma Diseases 0.000 description 1
- SWZXEVABPLUDIO-WSZYKNRRSA-N n-[(2s)-3-methoxy-1-[[(2s)-3-methoxy-1-[[(2s)-1-[(2r)-2-methyloxiran-2-yl]-1-oxo-3-phenylpropan-2-yl]amino]-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]-2-methyl-1,3-thiazole-5-carboxamide Chemical compound N([C@@H](COC)C(=O)N[C@@H](COC)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)[C@]1(C)OC1)C(=O)C1=CN=C(C)S1 SWZXEVABPLUDIO-WSZYKNRRSA-N 0.000 description 1
- BLCLNMBMMGCOAS-UHFFFAOYSA-N n-[1-[[1-[[1-[[1-[[1-[[1-[[1-[2-[(carbamoylamino)carbamoyl]pyrrolidin-1-yl]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-[(2-methylpropan-2-yl)oxy]-1-oxopropan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amin Chemical compound C1CCC(C(=O)NNC(N)=O)N1C(=O)C(CCCN=C(N)N)NC(=O)C(CC(C)C)NC(=O)C(COC(C)(C)C)NC(=O)C(NC(=O)C(CO)NC(=O)C(CC=1C2=CC=CC=C2NC=1)NC(=O)C(CC=1NC=NC=1)NC(=O)C1NC(=O)CC1)CC1=CC=C(O)C=C1 BLCLNMBMMGCOAS-UHFFFAOYSA-N 0.000 description 1
- LBWFXVZLPYTWQI-IPOVEDGCSA-N n-[2-(diethylamino)ethyl]-5-[(z)-(5-fluoro-2-oxo-1h-indol-3-ylidene)methyl]-2,4-dimethyl-1h-pyrrole-3-carboxamide;(2s)-2-hydroxybutanedioic acid Chemical compound OC(=O)[C@@H](O)CC(O)=O.CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C LBWFXVZLPYTWQI-IPOVEDGCSA-N 0.000 description 1
- JTSLALYXYSRPGW-UHFFFAOYSA-N n-[5-(4-cyanophenyl)-1h-pyrrolo[2,3-b]pyridin-3-yl]pyridine-3-carboxamide Chemical compound C=1C=CN=CC=1C(=O)NC(C1=C2)=CNC1=NC=C2C1=CC=C(C#N)C=C1 JTSLALYXYSRPGW-UHFFFAOYSA-N 0.000 description 1
- UZWDCWONPYILKI-UHFFFAOYSA-N n-[5-[(4-ethylpiperazin-1-yl)methyl]pyridin-2-yl]-5-fluoro-4-(7-fluoro-2-methyl-3-propan-2-ylbenzimidazol-5-yl)pyrimidin-2-amine Chemical compound C1CN(CC)CCN1CC(C=N1)=CC=C1NC1=NC=C(F)C(C=2C=C3N(C(C)C)C(C)=NC3=C(F)C=2)=N1 UZWDCWONPYILKI-UHFFFAOYSA-N 0.000 description 1
- KVBGVZZKJNLNJU-UHFFFAOYSA-M naphthalene-2-sulfonate Chemical compound C1=CC=CC2=CC(S(=O)(=O)[O-])=CC=C21 KVBGVZZKJNLNJU-UHFFFAOYSA-M 0.000 description 1
- 125000001624 naphthyl group Chemical group 0.000 description 1
- 125000004593 naphthyridinyl group Chemical group N1=C(C=CC2=CC=CN=C12)* 0.000 description 1
- 229940097496 nasal spray Drugs 0.000 description 1
- 201000011216 nasopharynx carcinoma Diseases 0.000 description 1
- 229950007221 nedaplatin Drugs 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- IXOXBSCIXZEQEQ-UHTZMRCNSA-N nelarabine Chemical compound C1=NC=2C(OC)=NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@@H]1O IXOXBSCIXZEQEQ-UHTZMRCNSA-N 0.000 description 1
- 229960000801 nelarabine Drugs 0.000 description 1
- 229950010159 nemorubicin Drugs 0.000 description 1
- CTMCWCONSULRHO-UHQPFXKFSA-N nemorubicin Chemical compound C1CO[C@H](OC)CN1[C@@H]1[C@H](O)[C@H](C)O[C@@H](O[C@@H]2C3=C(O)C=4C(=O)C5=C(OC)C=CC=C5C(=O)C=4C(O)=C3C[C@](O)(C2)C(=O)CO)C1 CTMCWCONSULRHO-UHQPFXKFSA-N 0.000 description 1
- 210000005170 neoplastic cell Anatomy 0.000 description 1
- 201000004931 neurofibromatosis Diseases 0.000 description 1
- 230000000926 neurological effect Effects 0.000 description 1
- 229940080607 nexavar Drugs 0.000 description 1
- 235000001968 nicotinic acid Nutrition 0.000 description 1
- 239000011664 nicotinic acid Substances 0.000 description 1
- 229960001346 nilotinib Drugs 0.000 description 1
- 229940030115 ninlaro Drugs 0.000 description 1
- PCHKPVIQAHNQLW-CQSZACIVSA-N niraparib Chemical compound N1=C2C(C(=O)N)=CC=CC2=CN1C(C=C1)=CC=C1[C@@H]1CCCNC1 PCHKPVIQAHNQLW-CQSZACIVSA-N 0.000 description 1
- 150000002829 nitrogen Chemical class 0.000 description 1
- 125000004433 nitrogen atom Chemical group N* 0.000 description 1
- OSTGTTZJOCZWJG-UHFFFAOYSA-N nitrosourea Chemical compound NC(=O)N=NO OSTGTTZJOCZWJG-UHFFFAOYSA-N 0.000 description 1
- 108010020615 nociceptin receptor Proteins 0.000 description 1
- 125000006574 non-aromatic ring group Chemical group 0.000 description 1
- 230000037434 nonsense mutation Effects 0.000 description 1
- 230000030147 nuclear export Effects 0.000 description 1
- 230000025308 nuclear transport Effects 0.000 description 1
- 125000003835 nucleoside group Chemical group 0.000 description 1
- 229950006584 obatoclax Drugs 0.000 description 1
- 229950009090 ocaratuzumab Drugs 0.000 description 1
- GLDOVTGHNKAZLK-UHFFFAOYSA-N octadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCCCO GLDOVTGHNKAZLK-UHFFFAOYSA-N 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- 229960002700 octreotide Drugs 0.000 description 1
- 201000002575 ocular melanoma Diseases 0.000 description 1
- QNDVLZJODHBUFM-WFXQOWMNSA-N okadaic acid Chemical compound C([C@H](O1)[C@H](C)/C=C/[C@H]2CC[C@@]3(CC[C@H]4O[C@@H](C([C@@H](O)[C@@H]4O3)=C)[C@@H](O)C[C@H](C)[C@@H]3[C@@H](CC[C@@]4(OCCCC4)O3)C)O2)C(C)=C[C@]21O[C@H](C[C@@](C)(O)C(O)=O)CC[C@H]2O QNDVLZJODHBUFM-WFXQOWMNSA-N 0.000 description 1
- VEFJHAYOIAAXEU-UHFFFAOYSA-N okadaic acid Natural products CC(CC(O)C1OC2CCC3(CCC(O3)C=CC(C)C4CC(=CC5(OC(CC(C)(O)C(=O)O)CCC5O)O4)C)OC2C(O)C1C)C6OC7(CCCCO7)CCC6C VEFJHAYOIAAXEU-UHFFFAOYSA-N 0.000 description 1
- 229960000572 olaparib Drugs 0.000 description 1
- FDLYAMZZIXQODN-UHFFFAOYSA-N olaparib Chemical compound FC1=CC=C(CC=2C3=CC=CC=C3C(=O)NN=2)C=C1C(=O)N(CC1)CCN1C(=O)C1CC1 FDLYAMZZIXQODN-UHFFFAOYSA-N 0.000 description 1
- FAQDUNYVKQKNLD-UHFFFAOYSA-N olaparib Chemical group FC1=CC=C(CC2=C3[CH]C=CC=C3C(=O)N=N2)C=C1C(=O)N(CC1)CCN1C(=O)C1CC1 FAQDUNYVKQKNLD-UHFFFAOYSA-N 0.000 description 1
- 229940049964 oleate Drugs 0.000 description 1
- 235000008390 olive oil Nutrition 0.000 description 1
- 229960002230 omacetaxine mepesuccinate Drugs 0.000 description 1
- HYFHYPWGAURHIV-JFIAXGOJSA-N omacetaxine mepesuccinate Chemical compound C1=C2CCN3CCC[C@]43C=C(OC)[C@@H](OC(=O)[C@@](O)(CCCC(C)(C)O)CC(=O)OC)[C@H]4C2=CC2=C1OCO2 HYFHYPWGAURHIV-JFIAXGOJSA-N 0.000 description 1
- 230000004650 oncogenic pathway Effects 0.000 description 1
- 229940048191 onivyde Drugs 0.000 description 1
- 229950005750 oprozomib Drugs 0.000 description 1
- 229940041678 oral spray Drugs 0.000 description 1
- 239000000668 oral spray Substances 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 210000002997 osteoclast Anatomy 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 210000003101 oviduct Anatomy 0.000 description 1
- 125000001715 oxadiazolyl group Chemical group 0.000 description 1
- 235000006408 oxalic acid Nutrition 0.000 description 1
- 125000000160 oxazolidinyl group Chemical group 0.000 description 1
- 125000002971 oxazolyl group Chemical group 0.000 description 1
- 229950011410 pacritinib Drugs 0.000 description 1
- HWXVIOGONBBTBY-ONEGZZNKSA-N pacritinib Chemical compound C=1C=C(C=2)NC(N=3)=NC=CC=3C(C=3)=CC=CC=3COC\C=C\COCC=2C=1OCCN1CCCC1 HWXVIOGONBBTBY-ONEGZZNKSA-N 0.000 description 1
- 229960004390 palbociclib Drugs 0.000 description 1
- 208000004019 papillary adenocarcinoma Diseases 0.000 description 1
- 201000010198 papillary carcinoma Diseases 0.000 description 1
- 239000012188 paraffin wax Substances 0.000 description 1
- 210000002990 parathyroid gland Anatomy 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 108700017947 pasireotide Proteins 0.000 description 1
- 229960005415 pasireotide Drugs 0.000 description 1
- NEEFMPSSNFRRNC-HQUONIRXSA-N pasireotide aspartate Chemical compound OC(=O)[C@@H](N)CC(O)=O.OC(=O)[C@@H](N)CC(O)=O.C([C@H]1C(=O)N2C[C@@H](C[C@H]2C(=O)N[C@H](C(=O)N[C@H](CC=2C3=CC=CC=C3NC=2)C(=O)N[C@H](C(N[C@@H](CC=2C=CC(OCC=3C=CC=CC=3)=CC=2)C(=O)N1)=O)CCCCN)C=1C=CC=CC=1)OC(=O)NCCN)C1=CC=CC=C1 NEEFMPSSNFRRNC-HQUONIRXSA-N 0.000 description 1
- 239000006072 paste Substances 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 239000013610 patient sample Substances 0.000 description 1
- 229960000639 pazopanib Drugs 0.000 description 1
- CUIHSIWYWATEQL-UHFFFAOYSA-N pazopanib Chemical compound C1=CC2=C(C)N(C)N=C2C=C1N(C)C(N=1)=CC=NC=1NC1=CC=C(C)C(S(N)(=O)=O)=C1 CUIHSIWYWATEQL-UHFFFAOYSA-N 0.000 description 1
- WVUNYSQLFKLYNI-AATRIKPKSA-N pelitinib Chemical compound C=12C=C(NC(=O)\C=C\CN(C)C)C(OCC)=CC2=NC=C(C#N)C=1NC1=CC=C(F)C(Cl)=C1 WVUNYSQLFKLYNI-AATRIKPKSA-N 0.000 description 1
- WBXPDJSOTKVWSJ-ZDUSSCGKSA-L pemetrexed(2-) Chemical compound C=1NC=2NC(N)=NC(=O)C=2C=1CCC1=CC=C(C(=O)N[C@@H](CCC([O-])=O)C([O-])=O)C=C1 WBXPDJSOTKVWSJ-ZDUSSCGKSA-L 0.000 description 1
- XDRYMKDFEDOLFX-UHFFFAOYSA-N pentamidine Chemical compound C1=CC(C(=N)N)=CC=C1OCCCCCOC1=CC=C(C(N)=N)C=C1 XDRYMKDFEDOLFX-UHFFFAOYSA-N 0.000 description 1
- 229960004448 pentamidine Drugs 0.000 description 1
- 229960002340 pentostatin Drugs 0.000 description 1
- FPVKHBSQESCIEP-JQCXWYLXSA-N pentostatin Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC[C@H]2O)=C2N=C1 FPVKHBSQESCIEP-JQCXWYLXSA-N 0.000 description 1
- 239000002304 perfume Substances 0.000 description 1
- SZFPYBIJACMNJV-UHFFFAOYSA-N perifosine Chemical compound CCCCCCCCCCCCCCCCCCOP([O-])(=O)OC1CC[N+](C)(C)CC1 SZFPYBIJACMNJV-UHFFFAOYSA-N 0.000 description 1
- 229950010632 perifosine Drugs 0.000 description 1
- 230000000737 periodic effect Effects 0.000 description 1
- 208000010918 peritoneal neoplasm Diseases 0.000 description 1
- JRKICGRDRMAZLK-UHFFFAOYSA-L peroxydisulfate Chemical compound [O-]S(=O)(=O)OOS([O-])(=O)=O JRKICGRDRMAZLK-UHFFFAOYSA-L 0.000 description 1
- 229950011309 pexastimogene devacirepvec Drugs 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 125000001791 phenazinyl group Chemical group C1(=CC=CC2=NC3=CC=CC=C3N=C12)* 0.000 description 1
- 125000001484 phenothiazinyl group Chemical group C1(=CC=CC=2SC3=CC=CC=C3NC12)* 0.000 description 1
- 125000001644 phenoxazinyl group Chemical group C1(=CC=CC=2OC3=CC=CC=C3NC12)* 0.000 description 1
- WVDDGKGOMKODPV-ZQBYOMGUSA-N phenyl(114C)methanol Chemical compound O[14CH2]C1=CC=CC=C1 WVDDGKGOMKODPV-ZQBYOMGUSA-N 0.000 description 1
- 230000002165 photosensitisation Effects 0.000 description 1
- 239000003504 photosensitizing agent Substances 0.000 description 1
- 238000001126 phototherapy Methods 0.000 description 1
- 125000004592 phthalazinyl group Chemical group C1(=NN=CC2=CC=CC=C12)* 0.000 description 1
- 125000005545 phthalimidyl group Chemical group 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 229940107670 picato Drugs 0.000 description 1
- IIMIOEBMYPRQGU-UHFFFAOYSA-L picoplatin Chemical compound N.[Cl-].[Cl-].[Pt+2].CC1=CC=CC=N1 IIMIOEBMYPRQGU-UHFFFAOYSA-L 0.000 description 1
- 229950005566 picoplatin Drugs 0.000 description 1
- 229950004941 pictilisib Drugs 0.000 description 1
- 125000004193 piperazinyl group Chemical group 0.000 description 1
- 125000003386 piperidinyl group Chemical group 0.000 description 1
- 208000021310 pituitary gland adenoma Diseases 0.000 description 1
- 229950010765 pivalate Drugs 0.000 description 1
- IUGYQRQAERSCNH-UHFFFAOYSA-N pivalic acid Chemical compound CC(C)(C)C(O)=O IUGYQRQAERSCNH-UHFFFAOYSA-N 0.000 description 1
- PEZPMAYDXJQYRV-UHFFFAOYSA-N pixantrone Chemical compound O=C1C2=CN=CC=C2C(=O)C2=C1C(NCCN)=CC=C2NCCN PEZPMAYDXJQYRV-UHFFFAOYSA-N 0.000 description 1
- 230000010118 platelet activation Effects 0.000 description 1
- 229940063179 platinol Drugs 0.000 description 1
- 210000000557 podocyte Anatomy 0.000 description 1
- 229920000058 polyacrylate Polymers 0.000 description 1
- 208000037244 polycythemia vera Diseases 0.000 description 1
- 238000006116 polymerization reaction Methods 0.000 description 1
- 239000001818 polyoxyethylene sorbitan monostearate Substances 0.000 description 1
- 235000010989 polyoxyethylene sorbitan monostearate Nutrition 0.000 description 1
- 229920001451 polypropylene glycol Polymers 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 229940113124 polysorbate 60 Drugs 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 229960000688 pomalidomide Drugs 0.000 description 1
- UVSMNLNDYGZFPF-UHFFFAOYSA-N pomalidomide Chemical compound O=C1C=2C(N)=CC=CC=2C(=O)N1C1CCC(=O)NC1=O UVSMNLNDYGZFPF-UHFFFAOYSA-N 0.000 description 1
- 229940008606 pomalyst Drugs 0.000 description 1
- 229960001131 ponatinib Drugs 0.000 description 1
- PHXJVRSECIGDHY-UHFFFAOYSA-N ponatinib Chemical compound C1CN(C)CCN1CC(C(=C1)C(F)(F)F)=CC=C1NC(=O)C1=CC=C(C)C(C#CC=2N3N=CC=CC3=NC=2)=C1 PHXJVRSECIGDHY-UHFFFAOYSA-N 0.000 description 1
- 229960004293 porfimer sodium Drugs 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 239000004302 potassium sorbate Substances 0.000 description 1
- 235000010241 potassium sorbate Nutrition 0.000 description 1
- 229940069338 potassium sorbate Drugs 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 208000016800 primary central nervous system lymphoma Diseases 0.000 description 1
- 229950003608 prinomastat Drugs 0.000 description 1
- YKPYIPVDTNNYCN-INIZCTEOSA-N prinomastat Chemical compound ONC(=O)[C@H]1C(C)(C)SCCN1S(=O)(=O)C(C=C1)=CC=C1OC1=CC=NC=C1 YKPYIPVDTNNYCN-INIZCTEOSA-N 0.000 description 1
- 230000001686 pro-survival effect Effects 0.000 description 1
- 125000001436 propyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 235000013772 propylene glycol Nutrition 0.000 description 1
- 102000017953 prostanoid receptors Human genes 0.000 description 1
- 108050007059 prostanoid receptors Proteins 0.000 description 1
- 210000002307 prostate Anatomy 0.000 description 1
- 229950008679 protamine sulfate Drugs 0.000 description 1
- 239000003528 protein farnesyltransferase inhibitor Substances 0.000 description 1
- 229940121649 protein inhibitor Drugs 0.000 description 1
- 239000012268 protein inhibitor Substances 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- 239000000007 protein synthesis inhibitor Substances 0.000 description 1
- 229940024999 proteolytic enzymes for treatment of wounds and ulcers Drugs 0.000 description 1
- 230000004063 proteosomal degradation Effects 0.000 description 1
- 229940034080 provenge Drugs 0.000 description 1
- 125000001042 pteridinyl group Chemical group N1=C(N=CC2=NC=CN=C12)* 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 150000003834 purine nucleoside derivatives Chemical class 0.000 description 1
- 150000003212 purines Chemical class 0.000 description 1
- 125000000561 purinyl group Chemical group N1=C(N=C2N=CNC2=C1)* 0.000 description 1
- 125000003373 pyrazinyl group Chemical group 0.000 description 1
- 125000003226 pyrazolyl group Chemical group 0.000 description 1
- 125000002098 pyridazinyl group Chemical group 0.000 description 1
- 125000004076 pyridyl group Chemical group 0.000 description 1
- 150000003230 pyrimidines Chemical class 0.000 description 1
- 125000000714 pyrimidinyl group Chemical group 0.000 description 1
- 125000001422 pyrrolinyl group Chemical group 0.000 description 1
- 125000000168 pyrrolyl group Chemical group 0.000 description 1
- 150000003856 quaternary ammonium compounds Chemical class 0.000 description 1
- 125000001453 quaternary ammonium group Chemical group 0.000 description 1
- 125000002294 quinazolinyl group Chemical group N1=C(N=CC2=CC=CC=C12)* 0.000 description 1
- 125000005493 quinolyl group Chemical group 0.000 description 1
- 125000001567 quinoxalinyl group Chemical group N1=C(C=NC2=CC=CC=C12)* 0.000 description 1
- 125000004621 quinuclidinyl group Chemical group N12C(CC(CC1)CC2)* 0.000 description 1
- 229950001626 quizartinib Drugs 0.000 description 1
- CVWXJKQAOSCOAB-UHFFFAOYSA-N quizartinib Chemical compound O1C(C(C)(C)C)=CC(NC(=O)NC=2C=CC(=CC=2)C=2N=C3N(C4=CC=C(OCCN5CCOCC5)C=C4S3)C=2)=N1 CVWXJKQAOSCOAB-UHFFFAOYSA-N 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 239000002534 radiation-sensitizing agent Substances 0.000 description 1
- 150000003254 radicals Chemical class 0.000 description 1
- AECPBJMOGBFQDN-YMYQVXQQSA-N radicicol Chemical compound C1CCCC(=O)C[C@H]2[C@H](Cl)C(=O)CC(=O)[C@H]2C(=O)O[C@H](C)C[C@H]2O[C@@H]21 AECPBJMOGBFQDN-YMYQVXQQSA-N 0.000 description 1
- 229930192524 radicicol Natural products 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 229940100618 rectal suppository Drugs 0.000 description 1
- 239000006215 rectal suppository Substances 0.000 description 1
- 229950008933 refametinib Drugs 0.000 description 1
- 208000019465 refractory cytopenia of childhood Diseases 0.000 description 1
- 229960004836 regorafenib Drugs 0.000 description 1
- 210000003289 regulatory T cell Anatomy 0.000 description 1
- 238000007634 remodeling Methods 0.000 description 1
- 201000007444 renal pelvis carcinoma Diseases 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 208000037803 restenosis Diseases 0.000 description 1
- 239000003340 retarding agent Substances 0.000 description 1
- OAKGNIRUXAZDQF-TXHRRWQRSA-N retaspimycin Chemical compound N1C(=O)\C(C)=C\C=C/[C@H](OC)[C@@H](OC(N)=O)\C(C)=C\[C@H](C)[C@@H](O)[C@@H](OC)C[C@H](C)CC2=C(O)C1=CC(O)=C2NCC=C OAKGNIRUXAZDQF-TXHRRWQRSA-N 0.000 description 1
- 229930002330 retinoic acid Natural products 0.000 description 1
- 229940120975 revlimid Drugs 0.000 description 1
- 229960000759 risedronic acid Drugs 0.000 description 1
- 229960000371 rofecoxib Drugs 0.000 description 1
- RZJQGNCSTQAWON-UHFFFAOYSA-N rofecoxib Chemical compound C1=CC(S(=O)(=O)C)=CC=C1C1=C(C=2C=CC=CC=2)C(=O)OC1 RZJQGNCSTQAWON-UHFFFAOYSA-N 0.000 description 1
- QXKJWHWUDVQATH-UHFFFAOYSA-N rogletimide Chemical compound C=1C=NC=CC=1C1(CC)CCC(=O)NC1=O QXKJWHWUDVQATH-UHFFFAOYSA-N 0.000 description 1
- VHXNKPBCCMUMSW-FQEVSTJZSA-N rubitecan Chemical compound C1=CC([N+]([O-])=O)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VHXNKPBCCMUMSW-FQEVSTJZSA-N 0.000 description 1
- 229950009213 rubitecan Drugs 0.000 description 1
- HMABYWSNWIZPAG-UHFFFAOYSA-N rucaparib Chemical compound C1=CC(CNC)=CC=C1C(N1)=C2CCNC(=O)C3=C2C1=CC(F)=C3 HMABYWSNWIZPAG-UHFFFAOYSA-N 0.000 description 1
- 229950008902 safingol Drugs 0.000 description 1
- NGWSFRIPKNWYAO-SHTIJGAHSA-N salinosporamide A Chemical compound C([C@@H]1[C@H](O)[C@]23C(=O)O[C@]2([C@H](C(=O)N3)CCCl)C)CCC=C1 NGWSFRIPKNWYAO-SHTIJGAHSA-N 0.000 description 1
- NGWSFRIPKNWYAO-UHFFFAOYSA-N salinosporamide A Natural products N1C(=O)C(CCCl)C2(C)OC(=O)C21C(O)C1CCCC=C1 NGWSFRIPKNWYAO-UHFFFAOYSA-N 0.000 description 1
- 229950000106 samalizumab Drugs 0.000 description 1
- 229960005399 satraplatin Drugs 0.000 description 1
- 190014017285 satraplatin Chemical compound 0.000 description 1
- 201000008407 sebaceous adenocarcinoma Diseases 0.000 description 1
- 108700027603 secretin receptor Proteins 0.000 description 1
- 229950003647 semaxanib Drugs 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 229940076279 serotonin Drugs 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 150000004760 silicates Chemical class 0.000 description 1
- RMAQACBXLXPBSY-UHFFFAOYSA-N silicic acid Chemical compound O[Si](O)(O)O RMAQACBXLXPBSY-UHFFFAOYSA-N 0.000 description 1
- 235000012239 silicon dioxide Nutrition 0.000 description 1
- IZTQOLKUZKXIRV-YRVFCXMDSA-N sincalide Chemical compound C([C@@H](C(=O)N[C@@H](CCSC)C(=O)NCC(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(N)=O)NC(=O)[C@@H](N)CC(O)=O)C1=CC=C(OS(O)(=O)=O)C=C1 IZTQOLKUZKXIRV-YRVFCXMDSA-N 0.000 description 1
- 238000009097 single-agent therapy Methods 0.000 description 1
- 229960000714 sipuleucel-t Drugs 0.000 description 1
- 201000003708 skin melanoma Diseases 0.000 description 1
- 239000004055 small Interfering RNA Substances 0.000 description 1
- 210000000813 small intestine Anatomy 0.000 description 1
- 229940126586 small molecule drug Drugs 0.000 description 1
- AWUCVROLDVIAJX-GSVOUGTGSA-N sn-glycerol 3-phosphate Chemical compound OC[C@@H](O)COP(O)(O)=O AWUCVROLDVIAJX-GSVOUGTGSA-N 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- MFBOGIVSZKQAPD-UHFFFAOYSA-M sodium butyrate Chemical compound [Na+].CCCC([O-])=O MFBOGIVSZKQAPD-UHFFFAOYSA-M 0.000 description 1
- 229910000029 sodium carbonate Inorganic materials 0.000 description 1
- 235000019812 sodium carboxymethyl cellulose Nutrition 0.000 description 1
- 229920001027 sodium carboxymethylcellulose Polymers 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 1
- 230000003381 solubilizing effect Effects 0.000 description 1
- NHXLMOGPVYXJNR-ATOGVRKGSA-N somatostatin Chemical compound C([C@H]1C(=O)N[C@H](C(N[C@@H](CO)C(=O)N[C@@H](CSSC[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@@H](CC=2C3=CC=CC=C3NC=2)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N1)[C@@H](C)O)NC(=O)CNC(=O)[C@H](C)N)C(O)=O)=O)[C@H](O)C)C1=CC=CC=C1 NHXLMOGPVYXJNR-ATOGVRKGSA-N 0.000 description 1
- 229960000553 somatostatin Drugs 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 239000001587 sorbitan monostearate Substances 0.000 description 1
- 235000011076 sorbitan monostearate Nutrition 0.000 description 1
- 229940035048 sorbitan monostearate Drugs 0.000 description 1
- OTKJDMGTUTTYMP-ZWKOTPCHSA-N sphinganine Chemical compound CCCCCCCCCCCCCCC[C@@H](O)[C@@H](N)CO OTKJDMGTUTTYMP-ZWKOTPCHSA-N 0.000 description 1
- DUYSYHSSBDVJSM-KRWOKUGFSA-N sphingosine 1-phosphate Chemical compound CCCCCCCCCCCCC\C=C\[C@@H](O)[C@@H](N)COP(O)(O)=O DUYSYHSSBDVJSM-KRWOKUGFSA-N 0.000 description 1
- 208000017572 squamous cell neoplasm Diseases 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 239000003206 sterilizing agent Substances 0.000 description 1
- 229940090374 stivarga Drugs 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 208000030819 subependymoma Diseases 0.000 description 1
- 239000001384 succinic acid Substances 0.000 description 1
- BDHFUVZGWQCTTF-UHFFFAOYSA-M sulfonate Chemical compound [O-]S(=O)=O BDHFUVZGWQCTTF-UHFFFAOYSA-M 0.000 description 1
- 150000003871 sulfonates Chemical class 0.000 description 1
- 150000003457 sulfones Chemical class 0.000 description 1
- 229960001796 sunitinib Drugs 0.000 description 1
- WINHZLLDWRZWRT-ATVHPVEESA-N sunitinib Chemical compound CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C WINHZLLDWRZWRT-ATVHPVEESA-N 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 238000011477 surgical intervention Methods 0.000 description 1
- 229940034785 sutent Drugs 0.000 description 1
- 201000010965 sweat gland carcinoma Diseases 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 229940022873 synribo Drugs 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 229940081616 tafinlar Drugs 0.000 description 1
- 229950004550 talazoparib Drugs 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 229950008461 talimogene laherparepvec Drugs 0.000 description 1
- 229950007866 tanespimycin Drugs 0.000 description 1
- 229940120982 tarceva Drugs 0.000 description 1
- 239000011975 tartaric acid Substances 0.000 description 1
- 235000002906 tartaric acid Nutrition 0.000 description 1
- 229940095064 tartrate Drugs 0.000 description 1
- 229940069905 tasigna Drugs 0.000 description 1
- RCINICONZNJXQF-XAZOAEDWSA-N taxol® Chemical compound O([C@@H]1[C@@]2(CC(C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3(C21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-XAZOAEDWSA-N 0.000 description 1
- 229940063683 taxotere Drugs 0.000 description 1
- YVSQVYZBDXIXCC-INIZCTEOSA-N telomestatin Chemical compound N=1C2=COC=1C(N=1)=COC=1C(N=1)=COC=1C(N=1)=COC=1C(N=1)=COC=1C(=C(O1)C)N=C1C(=C(O1)C)N=C1[C@@]1([H])N=C2SC1 YVSQVYZBDXIXCC-INIZCTEOSA-N 0.000 description 1
- 229940061353 temodar Drugs 0.000 description 1
- QFJCIRLUMZQUOT-UHFFFAOYSA-N temsirolimus Natural products C1CC(O)C(OC)CC1CC(C)C1OC(=O)C2CCCCN2C(=O)C(=O)C(O)(O2)C(C)CCC2CC(OC)C(C)=CC=CC=CC(C)CC(C)C(=O)C(OC)C(O)C(C)=CC(C)C(=O)C1 QFJCIRLUMZQUOT-UHFFFAOYSA-N 0.000 description 1
- 229960005353 testolactone Drugs 0.000 description 1
- BPEWUONYVDABNZ-DZBHQSCQSA-N testolactone Chemical compound O=C1C=C[C@]2(C)[C@H]3CC[C@](C)(OC(=O)CC4)[C@@H]4[C@@H]3CCC2=C1 BPEWUONYVDABNZ-DZBHQSCQSA-N 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- MHXBHWLGRWOABW-UHFFFAOYSA-N tetradecyl octadecanoate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCCCCCCCCCCCCCC MHXBHWLGRWOABW-UHFFFAOYSA-N 0.000 description 1
- 125000003718 tetrahydrofuranyl group Chemical group 0.000 description 1
- BSYVTEYKTMYBMK-UHFFFAOYSA-N tetrahydrofurfuryl alcohol Chemical compound OCC1CCCO1 BSYVTEYKTMYBMK-UHFFFAOYSA-N 0.000 description 1
- 125000001712 tetrahydronaphthyl group Chemical group C1(CCCC2=CC=CC=C12)* 0.000 description 1
- 125000003507 tetrahydrothiofenyl group Chemical group 0.000 description 1
- 125000003831 tetrazolyl group Chemical group 0.000 description 1
- 229960003433 thalidomide Drugs 0.000 description 1
- 125000001113 thiadiazolyl group Chemical group 0.000 description 1
- 125000005308 thiazepinyl group Chemical group S1N=C(C=CC=C1)* 0.000 description 1
- 125000000335 thiazolyl group Chemical group 0.000 description 1
- 125000001544 thienyl group Chemical group 0.000 description 1
- 229960004072 thrombin Drugs 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- 239000003734 thymidylate synthase inhibitor Substances 0.000 description 1
- 210000001685 thyroid gland Anatomy 0.000 description 1
- 108040006218 thyroid-stimulating hormone receptor activity proteins Proteins 0.000 description 1
- 229960003087 tioguanine Drugs 0.000 description 1
- PLHJCIYEEKOWNM-HHHXNRCGSA-N tipifarnib Chemical compound CN1C=NC=C1[C@](N)(C=1C=C2C(C=3C=C(Cl)C=CC=3)=CC(=O)N(C)C2=CC=1)C1=CC=C(Cl)C=C1 PLHJCIYEEKOWNM-HHHXNRCGSA-N 0.000 description 1
- QQHMKNYGKVVGCZ-UHFFFAOYSA-N tipiracil Chemical compound N1C(=O)NC(=O)C(Cl)=C1CN1C(=N)CCC1 QQHMKNYGKVVGCZ-UHFFFAOYSA-N 0.000 description 1
- 229960002952 tipiracil Drugs 0.000 description 1
- 230000009258 tissue cross reactivity Effects 0.000 description 1
- 229960000940 tivozanib Drugs 0.000 description 1
- 235000010384 tocopherol Nutrition 0.000 description 1
- 229960001295 tocopherol Drugs 0.000 description 1
- 239000011732 tocopherol Substances 0.000 description 1
- 229930003799 tocopherol Natural products 0.000 description 1
- 239000011731 tocotrienol Substances 0.000 description 1
- 229960001350 tofacitinib Drugs 0.000 description 1
- UJLAWZDWDVHWOW-YPMHNXCESA-N tofacitinib Chemical compound C[C@@H]1CCN(C(=O)CC#N)C[C@@H]1N(C)C1=NC=NC2=C1C=CN2 UJLAWZDWDVHWOW-YPMHNXCESA-N 0.000 description 1
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 239000012049 topical pharmaceutical composition Substances 0.000 description 1
- 229940100411 torisel Drugs 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 229960000977 trabectedin Drugs 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 239000003558 transferase inhibitor Substances 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- 230000005945 translocation Effects 0.000 description 1
- 229940066958 treanda Drugs 0.000 description 1
- 229960001727 tretinoin Drugs 0.000 description 1
- 229960005294 triamcinolone Drugs 0.000 description 1
- GFNANZIMVAIWHM-OBYCQNJPSA-N triamcinolone Chemical compound O=C1C=C[C@]2(C)[C@@]3(F)[C@@H](O)C[C@](C)([C@@]([C@H](O)C4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 GFNANZIMVAIWHM-OBYCQNJPSA-N 0.000 description 1
- 125000001425 triazolyl group Chemical group 0.000 description 1
- RTKIYFITIVXBLE-QEQCGCAPSA-N trichostatin A Chemical compound ONC(=O)/C=C/C(/C)=C/[C@@H](C)C(=O)C1=CC=C(N(C)C)C=C1 RTKIYFITIVXBLE-QEQCGCAPSA-N 0.000 description 1
- 125000000876 trifluoromethoxy group Chemical group FC(F)(F)O* 0.000 description 1
- 229960003962 trifluridine Drugs 0.000 description 1
- VSQQQLOSPVPRAZ-RRKCRQDMSA-N trifluridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(C(F)(F)F)=C1 VSQQQLOSPVPRAZ-RRKCRQDMSA-N 0.000 description 1
- 229950007127 trilaciclib Drugs 0.000 description 1
- 229960001670 trilostane Drugs 0.000 description 1
- KVJXBPDAXMEYOA-CXANFOAXSA-N trilostane Chemical compound OC1=C(C#N)C[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CC[C@@]32O[C@@H]31 KVJXBPDAXMEYOA-CXANFOAXSA-N 0.000 description 1
- 229910052722 tritium Inorganic materials 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- 102000003298 tumor necrosis factor receptor Human genes 0.000 description 1
- 229940094060 tykerb Drugs 0.000 description 1
- TUCIOBMMDDOEMM-RIYZIHGNSA-N tyrphostin B42 Chemical compound C1=C(O)C(O)=CC=C1\C=C(/C#N)C(=O)NCC1=CC=CC=C1 TUCIOBMMDDOEMM-RIYZIHGNSA-N 0.000 description 1
- ZDPHROOEEOARMN-UHFFFAOYSA-N undecanoic acid Chemical compound CCCCCCCCCCC(O)=O ZDPHROOEEOARMN-UHFFFAOYSA-N 0.000 description 1
- 229940022919 unituxin Drugs 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 229950005972 urelumab Drugs 0.000 description 1
- 210000000626 ureter Anatomy 0.000 description 1
- 208000010570 urinary bladder carcinoma Diseases 0.000 description 1
- 206010046885 vaginal cancer Diseases 0.000 description 1
- 208000013139 vaginal neoplasm Diseases 0.000 description 1
- 229940050482 valchlor Drugs 0.000 description 1
- 229960002004 valdecoxib Drugs 0.000 description 1
- LNPDTQAFDNKSHK-UHFFFAOYSA-N valdecoxib Chemical compound CC=1ON=C(C=2C=CC=CC=2)C=1C1=CC=C(S(N)(=O)=O)C=C1 LNPDTQAFDNKSHK-UHFFFAOYSA-N 0.000 description 1
- NQPDZGIKBAWPEJ-UHFFFAOYSA-N valeric acid Chemical class CCCCC(O)=O NQPDZGIKBAWPEJ-UHFFFAOYSA-N 0.000 description 1
- 229950001067 varlilumab Drugs 0.000 description 1
- 201000011531 vascular cancer Diseases 0.000 description 1
- 239000002525 vasculotropin inhibitor Substances 0.000 description 1
- 229960003726 vasopressin Drugs 0.000 description 1
- 229950000578 vatalanib Drugs 0.000 description 1
- YCOYDOIWSSHVCK-UHFFFAOYSA-N vatalanib Chemical compound C1=CC(Cl)=CC=C1NC(C1=CC=CC=C11)=NN=C1CC1=CC=NC=C1 YCOYDOIWSSHVCK-UHFFFAOYSA-N 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 229940099039 velcade Drugs 0.000 description 1
- 229960003862 vemurafenib Drugs 0.000 description 1
- GPXBXXGIAQBQNI-UHFFFAOYSA-N vemurafenib Chemical compound CCCS(=O)(=O)NC1=CC=C(F)C(C(=O)C=2C3=CC(=CN=C3NC=2)C=2C=CC(Cl)=CC=2)=C1F GPXBXXGIAQBQNI-UHFFFAOYSA-N 0.000 description 1
- 230000028973 vesicle-mediated transport Effects 0.000 description 1
- 229940065658 vidaza Drugs 0.000 description 1
- JXLYSJRDGCGARV-CFWMRBGOSA-N vinblastine Chemical compound C([C@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-CFWMRBGOSA-N 0.000 description 1
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 1
- 229940028393 vincasar Drugs 0.000 description 1
- 229960002066 vinorelbine Drugs 0.000 description 1
- GBABOYUKABKIAF-GHYRFKGUSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-GHYRFKGUSA-N 0.000 description 1
- 208000012498 virus associated tumor Diseases 0.000 description 1
- 229960001771 vorozole Drugs 0.000 description 1
- XLMPPFTZALNBFS-INIZCTEOSA-N vorozole Chemical compound C1([C@@H](C2=CC=C3N=NN(C3=C2)C)N2N=CN=C2)=CC=C(Cl)C=C1 XLMPPFTZALNBFS-INIZCTEOSA-N 0.000 description 1
- 229940069559 votrient Drugs 0.000 description 1
- 201000005102 vulva cancer Diseases 0.000 description 1
- 208000013013 vulvar carcinoma Diseases 0.000 description 1
- 239000003871 white petrolatum Substances 0.000 description 1
- 210000002268 wool Anatomy 0.000 description 1
- 229940049068 xalkori Drugs 0.000 description 1
- 229940053867 xeloda Drugs 0.000 description 1
- 229940014556 xgeva Drugs 0.000 description 1
- 229940085728 xtandi Drugs 0.000 description 1
- 229940055760 yervoy Drugs 0.000 description 1
- 229940004212 yondelis Drugs 0.000 description 1
- 229940036061 zaltrap Drugs 0.000 description 1
- 229940034727 zelboraf Drugs 0.000 description 1
- 150000003751 zinc Chemical class 0.000 description 1
- 229960002760 ziv-aflibercept Drugs 0.000 description 1
- 229940061261 zolinza Drugs 0.000 description 1
- 229940002005 zometa Drugs 0.000 description 1
- 229950009819 zotarolimus Drugs 0.000 description 1
- CGTADGCBEXYWNE-JUKNQOCSSA-N zotarolimus Chemical compound N1([C@H]2CC[C@@H](C[C@@H](C)[C@H]3OC(=O)[C@@H]4CCCCN4C(=O)C(=O)[C@@]4(O)[C@H](C)CC[C@H](O4)C[C@@H](/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C3)OC)C[C@H]2OC)C=NN=N1 CGTADGCBEXYWNE-JUKNQOCSSA-N 0.000 description 1
- 229940095188 zydelig Drugs 0.000 description 1
- 229940052129 zykadia Drugs 0.000 description 1
- 229940051084 zytiga Drugs 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D209/00—Heterocyclic compounds containing five-membered rings, condensed with other rings, with one nitrogen atom as the only ring hetero atom
- C07D209/02—Heterocyclic compounds containing five-membered rings, condensed with other rings, with one nitrogen atom as the only ring hetero atom condensed with one carbocyclic ring
- C07D209/52—Heterocyclic compounds containing five-membered rings, condensed with other rings, with one nitrogen atom as the only ring hetero atom condensed with one carbocyclic ring condensed with a ring other than six-membered
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/40—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
- A61K31/403—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with carbocyclic rings, e.g. carbazole
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D233/00—Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings
- C07D233/54—Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings having two double bonds between ring members or between ring members and non-ring members
- C07D233/64—Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings having two double bonds between ring members or between ring members and non-ring members with substituted hydrocarbon radicals attached to ring carbon atoms, e.g. histidine
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D261/00—Heterocyclic compounds containing 1,2-oxazole or hydrogenated 1,2-oxazole rings
- C07D261/02—Heterocyclic compounds containing 1,2-oxazole or hydrogenated 1,2-oxazole rings not condensed with other rings
- C07D261/04—Heterocyclic compounds containing 1,2-oxazole or hydrogenated 1,2-oxazole rings not condensed with other rings having one double bond between ring members or between a ring member and a non-ring member
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D261/00—Heterocyclic compounds containing 1,2-oxazole or hydrogenated 1,2-oxazole rings
- C07D261/02—Heterocyclic compounds containing 1,2-oxazole or hydrogenated 1,2-oxazole rings not condensed with other rings
- C07D261/06—Heterocyclic compounds containing 1,2-oxazole or hydrogenated 1,2-oxazole rings not condensed with other rings having two or more double bonds between ring members or between ring members and non-ring members
- C07D261/10—Heterocyclic compounds containing 1,2-oxazole or hydrogenated 1,2-oxazole rings not condensed with other rings having two or more double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D401/00—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom
- C07D401/02—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings
- C07D401/12—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings linked by a chain containing hetero atoms as chain links
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D413/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
- C07D413/02—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings
- C07D413/04—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings directly linked by a ring-member-to-ring-member bond
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D413/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
- C07D413/02—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings
- C07D413/10—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings linked by a carbon chain containing aromatic rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D413/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
- C07D413/02—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings
- C07D413/12—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings linked by a chain containing hetero atoms as chain links
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D413/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
- C07D413/14—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing three or more hetero rings
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Life Sciences & Earth Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Medicinal Chemistry (AREA)
- Public Health (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Epidemiology (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines Containing Plant Substances (AREA)
- Plural Heterocyclic Compounds (AREA)
Description
WO 2022/120354 PCT/US2021/072684 TEAD INHIBITORS AND USES THEREOF SEQUENCE LISTING [0001]The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on November 30, 2021, is named 187446_SL.txt and is 23,551 bytes in size.
TECHNICAL FIELD OF THE INVENTION [0002]The present invention relates to compounds and methods useful for inhibition of Transcriptional Enhancer Associate Domain (TEAD). The invention also provides pharmaceutically acceptable compositions comprising compounds of the present invention and methods of using said compositions in the treatment of various diseases, disorders, and conditions as described herein.
BACKGROUND OF THE INVENTION [0003]Yes-associated protein (YAP) and transcriptional co-activator with PDZ-binding motif (TAZ) are transcriptional co-activators of the Hippo pathway network and regulate cell proliferation, migration, and apoptosis. Inhibition of the Hippo pathway promotes YAP/TAZ translocation to the nucleus, wherein YAP/TAZ interact with TEAD transcription factors and coactivate the expression of target genes and promote cell proliferation. Hyperactivation of YAP and TAZ and/or mutations in one or more members of the Hippo pathway network have been implicated in numerous cancers.
SUMMARY OF THE INVENTION [0004]The Hippo signaling cascade is an important pathway for cancer biogenesis and tumor maintenance. The Hippo pathway is heavily mutated across many cancer indications through loss of function mutations in genes such as NF2. These pro-tumor mutations lead to the constitutive activation of the downstream transcriptional coactivators YAP and TAZ that drive the expression of many pro-survival and proliferation genes through the essential interaction with a TEAD protein family member. In addition, this unrestrained transcriptional program drives enhanced immune suppression in the tumor microenvironment. As described herein, to target this oncogenic pathway 1 WO 2022/120354 PCT/US2021/072684 novel small molecule inhibitors were identified that selectively bind to TEAD and disrupt their interaction with YAP and TAZ, thereby downregulating YAP- and TAZ-dependent transcription. As demonstrated herein, these TEAD inhibitors prevent TEAD palmitoylation, which is critical for the interaction between YAP and TEAD. Furthermore, the TEAD inhibitors described herein inhibit in vitro proliferation of YAP-dependent (ie., Hippo pathway-deficient cancer cell lines), but not Hippo pathway wild type cancer cell lines. Importantly, as shown herein, the TEAD inhibitor compounds of the present invention did not affect survival of a differentiated mouse podocyte cell line or compromise mouse kidney histology. Subsequent experiments in vivo demonstrate the TEAD inhibitors described herein downregulate YAP-dependent genes in human tumor xenografts after oral dosing. In addition, the TEAD inhibitors described herein exhibit single agent tumor growth inhibition of human tumor xenografts in mice at well tolerated oral doses. The data described herein demonstrate the ability of the small molecule TEAD inhibitors provided herein for targeting the Hippo pathway in cancers. [0005]It has now been found that compounds of the present invention, and pharmaceutically acceptable compositions thereof, are effective as TEAD inhibitors. In one aspect, the present invention provides a compound of Formula I: I or a pharmaceutically acceptable salt thereof, wherein each variable is independently as defined herein and as described in embodiments herein. [0006]Compounds of the present invention, and pharmaceutically acceptable salts and compositions thereof, are useful for treating a variety of diseases, disorders or conditions associated with TEAD. Such diseases, disorders, or conditions include cellular proliferative disorders (e.g., cancer as described herein).
BRIEF DESCRIPTION OF FIGURES [0007] FIGURE 1depicts a schematic of Hippo pathway signaling.
DETAILED DESCRIPTION OF CERTAIN EMBODIMENTS 2 WO 2022/120354 PCT/US2021/072684 1. General Description of Certain Embodiments of the Invention: [0008]Compounds of the present invention, and pharmaceutical salts and compositions thereof, are useful as inhibitors of TEAD. Without wishing to be bound by any particular theory, it is believed that compounds of the present invention, and pharmaceutical compositions thereof, inhibit the activity of TEAD, and thus treat diseases, disorders or conditions associated with TEAD, such as cancer. [0009]In one aspect, the present invention provides a compound of Formula I: or a pharmaceutically acceptable salt thereof, wherein:L1 is a covalent bound, or a C1-6 bivalent straight or branched hydrocarbon chain wherein 1, 2, ormethylene units of the chain are independently and optionally replaced with -N(R)-, -O-, or-C(O)-; each of which is optionally substituted; Ring B is selected from H each Rw is independently selected from ٥ 3 WO 2022/120354 PCT/US2021/072684 each R2 is independently selected from -OR, -C(O)NR2, optionally substituted -C1-6 aliphatic, each Y is independently N or CR5;each R3 is independently H or optionally substituted -C1-6 aliphatic;each R4 is independently -S(O)2NR2, -S(O)2R, -C(O)NR2, -C(O)R, or optionally substituted -C1-aliphatic;each R5 is independently R, -CN, -C(O)R, -C(O)NR2, or optionally substituted 5-6 membered heteroaryl having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur;each m is independently 0, 1, or 2;p is 0, 1, or 2; andeach R is independently H, optionally substituted -C1-6 aliphatic, optionally substituted 3-membered saturated or partially unsaturated monocyclic carbocyclyl, or optionally substituted 3-8 membered saturated or partially unsaturated monocyclic heterocyclyl having 1-heteroatoms independently selected from nitrogen, oxygen, or sulfur. 2. Compounds and Definitions: [0010]Compounds of the present invention include those described generally herein, and are further illustrated by the classes, subclasses, and species disclosed herein. As used herein, the following definitions shall apply unless otherwise indicated. For purposes of this invention, the chemical elements are identified in accordance with the Periodic Table of the Elements, CAS version, Handbook of Chemistry and Physics, 75th Ed. Additionally, general principles of organic chemistry are described in "Organic Chemistry", Thomas Sorrell, University Science Books, Sausalito: 1999, and "March ’s Advanced Organic Chemistry", 5th Ed., Ed.: Smith, M.B. and March, J., John Wiley & Sons, New York: 2001, the entire contents of which are hereby incorporated by reference. [0011]The term "aliphatic " or "aliphatic group ", as used herein, means a straight-chain (i.e., unbranched) or branched, substituted or unsubstituted hydrocarbon chain that is completely saturated or that contains one or more units of unsaturation, or a monocyclic hydrocarbon or 4 WO 2022/120354 PCT/US2021/072684 bicyclic hydrocarbon that is completely saturated or that contains one or more units of unsaturation, but which is not aromatic (also referred to herein as "carbocycle," "cycloaliphatic " or "cycloalkyl"), that has a single point of attachment to the rest of the molecule. Unless otherwise specified, aliphatic groups contain 1-6 aliphatic carbon atoms. In some embodiments, aliphatic groups contain 1-5 aliphatic carbon atoms. In other embodiments, aliphatic groups contain 1-aliphatic carbon atoms. In still other embodiments, aliphatic groups contain 1-3 aliphatic carbon atoms, and in yet other embodiments, aliphatic groups contain 1-2 aliphatic carbon atoms. In some embodiments, "cycloaliphatic " (or "carbocycle " or "cycloalkyl ") refers to a monocyclic C3-Chydrocarbon that is completely saturated or that contains one or more units of unsaturation, but which is not aromatic, that has a single point of attachment to the rest of the molecule. Suitable aliphatic groups include, but are not limited to, linear or branched, substituted or unsubstituted alkyl, alkenyl, alkynyl groups and hybrids thereof such as (cycloalkyl)alkyl, (cycloalkenyl)alkyl or (cycloalkyl)alkenyl. [0012]As used herein, the term "bicyclic ring" or "bicyclic ring system " refers to any bicyclic ring system, i.e. carbocyclic or heterocyclic, saturated or having one or more units of unsaturation, having one or more atoms in common between the two rings of the ring system. Thus, the term includes any permissible ring fusion, such as ortho-fused or spirocyclic. As used herein, the term "heterobicyclic " is a subset of "bicyclic " that requires that one or more heteroatoms are present in one or both rings of the bicycle. Such heteroatoms may be present at ring junctions and are optionally substituted, and may be selected from nitrogen (including N-oxides), oxygen, sulfur (including oxidized forms such as sulfones and sulfonates), phosphorus (including oxidized forms such as phosphates), boron, etc. In some embodiments, a bicyclic group has 7-12 ring members and 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur. As used herein, the term "bridged bicyclic " refers to any bicyclic ring system, i.e. carbocyclic or heterocyclic, saturated or partially unsaturated, having at least one bridge. As defined by IUPAC, a "bridge " is an unbranched chain of atoms or an atom or a valence bond connecting two bridgeheads, where a "bridgehead " is any skeletal atom of the ring system which is bonded to three or more skeletal atoms (excluding hydrogen). In some embodiments, a bridged bicyclic group has 7-12 ring members and 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur. Such bridged bicyclic groups are well known in the art and include those groups set forth below where each group is attached to the rest of the molecule at any substitutable carbon or nitrogen atom.
WO 2022/120354 PCT/US2021/072684 Unless otherwise specified, a bridged bicyclic group is optionally substituted with one or more substituents as set forth for aliphatic groups. Additionally or alternatively, any substitutable nitrogen of a bridged bicyclic group is optionally substituted. Exemplary bicyclic rings include: id="p-13" id="p-13" id="p-13" id="p-13" id="p-13" id="p-13" id="p-13" id="p-13" id="p-13" id="p-13" id="p-13" id="p-13" id="p-13" id="p-13"
id="p-13"
[0013]The term "lower alkyl " refers to a C1-4 straight or branched alkyl group. Exemplary lower alkyl groups are methyl, ethyl, propyl, isopropyl, butyl, isobutyl, and tert-butyl. [0014]The term "lower haloalkyl" refers to a C1-4 straight or branched alkyl group that is substituted with one or more halogen atoms. [0015]The term "heteroatom " means one or more of oxygen, sulfur, nitrogen, phosphorus, or silicon (including, any oxidized form of nitrogen, sulfur, phosphorus, or silicon; the quaternized form of any basic nitrogen or; a substitutable nitrogen of a heterocyclic ring, for example N (as in 3,4-dihydro-2/Z-pyrrolyl), NH (as in pyrrolidinyl) or NR+ (as in N-substituted pyrrolidinyl)). [0016]The term "unsaturated, " as used herein, means that a moiety has one or more units of unsaturation. 6 WO 2022/120354 PCT/US2021/072684 id="p-17" id="p-17" id="p-17" id="p-17" id="p-17" id="p-17" id="p-17" id="p-17" id="p-17" id="p-17" id="p-17" id="p-17" id="p-17" id="p-17"
id="p-17"
[0017]As used herein, the term "bivalent C1-8 (or C1-6) saturated or unsaturated, straight or branched, hydrocarbon chain ", refers to bivalent alkylene, alkenylene, and alkynylene chains that are straight or branched as defined herein. [0018]The term "alkylene " refers to a bivalent alkyl group. An "alkylene chain " is a polymethylene group, i.e., -(CH2)n-, wherein n is a positive integer, preferably from 1 to 6, from to 4, from 1 to 3, from 1 to 2, or from 2 to 3. A substituted alkylene chain is a polymethylene group in which one or more methylene hydrogen atoms are replaced with a substituent. Suitable substituents include those described below for a substituted aliphatic group. [0019]The term "alkenylene " refers to a bivalent alkenyl group. A substituted alkenylene chain is a polymethylene group containing at least one double bond in which one or more hydrogen atoms are replaced with a substituent. Suitable substituents include those described below for a substituted aliphatic group. [0020]As used herein, the term "cyclopropylenyl " refers to a bivalent cyclopropyl group of the following structure: [0021] The term "halogen " means F, Cl, Br, or I. [0022] The term "aryl" used alone or as part of a larger moiety as in "aralkyl, " "aralkoxy," or"aryloxyalkyl, " refers to monocyclic or bicyclic ring systems having a total of five to fourteen ring members, wherein at least one ring in the system is aromatic and wherein each ring in the system contains 3 to 7 ring members. The term "aryl" may be used interchangeably with the term "aryl ring." In certain embodiments of the present invention, "aryl" refers to an aromatic ring system which includes, but not limited to, phenyl, biphenyl, naphthyl, anthracyl and the like, which may bear one or more substituents. Also included within the scope of the term "aryl," as it is used herein, is a group in which an aromatic ring is fused to one or more non-aromatic rings, such as indanyl, phthalimidyl, naphthimidyl, phenanthridinyl, or tetrahydronaphthyl, and the like. [0023]The terms "heteroaryl " and "heteroar-," used alone or as part of a larger moiety, e.g., "heteroaralkyl, " or "heteroaralkoxy, " refer to groups having 5 to 10 ring atoms, preferably 5, 6, or ring atoms; having 6, 10, or 14 71 electrons shared in a cyclic array; and having, in addition to carbon atoms, from one to five heteroatoms. The term "heteroatom " refers to nitrogen, oxygen, or sulfur, and includes any oxidized form of nitrogen or sulfur, and any quaternized form of a basic nitrogen. Heteroaryl groups include, without limitation, thienyl, furanyl, pyrrolyl, imidazolyl, 7 WO 2022/120354 PCT/US2021/072684 pyrazolyl, triazolyl, tetrazolyl, oxazolyl, isoxazolyl, oxadiazolyl, thiazolyl, isothiazolyl, thiadiazolyl, pyridyl, pyridazinyl, pyrimidinyl, pyrazinyl, indolizinyl, purinyl, naphthyridinyl, and pteridinyl. The terms "heteroaryl" and "heteroar-", as used herein, also include groups in which a heteroaromatic ring is fused to one or more aryl, cycloaliphatic, or heterocyclyl rings, where the radical or point of attachment is on the heteroaromatic ring. Nonlimiting examples include indolyl, isoindolyl, benzothienyl, benzofuranyl, dibenzofuranyl, indazolyl, benzimidazolyl, benzthiazolyl, quinolyl, isoquinolyl, cinnolinyl, phthalazinyl, quinazolinyl, quinoxalinyl, 4H-quinolizinyl, carbazolyl, acridinyl, phenazinyl, phenothiazinyl, phenoxazinyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, and pyrido[2,3-b]-l,4-oxazin-3(4H)-one. A heteroaryl group may be mono- or bicyclic. The term "heteroaryl" may be used interchangeably with the terms "heteroaryl ring," "heteroaryl group, " or "heteroaromatic, " any of which terms include rings that are optionally substituted. The term "heteroaralkyl " refers to an alkyl group substituted by a heteroaryl, wherein the alkyl and heteroaryl portions independently are optionally substituted. [0024]As used herein, the terms "heterocycle, " "heterocyclyl, " "heterocyclic radical, " and "heterocyclic ring" are used interchangeably and refer to a stable 5- to 7-membered monocyclic or 7-10-membered bicyclic heterocyclic moiety that is either saturated or partially unsaturated, and having, in addition to carbon atoms, one or more, preferably one to four, heteroatoms, as defined above. When used in reference to a ring atom of a heterocycle, the term "nitrogen" includes a substituted nitrogen. As an example, in a saturated or partially unsaturated ring having 0-heteroatoms selected from oxygen, sulfur or nitrogen, the nitrogen may be N (as in 3,4-dihydro- 2H-pyrrolyl), NH (as in pyrrolidinyl), or +NR (as in N substituted pyrrolidinyl). [0025]A heterocyclic ring can be attached to its pendant group at any heteroatom or carbon atom that results in a stable structure and any of the ring atoms can be optionally substituted. Examples of such saturated or partially unsaturated heterocyclic radicals include, without limitation, tetrahydrofuranyl, tetrahydrothiophenyl, pyrrolidinyl, piperidinyl, pyrrolinyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl, oxazolidinyl, piperazinyl, dioxanyl, dioxolanyl, diazepinyl, oxazepinyl, thiazepinyl, morpholinyl, and quinuclidinyl. The terms "heterocycle, " "heterocyclyl, " "heterocyclyl ring," "heterocyclic group, " "heterocyclic moiety, " and "heterocyclic radical, " are used interchangeably herein, and also include groups in which a heterocyclyl ring is fused to one or more aryl, heteroaryl, or cycloaliphatic rings, such as indolinyl, 3H-indolyl, chromanyl, phenanthridinyl, or tetrahydroquinolinyl. A heterocyclyl group 8 WO 2022/120354 PCT/US2021/072684 may be mono- or bicyclic. The term "heterocyclylalkyl" refers to an alkyl group substituted by a heterocyclyl, wherein the alkyl and heterocyclyl portions independently are optionally substituted. [0026]As used herein, the term "partially unsaturated " refers to a ring moiety that includes at least one double or triple bond. The term "partially unsaturated " is intended to encompass rings having multiple sites of unsaturation, but is not intended to include aryl or heteroaryl moieties, as herein defined. [0027]As described herein, compounds of the invention may contain "optionally substituted " moieties. In general, the term "substituted, " whether preceded by the term "optionally " or not, means that one or more hydrogens of the designated moiety are replaced with a suitable substituent. Unless otherwise indicated, an "optionally substituted " group may have a suitable substituent at each substitutable position of the group, and when more than one position in any given structure may be substituted with more than one substituent selected from a specified group, the substituent may be either the same or different at every position. Combinations of substituents envisioned by this invention are preferably those that result in the formation of stable or chemically feasible compounds. The term "stable," as used herein, refers to compounds that are not substantially altered when subjected to conditions to allow for their production, detection, and, in certain embodiments, their recovery, purification, and use for one or more of the purposes disclosed herein. [0028]Each optional substituent on a substitutable carbon is a monovalent substituent independently selected from halogen; -(CH2)cmRo; -(CH2)0-4OR°; -O(CH2)0-4R°, -O-(CH2)0- 4C(O)OR°; -(CH2)o-4CH(OR°)2; -(CH2)o-4SR°; -(CH2)0-4Ph, which may be substituted with R°; -(CH2)0-4O(CH2)0-1Ph which may be substituted with R°; -CH=CHPh, which may be substituted with R°; -(CH2)0-4O(CH2)0-1-pyridyl which may be substituted with R°; -NO2; -CN; - N3; -(CH2)o^N(R°)2; -(CH2)o-4N(R°)C(0)R°; -N(R°)C(S)R°; -(CH2)o-4N(Ro)C(O)NR°2; -N(Ro)C(S)NR°2; -(CH2)0-4N(Ro)C(O)OR°;N(R°)N(R°)C(O)R°; -N(Ro)N(R°)C(O)NR°2; -N(R°)N(R°)C(O)OR°; -(CH2)o-4C(0)R°; - C(S)R°; -(CH2)o^C(0)OR°; -(CH2)o-4C(0)SR°; -(CH2)0-4C(O)OSiR°3; -(CH2)0-4OC(O)R°; - OC(O)(CH2)0-4SR-, SC(S)SR°; -(CH2)o^SC(0)R°; -(CH2)o-4C(0)NR°2; -C(S)NRo2; -C(S)SR°; -SC(S)SR°, -(CH2)0-4OC(O)NR°2; -C(O)N(OR°)R°; -C(O)C(O)R°; -C(O)CH2C(O)Ro; - C(NOR°)R°; -(CH2)o^SSR°; -(CH2)o^S(0)2R°; -(CH2)o^S(0)20R°; -(CH2)o-40S(0)2R°; - S(O)2NR°2; -S(O)(NR°)R°; -S(O)2N=C(NRo2)2; -(CH2)o^S(0)R°; -N(Ro)S(O)2NR°2; - 9 WO 2022/120354 PCT/US2021/072684 N(R°)S(O)2R°; -N(OR°)R°; -C(NH)NRo2; -P(O)2Ro; -P(O)Ro2; -OP(O)Ro2; -OP(O)(ORo)2; SiR°3; —(C1-4 straight or branched alkylene)O-N(R°)2; or -(C1-4 straight or branched alkylene)C(O)O-N(R°)2. [0029]Each R° is independently hydrogen, C1-6 aliphatic, -CH2Ph, -O(CH2)0-1Ph, -CH2-(5-membered heteroaryl ring), or a 5-6-membered saturated, partially unsaturated, or aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, or, notwithstanding the definition above, two independent occurrences of R°, taken together with their intervening atom(s), form a 3-12-membered saturated, partially unsaturated, or aryl mono- or bicyclic ring having 0- heteroatoms independently selected from nitrogen, oxygen, or sulfur, which may be substituted by a divalent substituent on a saturated carbon atom of R° selected from =0 and =S; or each R° is optionally substituted with a monovalent substituent independently selected from halogen, - (CH2)0-2Re, -(haloR*), -(CH2)0-2OH, -(CH2)0-2OR*, -(CH2)0-2CH(OR*)2; -O(haloR*), -CN, -N3, -(CH2)0-2C(O)R*, -(CH2)0-2C(O)OH, -(CH2)o-2C(0)OR*, -(CH2)0-2SR*, -(CH2)0-2SH, -(CH2)0- 2NH2, -(CH2)0-2NHR*, -(CH2)0-2NRe2, -NO2, -SiR*3, -OSiR*3, -C(O)SR* -(Cm straight or branched alkylene)C(O)OR*, or-SSR*. [0030]Each R* is independently selected from C1-4 aliphatic, -CH2Ph, -O(CH2)0-1Ph, or a 5- 6-membered saturated, partially unsaturated, or aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, and wherein each R* is unsubstituted or where preceded by halo is substituted only with one or more halogens; or wherein an optional substituent on a saturated carbon is a divalent substituent independently selected from =0, =S, =NNR*2, =NNHC(O)R =NNHC(O)OR =NNHS(O)2R*, =NR*, =N0R*, -O(C(R*2))2-3O-, or - S(C(R*2))2-3S-, or a divalent substituent bound to vicinal substitutable carbons of an "optionally substituted " group is -O(CR*2)2-3O-, wherein each independent occurrence of R* is selected from hydrogen, C1-6 aliphatic or an unsubstituted 5-6-membered saturated, partially unsaturated, or aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur. [0031]When R* is C1-6 aliphatic, R* is optionally substituted with halogen, - R*, -(haloR*), -OH, -OR*, -O(haloR*), -CN, -C(O)OH, -C(O)OR*, -NH2, -NHR*, -NR*2, or- NO2, wherein each R* is independently selected from Ci-4 aliphatic, -CH2Ph, -O(CH2)0-1Ph, or a 5-6-membered saturated, partially unsaturated, or aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, and wherein each R* is unsubstituted or where preceded by halo is substituted only with one or more halogens.
WO 2022/120354 PCT/US2021/072684 id="p-32" id="p-32" id="p-32" id="p-32" id="p-32" id="p-32" id="p-32" id="p-32" id="p-32" id="p-32" id="p-32" id="p-32" id="p-32" id="p-32"
id="p-32"
[0032]An optional substituent on a substitutable nitrogen is independently -R', -NR^, - C(O)R؟, -C(O)OR^, -C(O)C(O)Rt, -C(O)CH2C(O)Rt, -S(O)2Rt, -S(O)2NRt2, -C(S)NRt2, - C(NH)NR'2, or -N(R؟)S(O)2R؟; wherein each R؛ is independently hydrogen, C1-6 aliphatic, unsubstituted -OPh, or an unsubstituted 5-6-membered saturated, partially unsaturated, or aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, or, two independent occurrences ofR, taken together with their intervening atom(s) form an unsubstituted 3-12-membered saturated, partially unsaturated, or aryl mono- or bicyclic ring having 0-heteroatoms independently selected from nitrogen, oxygen, or sulfur; wherein when R؛ is C1-aliphatic, R؛ is optionally substituted with halogen, -R*, -(haloR*), -OH, -OR*, -O(haloR*), - CN, -C(O)OH, -C(O)OR*, -NH2, -NHR", -NR*2, or -NO2, wherein each R* is independently selected from C1-4 aliphatic, -CH2Ph, -O(CH2)0-1Ph, or a 5-6-membered saturated, partially unsaturated, or aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, and wherein each R* is unsubstituted or where preceded by halo is substituted only with one or more halogens. [0033]As used herein, the term "pharmaceutically acceptable salt" refers to those salts which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and lower animals without undue toxicity, irritation, allergic response and the like, and are commensurate with a reasonable benefit/risk ratio. Pharmaceutically acceptable salts are well known in the art. For example, S. M. Berge et al., describe pharmaceutically acceptable salts in detail in J. Pharmaceutical Sciences, 1977, 66, 1-19, incorporated herein by reference. Pharmaceutically acceptable salts of the compounds of this invention include those derived from suitable inorganic and organic acids and bases. Examples of pharmaceutically acceptable, nontoxic acid addition salts are salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid or with organic acids such as acetic acid, oxalic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other methods used in the art such as ion exchange. Other pharmaceutically acceptable salts include adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphor sulfonate, citrate, cyclopentanepropionate, digluconate, dodecyl sulfate, ethanesulfonate, formate, fumarate, glucoheptonate, glycerophosphate, gluconate, hemisulfate, heptanoate, hexanoate, hydroiodide, 2- hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, 11 WO 2022/120354 PCT/US2021/072684 methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palmitate, pamoate, pectinate, persulfate, 3-phenylpropionate, phosphate, pivalate, propionate, stearate, succinate, sulfate, tartrate, thiocyanate, p-toluenesulfonate, undecanoate, valerate salts, and the like. [0034]Salts derived from appropriate bases include alkali metal, alkaline earth metal, ammonium and NUC1-4alkyl)4 salts. Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like. Further pharmaceutically acceptable salts include, when appropriate, nontoxic ammonium, quaternary ammonium, and amine cations formed using counterions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, loweralkyl sulfonate and aryl sulfonate. [0035]Unless otherwise stated, structures depicted herein are also meant to include all isomeric (e.g., enantiomeric, diastereomeric, and geometric (or conformational)) forms of the structure; for example, the R and S configurations for each asymmetric center, Z and E double bond isomers, and Z and E conformational isomers. Therefore, single stereochemical isomers as well as enantiomeric, diastereomeric, and geometric (or conformational) mixtures of the present compounds are within the scope of the invention. Unless otherwise stated, all tautomeric forms of the compounds of the invention are within the scope of the invention. Additionally, unless otherwise stated, structures depicted herein are also meant to include compounds that differ only in the presence of one or more isotopically enriched atoms. For example, compounds having the present structures including the replacement of hydrogen by deuterium or tritium, or the replacement of a carbon by a 13C- or 14C-enriched carbon are within the scope of this invention. Such compounds are useful, for example, as analytical tools, as probes in biological assays, or as therapeutic agents in accordance with the present invention. In certain embodiments, a warhead moiety of a provided compound comprises one or more deuterium atoms. [0036]As used herein, the terms "inhibitor " or "TEAD inhibitor " or "TEAD antagonist " are defined as a compound that binds to and/or inhibits TEAD with measurable affinity. In some embodiments, inhibition in the presence of the inhibitor is observed in a dose-dependent manner. In some embodiments, the measured signal (e.g., signaling activity or biological activity) is at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at leastabout 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at leastabout 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at leastabout 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least 12 wo 2022/120354 PCTS2O21/O72684 about 97% at least about 98%, at least about 99% or at least about 100% lower than the signal measured with a negative control under comparable conditions. The potency of an inhibitor is usually defined by its ICso value (half maximal inhibitory concentration or concentration required to inhibit 50% of the agonist response). The lower the ICso value the greater the potency of the antagonist and the lower the concentration that is required to inhibit the maximum biological response. In certain embodiments, an inhibitor has an ICso and/or binding constant of less than about 100 و less than about 50 رو less than about 1 لإ و less than about 500 nM, less than about 100 nM, less than about 10 nM, or less than about 1 nM. 00371The terms "measurable affinity" and "measurably inhibit," as used herein, means a measurable change or inhibition in TEAD activity between a sample comprising a compound of the present invention, or composition thereof, and TEAD, and an equivalent sample comprising TEAD, in the absence of said compound, or composition thereof. 3. Description of Exemplary Embodiments: [0038]In one aspect, the present invention provides a compound of Formula I: or a pharmaceutically acceptable salt thereof, wherein:L1 is a covalent bound, or a C1-6 bivalent straight or branched hydrocarbon chain wherein 1, 2, or methylene units of the chain are independently and optionally replaced with -N(R)-, -O-, or -C(O)-; each of which is optionally substituted; 13 WO 2022/120354 PCT/US2021/072684 H each Rw is independently selected from 0each R2 is independently selected from -OR, -C(O)NR2, optionally substituted -C1-6 aliphatic, each Y is independently N or CR5;each R3 is independently H or optionally substituted -C1-6 aliphatic;each R4 is independently -S(O)2NR2, -S(O)2R, -C(O)NR2, -C(O)R, or optionally substituted -C1-aliphatic;each R5 is independently R, -CN, -C(O)R, -C(O)NR2, or optionally substituted 5-6 membered heteroaryl having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur;each m is independently 0, 1, or 2;p is 0, 1, or 2, andeach R is independently H, optionally substituted -C1-6 aliphatic, optionally substituted 3-membered saturated or partially unsaturated monocyclic carbocyclyl, or optionally substituted 3-8 membered saturated or partially unsaturated monocyclic heterocyclyl having 1-heteroatoms independently selected from nitrogen, oxygen, or sulfur. [0039]As defined generally above, L1 is a covalent bound, or a C1-6 bivalent straight or branched hydrocarbon chain wherein 1, 2, or 3 methylene units of the chain are independently and optionally replaced with -N(R)-, -O-, or -C(O)-. 14 WO 2022/120354 PCT/US2021/072684 id="p-40" id="p-40" id="p-40" id="p-40" id="p-40" id="p-40" id="p-40" id="p-40" id="p-40" id="p-40" id="p-40" id="p-40" id="p-40" id="p-40"
id="p-40"
[0040]In some embodiments, L1 is a covalent bond. [0041]In some embodiments, L1 is C1-6 bivalent straight or branched hydrocarbon chain wherein 1, 2, or 3 methylene units of the chain are independently and optionally replaced with - N(R)־ [0042]In some embodiments, L1 is C1-6 bivalent straight or branched hydrocarbon chain wherein 1, 2, or 3 methylene units of the chain are independently and optionally replaced with -O- id="p-43" id="p-43" id="p-43" id="p-43" id="p-43" id="p-43" id="p-43" id="p-43" id="p-43" id="p-43" id="p-43" id="p-43" id="p-43" id="p-43"
id="p-43"
[0043]In some embodiments, L1 is C1-6 bivalent straight or branched hydrocarbon chain wherein 1, 2, or 3 methylene units of the chain are independently and optionally replaced with - C(O)-. [0044]In some embodiments, L1 is -NH-. In some embodiments, L1 is -NH-CH2-. In someembodiments, L1 is -NH-CH2-CH2-. In some embodiments, L1 is -CH2-. In some embodiments, In some embodiments, L1 is In some embodiments, L1 is H L ; In some embodiments, L1 is . In some embodiments, L1 is -CH=CH-. In some embodiments, L1 is In some embodiments, L1 is In some embodiments, L1is -NH-C(O)-. [0045]In some embodiments, L1 is selected from those depicted in Table 1, below. and , each of which is optionally substituted. id="p-47" id="p-47" id="p-47" id="p-47" id="p-47" id="p-47" id="p-47" id="p-47" id="p-47" id="p-47" id="p-47" id="p-47" id="p-47" id="p-47"
id="p-47"
[0047] In some embodiments, Ring A is optionally substituted WO 2022/120354 PCT/US2021/072684 id="p-48" id="p-48" id="p-48" id="p-48" id="p-48" id="p-48" id="p-48" id="p-48" id="p-48" id="p-48" id="p-48" id="p-48" id="p-48" id="p-48"
id="p-48"
[0048] In some embodiments, Ring A is optionally substituted id="p-49" id="p-49" id="p-49" id="p-49" id="p-49" id="p-49" id="p-49" id="p-49" id="p-49" id="p-49" id="p-49" id="p-49" id="p-49" id="p-49"
id="p-49"
[0049] In some embodiments, Ring A is optionally substituted id="p-50" id="p-50" id="p-50" id="p-50" id="p-50" id="p-50" id="p-50" id="p-50" id="p-50" id="p-50" id="p-50" id="p-50" id="p-50" id="p-50"
id="p-50"
[0050] In some embodiments, Ring A is optionally substituted id="p-51" id="p-51" id="p-51" id="p-51" id="p-51" id="p-51" id="p-51" id="p-51" id="p-51" id="p-51" id="p-51" id="p-51" id="p-51" id="p-51"
id="p-51"
[0051] In some embodiments, Ring A is optionally substituted id="p-52" id="p-52" id="p-52" id="p-52" id="p-52" id="p-52" id="p-52" id="p-52" id="p-52" id="p-52" id="p-52" id="p-52" id="p-52" id="p-52"
id="p-52"
[0052] In some embodiments, Ring A is optionally substituted id="p-53" id="p-53" id="p-53" id="p-53" id="p-53" id="p-53" id="p-53" id="p-53" id="p-53" id="p-53" id="p-53" id="p-53" id="p-53" id="p-53"
id="p-53"
[0053] In some embodiments, Ring A is optionally substituted id="p-54" id="p-54" id="p-54" id="p-54" id="p-54" id="p-54" id="p-54" id="p-54" id="p-54" id="p-54" id="p-54" id="p-54" id="p-54" id="p-54"
id="p-54"
[0054] In someembodiments, Ring A is optionally substituted id="p-55" id="p-55" id="p-55" id="p-55" id="p-55" id="p-55" id="p-55" id="p-55" id="p-55" id="p-55" id="p-55" id="p-55" id="p-55" id="p-55"
id="p-55"
[0055] In some embodiments, Ring A is optionally substituted id="p-56" id="p-56" id="p-56" id="p-56" id="p-56" id="p-56" id="p-56" id="p-56" id="p-56" id="p-56" id="p-56" id="p-56" id="p-56" id="p-56"
id="p-56"
[0056] In some embodiments, Ring A is optionally substituted id="p-57" id="p-57" id="p-57" id="p-57" id="p-57" id="p-57" id="p-57" id="p-57" id="p-57" id="p-57" id="p-57" id="p-57" id="p-57" id="p-57"
id="p-57"
[0057] In some embodiments, Ring A is optionally substituted H id="p-58" id="p-58" id="p-58" id="p-58" id="p-58" id="p-58" id="p-58" id="p-58" id="p-58" id="p-58" id="p-58" id="p-58" id="p-58" id="p-58"
id="p-58"
[0058] In some embodiments, Ring A is optionally substituted In some embodiments, Ring A is selected from [0059] 16 WO 2022/120354 PCT/US2021/072684 halogen, -CN, -C(O)R, -C(O)NR2, -OR, -SR, -S(O)2NR2, or -S(O)2R, and each n is independently 0, 1, 2, or 3, wherein each R is independently as defined herein and as described in embodiments herein. [0060]In some embodiments, R1 is R. In some embodiments, R1 is halogen. In some embodiments, R1 is -CN. In some embodiments, R1 is -C(O)R. In some embodiments, R1 is - C(O)NR2. In some embodiments, R1 is -OR. In some embodiments, R1 is -SR. In some embodiments, R1 is -S(O)2NR2. In some embodiments, R1 is -S(O)2R. [0061]In some embodiments, each R1 is independently H, halogen, -C1-6 aliphatic optionally substituted by 1-6 halogen, 3-8 membered saturated or partially unsaturated monocyclic carbocyclyl optionally substituted by 1-6 halogen, or 3-8 membered saturated or partially unsaturated monocyclic heterocyclyl having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur optionally substituted by 1-6 halogen. [0062]In some embodiments, each R1 is independently H, -CF3, -C(O)NH2, -CH3, -CH2CH3, -OCH3, -CHF2, -OCF3, -OCHF2, -SCFs, -Cl, -S(O)2-NH2, -OCHCH3, -F, -C(O)NHCH3, -CN, - OS(O)2-CH3, -OCH(CH3)2, -CH(CH3)2, -C(CH3)3, -CH2OH, V id="p-63" id="p-63" id="p-63" id="p-63" id="p-63" id="p-63" id="p-63" id="p-63" id="p-63" id="p-63" id="p-63" id="p-63" id="p-63" id="p-63"
id="p-63"
[0063]In some embodiments, each R1 is independently selected from those depicted in Table 1, below. [0064]In some embodiments, n is 0. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. 17 WO 2022/120354 PCT/US2021/072684 In some embodiments, Ring A is selected fromR1 [0065] , wherein each of R1 is as defined above and described in embodiments herein, bothsingly and in combination.
In some embodiments, Ring A is selected from r1 , and [0066] , wherein each R1 is as defined above and described in embodiments herein, bothsingly and in combination. 18 WO 2022/120354 PCT/US2021/072684 19 WO 2022/120354 PCT/US2021/072684 id="p-69" id="p-69" id="p-69" id="p-69" id="p-69" id="p-69" id="p-69" id="p-69" id="p-69" id="p-69" id="p-69" id="p-69" id="p-69" id="p-69"
id="p-69"
[0069]In some embodiments, Ring A is selected from those depicted in Table 1, below. wherein each of R2, R3, Rw, p, and R4 is as defined herein and described in embodiments herein,both singly and in combination. id="p-71" id="p-71" id="p-71" id="p-71" id="p-71" id="p-71" id="p-71" id="p-71" id="p-71" id="p-71" id="p-71" id="p-71" id="p-71" id="p-71"
id="p-71"
[0071] In some embodiments, Ring B is RW wherein each of R2 and Rw is asdefined herein and described in embodiments herein, both singly and in combination. id="p-72" id="p-72" id="p-72" id="p-72" id="p-72" id="p-72" id="p-72" id="p-72" id="p-72" id="p-72" id="p-72" id="p-72" id="p-72" id="p-72"
id="p-72"
[0072] In some embodiments, Ring B is wherein each of R4 and Rw is asdefined herein and described in embodiments herein, both singly and in combination.
WO 2022/120354 PCT/US2021/072684 R2 id="p-73" id="p-73" id="p-73" id="p-73" id="p-73" id="p-73" id="p-73" id="p-73" id="p-73" id="p-73" id="p-73" id="p-73" id="p-73" id="p-73"
id="p-73"
[0073]In some embodiments, Ring B is Rw , wherein each of R2 and Rw is as defined herein and described in embodiments herein, both singly and in combination. id="p-74" id="p-74" id="p-74" id="p-74" id="p-74" id="p-74" id="p-74" id="p-74" id="p-74" id="p-74" id="p-74" id="p-74" id="p-74" id="p-74"
id="p-74"
[0074] In some embodiments, Ring B is RW R2 wherein each of R2 and Rw is asdefined herein and described in embodiments herein, both singly and in combination.Rw id="p-75" id="p-75" id="p-75" id="p-75" id="p-75" id="p-75" id="p-75" id="p-75" id="p-75" id="p-75" id="p-75" id="p-75" id="p-75" id="p-75"
id="p-75"
[0075]In some embodiments, Ring B is R , wherein each of R4 and Rw is asdefined herein and described in embodiments herein, both singly and in combination.
R2 id="p-76" id="p-76" id="p-76" id="p-76" id="p-76" id="p-76" id="p-76" id="p-76" id="p-76" id="p-76" id="p-76" id="p-76" id="p-76" id="p-76"
id="p-76"
[0076]In some embodiments, Ring B is RW , wherein each of R2 and Rw is as defined herein and described in embodiments herein, both singly and in combination. id="p-77" id="p-77" id="p-77" id="p-77" id="p-77" id="p-77" id="p-77" id="p-77" id="p-77" id="p-77" id="p-77" id="p-77" id="p-77" id="p-77"
id="p-77"
[0077] In some embodiments, Ring B is , wherein each of R3 and p is asdefined herein and described in embodiments herein, both singly and in combination. In some embodiments, Ring B isOor O id="p-78" id="p-78" id="p-78" id="p-78" id="p-78" id="p-78" id="p-78" id="p-78" id="p-78" id="p-78" id="p-78" id="p-78" id="p-78" id="p-78"
id="p-78"
[0078] In some embodiments, Ring B is wherein Rw is as defined herein and described in embodiments herein. In some embodiments, Ring Bis H wherein Rwis as defined herein and described in embodiments herein. [0079]In some embodiments, Ring B is selected from those depicted in Table 1, below. 21 WO 2022/120354 PCT/US2021/072684 id="p-80" id="p-80" id="p-80" id="p-80" id="p-80" id="p-80" id="p-80" id="p-80" id="p-80" id="p-80" id="p-80" id="p-80" id="p-80" id="p-80"
id="p-80"
[0080] id="p-81" id="p-81" id="p-81" id="p-81" id="p-81" id="p-81" id="p-81" id="p-81" id="p-81" id="p-81" id="p-81" id="p-81" id="p-81" id="p-81"
id="p-81"
[0081] H As defined generally above, Rw is selected from 0 H In some embodiments, Rw is O some embodiments, Rw is Br embodiments, Rw is In some embodiments, Rw is In some embodiments, Rw is In some embodiments, Rw is In some In some embodiments, R" is [0082] In some embodiments, Rw is selected from those depicted in Table 1, below. [0083] As defined generally above, each R2 is independently selected from -OR, -C(O)NR2, optionally substituted -C1-6 aliphatic, and , wherein each of Y, m, and R5 is as defined herein anddescribed in embodiments herein, both singly and in combination.. 22 WO 2022/120354 PCT/US2021/072684 id="p-84" id="p-84" id="p-84" id="p-84" id="p-84" id="p-84" id="p-84" id="p-84" id="p-84" id="p-84" id="p-84" id="p-84" id="p-84" id="p-84"
id="p-84"
[0084]In some embodiments, R2 is -OR. In some embodiments, R2 is -C(O)NR2. In some embodiments, R2 is optionally substituted -C1-6 aliphatic. In some embodiments, R2 is In some embodiments, R2 is In some embodiments, R2 is In some In some embodiments, In some embodiments, R2 is embodiments, R2 is id="p-85" id="p-85" id="p-85" id="p-85" id="p-85" id="p-85" id="p-85" id="p-85" id="p-85" id="p-85" id="p-85" id="p-85" id="p-85" id="p-85"
id="p-85"
[0085] In some embodiments, R2 is In some embodiments, R2 is R5 . In some embodiments, R2 is In some embodiments, R2 is In some embodiments, R2 In some embodiments, R2 is In some embodiments, R2 is 23 WO 2022/120354 PCT/US2021/072684 some embodiments, R2 is embodiments, R2 is embodiments, R2 is is In some embodiments, R2 is In some embodiments, R2 is In some embodiments, R2 is . In some embodiments, R2 is R5 In some In some In some embodiments, R2 24 WO 2022/120354 PCT/US2021/072684 WO 2022/120354 PCT/US2021/072684 id="p-88" id="p-88" id="p-88" id="p-88" id="p-88" id="p-88" id="p-88" id="p-88" id="p-88" id="p-88" id="p-88" id="p-88" id="p-88" id="p-88"
id="p-88"
[0088] In some embodiments, R2 is selected from those depicted in Table 1, below.[0089] As defined generally above, each ¥ is independently N or CR5.[0090] In some embodiments, Y is N. In some embodiments, Y is CR5. In some embodiments, Y is CH.[0091] In some embodiments, both Y are N. In some embodiments, both Y are CR5. In some embodiments, one Y is N, and the other Y is CR5. In some embodiments, both Y are CH. In some embodiments, one Y is N, and the other Y is CH.[0092] In some embodiments, Y is selected from those depicted in Table 1, below.[0093] As defined generally above, each R3 is independently H, -C(O)R, or optionally substituted -C1-6 aliphatic, wherein R is as defined herein and described in embodiments herein.[0094] In some embodiments, R3 is H.[0095] In some embodiments, R3 is -C(O)R. 26 WO 2022/120354 PCT/US2021/072684 id="p-96" id="p-96" id="p-96" id="p-96" id="p-96" id="p-96" id="p-96" id="p-96" id="p-96" id="p-96" id="p-96" id="p-96" id="p-96" id="p-96"
id="p-96"
[0096]In some embodiments, R3 is optionally substituted -C1-6 aliphatic. [0097]In some embodiments, R3 is selected from H, -CH3, -CH2CH3, -C(O)CH3, and id="p-98" id="p-98" id="p-98" id="p-98" id="p-98" id="p-98" id="p-98" id="p-98" id="p-98" id="p-98" id="p-98" id="p-98" id="p-98" id="p-98"
id="p-98"
[0098]In some embodiments, R3 is selected from those depicted in Table 1, below. [0099]As defined generally above, each R4 is independently -S(O)2NR2, -S(O)2R, -C(O)NR2, -C(O)R, or optionally substituted -C1-6 aliphatic, wherein each R is independently as defined herein and as described in embodiments herein. [00100]In some embodiments, R4 is -S(O)2NR2. [00101]In some embodiments, R4 is -S(O)2R. [00102]In some embodiments, R4 is -C(O)NR2. [00103]In some embodiments, R4 is -C(O)R. [00104]In some embodiments, R4 is -optionally substituted -C1-6 aliphatic. 27 WO 2022/120354 PCT/US2021/072684 id="p-106" id="p-106" id="p-106" id="p-106" id="p-106" id="p-106" id="p-106" id="p-106" id="p-106" id="p-106" id="p-106" id="p-106" id="p-106" id="p-106"
id="p-106"
[00106] In some embodiments, R4 is selected from: H ؛ T ؛ and id="p-107" id="p-107" id="p-107" id="p-107" id="p-107" id="p-107" id="p-107" id="p-107" id="p-107" id="p-107" id="p-107" id="p-107" id="p-107" id="p-107"
id="p-107"
[00107]In some embodiments, R4 is selected from those depicted in Table 1, below. [00108]As defined generally above, each R5 is independently R, -CN, -C(O)R, -C(O)NR2, or optionally substituted 5-6 membered heteroaryl having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur, wherein each R is independently as defined herein and as described in embodiments herein. [00109]In some embodiments, R5 is R. [00110]In some embodiments, R5 is -CN. [00111]In some embodiments, R5 is -C(O)R. [00112]In some embodiments, R5 is -C(O)NR2. [00113]In some embodiments, R5 is optionally substituted 5-6 membered heteroaryl having 1-heteroatoms independently selected from nitrogen, oxygen, or sulfur. [00114]In some embodiments, each R5 is independently selected from: H, -CH3, -CD3, ON, -CH2CH3, -C(O)CH3, -CH2C(O)NHCH3, h 28 WO 2022/120354 PCT/US2021/072684 id="p-115" id="p-115" id="p-115" id="p-115" id="p-115" id="p-115" id="p-115" id="p-115" id="p-115" id="p-115" id="p-115" id="p-115" id="p-115" id="p-115"
id="p-115"
[00115]In some embodiments, each R5 is independently selected from: -CH3, -CH2CH2OCH3, O __ hn-CH2CF3, -CH2CH2C1, >>a . id="p-116" id="p-116" id="p-116" id="p-116" id="p-116" id="p-116" id="p-116" id="p-116" id="p-116" id="p-116" id="p-116" id="p-116" id="p-116" id="p-116"
id="p-116"
[00116]In some embodiments, R5 is selected from those depicted in Table 1, below. [00117]As defined generally above, each m is independently 0, 1, or 2. [00118]In some embodiments, m is 0. In some embodiments, m is 1. In some embodiments, m is 2. [00119]In some embodiments, m is selected from those depicted in Table 1, below. [00120]As defined generally above, p is 0, 1, or 2. [00121]In some embodiments, p is 0. In some embodiments, p is 1. In some embodiments, p is 2. [00122]In some embodiments, p is selected from those depicted in Table 1, below. [00123]As defined generally above, each R is independently H, optionally substituted -C1-aliphatic, optionally substituted 3-8 membered saturated or partially unsaturated monocyclic carbocyclyl, or optionally substituted 3-8 membered saturated or partially unsaturated monocyclic heterocyclyl having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur. [00124]In some embodiments, R is H. [00125]In some embodiments, R is optionally substituted -C1-6 aliphatic. In some embodiments, R is unsubstituted -C1-6 aliphatic. In some embodiments, R is -C1-6 aliphatic substituted 1, 2, 3, 4, 5, or 6 times by -halogen, -CN, or -NO2. In some embodiments, R is -C1-aliphatic substituted 1, 2, 3, 4, 5, or 6 times by -F. In some embodiments, R is -C1-3 aliphatic substituted 1, 2, 3, 4, 5, or 6 times by -F. In some embodiments, R is -CH3. In some embodiments, R is -CH2CH3. In some embodiments, R is -CF3. In some embodiments, R is -CHF2. [00126]In some embodiments, R is optionally substituted 3-8 membered saturated or partially unsaturated monocyclic carbocyclyl. In some embodiments, R is unsubstituted 3, 4, 5, 6, 7, or membered saturated or partially unsaturated monocyclic carbocyclyl. In some embodiments, R is 3, 4, 5, 6, 7, or 8 membered saturated or partially unsaturated monocyclic carbocyclyl substituted 1, 2, 3, 4, 5, or 6 times by -halogen, -CN, -NO2, or -C1-6 aliphatic, wherein the -C1-6 aliphatic is optionally substituted 1, 2, 3, 4, 5, or 6 times by -halogen, -CN, or -NO2. In some embodiments, 29 WO 2022/120354 PCT/US2021/072684 R is 3, 4, 5, 6, 7, or 8 membered saturated or partially unsaturated monocyclic carbocyclyl substituted 1, 2, 3, 4, 5, or 6 times by -halogen. In some embodiments, R is 3, 4, 5, 6, 7, or membered saturated or partially unsaturated monocyclic carbocyclyl substituted 1, 2, 3, 4, 5, or times by -C1-6 aliphatic, wherein the -C1-6 aliphatic is optionally substituted 1, 2, 3, 4, 5, or 6 times by -halogen. In some embodiments, R is 3, 4, 5, 6, 7, or 8 membered saturated or partially unsaturated monocyclic carbocyclyl substituted 1, 2, 3, 4, 5, or 6 times by -F. In some embodiments, R is 3, 4, 5, 6, 7, or 8 membered saturated or partially unsaturated monocyclic carbocyclyl substituted 1, 2, 3, 4, 5, or 6 times by -C1-6 aliphatic, wherein the -C1-6 aliphatic is optionally substituted 1, 2, 3, 4, 5, or 6 times by -F. [00127]In some embodiments, R is optionally substituted 3-8 membered saturated or partially unsaturated monocyclic heterocyclyl having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur. In some embodiments, R is unsubstituted 3, 4, 5, 6, 7, or 8 membered saturated or partially unsaturated monocyclic heterocyclyl having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur. In some embodiments, R is 3, 4, 5, 6, 7, or 8 membered saturated or partially unsaturated monocyclic heterocyclyl having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur, which is substituted 1, 2, 3, 4, 5, or 6 times by -halogen, -CN, -NO2, or -C1-6 aliphatic, wherein the -C1-6 aliphatic is optionally substituted 1, 2, 3, 4, 5, or times by -halogen, -CN, or -NO2. In some embodiments, R is 3, 4, 5, 6, 7, or 8 membered saturated or partially unsaturated monocyclic heterocyclyl having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur substituted 1, 2, 3, 4, 5, or 6 times by -halogen. In some embodiments, R is 3, 4, 5, 6, 7, or 8 membered saturated or partially unsaturated monocyclic heterocyclyl having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur substituted 1, 2, 3, 4, 5, or 6 times by -C1-6 aliphatic, wherein the -C1-6 aliphatic is optionally substituted 1, 2, 3, 4, 5, or 6 times by -halogen. In some embodiments, R is 3, 4, 5, 6, 7, or membered saturated or partially unsaturated monocyclic heterocyclyl having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur substituted 1, 2, 3, 4, 5, or 6 times by -F. In some embodiments, R is 3, 4, 5, 6, 7, or 8 membered saturated or partially unsaturated monocyclic heterocyclyl having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur substituted 1, 2, 3, 4, 5, or 6 times by -C1-6 aliphatic, wherein the -C1-6 aliphatic is optionally substituted 1, 2, 3, 4, 5, or 6 times by -F.
WO 2022/120354 PCT/US2021/072684 -CH2CH2C1, [00129]In some embodiments, R is selected from those depicted in Table 1, below. [00130]In some embodiments, the present invention provides a compound of Formulas: 31 WO 2022/120354 PCT/US2021/072684 32 WO 2022/120354 PCT/US2021/072684 II-S Il-t or a pharmaceutically acceptable salt thereof, wherein each of R1, L1, Rw, Y, m, n, and R5 is as defined above and as described in embodiments herein, both singly and in combination. [00131]In some embodiments, the present invention provides a compound of Formulas: 33 WO 2022/120354 PCT/US2021/072684 34 WO 2022/120354 PCT/US2021/072684 WO 2022/120354 PCT/US2021/072684 Ill-y or a pharmaceutically acceptable salt thereof, wherein each of R1, L1, Rw, Y, n, and R5 is as defined above and as described in embodiments herein, both singly and in combination. [00132]In some embodiments, the present invention provides a compound of Formulas: IV-a IV-b 36 WO 2022/120354 PCT/US2021/072684 IV-k IV-1 37 WO 2022/120354 PCT/US2021/072684 38 WO 2022/120354 PCT/US2021/072684 IV-y or a pharmaceutically acceptable salt thereof, wherein each of R1, L1, Rw, n, and R5 is as defined above and as described in embodiments herein, both singly and in combination. [00133]In some embodiments, the present invention provides a compound of Formulas: 39 WO 2022/120354 PCT/US2021/072684 V-m V-n V-0 , or a pharmaceutically acceptable salt thereof, wherein each of R1, Rw, L1, and R5 is as defined above and as described in embodiments herein, both singly and in combination. [00134]In some embodiments, the present invention provides a compound of Formulas: 40 WO 2022/120354 PCT/US2021/072684 41 WO 2022/120354 PCT/US2021/072684 or a pharmaceutically acceptable salt thereof, wherein each of R, R1, L1, Rw, and n is as defined above and as described in embodiments herein, both singly and in combination. [00135]In some embodiments, the present invention provides a compound of Formulas: 42 WO 2022/120354 PCT/US2021/072684 Vll-m or a pharmaceutically acceptable salt thereof, wherein each of R, R1, L1, Rw, and n is as defined above and as described in embodiments herein, both singly and in combination. [00136]In some embodiments, the present invention provides a compound of Formulas: VIII-b VIII-d R1 VUI-f VIII-g VIII-h or a pharmaceutically acceptable salt thereof, wherein each of R1, L1, Rw, and n is as defined above and as described in embodiments herein, both singly and in combination. [00137]In some embodiments, the present invention provides a compound of Formulas: 43 WO 2022/120354 PCT/US2021/072684 44 WO 2022/120354 PCT/US2021/072684 45 WO 2022/120354 PCT/US2021/072684 or a pharmaceutically acceptable salt thereof, wherein each of R1, L1, Rw, Y, m, n, and R5 is as defined above and as described in embodiments herein, both singly and in combination. [00138]In some embodiments, the present invention provides a compound of Formulas: X-h 46 WO 2022/120354 PCT/US2021/072684 47 WO 2022/120354 PCT/US2021/072684 X-u X-w X-x or a pharmaceutically acceptable salt thereof, wherein each of R1, L1, Rw, Y, n, and R5 is as defined above and as described in embodiments herein, both singly and in combination. [00139]In some embodiments, the present invention provides a compound of Formulas: 48 wo 2022/120354 PCTS2O21/O72684 49 WO 2022/120354 PCT/US2021/072684 50 WO 2022/120354 PCT/US2021/072684 or a pharmaceutically acceptable salt thereof, wherein each of R1, L1, Rw, n, and R5 is as defined above and as described in embodiments herein, both singly and in combination. [00140]In some embodiments, the present invention provides a compound of Formulas: XH-a XH-b XII-c 51 WO 2022/120354 PCT/US2021/072684 or a pharmaceutically acceptable salt thereof, wherein each of R1, L1, Rw, and R5 is as defined above and as described in embodiments herein, both singly and in combination. [00141]Without wishing to be bound by any specific theory, the compounds provided herein are capable of covalently binding to an amino acid residue (such as cysteine, lysine, histidine, or 52 WO 2022/120354 PCT/US2021/072684 other residues capable of being covalently modified) present in the binding pocket of a target protein, for example, TEAD, thereby irreversibly inhibiting the protein. In some embodiments, a warhead group is capable of covalently binding to cysteine. In some embodiments, a warhead group is capable of covalently binding to serine. In some embodiments, a warhead group is capable of covalently binding to lysine. In some embodiments, a warhead group is capable of covalently binding to Cys359 of hTEADl, Cys405 of hTEADl, Cys380 of hTEAD2, Cys368 of hTEAD3, and/or Cys367 of hTEAD4. In some embodiments, a warhead group is capable of covalently binding to Ser356 of hTEADl, Ser345 and/or Ser377 of hTEAD2, Ser365 of hTEAD3, and/or Ser364 of hTEAD4. In some embodiments, a warhead group is capable of covalently binding to Lys336 of hTEADl, Lys357 of hTEAD2, Lys345 of hTEAD3, and/or Lys344 of hTEAD4. Representative reference amino acid sequences of human TEAD1, human TEAD2, human TEAD3, and human TEAD4 include UniProt KB ID P28347-1 (SEQ ID NO: 1), UniProtKB ID Q15562 (SEQ ID NO: 2), UniProtKB ID Q99594 (SEQ ID NO: 3), and UniProtKB ID Q155(SEQ ID NO: 4), respectively. Below is the sequence alignments of TEAD coactivator binding domains, which is shown in Table 1 of "Targeting Transcriptional Enhanced Associate Domains (TEADs)," J. Med. Chem. 2018,61, 5057-5072, the entire content of which is incorporated herein by reference.SEQ IDNO: 5hTEADl 206WQGRSIG'nKLRlA'EFSAFLEQQRDPDSYNKHLF'VHIGHANHSYSDPLLESVDIRQlYDKFPEKKGGLKE275 SEQ IDNO: 6hTEAD2 218WQARGLGTARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDVRQIYDKFPEKKGGLRE 287 SEQ ID no : רhTEAD3 215WQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKE284 SEQ IDNO: 8hTEAD4 2,4WQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKD 283 SEQ IDNO: 5hTEADl 276LFGKGPQNAFFLVKFWADLNCN1Q-DDAGA............FYGVTSQYESSENMTVTCSTKVCSFGKQWEK336 SEQ IDNO: 6hTEAD2 288LYDRGPPHAFFLVKFWADLNWGPSGEEAGAGGSISSGGFYGVSSQYESLEHMTLTCSSKVCSFGKQWEK 357 SEQ IDNO: 7hTEAD3 285LYEKGPPNAFELVKFWADLNSTIQ-EGPGA............FYGVSSQYSSADSMTISVSTKVCSFGKQVVEK345 SEQ IDNO: 8hTEAD4 284LFERGPSNAFFLVKFWADLNTNIE-DEGSS™—-FYGVSSQYESPENMIITCSTKVCSFGKQVVEK344 SEQ IDNO: 5hTEADl 337VETEYARFENGRFVYRINRSPMCEYMINF'IHKLKHLPEKYMMNSVLENFTILLVVTNRDTQETLLCMACV 406 53 WO 2022/120354 PCT/US2021/072684 SEQ IDNO: 6hTEAD2 358VETERAQLEDGRFVYRLLRSPMCEYLVNFL.HKLRQLPERYMMNSX'LENFTILQVVTNRDTQELLLCTAYV427 SEQ ID no : רhTEAD3 346VETEYARLENGRFVYRIHRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTSRDSQETLLVIAFV 415 SEQ IDNO: 8hTEAD4 345VETEYARYE.NGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQEmLCIAYV 414 SEQ IDNO: 5hTEADl 40‘FEVSNSEHGAQHHTYRLVKD426 SEQ IDNO: 6hTEAD2 42SFEVSTSERGAQHHTYRLVRD447 SEQ ID no : רhTEAD3 "eevs ■ sehgaqhh vyklvkd !;' SEQ IDNO: 8hTEAD4 15FEVS ASEHGAQHHIYRL VKE43 id="p-142" id="p-142" id="p-142" id="p-142" id="p-142" id="p-142" id="p-142" id="p-142" id="p-142" id="p-142" id="p-142" id="p-142" id="p-142" id="p-142"
id="p-142"
[00142]Exemplary compounds of the invention are set forth in Table 1,below. Table 1: Exemplary Compounds 54 WO 2022/120354 PCT/US2021/072684 55 WO 2022/120354 PCT/US2021/072684 56 WO 2022/120354 PCT/US2021/072684 id="p-143" id="p-143" id="p-143" id="p-143" id="p-143" id="p-143" id="p-143" id="p-143" id="p-143" id="p-143" id="p-143" id="p-143" id="p-143" id="p-143"
id="p-143"
[00143]In some embodiments, the present invention provides a compound set forth in Table 1,above, or a pharmaceutically acceptable salt thereof. [00144]In some embodiments, a compound of the present invention is not a compound selected from: id="p-145" id="p-145" id="p-145" id="p-145" id="p-145" id="p-145" id="p-145" id="p-145" id="p-145" id="p-145" id="p-145" id="p-145" id="p-145" id="p-145"
id="p-145"
[00145]The compounds of this invention can be prepared or isolated in general by synthetic and/or semi-synthetic methods known to those skilled in the art for analogous compounds and by methods described in detail in the Examples, herein. In some embodiments, the present invention provides an intermediate compound described in the Examples, or a salt thereof. 4. Uses, Formulation and Administration: Pharmaceutically acceptable compositions [00146]According to another embodiment, the invention provides a pharmaceutical composition comprising a compound of this invention or a pharmaceutically acceptable derivative thereof and a pharmaceutically acceptable carrier, adjuvant, or vehicle. The amount of compound in compositions of this invention is such that is effective to measurably inhibit TEAD, or a variant or mutant thereof, in a biological sample or in a patient. In certain embodiments, the amount of compound in compositions of this invention is such that is effective to measurably inhibit TEAD, or a variant or mutant thereof, in a biological sample or in a patient. In certain embodiments, a composition of this invention is formulated for administration to a patient in need of such 57 WO 2022/120354 PCT/US2021/072684 composition. In some embodiments, a composition of this invention is formulated for oral administration to a patient. [00147]The terms "patient" or "subject " as used herein, means an animal, preferably a mammal, and most preferably a human. [00148]The term "pharmaceutically acceptable carrier, adjuvant, or vehicle " refers to a non- toxic carrier, adjuvant, or vehicle that does not destroy the pharmacological activity of the compound with which it is formulated. Pharmaceutically acceptable carriers, adjuvants or vehicles that may be used in the compositions of this invention include, but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, waxes, polyethylene- polyoxypropylene-block polymers, polyethylene glycol and wool fat. [00149]A "pharmaceutically acceptable derivative " means any non-toxic salt, ester, salt of an ester or other derivative of a compound of this invention that, upon administration to a recipient, is capable of providing, either directly or indirectly, a compound of this invention or an inhibitorily active metabolite or residue thereof. [00150]As used herein, the term "inhibitorily active metabolite or residue thereof' means that a metabolite or residue thereof is also an inhibitor of TEAD, or a variant or mutant thereof. [00151]Compositions of the present invention canbe administered orally, parenterally, by inhalation spray, topically, rectally, nasally, buccally, vaginally or via an implanted reservoir. The term "parenteral" as used herein includes subcutaneous, intravenous, intramuscular, intra-articular, intra-synovial, intrastemal, intrathecal, intrahepatic, intralesional and intracranial injection or infusion techniques. Preferably, the compositions are administered orally, intraperitoneally or intravenously. Sterile injectable forms of the compositions of this invention cancan be aqueous or oleaginous suspension. These suspensions cancan be formulated according to techniques known in the art using suitable dispersing or wetting agents and suspending agents. The sterile injectable preparation cancan also be a sterile injectable solution or suspension in a non-toxic parenterally acceptable diluent or solvent, for example as a solution in 1,3-butanedi 01. Among the acceptable 58 WO 2022/120354 PCT/US2021/072684 vehicles and solvents that can be employed are water, Ringer’s solution and isotonic sodium chloride solution. In addition, sterile, fixed oils are conventionally employed as a solvent or suspending medium. [00152]For this purpose, any bland fixed oil can be employed including synthetic mono- or di- glycerides. Fatty acids, such as oleic acid and its glyceride derivatives are useful in the preparation of injectables, as are natural pharmaceutically-acceptable oils, such as olive oil or castor oil, especially in their polyoxyethylated versions. These oil solutions or suspensions can also contain a long-chain alcohol diluent or dispersant, such as carboxymethyl cellulose or similar dispersing agents that are commonly used in the formulation of pharmaceutically acceptable dosage forms including emulsions and suspensions. Other commonly used surfactants, such as Tweens, Spans and other emulsifying agents or bioavailability enhancers which are commonly used in the manufacture of pharmaceutically acceptable solid, liquid, or other dosage forms can also be used for the purposes of formulation. [00153]Pharmaceutically acceptable compositions of this invention can be orally administered in any orally acceptable dosage form including, but not limited to, capsules, tablets, aqueous suspensions or solutions. In the case of tablets for oral use, carriers commonly used include lactose and com starch. Lubricating agents, such as magnesium stearate, are also typically added. For oral administration in a capsule form, useful diluents include lactose and dried cornstarch. When aqueous suspensions are required for oral use, the active ingredient is combined with emulsifying and suspending agents. If desired, certain sweetening, flavoring or coloring agents can also be added. [00154]Alternatively, pharmaceutically acceptable compositions of this invention can be administered in the form of suppositories for rectal administration. These can be prepared by mixing the agent with a suitable non-irritating excipient that is solid at room temperature but liquid at rectal temperature and therefore will melt in the rectum to release the dmg. Such materials include cocoa butter, beeswax and polyethylene glycols. [00155]Pharmaceutically acceptable compositions of this invention can also be administered topically, especially when the target of treatment includes areas or organs readily accessible by topical application, including diseases of the eye, the skin, or the lower intestinal tract. Suitable topical formulations are readily prepared for each of these areas or organs. 59 WO 2022/120354 PCT/US2021/072684 id="p-156" id="p-156" id="p-156" id="p-156" id="p-156" id="p-156" id="p-156" id="p-156" id="p-156" id="p-156" id="p-156" id="p-156" id="p-156" id="p-156"
id="p-156"
[00156]Topical application for the lower intestinal tract can be effected in a rectal suppository formulation (see above) or in a suitable enema formulation. Topically-transdermal patches can also be used. [00157]For topical applications, provided pharmaceutically acceptable compositions can be formulated in a suitable ointment containing the active component suspended or dissolved in one or more carriers. Carriers for topical administration of compounds of this invention include, but are not limited to, mineral oil, liquid petrolatum, white petrolatum, propylene glycol, polyoxyethylene, polyoxypropylene compound, emulsifying wax and water. Alternatively, provided pharmaceutically acceptable compositions can be formulated in a suitable lotion or cream containing the active components suspended or dissolved in one or more pharmaceutically acceptable carriers. Suitable carriers include, but are not limited to, mineral oil, sorbitan monostearate, polysorbate 60, cetyl esters wax, cetearyl alcohol, 2-octyldodecanol, benzyl alcohol and water. [00158]For ophthalmic use, provided pharmaceutically acceptable compositions can be formulated as micronized suspensions in isotonic, pH adjusted sterile saline, or, preferably, as solutions in isotonic, pH adjusted sterile saline, either with or without a preservative such as benzylalkonium chloride. Alternatively, for ophthalmic uses, the pharmaceutically acceptable compositions can be formulated in an ointment such as petrolatum. [00159]Pharmaceutically acceptable compositions of this invention can also be administered by nasal aerosol or inhalation. Such compositions are prepared according to techniques well- known in the art of pharmaceutical formulation and can be prepared as solutions in saline, employing benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, fluorocarbons, and/or other conventional solubilizing or dispersing agents. [00160]Most preferably, pharmaceutically acceptable compositions of this invention are formulated for oral administration. Such formulations can be administered with or without food. In some embodiments, pharmaceutically acceptable compositions of this invention are administered without food. In other embodiments, pharmaceutically acceptable compositions of this invention are administered with food. [00161]The amount of compounds of the present invention that can be combined with the carrier materials to produce a composition in a single dosage form varies depending upon the host treated, the particular mode of administration. Preferably, provided compositions should be 60 WO 2022/120354 PCT/US2021/072684 formulated so that a dosage of between 0.01 -100 mg/kg body weight/day of the inhibitor can be administered to a patient receiving these compositions. [00162]It should also be understood that a specific dosage and treatment regimen for any particular patient depends upon a variety of factors, including the activity of the specific compound employed, the age, body weight, general health, sex, diet, time of administration, rate of excretion, drug combination, and the judgment of the treating physician and the severity of the particular disease being treated. The amount of a compound of the present invention in the composition also depends upon the particular compound in the composition.
Uses of Compounds and Pharmaceutically Acceptable Compositions The Hippo Signaling Network [00163]The Hippo signaling network (also known as the Salvador/Warts/Hippo (SWH) pathway) is a master regulator of cell proliferation, death, and differentiation. In some embodiments, the main function of the Hippo signaling pathway is to regulate negatively the transcriptional co-activators Yes-associated protein (YAP) and its paralogue, the transcriptional co-activator with PDZ-binding motif (TAZ; also known as WWTR1). The Hippo kinase cascade phosphorylates and inhibits YAP/TAZ by promoting its cytoplasmic retention and degradation, thereby inhibiting the growth promoting function regulated under the YAP/TAZ control. In an un- phosphorylated/de-phosphorylated state, YAP, also known as YAP1 or YAP65, together with TAZ, are transported into the nucleus where they interact with TEAD family of transcription factors to upregulate genes that promote proliferation and migration, and inhibit apoptosis. In some instances, unregulated upregulation of these genes involved in proliferation, migration, and anti- apoptosis leads to development of cancer. In some instances, overexpression of YAP/TAZ is associated with cancer. [00164]Additional core members of the Hippo signaling pathway comprise the serine/threonine kinases MST1/2 (homologues of Hippo/Hpo in Drosophila), Latsl/2 (homologues of Warts/Wts), and their adaptor proteins Savl (homologue of Salvador/Sav) and Mob (MOBKL1A and MOBKL1B; homologues of Mats), respectively. In general, MST1/2 kinase complexes with the scaffold protein Savl, which in turn phosphorylates and activates Latsl/2 kinase. Latsl/2 is also activated by the scaffold protein Mob. The activated Latsl/2 then phosphorylates and inactivates 61 WO 2022/120354 PCT/US2021/072684 YAP or its paralog TAZ. The phosphorylation of YAP/TAZ leads to their nuclear export, retention within the cytoplasm, and degradation by the ubiquitin proteasome system. [00165]In some instances, Latsl/2 phosphorylates YAP at the [HXRXXS] (SEQ ID NO: 9) consensus motifs. YAP comprises five [HXRXXS] (SEQ ID NO: 9) consensus motifs, wherein X denotes any amino acid residue. In some instances, Latsl/2 phosphorylates YAP at one or more of the consensus motifs. In some instances, Latsl/2 phosphorylates YAP at all five of the consensus motifs. In some instances, Latsl/2 phosphorylate at the S127 amino acid position. The phosphorylation of YAP SI27 promotes 14-3-3 protein binding and results in cytoplasmic sequestration of YAP. Mutation of YAP at the S127 position thereby disrupts its interaction with 14-3-3 and subsequently promotes nuclear translocation. [00166]Additional phosphorylation occurs at the S381 amino acid position in YAP. Phosphorylation of YAP at the S381 position and on the corresponding site in TAZ primes both proteins for further phosphorylation events by CK18/8 in the degradation motif, which then signals for interaction with the B-TRCP E3 ubiquitin ligase, leading to polyubiquitination and degradation of YAP. [00167]In some instances, Latsl/2 phosphorylates TAZ at the [HXRXXS] (SEQ ID NO: 9) consensus motifs. TAZ comprises four [HXRXXS] (SEQ ID NO: 9) consensus motifs, wherein X denotes any amino acid residues. In some instances, Latsl/2 phosphorylates TAZ at one or more of the consensus motifs. In some instances, Latsl/2 phosphorylates TAZ at all four of the consensus motifs. In some instances, Latsl/2 phosphorylate at the S89 amino acid position. The phosphorylation of TAZ S89 promotes 14-3-3 protein binding and results in cytoplasmic sequestration of TAZ. Mutation of TAZ at the S89 position thereby disrupts its interaction with 14-3-3 and subsequently promotes nuclear translocation. [00168]In some embodiments, phosphorylated YAP/TAZ accumulates in the cytoplasm, and undergoes SCFp_TRCP-mediated ubiquitination and subsequent proteasomal degradation. In some instances, the Skp, Cullin, F-box containing complex (SCF complex) is a multi-protein Eubiquitin ligase complex that comprises a F-box family member protein (e.g., Cdc4), Skpl, a bridging protein, and RBX1, which contains a small RING Finger domain which interacts with E-ubiquitin conjugating enzyme. In some cases, the F-box family comprises more than 40 members, in which exemplary members include F-box/WD repeat-containing protein 1A (FBXW1A, BTrCP1, Fbxwl, hsSlimb, plkappaBalpha-E3 receptor subunit) and S-phase kinase-associated 62 WO 2022/120354 PCT/US2021/072684 proteins 2 (SKP2). In some embodiments, the SCF complex (e.g., SCFpTrCP1) interacts with an El ubiquitin-activating enzyme and an E2 ubiquitin-conjugating enzyme to catalyze the transfer of ubiquitin to the YAP/TAZ substrate. Exemplary El ubiquitin-activating enzymes include those encoded by the following genes: UBA1, UBA2, UBA3, UBAS, UBAS, UBA7, ATG7, NAE1, and SAE1. Exemplary E2 ubiquitin-conjugating enzymes include those encoded by the following genes: UBE2A, UBE2B, UBE2C, UBE2DI, UBE2D2, UBE2D3, UBE2E1, UBE2E2, UBE2E3, UBE2F, UBE2GI, UBE2G2, UBE2H, UBE2I, UBE2J1, UBE2J2, UBE2K, UBE2L3, UBE2L6, UBE2M, UBE2N, UBE20, UBE2Q1, UBE2Q2, UBE2R1, UBE2R2, UBE2S, UBE2T, UBE2U, UBE2V1, UBE2V2, UBE2Z, ATG2, BIRC5, and UFC1. In some embodiments, the ubiquitinated YAP/TAZ further undergoes the degradation process through the 26S proteasome. [00169]In some embodiments, the Hippo pathway is regulated upstream by several different families of regulators. In some instances, the Hippo pathway is regulated by the G-protein and its coupled receptors, the Crumbs complex, regulators upstream of the MST kinases, and the adherens junction. YAP/TAZ Interaction with TEAD [00170]In some embodiments, un-phosphorylated and/or dephosphorylated YAP/TAZ accumulates in the nucleus. Within the nucleus, YAP/TAZ interacts with the TEAD family of transcription factors (e.g., human TEAD1 (UniProt KB ID P28347-1 (SEQ ID NO: 1)), human TEAD2 (UniProtKB ID Q15562 (SEQ ID NO: 2)), human TEAD3 (UniProtKB ID Q99594 (SEQ ID NO: 3)), and human TEAD4 (UniProtKB ID Q15561 (SEQ ID NO: 4)) to activate genes involved in anti-apoptosis and proliferation, such as, for example, CTFG, Cyr61, and FGF1. [00171]Proteomic and biochemical studies have shown that the TEAD (TEA Domain) transcription factors are palmitoylated at evolutionarily conserved cysteine residues. Three cysteine residues were found that are evolutionarily conserved and mutated to serine in human TEAD1 (C53S, C327S and C359S) to test whether the mutation affects TEAD1 palmitoylation. The C359S mutant showed the greatest loss of palmitoylation, and C327S and C53S also showed decreased palmitoylation. These results suggest that C359 plays a critical role in TEADpalmitoylation. Furthermore, combination mutation of all three cysteine residues, C53/327/359S (3CS), completely ablated TEAD1 palmitoylation, indicating that these residues are involved in TEAD1 palmitoylation. It has been found that TEADs undergo PAT-independent autopalmitoylation, under physiological concentrations of palmitoy 1-C0A. Furthermore, 63 WO 2022/120354 PCT/US2021/072684 autopalmitoylation plays critical roles in regulating TEAD-YAP association and their physiological functions in vitro and in vivo. Chan, et al. Nature Chem. Biol. 12, pages 282-2(2016); Noland, et al. Structure, 24, 1-8 (2016); Gibault et al. J. Med. Chem. 61, 5057-50(2018). Therefore, palmitoylation of TEADs play important roles in regulating Hippo pathway transcriptional complexes. [00172]In some embodiments, the compounds disclosed herein modulate the interaction between YAP/TAZ and TEAD. In some embodiments, the compounds disclosed herein bind to TEAD, YAP, or TAZ and prevent the interaction between YAP/TAZ and TEAD. [00173]In some embodiments, the compounds described herein irreversibly inhibit a TEAD transcription factor. In some embodiments, the transcription factor is TEAD1. In some embodiments, the transcription factor is TEAD2. In some embodiments, the transcription factor is TEAD3. In some embodiments, the transcription factor is TEAD4. In some embodiments, the compounds described herein covalently bind to the TEAD transcription factor (e.g., TEAD1, TEAD2, TEAD3, or TEAD4). In some embodiments, the compounds described herein irreversibly inhibit the activity of a TEAD transcription factor (e.g., TEAD1, TEAD2, TEAD3, or TEAD4). In some embodiments, the compounds described herein covalently inhibit the activity of a TEAD transcription factor (e.g., TEAD1, TEAD2, TEAD3, and/or TEAD4). [00174]In some embodiments, the compounds disclosed herein bind to TEAD1 and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEAD2 and disrupt or inhibit the interaction between YAP and TEAD2. In some embodiments, the compounds disclosed herein bind to TEAD3 and disrupt or inhibit the interaction between YAP and TEAD3. In some embodiments, the compounds disclosed herein bind to TEAD4 and disrupt or inhibit the interaction between YAP and TEAD4. [00175]In some embodiments, the compounds disclosed herein bind to TEAD1 and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEAD1 at C359, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEAD1 at C53, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEAD1 at C327, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEAD1 at C405, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed 64 WO 2022/120354 PCT/US2021/072684 herein bind to TEADI at C359 and C327, and disrupt or inhibit the interaction between YAP and TEADI. In some embodiments, the compounds disclosed herein bind to TEAD1 at C359 and C53, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEADI at C53 and C327, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEADI at C359 and C405, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEADI at C53 and C405, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEADI at C327 and C405, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEADI at C359, C327, and C53, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEADI at C359, C327, and C405, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEADI at C359, C353, and C405, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEADI at C327, C53, and C405, and disrupt or inhibit the interaction between YAP and TEADI. In some embodiments, the compounds disclosed herein bind to TEADI at C359, C327, C53, and C405, and disrupt or inhibit the interaction between YAP and TEADI. [00176]In some embodiments, the compounds disclosed herein bind to TEAD, prevent TEAD palmitoylation, and disrupt or inhibit the interaction between YAP and TEAD. In some embodiments, the compounds disclosed herein bind to TEADI and prevent TEADI palmitoylation. In some embodiments, the compounds disclosed herein bind to TEADI and prevent TEADI palmitoylation at C359. In some embodiments, the compounds disclosed herein bind to TEADI and prevent TEADI palmitoylation at C53. In some embodiments, the compounds disclosed herein bind to TEADI and prevent TEADI palmitoylation at C327. In some embodiments, the compounds disclosed herein bind to TEADI and prevent TEADI palmitoylation at C405. In some embodiments, the compounds disclosed herein bind to TEADI and prevent TEADI palmitoylation at C359 and C327. In some embodiments, the compounds disclosed herein bind to TEADI and prevent TEADI palmitoylation at C359 and C53. In some embodiments, the compounds disclosed herein bind to TEADI and prevent TEADI palmitoylation at C53 and C327. In some embodiments, the compounds disclosed herein bind to TEADI and prevent TEADI 65 WO 2022/120354 PCT/US2021/072684 palmitoylation at C359 and C405. In some embodiments, the compounds disclosed herein bind to TEAD1 and prevent TEAD1 palmitoylation at C53 and C405. In some embodiments, the compounds disclosed herein bind to TEAD1 and prevent TEAD1 palmitoylation at C327 and C405. In some embodiments, the compounds disclosed herein bind to TEAD1 and prevent TEADpalmitoylation at C359, C327, and C53. In some embodiments, the compounds disclosed herein bind to TEAD1 and prevent TEAD1 palmitoylation at C359, C327, and C405. In some embodiments, the compounds disclosed herein bind to TEAD1 and prevent TEAD1 palmitoylation at C359, C353, and C405. In some embodiments, the compounds disclosed herein bind to TEADand prevent TEAD1 palmitoylation at C327, C53, and C405. In some embodiments, the compounds disclosed herein bind to TEAD1 and prevent TEAD1 palmitoylation at C359, C327, C53, and C405. [00177]In some embodiments, the compounds disclosed herein bind to TEAD1, prevent TEAD1 palmitoylation, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEAD1 and prevent TEAD1 palmitoylation at C359, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEAD1 and prevent TEAD1 palmitoylation at C53, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEAD1 and prevent TEAD1 palmitoylation at C327, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEAD1 and prevent TEAD1 palmitoylation at C405, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEAD1 and prevent TEAD1 palmitoylation at C359 and C327, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEAD1 and prevent TEAD1 palmitoylation at C359 and C53, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEAD1 and prevent TEAD1 palmitoylation at C53 and C327, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEAD1 and prevent TEAD1 palmitoylation at C359 and C405, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEAD1 and prevent TEAD1 palmitoylation at C53 and C405, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein 66 WO 2022/120354 PCT/US2021/072684 bind to TEAD1 and prevent TEAD1 palmitoylation at C327 and C405, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEAD1 and prevent TEAD1 palmitoylation at C359, C327, and C53, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEAD1 and prevent TEAD1 palmitoylation at C359, C327, and C405, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEAD1 and prevent TEAD1 palmitoylation at C359, C353, and C405, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEAD1 and prevent TEAD1 palmitoylation at C327, C53, and C405, and disrupt or inhibit the interaction between YAP and TEAD1. In some embodiments, the compounds disclosed herein bind to TEAD1 and prevent TEAD1 palmitoylation at C359, C327, C53, and C405, and disrupt or inhibit the interaction between YAP and TEAD1. [00178]In some embodiments, the compounds disclosed herein bind to TEAD2 at C380, and disrupt or inhibit the interaction between YAP and TEAD2. [00179]In some embodiments, the compounds disclosed herein bind to TEAD2 and prevent TEAD2 palmitoylation. In some embodiments, the compounds disclosed herein bind to TEADand prevent TEAD2 palmitoylation at C380. [00180]In some embodiments, the compounds disclosed herein bind to TEAD2, prevent TEAD2 palmitoylation, and disrupt or inhibit the interaction between YAP and TEAD2. In some embodiments, the compounds disclosed herein bind to TEAD2 and prevent TEAD2 palmitoylation at C380, and disrupt or inhibit the interaction between YAP and TEAD2. [00181]In some embodiments, the compounds disclosed herein bind to TEAD3 at C371, and disrupt or inhibit the interaction between YAP and TEAD3. In some embodiments, the compounds disclosed herein bind to TEAD3 at C368, and disrupt or inhibit the interaction between YAP and TEAD3. In some embodiments, the compounds disclosed herein bind to TEAD3 at C371 and C368, and disrupt or inhibit the interaction between YAP and TEAD3. [00182]In some embodiments, the compounds disclosed herein bind to TEAD3 and prevent TEAD3 palmitoylation. In some embodiments, the compounds disclosed herein bind to TEADand prevent TEAD3 palmitoylation at C371. In some embodiments, the compounds disclosed herein bind to TEAD3 and prevent TEAD3 palmitoylation at C368. In some embodiments, the WO 2022/120354 PCT/US2021/072684 compounds disclosed herein bind to TEAD3 and prevent TEAD3 palmitoylation at C368 and C371. [00183]In some embodiments, the compounds disclosed herein bind to TEAD3, prevent TEAD3 palmitoylation, and disrupt or inhibit the interaction between YAP and TEAD3. In some embodiments, the compounds disclosed herein bind to TEAD3 and prevent TEAD3 palmitoylation at C371, and disrupt or inhibit the interaction between YAP and TEAD3. In some embodiments, the compounds disclosed herein bind to TEAD3 and prevent TEAD3 palmitoylation at C368, and disrupt or inhibit the interaction between YAP and TEAD3. In some embodiments, the compounds disclosed herein bind to TEAD3 and prevent TEAD3 palmitoylation at C371 and C368, and disrupt or inhibit the interaction between YAP and TEAD3. [00184]In some embodiments, the compounds disclosed herein bind to TEAD4 at C367, and disrupt or inhibit the interaction between YAP and TEAD4. [00185]In some embodiments, the compounds disclosed herein bind to TEAD4 and prevent TEAD4 palmitoylation. In some embodiments, the compounds disclosed herein bind to TEAD4and prevent TEAD4 palmitoylation at C367. [00186]In some embodiments, the compounds disclosed herein bind to TEAD4, prevent TEAD4 palmitoylation, and disrupt or inhibit the interaction between YAP and TEAD4. In some embodiments, the compounds disclosed herein bind to TEAD4 and prevent TEAD4 palmitoylation at C367, and disrupt or inhibit the interaction between YAP and TEAD4.
YAP/TAZ regulation mediated by G-proteins/GPCRs [00187]In some embodiments, the Hippo pathway is regulated by the G protein-coupled receptor (GPCR) and G protein (also known as guanine nucleotide-binding proteins) family of proteins. G proteins are molecular switches that transmit extracellular stimuli into the cell through GPCRs. In some instances, there are two classes of G proteins: monomeric small GTPases and heterotrimeric G protein complexes. In some instances, the latter class of complexes comprise of alpha (Ga), beta (Gp), and gamma (G7) subunits. In some cases, there are several classes of Ga subunits: Gq/1!a, G12/13a, Gi/Oa (G inhibitory, G other), and Gsa (G stimulatory). [00188]In some instances, Gia (G inhibitory), Go a (G other), Gq/lla, and G12/13a coupled GPCRs activate YAP/TAZ and promote nuclear translocation. In other instances, Gsa (G stimulatory) coupled GPCRs suppress YAP/TAZ activity, leading to YAP/TAZ degradation. 68 WO 2022/120354 PCT/US2021/072684 id="p-189" id="p-189" id="p-189" id="p-189" id="p-189" id="p-189" id="p-189" id="p-189" id="p-189" id="p-189" id="p-189" id="p-189" id="p-189" id="p-189"
id="p-189"
[00189]In some cases, G!a (G inhibitory), Go a (G other), Gq/1!a, and G12/13a coupled GPCRs activate YAP/TAZ through repression of Latsl/2 activities. In contrast, Gsa, in some embodiments, induces Latsl/2 activity, thereby promoting YAP/TAZ degradation.GaFamily [00190]Gqa (also known as Gq/u protein), participates in the inositol trisphosphate (IP3) signal transduction pathway and calcium (Ca2+) release from intracellular storage through the activation of phospholipase C (PLC). The activated PLC hydrolyzes phosphatidylinositol 4,5-bisphosphate (PIP2) to diacyl glycerol (DAG) and IP3. In some instances, IP3 then diffuses through the cytoplasm into the ER or the sarcoplasmic reticulum (SR) in the case of muscle cells, and then binds to inositol trisphosphate receptor (InsP3R), which is a Ca2+ channel. In some cases, the binding triggers the opening of the Ca2+ channel, and thereby increases the release of Ca2+ into the cytoplasm. [00191]In some embodiments, the GPCRs that interact with Gqa include, but are not limited to, 5-hydroxytryptamine receptor (5-HT receptor) types 5-HT2 and 5-HT3; alpha-1 adrenergic receptor; vasopressin type 1 receptors 1A and IB; angiotensin II receptor type 1; calcitonin receptor; histamine Hl receptor; metabotropic glutamate receptor, group I; muscarinic receptors Mi, M3, and M5; and trace amine-associated receptor 1. [00192]In some instances, there are several types of Gqa: Gq, Gq/u, Gq/14, and Gq/15. The Gq protein is encoded by GNAQ. Gq/n is encoded by GNA11. Gq/14 is encoded by GNA14. Gq/15 is encoded by GNA15. [00193]In some instances, mutations or modifications of the Gqa genes have been associated with cancer. Indeed, studies have shown that mutations in Gqa promote uveal melanoma (UM) tumorigenesis. In some instances, about 80% of UM cases have been detected to contain a mutation in GNAQ and/or GNA11. [00194]In some instances, mutations or modifications of the Gqa genes have been associated with congenital diseases. In some instances, mutations of Gqa have been observed in congenital diseases such as Port-Wine Stain and/or Sturge-Weber Syndrome. In some instances, about 92% of Port-Wine stain cases harbors a mutation in GNAQ. In some instances, about 88% of Sturge- Weber Syndrome harbors a mutation in GNAQ.
G12/13 Family 69 WO 2022/120354 PCT/US2021/072684 id="p-195" id="p-195" id="p-195" id="p-195" id="p-195" id="p-195" id="p-195" id="p-195" id="p-195" id="p-195" id="p-195" id="p-195" id="p-195" id="p-195"
id="p-195"
[00195] G12/13a modulates actin cytoskeletal remodeling in cells and regulates cell processesthrough guanine nucleotide exchange factors (GEFs). GEFs participate in the activation of small GTPases which acts as molecular switches in a variety of intracellular signaling pathways. Examples of small GTPases include the Ras-related GTPase superfamily (e.g., Rho family such as Cdc42), which is involved in cell differentiation, proliferation, cytoskeletal organization, vesicle trafficking, and nuclear transport. [00196]In some embodiments, the GPCRs that interact with G12/13a include, but are not limited to, purinergic receptors (e.g., P2Y1, P2Y2, P2Y4, P2Y6); muscarinic acetylcholine receptors Ml and M3; receptors for thrombin [protease-activated receptor (PAR)-l, PAR-2]; thromboxane (TXA2); sphingosine 1-phosphate (e.g., S1P2, S1P3, S1P4 and S1P5); lysophosphatidic acid (e.g., LPA1, LPA2, LPA3); angiotensin II (ATI); serotonin (5-HT2c and 5-HT4); somatostatin (sst5); endothelin (ETA and ETB); cholecystokinin (CCK!); Via vasopressin receptors; D5 dopamine receptors; fMLP formyl peptide receptors; GAL2 galanin receptors; EP3 prostanoid receptors; A! adenosine receptors; a! adrenergic receptors; BB2 bombesin receptors; B2 bradykinin receptors; calcium-sensing receptors; KSHV-ORF74 chemokine receptors; NK! tachykinin receptors; and thyroid-stimulating hormone (TSH) receptors. [00197]In some instances, G12/13a is further subdivided into G12 and G13 types which are encoded by GNA12 and GNA13, respectively.Gi/o Family [00198]Gi/Oa (G inhibitory, G other) (also known as Gi/G0 or G! protein) suppresses the production of 3’, 5’-cyclic AMP (cAMP) from adenosine triphosphate (ATP) through an inhibition of adenylate cyclase activity, which converts ATP to cAMP. [00199]In some embodiments, the GPCRs that interact with Gia include, but are not limited to, 5-hydroxytryptamine receptor (5-HT receptor) types 5-HT! and 5-HT5; muscarinic acetylcholine receptors such as M2 and M4; adenosine receptors such as A! and A3; adrenergic receptors such as A2A, A2B, and a2c ; apelin receptors; calcium-sensing receptor; cannabinoid receptors CB1and CB2; chemokine CXCR4 receptor; dopamines D2, D3, and D4; GABAB receptor; glutamate receptors such as metabotropic glutamate receptor 2 (mGluR2), metabotropic glutamate receptor (mGluR3), metabotropic glutamate receptor 4 (mGluR4), metabotropic glutamate receptor (mGluR6), metabotropic glutamate receptor 7 (mGluR7), and metabotropic glutamate receptor (mGluR8); histamine receptors such as H3 and H4 receptors; melatonin receptors such as melatonin 70 WO 2022/120354 PCT/US2021/072684 receptor type 1 (MT1), melatonin receptor type 2 (MT2), and melatonin receptor type 3 (MT3); niacin receptors such as NIACR1 and NIACR2; opioid receptors such as 5, k, p, and nociceptin receptors; prostaglandin receptors such as prostaglandin E receptor 1 (EP1), prostaglandin E receptor 3 (EP3), prostaglandin F receptor (FP), and thromboxane receptor (TP); somatostatin receptors ssti, sst2, sst3, sst4, and sst5; and trace amine-associated receptor 8. [00200]In some instances, there are several types of Ga: G!al, G!a2, G!a3, G!a4, Go a, Gt, Ggust, and Gz. Gal is encoded by GNAI1. G!a2 is encoded by GNAI2. G!a3 is encoded by GNAI3. Go a, the 010 subunit, is encoded by GNA01. Gt is encoded by GNAT1 and GNAT2. Ggust is encoded by GNAT3. Gz is encoded by GNAZ.Gs Family [00201]Gsa (also known as G stimulatory, Gs alpha subunit, or Gs protein) activates the cAMP- dependent pathway through the activation of adenylate cyclase, which convers adenosine triphosphate (ATP) to 3’,5’-cyclic AMP (cAMP) and pyrophosphate. In some embodiments, the GPCRs that interact with Gsa include, but are not limited to, 5-hydroxytryptamine receptor (5-HT receptor) types 5-HT4, 5-HT6, and 5-HT?; adrenocorticotropic hormone receptor (ACTH receptor) (also known as melanocortin receptor 2 or MC2R); adenosine receptor types A2a and A2b; arginine vasopressin receptor 2 (AVPR2); B-adrenergic receptors Pi, P2, and P3; calcitonin receptor; calcitonin gene-related peptide receptor; corticotropin-releasing hormone receptor; dopamine receptor DI-like family receptors such as D! and D5; follicle-stimulating hormone receptor (FSH- receptor); gastric inhibitory polypeptide receptor; glucagon receptor; histamine H2 receptor; luteinizing hormone/choriogonadotropin receptor; melanocortin receptors such as MC1R, MC2R, MC3R, MC4R, and MC5R; parathyroid hormone receptor 1; prostaglandin receptor types D2 and 12; secretin receptor; thyrotropin receptor; trace amine-associated receptor 1; and box jellyfish opsin.[00202] In some instances, there are two types of Gsa: Gs and G01f. Gs is encoded by GNAS. Goif is encoded by GN AL. Additional Regulators of the Hippo signaling network [00203]In some embodiments, the additional regulator of the Hippo signaling pathway is the Crumbs (Crb) complex. The Crumbs complex is a key regulator of cell polarity and cell shape. In some instances, the Crumbs complex comprises transmembrane CRB proteins which assemble multi-protein complexes that function in cell polarity. In some instances, CRB complexes recruit 71 WO 2022/120354 PCT/US2021/072684 members of the Angiomotin (AMOT) family of adaptor proteins that interact with the Hippo pathway components. In some instances, studies have shown that AMOT directly binds to YAP, promotes YAP phosphorylation, and inhibits its nuclear localization. [00204]In some instances, the additional regulator of the Hippo signaling pathway comprises regulators of the MST kinase family. MST kinases monitor actin cytoskeletal integrity. In some instances, the regulators include TAO kinases and cell polarity kinase PAR-1. [00205]In some instances, the additional regulator of the Hippo signaling pathway comprises molecules of the adherens junction. In some instances, E-Cadherin (E-cad) suppresses YAP nuclear localization and activity through regulating MST activity. In some embodiments, E-cad- associated protein a-catenin regulates YAP through sequestering YAP/14-3-3 complexes in the cytoplasm. In other instances, Ajuba protein family members interact with Latsl/2 kinase activity, thereby preventing inactivation of YAP/TAZ. [00206]In some embodiments, additional proteins that interact with YAP/TAZ either directly or indirectly include, but are not limited to, Merlin, protocadherin Fat 1, MASK1/2, HIPK2, PTPN14, RASSF, PP2A, Salt-inducible kinases (SIKs), Scribble (SCRIB), the Scribble associated proteins Discs large (Dig), KIBRA, PTPN14, NPHP3, LKB1, Ajuba, and ZO1/2. [00207]In some embodiments, the compounds described herein are inhibitors of transcriptional coactivator with PDZ binding motif/Yes-associated protein transcriptional coactivator (TAZ/YAP). In some embodiments, the compounds described herein increase the phosphorylation of transcriptional coactivator with PDZ binding motif/Yes-associated protein transcriptional coactivator (TAZ/YAP) or decrease the dephosphorylation of transcriptional coactivator with PDZ binding motif/Yes-associated protein transcriptional coactivator (TAZ/YAP). In some embodiments, the compounds increase the ubiquitination of transcriptional coactivator with PDZ binding motif/Yes-associated protein transcriptional coactivator (TAZ/YAP) or decrease the deubiquitination of transcriptional coactivator with PDZ binding motif/Yes-associated protein transcriptional coactivator (TAZ/YAP). [00208]In some embodiments, the compounds disclosed herein are inhibitors of one or more of the proteins encompassed by, or related to, the Hippo pathway. In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of a G-protein and/or its coupled GPCR. In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of a G-protein. In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of the Gqa family proteins such as 72 WO 2022/120354 PCT/US2021/072684 Gq, Gq/u, Gq/14, and Gq/15; the G12/13a family of proteins such as G12 and G13; or the G!a family of proteins such as G!al, G!a2, G!a3, G!a4, Go a, Gt, Ggust, and Gz. In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of Gq. In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of Gq/u. In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of Gq/14. In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of Gq/15. In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of G12. In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of G13. In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of Gjal . In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of G!a2. In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of G!a3. In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of G!a4. In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of Go a. In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of Gt. In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of Ggust. In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of Gz. [00209]In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of a core protein of the Hippo pathway. In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of Savl . In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of Mob. In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of YAP. In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of TAZ. In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of TEAD. [00210]In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of a protein associated with the ubiquitination and proteasomal degradation pathway. In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of a proteasomal degradation pathway protein (e.g., 26S proteasome). [00211]In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of a protein of the Ras superfamily of proteins. In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of a protein of the Rho family of proteins. In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of Cdc42. [00212]Cdc42 is a member of the Ras superfamily of small GTPases. Specifically, Cdcbelongs to the Rho family of GTPases, in which the family members participate in diverse and critical cellular processes such as gene transcription, cell-cell adhesion, and cell cycle progression. 73 WO 2022/120354 PCT/US2021/072684 Cdc42 is involved in cell growth and polarity, and in some instances, Cdc42 is activated by guanine nucleotide exchange factors (GEFs). In some cases, an inhibitor of Cdc42 is a compound disclosed herein. [00213]In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of a deubiquitinating enzyme. In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of a cysteine protease or a metalloprotease. In some embodiments, an inhibitor of the Hippo pathway is an inhibitor of an ubiquitin-specific protease. USP47 is a member of the ubiquitin-specific protease (USP/UBP) superfamily of cysteine proteases. In some embodiments, the compounds disclosed herein are inhibitors of USP47. [00214]In some embodiments, the present invention provides a use of a compound, or a pharmaceutical salt or composition thereof, for treating one or more disorders, diseases, and/or conditions wherein the disorder, disease, or condition includes, but is not limited to, a cellular proliferative disorder. [00215]The activity of a compound utilized in this invention as an inhibitor of TEAD (e.g., TEAD1, TEAD2, TEAD3, and/or TEAD4), or a variant or mutant thereof, can be assayed in vitro, in vivo or in a cell line. In vitro assays include assays that determine inhibition of TEAD (e.g., TEAD1, TEAD2, TEAD3, and/or TEAD4), or a variant or mutant thereof. Alternate in vitro assays quantitate the ability of the inhibitor to bind to TEAD (e.g., TEAD1, TEAD2, TEAD3, and/or TEAD4) or a variant or mutant thereof. Detailed conditions for assaying a compound utilized in this invention as an inhibitor of TEAD (e.g., TEAD1, TEAD2, TEAD3, and/or TEAD4), or a variant or mutant thereof, are set forth in the Examples below. See, for example, Examples and 5. [00216]As used herein, the terms "treatment, " "treat," and "treating" refer to reversing, alleviating, delaying the onset of, or inhibiting the progress of a disease or disorder, or one or more symptoms thereof, as described herein. In some embodiments, treatment can be administered after one or more symptoms have developed. In other embodiments, treatment can be administered in the absence of symptoms. For example, treatment can be administered to a susceptible individual prior to the onset of symptoms (e.g., in light of a history of symptoms and/or in light of genetic or other susceptibility factors). Treatment can also be continued after symptoms have resolved, for example, to prevent or delay their recurrence. 74 WO 2022/120354 PCT/US2021/072684 id="p-217" id="p-217" id="p-217" id="p-217" id="p-217" id="p-217" id="p-217" id="p-217" id="p-217" id="p-217" id="p-217" id="p-217" id="p-217" id="p-217"
id="p-217"
[00217]The provided compounds are inhibitors of TEAD (e.g., TEAD1, TEAD2, TEAD3, and/or TEAD4) and are therefore useful for treating one or more disorders associated with activity of TEAD (e.g., TEAD1, TEAD2, TEAD3, and/or TEAD4). Thus, in certain aspects and embodiments, the present invention provides a method for treating a TEAD-mediated disorder comprising the step of administering to a patient in need thereof a therapeutically effective compound of the present invention, or pharmaceutically acceptable composition thereof. [00218]As used herein, the term "TEAD-mediated " disorders, diseases, and/or conditions as used herein means any disease or other deleterious condition in which TEAD (e.g., TEAD1, TEAD2, TEAD3, and/or TEAD4), or a variant or mutant thereof, is known to play a role. Accordingly, another aspect or embodiment of the present invention relates to treating or lessening the severity of one or more diseases in which TEAD (e.g., TEAD1, TEAD2, TEAD3, and/or TEAD4), or a variant or mutant thereof, are known to play a role. [00219]As used herein, the term "a therapeutically effective amount of ’ refers to the amount of a TEAD inhibitor or a pharmaceutically acceptable salt thereof, which is effective to reduce or attenuate the biological activity of TEAD (e.g., TEAD1, TEAD2, TEAD3, and/or TEAD4) or a variant or mutant thereof, provide a therapeutic benefit in the treatment of a condition, or to delay or minimize one or more symptoms associated with the condition in a biological sample or in a patient. In some embodiments, "a therapeutically effective amount of ’ refers to the amount of a TEAD inhibitor or a pharmaceutically acceptable salt thereof that measurably decreases the binding or signaling activity of TEAD (e.g., TEAD1, TEAD2, TEAD3, and/or TEAD4), or a variant or mutant thereof or any TEAD-mediated activity. The term "therapeutically effective amount " can encompass, in some embodiments, an amount that improves overall therapy, reduces or avoids symptoms, signs, or causes of the condition, and/or enhances the therapeutic efficacy of another therapeutic agent. In certain embodiments, a therapeutically effective amount is an amount sufficient for inhibition of a TEAD transcription factor. In certain embodiments, a therapeutically effective amount is an amount sufficient for treating a proliferative disease. [00220]In some aspects and embodiments, provided herein are methods of treating, reducing the severity of, delaying the onset of, or inhibiting the progress of a disease or disorder, or one or more symptoms thereof of a disease or disorder characterized by or associated with increased TEAD (e.g., TEAD1, TEAD2, TEAD3, and/or TEAD4) expression and/or increased TEAD (e.g., TEAD1, TEAD2, TEAD3, and/or TEAD4) activity comprising the step of administering to a 75 WO 2022/120354 PCT/US2021/072684 patient in need thereof a therapeutically effective compound of the present invention, or pharmaceutically acceptable composition thereof. In some aspects and embodiments, provided herein are methods of treating, reducing the severity of, delaying the onset of, or inhibiting the progress of a disease or disorder, or one or more symptoms thereof of a disease or disorder in which inhibition or antagonizing of TEAD (e-g•, TEAD1, TEAD2, TEAD3, and/or TEAD4) activity is beneficial comprising the step of administering to a patient in need thereof a therapeutically effective compound of the present invention, or pharmaceutically acceptable composition thereof. In some aspects and embodiments, provided herein are methods of treating, reducing the severity of, delaying the onset of, or inhibiting the progress of a disease or disorder, or one or more symptms thereof of a disease or disorder in which inhibition or antagonizing of the Hippo pathway is beneficial comprising the step of administering to a patient in need thereof a therapeutically effective compound of the present invention, or pharmaceutically acceptable composition thereof. [00221]In some aspects and embodiments, the present invention provides a method for treating one or more disorders, diseases, and/or conditions wherein the disorder, disease, or condition includes, but is not limited to, a cellular proliferative disorder, comprising administering to a patient in need thereof, a TEAD inhibitor compound as described herein, or a pharmaceutical salt or composition thereof. In some embodiments, a cellular proliferative disorder is cancer. In some embodiments, the cancer is characterized by increased TEAD (e.g., TEAD1, TEAD2, TEAD3, and/or TEAD4) expression and/or increased TEAD (e.g., TEAD1, TEAD2, TEAD3, and/or TEAD4) activity. [00222]As used herein, the terms "increased," "elevated, " or "enhanced, " are used interchangeably and encompass any measurable increase in a biological function and/or biological activity and/or a concentration. For example, an increase can be by at least about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, about 100%, about 2-fold, about 3-fold, about 4- fold, about 5-fold, about 6-fold, about 7-fold, about 8-fold, about 9-fold, about 10-fold, about 20- fold, about 25-fold, about 50-fold, about 100-fold, or higher, relative to a control or baseline amount of a function, or activity, or concentration.
WO 2022/120354 PCT/US2021/072684 id="p-223" id="p-223" id="p-223" id="p-223" id="p-223" id="p-223" id="p-223" id="p-223" id="p-223" id="p-223" id="p-223" id="p-223" id="p-223" id="p-223"
id="p-223"
[00223]As used herein, the terms "increased expression " and/or "increased activity " of a substance, such as TEAD, in a sample or cancer or patient refers to an increase in the amount of the substance, such as TEAD, of about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, about 100%, about 2-fold, about 3-fold, about 4-fold, about 5-fold, about 6-fold, about 7-fold, about 8-fold, about 9-fold, about 10-fold, about 20-fold, about 25-fold, about 50- fold, about 100-fold, or higher, relative to the amount of the substance, such as TEAD, in a control sample or control samples, such as an individual or group of individuals who are not suffering from the disease or disorder (e.g., cancer) or an internal control, as determined by techniques known in the art. A subject can also be determined to have an "increased expression " or "increased activity " of TEAD if the expression and/or activity of TEAD is increased by one standard deviation, two standard deviations, three standard deviations, four standard deviations, five standard deviations, or more, relative to the mean (average) or median amount of TEAD in a control group of samples or a baseline group of samples or a retrospective analysis of patient samples. As practiced in the art, such control or baseline expression levels can be previously determined, or measured prior to the measurement in the sample or cancer or subject, or can be obtained from a database of such control samples. [00224]As used herein, a "proliferative disease " refers to a disease that occurs due to abnormal growth or extension by the multiplication of cells (Walker, Cambridge Dictionary of Biology, Cambridge University Press: Cambridge, UK, 1990). A proliferative disease can be associated with: 1) the pathological proliferation of normally quiescent cells; 2) the pathological migration of cells from their normal location (e.g., metastasis of neoplastic cells); 3) the pathological expression of proteolytic enzymes, such as the matrix metalloproteinases (e.g., collagenases, gelatinases, and elastases); or 4) the pathological angiogenesis as in proliferative retinopathy and tumor metastasis. Exemplary proliferative diseases include cancers (i.e., "malignant neoplasms "), benign neoplasms, angiogenesis, inflammatory diseases, and autoimmune diseases.
Cancer [00225]The cancer or proliferative disorder or tumor to be treated using the compounds and methods and uses described herein include, but are not limited to, a hematological cancer, a 77 WO 2022/120354 PCT/US2021/072684 lymphoma, a myeloma, a leukemia, a neurological cancer, skin cancer, breast cancer, a prostate cancer, a colorectal cancer, lung cancer, head and neck cancer, a gastrointestinal cancer, a liver cancer, a pancreatic cancer, a genitourinary cancer, a bone cancer, renal cancer, and a vascular cancer. [00226]In some embodiments of the methods and uses described herein, a cancer is mediated by activation of transcriptional coactivator with PDZ binding motif/Yes-associated protein transcription coactivator (TAZ/YAP). In some embodiments of the methods and uses described herein, a cancer is mediated by modulation of the interaction of YAP/TAZ with TEAD (e.g., TEAD1, TEAD2, TEAD3, and/or TEAD4). In some embodiments of the methods and uses described herein, the cancer is characterized by or associated with increased TEAD (e.g., TEAD1, TEAD2, TEAD3, and/or TEAD4) expression and/or increased TEAD (e.g., TEAD1, TEAD2, TEAD3, and/or TEAD4) activity. In some embodiments of the methods and uses described herein, the cancer is a cancer in which YAP is localized in the nucleus of the cancer cells. [00227]In some embodiments of the methods and uses described herein, the cancer is characterized or associated with a genetic alteration in one or more Hippo pathway genes. As used herein, the term "genetic alteration in one or more Hippo pathway genes" refers to that certain percentage of cells in a sample, such as a tumor sample, having a detectable amount of genetic alteration in one or more Hippo pathway genes. As used herein, a genetic alteration in a gene, such as a Hippo pathway gene, can refer, for example, to a loss-of-function mutation in the gene (including, for example, frameshifts, nonsense mutations and splicing mutations), a change in gene copy number (including, for example, copy gain, amplification, copy loss, or deletion), or a fusion of the gene with another gene, such as, for example, a TAZ-CAMTA1 fusion or YAP1-TFEfusion. In some embodiments, genetic alteration in Hippo pathway genes refers to that about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or 100% of cells, such as tumor cells, in a sample have at least about three copies of genetically altered Hippo pathway genes, at least about four copies of genetically altered Hippo pathway genes, at least about five copies of genetically altered Hippo pathway genes, at least about six copies of genetically altered Hippo pathway genes, at least about seven copies of genetically altered Hippo pathway genes, at least about eight copies of genetically altered Hippo pathway genes, at least about nine copies of 78 WO 2022/120354 PCT/US2021/072684 genetically altered Hippo pathway genes, at least about ten copies of genetically altered Hippo pathway genes, at least about eleven copies of genetically altered Hippo pathway genes, at least about twelve copies of genetically altered Hippo pathway genes, at least about nine copies of genetically altered Hippo pathway genes, at least about ten copies of genetically altered Hippo pathway genes, at least about eleven copies of genetically altered Hippo pathway genes, at least about twelve copies of genetically altered Hippo pathway genes, at least about thirteen copies of genetically altered Hippo pathway genes, at least about fourteen copies of genetically altered Hippo pathway genes, at least about fifteen copies of genetically altered Hippo pathway genes, at least about twenty copies of genetically altered Hippo pathway genes, or more. In some embodiments, genetic alteration in Hippo pathway genes refers to that about 10% tumor cells in a sample have at least about 15 copies of genetically altered Hippo pathway genes. In some embodiments, genetic alteration in Hippo pathway genes refers to that about 40% tumor cells in a sample have at least about 4 copies of genetically altered Hippo pathway genes. In some embodiments, genetic alteration in Hippo pathway genes refers to that about 10% tumor cells in a sample have at least about four copies of genetically altered Hippo pathway genes. In some embodiments, a Hippo pathway gene is NF2. In some embodiments, the genetic alteration in the one or more Hippo pathway genes is NF2 deficiency. In some embodiments, NF2 deficiency refers to NF2 loss of function mutations. In some embodiments, NF2 deficiency refers to NF2 copy losses or deletions. In some embodiments, NF2 deficiency refers to absent or very low NF2 mRNA expression. In some embodiments, a Hippo pathway gene is YAP1. In some embodiments, the genetic alteration in the one or more Hippo pathway genes is YAP1 amplification. In some embodiments, the genetic alteration in the one or more Hippo pathway genes is a YAP1 fusion, such as a YAP1-TFE3 fusion. In some embodiments, a Hippo pathway gene is TAZ. In some embodiments, the genetic alteration in the one or more Hippo pathway genes is TAZ amplification. In some embodiments, the genetic alteration in the one or more Hippo pathway genes is a TAZ fusion, such as a TAZ-CAMTA1 fusion. In some embodiments, a Hippo pathway gene is LATS 1/2. In some embodiments, the genetic alteration in the one or more Hippo pathway genes is LATS 1/2 copy number loss or deletion. In some embodiments, a Hippo pathway gene is MST1/2. In some embodiments, a Hippo pathway gene is BAP1. [00228]In some embodiments, a cancer is characterized by a mutant Ga-protein. In some embodiments, a mutant Ga-protein is selected from G12, G13, Gq, Gil, Gi, Go, and Gs. In some WO 2022/120354 PCT/US2021/072684 embodiments, a mutant Ga-protein is G12. In some embodiments, a mutant Ga-protein is G13. In some embodiments, a mutant Ga-protein is Gq. In some embodiments, a mutant Ga-protein is G. In some embodiments, a mutant Ga-protein is Gi. In some embodiments, a mutant Ga-protein is Go. In some embodiments, a mutant Ga-protein is Gs. [00229]In some embodiments of the methods and uses described herein, a cancer is treated by inhibiting or reducing or decreasing or arresting further growth or spread of the cancer or tumor. In some embodiments of the methods and uses described herein, a cancer is treated by inhibiting or reducing the size (e.g., volume or mass) of the cancer or tumor by at least 5%, at least 10%, at least 25%, at least 50%, at least 75%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% relative to the size of the cancer or tumor prior to treatment. In some embodiments of the methods and uses described herein, a cancer is treated by reducing the quantity of the cancers or tumors in the patient by at least 5%, at least 10%, at least 25%, at least 50%, at least 75%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% relative to the quantity of the cancers or tumors prior to treatment. [00230]In some embodiments, a patient treated using the methods or uses described herein exhibits progression-free survival of at least about one month, at least about 2 months, at least about 3 months, at least about 4 months, at least about 5 months, at least about 6 months, at least about 7 months, at least about 8 months, at least about 9 months, at least about 10 months, at least about 11 months, at least about one year, at least about eighteen months, at least about two years, at least about three years, at least about four years, or at least about five years after the treatment is initiated. In some embodiments, a patient treated using the methods or uses described herein exhibits an overall survival of at least about one month, at least about 2 months, at least about months, at least about 4 months, at least about 5 months, at least about 6 months, at least about months, at least about 8 months, at least about 9 months, at least about 10 months, at least about months, at least about one year, at least about 14 months, at least about 16 months, at least about months, at least about 20 months, at least about 22 months, at least about two years, at least about three years, at least about four years, or at least about five years after the treatment is initiated. [00231]In some embodiments, a patient treated using the methods or uses described herein exhibits an objective response rate (ORR) of at least about 15%, at least about 20%, at least about 80 WO 2022/120354 PCT/US2021/072684 %, at least about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, or about 100%. [00232]In some embodiments of the methods and uses described herein, the cancer is lung cancer, thyroid cancer, ovarian cancer, colorectal cancer, prostate cancer, cancer of the pancreas, cancer of the esophagus, liver cancer, breast cancer, skin cancer, or mesothelioma. In some embodiments, the cancer is lung cancer, thyroid cancer, ovarian cancer, colorectal cancer, prostate cancer, cancer of the pancreas, cancer of the esophagus, liver cancer, breast cancer, skin cancer, or mesothelioma, sarcoma, or epithelioid hemangioendothelioma (EHE). In some embodiments, the cancer is mesothelioma, such as malignant mesothelioma. In some embodiments, the cancer is EHE. [00233]In some embodiments, cancer includes, without limitation, leukemias (e.g., acute leukemia, acute lymphocytic leukemia, acute myelocytic leukemia, acute myeloblastic leukemia, acute promyelocytic leukemia, acute myelomonocytic leukemia, acute monocytic leukemia, acute erythroleukemia, chronic leukemia, chronic myelocytic leukemia, chronic lymphocytic leukemia), polycythemia vera, lymphoma (e.g., Hodgkin ’s disease or non-Hodgkin ’s disease), Waldenstrom's macroglobulinemia, multiple myeloma, heavy chain disease, and solid tumors such as sarcomas and carcinomas (e.g., fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma, chordoma, angiosarcoma, endotheliosarcoma, lymphangiosarcoma, lymphangioendotheliosarcoma, synovioma, mesothelioma, Ewing’s tumor, leiomyosarcoma, rhabdomyosarcoma, colon carcinoma, pancreatic cancer, breast cancer, ovarian cancer, prostate cancer, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, cystadenocarcinoma, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duct carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilm's tumor, cervical cancer, uterine cancer, testicular cancer, lung carcinoma, small cell lung carcinoma, bladder carcinoma, epithelial carcinoma, glioma, astrocytoma, glioblastoma multiforme (GBM, also known as glioblastoma), medulloblastoma, craniopharyngioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, schwannoma, neurofibrosarcoma, meningioma, melanoma, neuroblastoma, and retinoblastoma).[00234] In some embodiments, the cancer is glioma, astrocytoma, glioblastoma multiforme (GBM, also known as glioblastoma), medulloblastoma, craniopharyngioma, ependymoma, 81 WO 2022/120354 PCT/US2021/072684 pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, schwannoma, neurofibrosarcoma, meningioma, melanoma, neuroblastoma, or retinoblastoma. [00235]In some embodiments, the cancer is acoustic neuroma, astrocytoma (e.g., Grade I - Pilocytic Astrocytoma, Grade II - Low-grade Astrocytoma, Grade III - Anaplastic Astrocytoma, or Grade IV - Glioblastoma (GBM)), chordoma, CNS lymphoma, craniopharyngioma, brain stem glioma, ependymoma, mixed glioma, optic nerve glioma, subependymoma, medulloblastoma, meningioma, metastatic brain tumor, oligodendroglioma, pituitary tumors, primitive neuroectodermal (PNET) tumor, or schwannoma. In some embodiments, the cancer is a type found more commonly in children than adults, such as brain stem glioma, craniopharyngioma, ependymoma, juvenile pilocytic astrocytoma (IPA), medulloblastoma, optic nerve glioma, pineal tumor, primitive neuroectodermal tumors (PNET), or rhabdoid tumor. In some embodiments, the patient is an adult human. In some embodiments, the patient is a child or pediatric patient. [00236]Cancer includes, in another embodiment, without limitation, mesothelioma, hepatobilliary (hepatic and billiary duct), bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular melanoma, ovarian cancer, colon cancer, rectal cancer, cancer of the anal region, stomach cancer, gastrointestinal (gastric, colorectal, and duodenal), uterine cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, Hodgkin ’s Disease, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, prostate cancer, testicular cancer, chronic or acute leukemia, chronic myeloid leukemia, lymphocytic lymphomas, cancer of the bladder, cancer of the kidney or ureter, renal cell carcinoma, carcinoma of the renal pelvis, non-Hodgkins ’s lymphoma, spinal axis tumors, brain stem glioma, pituitary adenoma, adrenocortical cancer, gall bladder cancer, multiple myeloma, cholangiocarcinoma, fibrosarcoma, neuroblastoma, retinoblastoma, or a combination of one or more of the foregoing cancers. [00237]In some embodiments, the cancer is selected from hepatocellular carcinoma, ovarian cancer, ovarian epithelial cancer, or fallopian tube cancer; papillary serous cystadenocarcinoma or uterine papillary serous carcinoma (UPSC); prostate cancer; testicular cancer; gallbladder cancer; hepatocholangiocarcinoma; soft tissue and bone synovial sarcoma; rhabdomyosarcoma; osteosarcoma; chondrosarcoma; Ewing sarcoma; anaplastic thyroid cancer; adrenocortical 82 WO 2022/120354 PCT/US2021/072684 adenoma; pancreatic cancer; pancreatic ductal carcinoma or pancreatic adenocarcinoma; gastrointestinal/stomach (GIST) cancer; lymphoma; squamous cell carcinoma of the head and neck (SCCHN); salivary gland cancer; glioma, or brain cancer; neurofibromatosis- 1 associated malignant peripheral nerve sheath tumors (MPNST); Waldenstrom ’s macroglobulinemia; or medulloblastoma.[00238] In some embodiments, the cancer is selected from hepatocellular carcinoma (HCC), hepatoblastoma, colon cancer, rectal cancer, ovarian cancer, ovarian epithelial cancer, fallopian tube cancer, papillary serous cystadenocarcinoma, uterine papillary serous carcinoma (UPSC), hepatocholangiocarcinoma, soft tissue and bone synovial sarcoma, rhabdomyosarcoma, osteosarcoma, anaplastic thyroid cancer, adrenocortical adenoma, pancreatic cancer, pancreatic ductal carcinoma, pancreatic adenocarcinoma, glioma, neurofibromatosis- 1 associated malignant peripheral nerve sheath tumors (MPNST), Waldenstrom ’s macroglobulinemia, or medulloblastoma.[00239] In some embodiments, a cancer is a solid tumor, such as a sarcoma, carcinoma, or lymphoma. Solid tumors generally comprise an abnormal mass of tissue that typically does not include cysts or liquid areas. In some embodiments, the cancer is selected from renal cell carcinoma, or kidney cancer; hepatocellular carcinoma (HCC) or hepatoblastoma, or liver cancer; melanoma; breast cancer; colorectal carcinoma, or colorectal cancer; colon cancer; rectal cancer; anal cancer; lung cancer, such as non-small cell lung cancer (NSCLC) or small cell lung cancer (SCLC); ovarian cancer, ovarian epithelial cancer, ovarian carcinoma, or fallopian tube cancer; papillary serous cystadenocarcinoma or uterine papillary serous carcinoma (UPSC); prostate cancer; testicular cancer; gallbladder cancer; hepatocholangiocarcinoma; soft tissue and bone synovial sarcoma; rhabdomyosarcoma; osteosarcoma; chondrosarcoma; Ewing sarcoma; anaplastic thyroid cancer; adrenocortical carcinoma; pancreatic cancer; pancreatic ductal carcinoma or pancreatic adenocarcinoma; gastrointestinal/stomach (GIST) cancer; lymphoma; squamous cell carcinoma of the head and neck (SCCHN); salivary gland cancer; glioma, or brain cancer; neurofibromatosis- 1 associated malignant peripheral nerve sheath tumors (MPNST); Waldenstrom ’s macroglobulinemia; or medulloblastoma.[00240] In some embodiments, the cancer is selected from renal cell carcinoma, hepatocellular carcinoma (HCC), hepatoblastoma, colorectal carcinoma, colorectal cancer, colon cancer, rectal cancer, anal cancer, ovarian cancer, ovarian epithelial cancer, ovarian carcinoma, fallopian tube 83 WO 2022/120354 PCT/US2021/072684 cancer, papillary serous cystadenocarcinoma, uterine papillary serous carcinoma (UPSC), hepatocholangiocarcinoma, soft tissue and bone synovial sarcoma, rhabdomyosarcoma, osteosarcoma, chondrosarcoma, anaplastic thyroid cancer, adrenocortical carcinoma, pancreatic cancer, pancreatic ductal carcinoma, pancreatic adenocarcinoma, glioma, brain cancer, neurofibromatosis- 1 associated malignant peripheral nerve sheath tumors (MPNST), Waldenstrom ’s macroglobulinemia, or medulloblastoma.[00241] In some embodiments, the cancer is selected from hepatocellular carcinoma (HCC), hepatoblastoma, colon cancer, rectal cancer, ovarian cancer, ovarian epithelial cancer, ovarian carcinoma, fallopian tube cancer, papillary serous cystadenocarcinoma, uterine papillary serous carcinoma (UPSC), hepatocholangiocarcinoma, soft tissue and bone synovial sarcoma, rhabdomyosarcoma, osteosarcoma, anaplastic thyroid cancer, adrenocortical carcinoma, pancreatic cancer, pancreatic ductal carcinoma, pancreatic adenocarcinoma, glioma, neurofibromatosis- 1 associated malignant peripheral nerve sheath tumors (MPNST), Waldenstrom ’s macroglobulinemia, or medulloblastoma.[00242] In some embodiments, the cancer is hepatocellular carcinoma (HCC). In some embodiments, the cancer is hepatoblastoma. In some embodiments, the cancer is colon cancer. In some embodiments, the cancer is rectal cancer. In some embodiments, the cancer is ovarian cancer, or ovarian carcinoma. In some embodiments, the cancer is ovarian epithelial cancer. In some embodiments, the cancer is fallopian tube cancer. In some embodiments, the cancer is papillary serous cystadenocarcinoma. In some embodiments, the cancer is uterine papillary serous carcinoma (UPSC). In some embodiments, the cancer is hepatocholangiocarcinoma. In some embodiments, the cancer is soft tissue and bone synovial sarcoma. In some embodiments, the cancer is rhabdomyosarcoma. In some embodiments, the cancer is osteosarcoma. In some embodiments, the cancer is anaplastic thyroid cancer. In some embodiments, the cancer is adrenocortical carcinoma. In some embodiments, the cancer is pancreatic cancer, or pancreatic ductal carcinoma. In some embodiments, the cancer is pancreatic adenocarcinoma. In some embodiments, the cancer is glioma. In some embodiments, the cancer is malignant peripheral nerve sheath tumors (MPNST). In some embodiments, the cancer is neurofibromatosis- associated MPNST. In some embodiments, the cancer is Waldenstrom ’s macroglobulinemia. In some embodiments, the cancer is medulloblastoma. 84 WO 2022/120354 PCT/US2021/072684 id="p-243" id="p-243" id="p-243" id="p-243" id="p-243" id="p-243" id="p-243" id="p-243" id="p-243" id="p-243" id="p-243" id="p-243" id="p-243" id="p-243"
id="p-243"
[00243]In some embodiments, a cancer is a viral-associated cancer, including human immunodeficiency virus (HIV) associated solid tumors, human papillomavirus (HPV)-16 positive incurable solid tumors, and adult T-cell leukemia, which is caused by human T-cell leukemia virus type I (HTLV-I) and is a highly aggressive form of CD4+ T-cell leukemia characterized by clonal integration of HTLV-I in leukemic cells (See https://clinicaltrials.gov/ct2/show/study/ NCT02631746); as well as virus-associated tumors in gastric cancer, nasopharyngeal carcinoma, cervical cancer, vaginal cancer, vulvar cancer, squamous cell carcinoma of the head and neck, and Merkel cell carcinoma. (See https://clinicaltrials.gov/ct2/show/study/NCT02488759 ; see also https://clinicaltrials.gov/ct2/show/study/NCT0240886 ; https://clinicaltrials.gov/ct2/show/ NCT02426892) [00244]In some embodiments, a cancer is melanoma cancer. In some embodiments, a cancer is breast cancer. In some embodiments, a cancer is lung cancer. In some embodiments, a cancer is small cell lung cancer (SCLC). In some embodiments, a cancer is non-small cell lung cancer (NSCLC). [00245]The compounds and compositions, according to the methods of the present invention, can be administered using any amount and any route of administration effective for treating or lessening the severity of a cancer or tumor. The exact amount required varies from subject to subject, depending on the species, age, and general condition of the subject, the severity of the disease or condition, the particular agent, its mode of administration, and the like. Compounds of the invention are preferably formulated in dosage unit form for ease of administration and uniformity of dosage. The expression "dosage unit form " as used herein refers to a physically discrete unit of agent appropriate for the patient to be treated. It will be understood, however, that the total daily usage of the compounds and compositions of the present invention is decided by the attending physician within the scope of sound medical judgment. The specific effective dose level for any particular patient or organism depends upon a variety of factors, including the disorder being treated and the severity of the disorder; the activity of the specific compound employed; the specific composition employed; the age, body weight, general health, sex and diet of the patient; the time of administration, route of administration, and rate of excretion of the specific compound employed; the duration of the treatment; drugs used in combination or coincidental with the specific compound employed, and like factors well known in the medical arts. The terms "patient" or "subject ", as used herein, means an animal, preferably a mammal, and most preferably a human. 85 WO 2022/120354 PCT/US2021/072684 id="p-246" id="p-246" id="p-246" id="p-246" id="p-246" id="p-246" id="p-246" id="p-246" id="p-246" id="p-246" id="p-246" id="p-246" id="p-246" id="p-246"
id="p-246"
[00246]Pharmaceutically acceptable compositions of this invention can be administered to humans and other animals orally, rectally, parenterally, intracisternally, intravaginally, intraperitoneally, topically (as by powders, ointments, or drops), bucally, as an oral or nasal spray, or the like, depending on the severity of the disease or disorder being treated. In certain embodiments, the compounds of the invention can be administered orally or parenterally at dosage levels of about 0.01 mg/kg to about 50 mg/kg and preferably from about 1 mg/kg to about mg/kg, of subject body weight per day, one or more times a day, to obtain the desired therapeutic effect. [00247]Liquid dosage forms for oral administration include, but are not limited to, pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups and elixirs. In addition to the active compounds, the liquid dosage forms may contain inert diluents commonly used in the art such as, for example, water or other solvents, solubilizing agents and emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, dimethylformamide, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofurfuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof. Besides inert diluents, the oral compositions can also include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, and perfuming agents. [00248]Injectable preparations, for example, sterile injectable aqueous or oleaginous suspensions may be formulated according to the known art using suitable dispersing or wetting agents and suspending agents. The sterile injectable preparation may also be a sterile injectable solution, suspension or emulsion in a nontoxic parenterally acceptable diluent or solvent, for example, as a solution in 1,3-butanedi 01. Among the acceptable vehicles and solvents that may be employed are water, Ringer’s solution, U.S.P. and isotonic sodium chloride solution. In addition, sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this purpose any bland fixed oil can be employed including synthetic mono- or diglycerides. In addition, fatty acids such as oleic acid are used in the preparation of injectables. [00249]Injectable formulations can be sterilized, for example, by filtration through a bacterial- retaining filter, or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable medium prior to use. 86 WO 2022/120354 PCT/US2021/072684 id="p-250" id="p-250" id="p-250" id="p-250" id="p-250" id="p-250" id="p-250" id="p-250" id="p-250" id="p-250" id="p-250" id="p-250" id="p-250" id="p-250"
id="p-250"
[00250]In order to prolong the effect of a compound of the present invention, it is often desirable to slow the absorption of the compound from subcutaneous or intramuscular injection. This may be accomplished by the use of a liquid suspension of crystalline or amorphous material with poor water solubility. The rate of absorption of the compound then depends upon its rate of dissolution that, in turn, may depend upon crystal size and crystalline form. Alternatively, delayed absorption of a parenterally administered compound form is accomplished by dissolving or suspending the compound in an oil vehicle. Injectable depot forms are made by forming microencapsule matrices of the compound in biodegradable polymers such as polylactide- polyglycolide. Depending upon the ratio of compound to polymer and the nature of the particular polymer employed, the rate of compound release can be controlled. Examples of other biodegradable polymers include poly(orthoesters) and poly(anhydrides). Depot injectable formulations are also prepared by entrapping the compound in liposomes or microemulsions that are compatible with body tissues. [00251]Compositions for rectal or vaginal administration are preferably suppositories which can be prepared by mixing the compounds of this invention with suitable non-irritating excipients or carriers such as cocoa butter, polyethylene glycol or a suppository wax which are solid at ambient temperature but liquid at body temperature and therefore melt in the rectum or vaginal cavity and release the active compound. [00252]Solid dosage forms for oral administration include capsules, tablets, pills, powders, and granules. In such solid dosage forms, the active compound is mixed with at least one inert, pharmaceutically acceptable excipient or carrier such as sodium citrate or dicalcium phosphate and/or a) fillers or extenders such as starches, lactose, sucrose, glucose, mannitol, and silicic acid, b) binders such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinylpyrrolidinone, sucrose, and acacia, c) humectants such as glycerol, d) disintegrating agents such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate, e) solution retarding agents such as paraffin, f) absorption accelerators such as quaternary ammonium compounds, g) wetting agents such as, for example, cetyl alcohol and glycerol monostearate, h) absorbents such as kaolin and bentonite clay, and i) lubricants such as talc, calcium stearate, magnesium stearate, solid polyethylene glycols, sodium lauryl sulfate, and mixtures thereof. In the case of capsules, tablets and pills, the dosage form may also comprise buffering agents. 87 WO 2022/120354 PCT/US2021/072684 id="p-253" id="p-253" id="p-253" id="p-253" id="p-253" id="p-253" id="p-253" id="p-253" id="p-253" id="p-253" id="p-253" id="p-253" id="p-253" id="p-253"
id="p-253"
[00253]Solid compositions of a similar type can also be employed as fillers in soft and hard- filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like. The solid dosage forms of tablets, dragees, capsules, pills, and granules can be prepared with coatings and shells such as enteric coatings and other coatings well known in the pharmaceutical formulating art. They can optionally contain opacifying agents and can also be of a composition that they release the active ingredient(s) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner. Examples of embedding compositions that can be used include polymeric substances and waxes. Solid compositions of a similar type can also be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polethylene glycols and the like. [00254]The active compounds can also be in micro-encapsulated form with one or more excipients as noted above. The solid dosage forms of tablets, dragees, capsules, pills, and granules can be prepared with coatings and shells such as enteric coatings, release controlling coatings and other coatings well known in the pharmaceutical formulating art. In such solid dosage forms the active compound may be admixed with at least one inert diluent such as sucrose, lactose or starch. Such dosage forms may also comprise, as is normal practice, additional substances other than inert diluents, e.g., tableting lubricants and other tableting aids such a magnesium stearate and microcrystalline cellulose. In the case of capsules, tablets and pills, the dosage forms may also comprise buffering agents. They may optionally contain opacifying agents and can also be of a composition that they release the active ingredient(s) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner. Examples of embedding compositions that can be used include polymeric substances and waxes. [00255]Dosage forms for topical or transdermal administration of a compound of this invention include ointments, pastes, creams, lotions, gels, powders, solutions, sprays, inhalants or patches. The active component is admixed under sterile conditions with a pharmaceutically acceptable carrier and any needed preservatives or buffers as may be required. Ophthalmic formulation, ear drops, and eye drops are also contemplated as being within the scope of this invention. Additionally, the present invention contemplates the use of transdermal patches, which have the added advantage of providing controlled delivery of a compound to the body. Such dosage forms can be made by dissolving or dispensing the compound in the proper medium. Absorption 88 WO 2022/120354 PCT/US2021/072684 enhancers can also be used to increase the flux of the compound across the skin. The rate can be controlled by either providing a rate controlling membrane or by dispersing the compound in a polymer matrix or gel. Co-Administration with One or More Other Therapeutic Agent(s) [00256]Depending upon the particular condition, or disease, to be treated, additional therapeutic agents that are normally administered to treat that condition, can also be present in the compositions of this invention. As used herein, additional therapeutic agents that are normally administered to treat a particular disease, or condition, are known as "appropriate for the disease, or condition, being treated. " [00257]In some embodiments, the present invention provides a method of treating a disclosed disease or condition comprising administering to a patient in need thereof an effective amount of a compound disclosed herein or a pharmaceutically acceptable salt thereof and co-administering simultaneously or sequentially an effective amount of one or more additional therapeutic agents, such as those described herein. In some embodiments, the method includes co-administering one additional therapeutic agent. In some embodiments, the method includes co-administering two additional therapeutic agents. In some embodiments, the combination of the disclosed compound and the additional therapeutic agent or agents acts synergistically. [00258]A compound of the current invention can also be used in combination with known therapeutic processes, for example, the administration of hormones or radiation. In certain embodiments, a provided compound is used as a radiosensitizer, especially for the treatment of tumors which exhibit poor sensitivity to radiotherapy. [00259]A compound of the current invention can be administered alone or in combination with one or more other therapeutic compounds, possible combination therapy taking the form of fixed combinations or the administration of a compound of the invention and one or more other therapeutic compounds being staggered or given independently of one another, or the combined administration of fixed combinations and one or more other therapeutic compounds. A compound of the current invention can besides, or in addition, be administered especially for tumor therapy in combination with chemotherapy, radiotherapy, immunotherapy, phototherapy, surgical intervention, or a combination of these. Long-term therapy is equally possible, as is adjuvant therapy in the context of other treatment strategies, as described above. Other possible treatments 89 WO 2022/120354 PCT/US2021/072684 are therapy to maintain the patient's status after tumor regression, or even chemopreventive therapy, for example in patients at risk. [00260]One or more other therapeutic agent(s) may be administered separately from a compound or composition of the invention, as part of a multiple dosage regimen. Alternatively, one or more other therapeutic agent(s) may be part of a single dosage form, mixed together with a compound of this invention in a single composition. If administered as a multiple dosage regime, one or more other therapeutic agent(s) and a compound or composition of the invention can be administered simultaneously, sequentially or within a period of time from one another, for example within 1, 2, 3, 4, 5,6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 18, 20,21,22, 23, or 24 hours from one another. In some embodiments, one or more other therapeutic agent(s) and a compound or composition of the invention are administered as a multiple dosage regimen within greater than hours apart. [00261]As used herein, the term "combination, " "combined, " and related terms refers to the simultaneous or sequential administration of therapeutic agents in accordance with this invention. For example, a compound of the present invention can be administered with one or more other therapeutic agent(s) simultaneously or sequentially in separate unit dosage forms or together in a single unit dosage form. Accordingly, the present invention provides a single unit dosage form comprising a compound of the current invention, one or more other therapeutic agent(s), and a pharmaceutically acceptable carrier, adjuvant, or vehicle. [00262]The amount of a compound of the invention and one or more other therapeutic agent(s) (in those compositions which comprise an additional therapeutic agent as described above) that may be combined with the carrier materials to produce a single dosage form will vary depending upon the host treated and the particular mode of administration. Preferably, a composition of the invention should be formulated so that a dosage of between 0.01 -100 mg/kg body weight/day of a compound of the invention can be administered. [00263]In those compositions which comprise one or more other therapeutic agent(s), the one or more other therapeutic agent(s) and a compound of the invention may act synergistically. Therefore, the amount of the one or more other therapeutic agent(s) in such compositions may be less than that required in a monotherapy utilizing only that therapeutic agent. In such compositions a dosage of between 0.01 - 1,000 pg/kg body weight/day of the one or more other therapeutic agent(s) can be administered. 90 WO 2022/120354 PCT/US2021/072684 id="p-264" id="p-264" id="p-264" id="p-264" id="p-264" id="p-264" id="p-264" id="p-264" id="p-264" id="p-264" id="p-264" id="p-264" id="p-264" id="p-264"
id="p-264"
[00264]The amount of one or more other therapeutic agent present in the compositions of this invention may be no more than the amount that would normally be administered in a composition comprising that therapeutic agent as the only active agent. Preferably the amount of one or more other therapeutic agent(s) in the presently disclosed compositions will range from about 50% to 100% of the amount normally present in a composition comprising that agent as the only therapeutically active agent. In some embodiments, one or more other therapeutic agent(s) is administered at a dosage of about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, or about 95% of the amount normally administered for that agent. As used herein, the phrase "normally administered " means the amount an FDA approved therapeutic agent is approved for dosing per the FDA label insert. [00265]The compounds of this invention, or pharmaceutical compositions thereof, may also be incorporated into compositions for coating an implantable medical device, such as prostheses, artificial valves, vascular grafts, stents and catheters. Vascular stents, for example, have been used to overcome restenosis (re-narrowing of the vessel wall after injury). However, patients using stents or other implantable devices risk clot formation or platelet activation. These unwanted effects may be prevented or mitigated by pre-coating the device with a pharmaceutically acceptable composition comprising a kinase inhibitor. Implantable devices coated with a compound of this invention are another embodiment of the present invention.
Exemplary Other Therapeutic Agents [00266]In some embodiments, one or more other therapeutic agent is a Poly ADP ribose polymerase (PARP) inhibitor. In some embodiments, a PARP inhibitor is selected from olaparib (LYNPARZA®, AstraZeneca); rucaparib (RUBRACA@, Clovis Oncology); niraparib (ZEJULA@, Tesaro); talazoparib (MDV3800/BMN 673/LT00673, Medivation/Pfizer/Biomarin): veliparib (ABT-888, Abb Vie); and BGB-290 (BeiGene, Inc.). [00267]In some embodiments, one or more other therapeutic agent is a histone deacetylase (HDAC) inhibitor. In some embodiments, an HDAC inhibitor is selected from vorinostat (ZOLINZA@, Merck); romidepsin (ISTODAX®, Celgene); panobinostat (FARYDAK@, Novartis); belinostat (BELEODAQ®, Spectrum Pharmaceuticals); entinostat (SNDX-275, Syndax Pharmaceuticals) (NCT00866333); and chidamide (EPIDAZA®, HBI-8000, Chipscreen Biosciences, China). 91 WO 2022/120354 PCT/US2021/072684 id="p-268" id="p-268" id="p-268" id="p-268" id="p-268" id="p-268" id="p-268" id="p-268" id="p-268" id="p-268" id="p-268" id="p-268" id="p-268" id="p-268"
id="p-268"
[00268]In some embodiments, one or more other therapeutic agent is a CDK inhibitor, such as a CDK4/CDK6 inhibitor. In some embodiments, a CDK 4/6 inhibitor is selected from palbociclib (IBRANCE®, Pfizer); riboci clib (KISQALI@, Novartis); abemaciclib (Ly2835219, Eli Lilly); and trilaciclib (G1T28, G1 Therapeutics). [00269]In some embodiments, one or more other therapeutic agent is a phosphatidylinositol kinase (PI3K) inhibitor. In some embodiments, a PI3K inhibitor is selected from idelalisib (ZYDELIG®, Gilead), alpelisib (BYE? 19, Novartis), taselisib (GDC-0032, Genentech/Roche); pictilisib (GDC-0941, Genentech/Roche); copanlisib (BAY806946, Bayer); duvelisib (formerly IPI-145, Infinity Pharmaceuticals); PQR309 (Piqur Therapeutics, Switzerland); and TGR12(formerly RP5230, TG Therapeutics). [00270]In some embodiments, one or more other therapeutic agent is a platinum-based therapeutic, also referred to as platins. Platins cause cross-linking of DNA, such that they inhibit DNA repair and/or DNA synthesis, mostly in rapidly reproducing cells, such as cancer cells. [00271]In some embodiments, a platinum-based therapeutic is selected from cisplatin (PLATINOL@, Bristol-Myers Squibb); carboplatin (PARAPLATIN®, Bristol-Myers Squibb; also, Teva; Pfizer); oxaliplatin (ELOXITIN@ Sanofi-Aventis); nedaplatin (AQUPLA®, Shionogi), picoplatin (Poniard Pharmaceuticals); and satraplatin (JM-216, Agennix). [00272]In some embodiments, one or more other therapeutic agent is a taxane compound, which causes disruption of microtubules, which are essential for cell division. In some embodiments, a taxane compound is selected from paclitaxel (TAXOL®, Bristol-Myers Squibb), docetaxel (TAXOTERE®, Sanofi-Aventis; DOCEFREZ®, Sun Pharmaceutical), albumin-bound paclitaxel (ABRAXANE@; Abraxis/Celgene), cabazitaxel (JEVTANA@, Sanofi-Aventis), and SID530 (SKChemicals, Co.) (NCT00931008). [00273]In some embodiments, one or more other therapeutic agent is a nucleoside inhibitor, or a therapeutic agent that interferes with normal DNA synthesis, protein synthesis, cell replication, or will otherwise inhibit rapidly proliferating cells. [00274]In some embodiments, a nucleoside inhibitor is selected from trabectedin (guanidine alkylating agent, YONDELIS®, Janssen Oncology), mechlorethamine (alkylating agent, VALCHLOR@, Aktelion Pharmaceuticals); vincristine (ONCOVIN®, Eli Lilly; VINCASAR@, Teva Pharmaceuticals; MARQIBO, Talon Therapeutics); temozolomide (prodrug to alkylating agent 5-(3-methyltriazen-l-yl)-imidazole-4-carboxamide (MTIC) TEMODAR®, Merck); 92 WO 2022/120354 PCT/US2021/072684 cytarabine injection (ara-C, antimetabolic cytidine analog, Pfizer); lomustine (alkylating agent, CEENU@, Bristol-Myers Squibb; GLEOSTINE@, NextSource Biotechnology); azacitidine (pyrimidine nucleoside analog of cytidine, VIDAZA@, Celgene); omacetaxine mepesuccinate (cephalotaxine ester) (protein synthesis inhibitor, SYNRIBO@; Teva Pharmaceuticals); asparaginase Erwinia chrysanthemi (enzyme for depletion of asparagine, ELSPAR@, Lundbeck; ERWINAZE, EUSA Pharma); eribulin mesylate (microtubule inhibitor, tubulin-based antimitotic, HALAVEN@, Eisai); cabazitaxel (microtubule inhibitor, tubulin-based antimitotic, JEVTANA@, Sanofi-Aventis); capacetrine (thymidylate synthase inhibitor, XELODA®, Genentech); bendamustine (bifunctional mechlorethamine derivative, believed to form interstrand DNA cross-links, TREANDA, Cephalon/Teva); ixabepilone (semi-synthetic analog of epothilone B, microtubule inhibitor, tubulin-based antimitotic, IXEMPRA®, Bristol-Myers Squibb); nelarabine (prodrug of deoxyguanosine analog, nucleoside metabolic inhibitor, ARRANON@, Novartis); clorafabine (prodrug of ribonucleotide reductase inhibitor, competitive inhibitor of deoxycytidine, CLOLAR@, Sanofi-Aventis); and trifluridine and tipiracil (thymidine- based nucleoside analog and thymidine phosphorylase inhibitor, LONSURF@, Taiho Oncology). [00275]In some embodiments, one or more other therapeutic agent is a kinase inhibitor or VEGF-R antagonist. In some embodiments, one or more other therapeutic agent is a MEK inhibitor. As used herein, a "MEK inhibitor ’’ refers to any inhibitor or blocker or antagonist that binds to and/or inhibits mitogen-activated protein kinase enzymes MEK1 and/or MEK2. In some embodiments, an MEK inhibitor is selected from those as described in Cheng et al., "Current Development Status of MEK Inhibitors, " Molecules 2017,22, 1551, the contents of which are incorporated herein by reference in its entirety. In certain embodiments, the MEK inhibitor is selected from binimetinib (MEK162, ARRY-438162, ARRAY BIOPHARMA INC), cobimetinib(COTELLIC®, Exelexis/Genentech/Roche), refametinib (BAY 86-9766, RDEA119; Bayer AG), selumetinib (AZD6244, ARRY-142886; ASTRAZENECA),trametinib(MEKINIST®, Novartis), mirdametinib(PD-0325901, Spring Works Therapeutics), pimasertib (AS703026, MSC1936369B, Merck KGaA)or a pharmaceutically acceptable salt and/or solvate of any of the foregoing. In certain embodiments, the second anti-cancer agent is binimetinib, cobimetinib, selumetinib, trametinib, mirdametinib, pimasertib, or a pharmaceutically acceptable salt and/or solvate of any of the foregoing. Other examples of MEK inhibitors for use as an other therapeutic agent in the methods and uses described herein include, but are not limited 93 WO 2022/120354 PCT/US2021/072684 to, E6201 (Eisai Co Ltd./Strategia Theraputics), GDC-0623 (RG 7421, Genentech, Inc.), CH5126766 (RO5126766, Chugai 232Pharmaceutical Co., Roche), HL-085 (Shanghai Kechow Pharma, Inc.), SHR7390 (HENGRUIMEDICINE), TQ-B3234 (CHIAIAITIANQING), CS-30(CSTONE Pharmaceuticals), FCN-159 (FosunPharmaceuticals), VS-6766 (Verastem Oncology), and IMM-1-104 (Immuneering Corp.). Other examples of MEK inhibitors for use as second anti- cancer agents in the methods and uses described herein include, but are not limited to, those described in WO2005/121142, WO2014/169843, WO2016/03 5008, WO2016/168704, WO2020/125747, WO2021/142144, WO2021/142345, WO2021/149776, the contents of each of which are herein incorporated by reference in their entireties. [00276]In some embodiments, one or more other therapeutic agent is an EGER inhibitor. As used herein, an "EGFR inhibitor " refers to any inhibitor or blocker or antagonist that binds to and/or inhibits epidermal growth factor receptor (EGFR). In some embodiments, an EGFR inhibitor is selected from those as described in Ayati et cd., "‘A review7 on progression of epidermal growth factor receptor (EGFR) inhibitors as an efficient approach in cancer targeted, therapy," Bioorganic Chemistry 2020, 99: 103811, the contents of which are incorporated herein by reference in its entirety. In some embodiments, an EGFR inhibitor is selected from cetuximab, necitumumab, panitumumab, zalutumumab, nimotuzumab, and matuzumab. In some embodiments, an EGFR inhibitor is cetuximab. In some embodiments, an EGFR inhibitor is necitumumab. In some embodiments, an EGFR inhibitor is panitumumab. In some embodiments, an EGFR inhibitor is zalutumumab. In some embodiments, an EGFR inhibitor is nimotuzumab. In some embodiments, an EGFR inhibitor is matuzumab. [0001]In some embodiments, an EGFR inhibitor is selected from osimertinib, gefitinib, erlotinib, lapatinib, neratinib, vandetanib, afatinib, brigatinib, dacomitinib, and icotinib. In some embodiments, an EGFR inhibitor is Osimertinib. In some embodiments, an EGFR inhibitor is gefitinib. In some embodiments, an EGFR inhibitor is erlotinib. In some embodiments, an EGFR inhibitor is lapatinib. In some embodiments, an EGFR inhibitor is neratinib. In some embodiments, an EGFR inhibitor is vandetanib. In some embodiments, an EGFR inhibitor is afatinib. In some embodiments, an EGFR inhibitor is brigatinib. In some embodiments, an EGFR inhibitor is dacomitinib. In some embodiments, an EGFR inhibitor is icotinib. [0002]In some embodiments, an EGFR inhibitor is a "1st generation EGFR tyrosine kinase inhibitor " (1st generation TKI). A 1st generation TKI refers to reversible EGFR inhibitors, such as 94 WO 2022/120354 PCT/US2021/072684 gefitinib and erlotinib, which are effective in first-line treatment of NSCLC harboring EGFR activating mutations such as deletions in exon 19 and exon 21 L858R mutation. [0003]In some embodiments, an EGFR inhibitor is a "2nd generation EGFR tyrosine kinase inhibitor " (2nd generation TKI). A 2nd generation TKI refers to covalent irreversible EGFR inhibitors, such as afatinib and dacomitib, which are effective in first-line treatment of NSCLC harboring EGFR activating mutations such as deletions in exon 19 and exon 21 L858R mutation. [00277]In some embodiments, an EGFR inhibitor is a "3rd generation EGFR tyrosine kinase inhibitor " (3rd generation TKI). A 3rd generation TKI refers to covalent irreversible EGFR inhibitors, such as osimertinib and lazertinib, which are selective to the EGFR activating mutations, such as deletions in exon 19 and exon 21 L858R, alone or in combination with T790M mutation, and have lower inhibitory activity against wild-type EGFR. [00278]In some embodiment, one or more other therapeutic agent is selected from approved VEGF inhibitors and kinase inhibitors useful in the present invention include: bevacizumab (AVASTIN@, Genentech/Roche) an anti-VEGF monoclonal antibody; ramucirumab (CYRAMZA@, Eli Lilly), an anti-VEGFR-2 antibody and ziv-aflibercept, also known as VEGF Trap (ZALTRAP@; Regeneron/Sanofi). VEGFR inhibitors, such as regorafenib (STIVARGA®, Bayer); vandetanib (CAPRELSA®, AstraZeneca); axitinib (INLYTA@, Pfizer); and lenvatinib (LENVIMA@, Eisai); Raf inhibitors, such as sorafenib (NEXAVAR®, Bayer AG and Onyx); dabrafenib (TAFINLAR@, Novartis); and vemurafenib (ZELBORAF@, Genentech/Roche); MEK inhibitors, such as cobimetanib (COTELLIC®, Exelexis/Genentech/Roche); trametinib (MEKINIST@, Novartis); Bcr-Abl tyrosine kinase inhibitors, such as imatinib (GLEEVEC@, Novartis); nilotinib (TASIGNA®, Novartis); dasatinib (SPRYCEL®, BristolMyersSquibb); bosutinib (BOSULIF@, Pfizer); and ponatinib (INCLUSIG@, Ariad Pharmaceuticals); Her2 and EGFR inhibitors, such as gefitinib (IRESSA®, AstraZeneca); erlotinib (TARCEEVA®, Genentech/Roche/Astellas); lapatinib (TYKERB@, Novartis); afatinib (GILOTRIF@, Boehringer Ingelheim); osimertinib (targeting activated EGFR, TAGRISSO®, AstraZeneca); and brigatinib (ALUNBRIG®, Ariad Pharmaceuticals); c-Met and VEGFR2 inhibitors, such as cabozanitib (COMETRIQ@, Exelexis); and multikinase inhibitors, such as sunitinib (SUTENT®, Pfizer); pazopanib (VOTRIENT@, Novartis); ALK inhibitors, such as crizotinib (XALKORI@, Pfizer); ceritinib (ZYKADIA@, Novartis); and alectinib (ALECENZa@, Genentech/Roche); Bruton ’s 95 WO 2022/120354 PCT/US2021/072684 tyrosine kinase inhibitors, such as ibrutinib (IMBRUVICA®, Pharmacyclics/Janssen); and Fltreceptor inhibitors, such as midostaurin (R YD APT®, Novartis). [00279]Other kinase inhibitors and VEGF-R antagonists that are in development and may be used in the present invention include tivozanib (Aveo Pharmaceuticals); vatalanib (Bayer/Novartis); lucitanib (Clovis Oncology); dovitinib (TKI258, Novartis); Chiauanib (Chipscreen Biosciences); CEP-11981 (Cephalon); linifanib (Abbott Laboratories); neratinib (HKI-272, Puma Biotechnology); radotinib (SUPECT@, IY5511, Il-Yang Pharmaceuticals, S. Korea); ruxolitinib (JAKAFI@, Incyte Corporation); PTC299 (PTC Therapeutics); CP-547,6(Pfizer); foretinib (Exelexis, GlaxoSmithKline); quizartinib (Daiichi Sankyo) and motesanib (Amgen/T akeda) . [00280]In some embodiments, one or more other therapeutic agent is an mTOR inhibitor, which inhibits cell proliferation, angiogenesis and glucose uptake. In some embodiments, an mTOR inhibitor is everolimus (AFINITOR@, Novartis); temsirolimus (TORISEL@@, Pfizer); and sirolimus (RAPAMUNE@, Pfizer). [00281]In some embodiments, one or more other therapeutic agent is a proteasome inhibitor. Approved proteasome inhibitors useful in the present invention include bortezomib (VELCADE®, Takeda); carfilzomib (KYPROLIS®, Amgen); and ixazomib (NINLARO®, Takeda). [00282]In some embodiments, one or more other therapeutic agent is a growth factor antagonist, such as an antagonist of platelet-derived growth factor (PDGF), or epidermal growth factor (EGF) or its receptor (EGFR). Approved PDGF antagonists which may be used in the present invention include olaratumab (LARTRUVO®; Eli Lilly). Approved EGFR antagonists which may be used in the present invention include cetuximab (ERBITUX®, Eli Lilly); necitumumab (PORTRAZZA®, Eli Lilly), panitumumab (VECTIBIX®, Amgen); and osimertinib (targeting activated EGFR, TAGRISSO®, AstraZeneca). [00283]In some embodiments, one or more other therapeutic agent is an aromatase inhibitor. In some embodiments, an aromatase inhibitor is selected from exemestane (AROMASIN@, Pfizer); anastazole (ARIMIDEX@, AstraZeneca) and letrozole (FEMARA®, Novartis). [00284]In some embodiments, one or more other therapeutic agent is an antagonist of the hedgehog pathway. Approved hedgehog pathway inhibitors which may be used in the present invention include sonidegib (0D0MZ0®, Sun Pharmaceuticals); and vismodegib (ERIVEDGE@, Genentech), both for treatment of basal cell carcinoma. 96 WO 2022/120354 PCT/US2021/072684 id="p-285" id="p-285" id="p-285" id="p-285" id="p-285" id="p-285" id="p-285" id="p-285" id="p-285" id="p-285" id="p-285" id="p-285" id="p-285" id="p-285"
id="p-285"
[00285]In some embodiments, one or more other therapeutic agent is a folic acid inhibitor. Approved folic acid inhibitors useful in the present invention include pemetrexed (ALIMTA, Eli Lilly).[00286] In some embodiments, one or more other therapeutic agent is a CC chemokine receptor (CCR4) inhibitor. CCR4 inhibitors being studied that may be useful in the present invention include mogamulizumab (POTELIGEO®, Kyowa Hakko Kirin, Japan). [00287]In some embodiments, one or more other therapeutic agent is an isocitrate dehydrogenase (IDH) inhibitor. IDH inhibitors being studied which may be used in the present invention include AG120 (Celgene; NCT02677922); AG221 (Celgene, NCT02677922; NCT02577406); BAY1436032 (Bayer, NCT02746081); IDH305 (Novartis, NCT02987010). [00288]In some embodiments, one or more other therapeutic agent is an arginase inhibitor. Arginase inhibitors being studied which may be used in the present invention include AEB11(pegylated recombinant arginase, Aeglea Biotherapeutics), which is being studied in Phase clinical trials for acute myeloid leukemia and myelodysplastic syndrome (NCT02732184) and solid tumors (NCT02561234); and CB-1158 (Calithera Biosciences). [00289]In some embodiments, one or more other therapeutic agent is a glutaminase inhibitor. Glutaminase inhibitors being studied which may be used in the present invention include CB-8(Calithera Biosciences). [00290]In some embodiments, one or more other therapeutic agent is an antibody that binds to tumor antigens, that is, proteins expressed on the cell surface of tumor cells. Approved antibodies that bind to tumor antigens which may be used in the present invention include rituximab (RITUXAN@, Genentech/BiogenIdec): ofatumumab (anti-CD20, ARZERRA®, GlaxoSmithKline); obinutuzumab (anti-CD20, GAZYVA®, Genentech), ibritumomab (anti- CD20 and Yttrium-90, ZEVALIN®, Spectrum Pharmaceuticals); daratumumab (anti-CD38, DARZALEX@, Janssen Biotech), dinutuximab (anti-glycolipid GD2, UNITUXIN®, United Therapeutics); trastuzumab (anti-HER2, HERCEPTIN®, Genentech); ado-trastuzumab emtansine (anti-HER2, fused to emtansine, KADCYLA@, Genentech); and pertuzumab (anti-HER2, PERJETA@, Genentech); and brentuximab vedotin (anti-CD30-drug conjugate, ADCETRIS@, Seattle Genetics). [00291]In some embodiments, one or more other therapeutic agent is a topoisomerase inhibitor. Approved topoisomerase inhibitors useful in the present invention include irinotecan 97 WO 2022/120354 PCT/US2021/072684 (ONIVYDE®, Merrimack Pharmaceuticals); topotecan (HYCAMTIN®, GlaxoSmithKline). Topoisomerase inhibitors being studied which may be used in the present invention include pixantrone (PIXUVRI@, CTI Biopharma). [00292]In some embodiments, one or more other therapeutic agent is an inhibitor of anti- apoptotic proteins, such as BCL-2. Approved anti-apoptotics which may be used in the present invention include venetoclax (VENCLEXTA@, AbbVie/Genentech); and blinatumomab (BLINCYTO@, Amgen). Other therapeutic agents targeting apoptotic proteins which have undergone clinical testing and may be used in the present invention include navitoclax (ABT-263, Abbott), a BCL-2 inhibitor (NCTO2079740). [00293]In some embodiments, one or more other therapeutic agent is an androgen receptor inhibitor. Approved androgen receptor inhibitors useful in the present invention include enzalutamide (XTANDI@, Astellas/Medivation); approved inhibitors of androgen synthesis include abiraterone (ZYTIGA®, Centocor/Ortho); approved antagonist of gonadotropin-releasing hormone (GnRH) receptor (degaralix, FIRMAGON, Feiring Pharmaceuticals). [00294]In some embodiments, one or more other therapeutic agent is a selective estrogen receptor modulator (SERM), which interferes with the synthesis or activity of estrogens. Approved SERMs useful in the present invention include raloxifene (EVISTA®, Eli Lilly). [00295]In some embodiments, one or more other therapeutic agent is an inhibitor of bone resorption. An approved therapeutic which inhibits bone resorption is Denosumab (XGEVA®, Amgen), an antibody that binds to RANKL, prevents binding to its receptor RANK, found on the surface of osteoclasts, their precursors, and osteoclast-like giant cells, which mediates bone pathology in solid tumors with osseous metastases. Other approved therapeutics that inhibit bone resorption include bisphosphonates, such as zoledronic acid (ZOMETA®, Novartis). [00296]In some embodiments, one or more other therapeutic agent is an inhibitor of interaction between the two primary p53 suppressor proteins, MDMX and MDM2. Inhibitors of psuppression proteins being studied which may be used in the present invention include ALRN- 6924 (Aileron), a stapled peptide that equipotently binds to and disrupts the interaction of MDMX and MDM2 with p53. ALRN-6924 is currently being evaluated in clinical trials for the treatment of AML, advanced myelodysplastic syndrome (MDS) and peripheral T-cell lymphoma (PTCL) (NCT02909972; NCT02264613). 98 WO 2022/120354 PCT/US2021/072684 id="p-297" id="p-297" id="p-297" id="p-297" id="p-297" id="p-297" id="p-297" id="p-297" id="p-297" id="p-297" id="p-297" id="p-297" id="p-297" id="p-297"
id="p-297"
[00297]In some embodiments, one or more other therapeutic agent is an inhibitor of transforming growth factor-beta (TGF-beta or TGF־P). Inhibitors of TGF-beta proteins being studied which may be used in the present invention include NIS793 (Novartis), an anti-TGF-beta antibody being tested in the clinic for treatment of various cancers, including breast, lung, hepatocellular, colorectal, pancreatic, prostate and renal cancer (NCT 02947165). In some embodiments, the inhibitor of TGF-beta proteins is fresolimumab (GC1008; Sanofi-Genzyme), which is being studied for melanoma (NCT00923169); renal cell carcinoma (NCT003 56460); and non-small cell lung cancer (NCT02581787). Additionally, in some embodiments, the additional therapeutic agent is a TGF-beta trap, such as described in Connolly et al. (2012) Int’l J. Biological Sciences 8:964-978. One therapeutic compound currently in clinical trials for treatment of solid tumors is M7824 (Merck KgaA - formerly MSB0011459X), which is a bispecific, anti-PD- Ll/TGF-P trap compound (NCT02699515); and (NCT02517398). M7824 is comprised of a fully human IgGl antibody against PD-L1 fused to the extracellular domain of human TGF-beta receptor II, which functions as a TGF־P "trap." [00298]In some embodiments, one or more other therapeutic agent is selected from glembatumumab vedotin-monomethyl auristatin E (MMAE) (Celldex), an anti-gly coprotein NMB (gpNMB) antibody (CR011) linked to the cytotoxic MMAE. gpNMB is a protein overexpressed by multiple tumor types associated with cancer cells ’ ability to metastasize. [00299]In some embodiments, one or more other therapeutic agents is an antiproliferative compound. Such antiproliferative compounds include, but are not limited to aromatase inhibitors; antiestrogens; topoisomerase I inhibitors; topoisomerase II inhibitors; microtubule active compounds; alkylating compounds; histone deacetylase inhibitors; compounds which induce cell differentiation processes; cyclooxygenase inhibitors; MMP inhibitors; mTOR inhibitors; antineoplastic antimetabolites; platin compounds; compounds targeting/decreasing a protein or lipid kinase activity and further anti-angiogenic compounds; compounds which target, decrease or inhibit the activity of a protein or lipid phosphatase; gonadorelin agonists; anti-androgens; methionine aminopeptidase inhibitors; matrix metalloproteinase inhibitors; bisphosphonates; biological response modifiers; antiproliferative antibodies; heparanase inhibitors; inhibitors of Ras oncogenic isoforms; telomerase inhibitors; proteasome inhibitors; compounds used in the treatment of hematologic malignancies; compounds which target, decrease or inhibit the activity of Flt-3; Hsp90 inhibitors such as 17-AAG (17-allylaminogeldanamycin, NSC330507), 17- 99 WO 2022/120354 PCT/US2021/072684 DMAG (17-dimethylaminoethylamino-17-demethoxy-geldanamycin, NSC707545), IPI-504, CNF 1010, CNF2024, CNF1010 from Conforma Therapeutics; temozolomide (TEMODAL®); kinesin spindle protein inhibitors, such as SB715992 or SB743921 from GlaxoSmithKline, or pentamidine/chlorpromazine from CombinatoRx; MEK inhibitors such as ARRY142886 from Array BioPharma, AZd6244 from AstraZeneca, PD181461 from Pfizer and leucovorin. [00300]The term "aromatase inhibitor " as used herein relates to a compound which inhibits estrogen production, for instance, the conversion of the substrates androstenedione and testosterone to estrone and estradiol, respectively. The term includes, but is not limited to steroids, especially atamestane, exemestane and formestane and, in particular, non-steroids, especially aminoglutethimide, roglethimide, pyridoglutethimide, trilostane, testolactone, ketokonazole, vorozole, fadrozole, anastrozole and letrozole. Exemestane is marketed under the trade name AROMASIN™. Formestane is marketed under the trade name LENTARON™. Fadrozole is marketed under the trade name AFEMATM. Anastrozole is marketed under the trade name ARIMIDEXTM Letrozole is marketed under the trade names FEMARATM or FEMAr™. Aminoglutethimide is marketed under the trade name ORIMETENTM. A combination of the invention comprising a chemotherapeutic agent which is an aromatase inhibitor is particularly useful for the treatment of hormone receptor positive tumors, such as breast tumors. [00301]The term "antiestrogen" as used herein relates to a compound which antagonizes the effect of estrogens at the estrogen receptor level. The term includes, but is not limited to tamoxifen, fulvestrant, raloxifene and raloxifene hydrochloride. Tamoxifen is marketed under the trade name NOLVADEX™. Raloxifene hydrochloride is marketed under the trade name EVISTA™. Fulvestrant can be administered under the trade name FASLODEX™Fulvestrant can be administered under the trade name Faslodex™. A combination of the invention comprising a chemotherapeutic agent which is an anti estrogen is particularly useful for the treatment of estrogen receptor positive tumors, such as breast tumors. [00302]The term "anti-androgen" as used herein relates to any substance which is capable of inhibiting the biological effects of androgenic hormones and includes, but is not limited to, bicalutamide (CASODEX™). The term "gonadorelin agonist" as used herein includes, but is not limited to abarelix, goserelin, and goserelin acetate. Goserelin can be administered under the trade name ZOLADEX™. 100 WO 2022/120354 PCT/US2021/072684 id="p-303" id="p-303" id="p-303" id="p-303" id="p-303" id="p-303" id="p-303" id="p-303" id="p-303" id="p-303" id="p-303" id="p-303" id="p-303" id="p-303"
id="p-303"
[00303]The term "topoisomerase I inhibitor" as used herein includes, but is not limited to topotecan, gimatecan, irinotecan, camptothecian and its analogues, 9-nitrocamptothecin and the macromolecular camptothecin conjugate PNU-166148. Irinotecan can be administered, e.g., in the form as it is marketed, e.g., under the trademark CAMPTOSARTM. Topotecan is marketed under the trade name HYCAMPTIN™. [00304]The term "topoisomerase II inhibitor" as used herein includes, but is not limited to the anthracyclines such as doxorubicin (including liposomal formulation, such as CAELYXTM), daunorubicin, epirubicin, idarubicin and nemorubicin, the anthraquinones mitoxantrone and losoxantrone, and the podophillotoxines etoposide and teniposide. Etoposide is marketed under the trade name ETOPOPHOSTM. Teniposide is marketed under the trade name VM 26-Bristol Doxorubicin is marketed under the trade name ACRIBLASTINTM or ADRIAMYCIN™. Epirubicin is marketed under the trade name FARMORUBICINTM. Idarubicin is marketed, under the trade name ZAVEDOS™. Mitoxantrone is marketed under the trade name NOVANTRON™. [00305]The term "microtubule active agent" relates to microtubule stabilizing, microtubule destabilizing compounds and microtublin polymerization inhibitors including, but not limited to taxanes, such as paclitaxel and docetaxel; vinca alkaloids, such as vinblastine or vinblastine sulfate, vincristine or vincristine sulfate, and vinorelbine; discodermolides; cochicine and epothilones and derivatives thereof. Paclitaxel is marketed under the trade name TAXOLTM. Docetaxel is marketed under the trade name TAXOTERETM. Vinblastine sulfate is marketed under the trade name VINBLASTIN R.P™. Vincristine sulfate is marketed under the trade name FARMISTIN™. [00306]The term "alkylating agent" as used herein includes, but is not limited to, cyclophosphamide, ifosfamide, melphalan or nitrosourea (BCNU or Gliadel). Cyclophosphamide is marketed under the trade name CYCLOSTINTM. Ifosfamide is marketed under the trade name HOLOXAN™ [00307]The term "histone deacetylase inhibitors" or "HDAC inhibitors" relates to compounds which inhibit the histone deacetylase and which possess antiproliferative activity. This includes, but is not limited to, suberoylanilide hydroxamic acid (SAHA). [00308]The term "antineoplastic antimetabolite" includes, but is not limited to, 5-fluorouracil or 5-FU, capecitabine, gemcitabine, DNA demethylating compounds, such as 5-azacytidine and decitabine, methotrexate and edatrexate, and folic acid antagonists such as pemetrexed. 101 WO 2022/120354 PCT/US2021/072684 Capecitabine is marketed under the trade name XELODA™. Gemcitabine is marketed under the trade name GEMZAR™. [00309]The term "platin compound" as used herein includes, but is not limited to, carboplatin, cis-platin, cisplatinum and oxaliplatin. Carboplatin can be administered, e.g., in the form as it is marketed, e.g., under the trademark CARBOPLATTM. Oxaliplatin can be administered, e.g., in the form as it is marketed, e.g. under the trademark ELOXATINTM. [00310]The term "compounds targeting/decreasing a protein or lipid kinase activity; or a protein or lipid phosphatase activity; or further anti-angiogenic compounds" as used herein includes, but is not limited to, protein tyrosine kinase and/or serine and/or threonine kinase inhibitors or lipid kinase inhibitors, such as a) compounds targeting, decreasing or inhibiting the activity of the platelet-derived growth factor-receptors (PDGFR), such as compounds which target, decrease or inhibit the activity of PDGFR, especially compounds which inhibit the PDGF receptor, such as an N-phenyl-2-pyrimidine-amine derivative, such as imatinib, SU101, SU6668 and GFB- 111; b) compounds targeting, decreasing or inhibiting the activity of the fibroblast growth factor- receptors (FGFR); c) compounds targeting, decreasing or inhibiting the activity of the insulin-like growth factor receptor I (IGF-IR), such as compounds which target, decrease or inhibit the activity ofIGF-IR, especially compounds which inhibit the kinase activity of IGF-I receptor, or antibodies that target the extracellular domain of IGF-I receptor or its growth factors; d) compounds targeting, decreasing or inhibiting the activity of the Trk receptor tyrosine kinase family, or ephrin Binhibitors; e) compounds targeting, decreasing or inhibiting the activity of the Axl receptor tyrosine kinase family; f) compounds targeting, decreasing or inhibiting the activity of the Ret receptor tyrosine kinase; g) compounds targeting, decreasing or inhibiting the activity of the Kit/SCFR receptor tyrosine kinase, such as imatinib; h) compounds targeting, decreasing or inhibiting the activity of the C-kit receptor tyrosine kinases, which are part of the PDGFR family, such as compounds which target, decrease or inhibit the activity of the c-Kit receptor tyrosine kinase family, especially compounds which inhibit the c-Kit receptor, such as imatinib; i) compounds targeting, decreasing or inhibiting the activity of members of the c-Abl family, their gene-fusion products (e.g., BCR-Abi kinase) and mutants, such as compounds which target decrease or inhibit the activity of c-Abl family members and their gene fusion products, such as an N-phenyl-2-pyrimidine-amine derivative, such as imatinib or nilotinib (AMN107); PD180970; AG957; NSC 680410; PD173955 from ParkeDavis; or dasatinib (BMS-354825); j) compounds 102 WO 2022/120354 PCT/US2021/072684 targeting, decreasing or inhibiting the activity of members of the protein kinase C (PKC) and Raf family of serine/threonine kinases, members of the MEK, SRC, JAK/pan-JAK, FAK, PDK1, PKB/Akt, Ras/MAPK, PI3K, SYK, TYK2, BTK and TEC family, and/or members of the cyclin- dependent kinase family (CDK) including staurosporine derivatives, such as midostaurin; examples of further compounds include UCN-01, safingol, BAY 43-9006, Bryostatin 1, Perifosine; llmofosine; RO 318220 and RO 320432; GO 6976; Isis 3521; LY333531/LY379196; isochinoline compounds; FTIs; PD184352 or QAN697 (a P13K inhibitor) or AT7519 (CDK inhibitor); k) compounds targeting, decreasing or inhibiting the activity of protein-tyrosine kinase inhibitors, such as compounds which target, decrease or inhibit the activity of protein-tyrosine kinase inhibitors include imatinib mesylate (GLEEVECTM) or tyrphostin such as Tyrphostin A23/RG-50810; AG 99; Tyrphostin AG 213; Tyrphostin AG 1748; Tyrphostin AG 490; Tyrphostin B44; Tyrphostin B44 (+) enantiomer; Tyrphostin AG 555; AG 494; Tyrphostin AG 556, AG957 and adaphostin (4-{[(2,5- dihydroxyphenyl)methyl]amino}-benzoic acid adamantyl ester; NSC 680410, adaphostin); 1) compounds targeting, decreasing or inhibiting the activity of the epidermal growth factor family of receptor tyrosine kinases (EGER! ErbB2, ErbB3, ErbB4 as homo- or heterodimers) and their mutants, such as compounds which target, decrease or inhibit the activity of the epidermal growth factor receptor family are especially compounds, proteins or antibodies which inhibit members of the EGF receptor tyrosine kinase family, such as EGF receptor, ErbB2, ErbB3 and ErbB4 or bind to EGF or EGF related ligands, CP 358774, ZD 1839, ZM 105180; trastuzumab (HERCEPTINTM), cetuximab (ERBITUXTM), Iressa, Tarceva, OSI-774, Cl-1033, EKB-569, GW-2016, El.l, E2.4, E2.5, E6.2, E6.4, E2.ll, E6.3 or E7.6.3, and 7H- pyrrolo-[2,3-d]pyrimidine derivatives; m) compounds targeting, decreasing or inhibiting the activity of the c-Met receptor, such as compounds which target, decrease or inhibit the activity of c-Met, especially compounds which inhibit the kinase activity of c-Met receptor, or antibodies that target the extracellular domain of c-Met or bind to HGF, n) compounds targeting, decreasing or inhibiting the kinase activity of one or more JAK family members (JAK1/JAK2/JAK3/TYKand/or pan-JAK), including but not limited to PRT-062070, SB-1578, baricitinib, pacritinib, momelotinib, VX-509, AZD-1480, TG-101348, tofacitinib, and ruxolitinib; o) compounds targeting, decreasing or inhibiting the kinase activity of PI3 kinase (PI3K) including but not limited to ATU-027, SF-1126, DS-7423, PBI-05204, GSK-2126458, ZSTK-474, buparlisib, pictrelisib, PF-4691502, BYE-719, dactolisib, XL-147, XL-765, and idelalisib; and; and q) compounds 103 WO 2022/120354 PCT/US2021/072684 targeting, decreasing or inhibiting the signaling effects of hedgehog protein (Hh) or smoothened receptor (SMO) pathways, including but not limited to cyclopamine, vismodegib, itraconazole, erismodegib, and IPI-926 (saridegib). [00311]The term "PI3K inhibitor " as used herein includes, but is not limited to compounds having inhibitory activity against one or more enzymes in the phosphatidylinositol-3-kinase family, including, but not limited to PI3Ka, PI3Ky, PI3K5, PI3Kp, PI3K-C2a, PI3K-C2p, PI3K- C2y, Vps34, pl 10-a, pl 10־P, pl 10-y, pl 10-5, p85-a, p85־P, p55-y, pl50, p 101, and p87. Examples of PI3K inhibitors useful in this invention include but are not limited to ATU-027, SF-1126, DS- 7423, PBI-05204, GSK-2126458, ZSTK-474, buparlisib, pictrelisib, PF-4691502, BYE-719, dactolisib, XL-147, XL-765, and idelalisib. [00312]The term "Bcl-2 inhibitor " as used herein includes, but is not limited to compounds having inhibitory activity against B-cell lymphoma 2 protein (Bcl-2), including but not limited to ABT-199, ABT-731, ABT-737, apogossypol, Ascenta ’s pan-Bcl-2 inhibitors, curcumin (and analogs thereof), dual Bcl-2/Bcl-xL inhibitors (Infinity Pharmaceuticals/Novartis Pharmaceuticals), Genasense (G3139), HA14-1 (and analogs thereof; see WO2008118802), navitoclax (and analogs thereof, see US7390799), NH-1 (Shenayng Pharmaceutical University), obatoclax (and analogs thereof, see WO2004106328), S-001 (Gloria Pharmaceuticals), TW series compounds (Univ, of Michigan), and venetoclax. In some embodiments the Bcl-2 inhibitor is a small molecule therapeutic. In some embodiments the Bcl-2 inhibitor is a peptidomimetic. [00313]The term "BTK inhibitor " as used herein includes, but is not limited to compounds having inhibitory activity against Bruton ’s Tyrosine Kinase (BTK), including, but not limited to AVL-292 and ibrutinib. [00314]The term "SYK inhibitor " as used herein includes, but is not limited to compounds having inhibitory activity against spleen tyrosine kinase (SYK), including but not limited to PRT- 062070, R-343, R-333, Excellair, PRT-062607, and fostamatinib. [00315]Further examples of BTK inhibitory compounds, and conditions treatable by such compounds in combination with compounds of this invention can be found in WO20080392and WO2011090760, the entirety of which are incorporated herein by reference. [00316]Further examples of SYK inhibitory compounds, and conditions treatable by such compounds in combination with compounds of this invention can be found in WO2003063794, WO2005007623, and WO2006078846, the entirety of which are incorporated herein by reference. 104 WO 2022/120354 PCT/US2021/072684 id="p-317" id="p-317" id="p-317" id="p-317" id="p-317" id="p-317" id="p-317" id="p-317" id="p-317" id="p-317" id="p-317" id="p-317" id="p-317" id="p-317"
id="p-317"
[00317]Further examples of PI3K inhibitory compounds, and conditions treatable by such compounds in combination with compounds of this invention can be found in WO2004019973, WO2004089925, WO2007016176, US8138347, WO2002088112, WO2007084786,WO2007129161, WO2006122806, WO2005113554, and WO2007044729 the entirety of which are incorporated herein by reference. [00318]Further examples of JAK inhibitory compounds, and conditions treatable by such compounds in combination with compounds of this invention can be found in WO2009114512, WO2008109943, WO2007053452, WO2000142246, and WO2007070514, the entirety of which are incorporated herein by reference. [00319]Further anti-angiogenic compounds include compounds having another mechanism for their activity, e.g. , unrelated to protein or lipid kinase inhibition e.g. , thalidomide (THALOMIDTM) and TNP-470. [00320]Examples of proteasome inhibitors useful for use in combination with compounds of the invention include, but are not limited to bortezomib, disulfiram, epigallocatechin-3-gallate (EGCG), salinosporamide A, carfilzomib, ONX-0912, CEP-18770, andMLN9708. [00321]Compounds which target, decrease or inhibit the activity of a protein or lipid phosphatase are e.g., inhibitors of phosphatase 1, phosphatase 2A, or CDC25, such as okadaic acid or a derivative thereof. [00322]Compounds which induce cell differentiation processes include, but are not limited to, retinoic acid, a- y- or 5- tocopherol or a- y- or 8-tocotrienol. [00323]The term cyclooxygenase inhibitor as used herein includes, but is not limited to, Cox- inhibitors, 5-alkyl substituted 2-arylaminophenylacetic acid and derivatives, such as celecoxib ( [00324]CELEBREXTM), rofecoxib (VIOXX™), etoricoxib, valdecoxib or a 5-alkyl-2- arylaminophenylacetic acid, such as 5-methyl-2-(2'-chloro-6'-fluoroanilino)phenyl acetic acid, lumiracoxib. [00325]The term "bisphosphonates" as used herein includes, but is not limited to, etridonic, clodronic, tiludronic, pamidronic, alendronic, ibandronic, risedronic and zoledronic acid. Etridonic acid is marketed under the trade name DIDRONELTM. Clodronic acid is marketed under the trade name BONEFOSTM. Tiludronic acid is marketed under the trade name Skelid™. Pamidronic acid is marketed under the trade name AREDIATM. Alendronic acid is marketed under the trade name FOSAMAX™. Ibandronic acid is marketed under the trade name BONDRANAT™. Risedronic 105 WO 2022/120354 PCT/US2021/072684 acid is marketed under the trade name ACTONEL™. Zoledronic acid is marketed under the trade name ZOMETATM. The term "mTOR inhibitors" relates to compounds which inhibit the mammalian target of rapamycin (mTOR) and which possess antiproliferative activity such as sirolimus (RAPAMUNE®), everolimus (CERTICANTM), CCI-779 and ABT578. [00326]The term "heparanase inhibitor" as used herein refers to compounds which target, decrease or inhibit heparin sulfate degradation. The term includes, but is not limited to, PI-88. The term "biological response modifier" as used herein refers to a lymphokine or interferons. [00327]The term "inhibitor of Ras oncogenic isoforms", such as H-Ras, K-Ras, or N-Ras, as used herein refers to compounds which target, decrease or inhibit the oncogenic activity of Ras; for example, a "famesyl transferase inhibitor" such as L-744832, DK8G557 or RI 157(ZARNESTRA ™). The term "telomerase inhibitor" as used herein refers to compounds which target, decrease or inhibit the activity of telomerase. Compounds which target, decrease or inhibit the activity of telomerase are especially compounds which inhibit the telomerase receptor, such as telomestatin. [00328]The term "methionine aminopeptidase inhibitor" as used herein refers to compounds which target, decrease or inhibit the activity of methionine aminopeptidase. Compounds which target, decrease or inhibit the activity of methionine aminopeptidase include, but are not limited to, bengamide or a derivative thereof. [00329]The term "proteasome inhibitor" as used herein refers to compounds which target, decrease or inhibit the activity of the proteasome. Compounds which target, decrease or inhibit the activity of the proteasome include, but are not limited to, Bortezomib (VELCADETM) and MLN 341. [00330]The term "matrix metalloproteinase inhibitor" or ("MMP" inhibitor) as used herein includes, but is not limited to, collagen peptidomimetic and nonpeptidomimetic inhibitors, tetracycline derivatives, e.g., hydroxamate peptidomimetic inhibitor batimastat and its orally bioavailable analogue marimastat (BB-2516), prinomastat (AG3340), metastat (NSC 683551) BMS-279251, BAY 12-9566, TAA211 , MMI270B or AAJ996. [00331]The term "compounds used in the treatment of hematologic malignancies" as used herein includes, but is not limited to, FMS-like tyrosine kinase inhibitors, which are compounds targeting, decreasing or inhibiting the activity of FMS-like tyrosine kinase receptors (Flt-3R); 106 WO 2022/120354 PCT/US2021/072684 interferon, l־P־D־arabinofuransylcytosine (ara-c) and bisulfan; and ALK inhibitors, which are compounds which target, decrease or inhibit anaplastic lymphoma kinase. [00332]Compounds which target, decrease or inhibit the activity of FMS-like tyrosine kinase receptors (Flt-3R) are especially compounds, proteins or antibodies which inhibit members of the Flt-3R receptor kinase family, such as PKC412, midostaurin, a staurosporine derivative, SUI 12and MLNS 18. [00333]The term "HSP90 inhibitors" as used herein includes, but is not limited to, compounds targeting, decreasing or inhibiting the intrinsic ATPase activity of HSP90; degrading, targeting, decreasing or inhibiting the HSP90 client proteins via the ubiquitin proteosome pathway. Compounds targeting, decreasing or inhibiting the intrinsic ATPase activity of HSP90 are especially compounds, proteins or antibodies which inhibit the ATPase activity of HSP90, such as 17-allylamino,17-demethoxygeldanamycin (17AAG), a geldanamycin derivative; other geldanamycin related compounds; radicicol and HD AC inhibitors. [00334]The term "antiproliferative antibodies" as used herein includes, but is not limited to, trastuzumab (HERCEPTINTM). Trastuzumab-DMl, erbitux, bevacizumab (AVASTINTM), rituximab (RITUXAN®), PRO64553 (anti-CD40) and 2C4 Antibody. By antibodies is meant intact monoclonal antibodies, polyclonal antibodies, multispecific antibodies formed from at least intact antibodies, and antibodies fragments so long as they exhibit the desired biological activity. [00335]For the treatment of acute myeloid leukemia (AML), compounds of the current invention can be used in combination with standard leukemia therapies, especially in combination with therapies used for the treatment of AML. In particular, compounds of the current invention can be administered in combination with, for example, farnesyl transferase inhibitors and/or other drugs useful for the treatment of AML, such as Daunorubicin, Adriamycin, Ara-C, VP-16, Teniposide, Mitoxantrone, Idarubicin, Carboplatinum and PKC412. [00336]Other anti-leukemic compounds include, for example, Ara-C, a pyrimidine analog, which is the 2'-alpha-hydroxy ribose (arabinoside) derivative of deoxycytidine. Also included is the purine analog of hypoxanthine, 6-mercaptopurine (6-MP) and fludarabine phosphate. Compounds which target, decrease or inhibit activity of histone deacetylase (HDAC) inhibitors such as sodium butyrate and suberoylanilide hydroxamic acid (SAHA) inhibit the activity of the enzymes known as histone deacetylases. Specific HDAC inhibitors include MS275, SAHA, FK228 (formerly FR901228), Trichostatin A and compounds disclosed in US 6,552,065 including, 107 WO 2022/120354 PCT/US2021/072684 but not limited to, N-hydroxy-3-[4-[[[2-(2-methyl-lH-indol-3-yl)-ethyl]- amino]methyl]phenyl]- 2E-2-propenamide, or a pharmaceutically acceptable salt thereof and N-hydroxy-3-[4-[(2- hydroxyethyl){2-(lH-indol-3-yl)ethyl]-amino]methyl]phenyl]-2E-2- propenamide, or a pharmaceutically acceptable salt thereof, especially the lactate salt. Somatostatin receptor antagonists as used herein refer to compounds which target, treat or inhibit the somatostatin receptor such as octreotide, and SOM230. Tumor cell damaging approaches refer to approaches such as ionizing radiation. The term "ionizing radiation" referred to above and hereinafter means ionizing radiation that occurs as either electromagnetic rays (such as X-rays and gamma rays) or particles (such as alpha and beta particles). Ionizing radiation is provided in, but not limited to, radiation therapy and is known in the art. See Hellman, Principles of Radiation Therapy, Cancer, in Principles and Practice of Oncology, Devita et al., Eds., 4th Edition, Vol. 1, pp. 248-275 (1993). [00337]Also included are EDG binders and ribonucleotide reductase inhibitors. The term "EDG binders " as used herein refers to a class of immunosuppressants that modulates lymphocyte recirculation, such as FTY720. The term "ribonucleotide reductase inhibitors " refers to pyrimidine or purine nucleoside analogs including, but not limited to, fludarabine and/or cytosine arabinoside (ara-C), 6-thioguanine, 5-fluorouracil, cladribine, 6-mercaptopurine (especially in combination with ara-C against ALL) and/or pentostatin. Ribonucleotide reductase inhibitors are especially hydroxyurea or 2-hydroxy-lH-isoindole-l ,3-dione derivatives. [00338]Also included are in particular those compounds, proteins or monoclonal antibodies of VEGF such as l-(4-chloroanilino)-4-(4-pyridylmethyl)phthalazine or a pharmaceutically acceptable salt thereof, l-(4-chloroanilino)-4-(4-pyridylmethyl)phthalazine succinate; ANGIOSTATIN™; ENDOSTATIN™; anthranilic acid amides; ZD4190; Zd 6474; SU5416; SU6668; bevacizumab; or anti-VEGF antibodies or anti-VEGF receptor antibodies, such as rhuMAb and RHUFab, VEGF aptamer such as Macugon; FLT-4 inhibitors, FLT-3 inhibitors, VEGFR-2 IgGI antibody, Angiozyme (RPI4610) and Bevacizumab (AVASTINTM). [00339]Photodynamic therapy as used herein refers to therapy which uses certain chemicals known as photosensitizing compounds to treat or prevent cancers. Examples of photodynamic therapy include treatment with compounds, such as VISUDYNE™ and porfimer sodium. [00340]Angiostatic steroids as used herein refers to compounds which block or inhibit angiogenesis, such as, e.g., anecortave, triamcinolone, hydrocortisone, 11-a-epihydrocotisol, 108 WO 2022/120354 PCT/US2021/072684 cortexolone, 17a-hydroxyprogesterone, corticosterone, desoxy corticosterone, testosterone, estrone and dexamethasone. [00341]Implants containing corticosteroids refers to compounds, such as fluocinolone and dexamethasone. [00342]Other chemotherapeutic compounds include, but are not limited to, plant alkaloids, hormonal compounds and antagonists; biological response modifiers, preferably lymphokines or interferons; antisense oligonucleotides or oligonucleotide derivatives; shRNA or siRNA; or miscellaneous compounds or compounds with other or unknown mechanism of action. [00343]The structure of the active compounds identified by code numbers, generic or trade names may be taken from the actual edition of the standard compendium "The Merck Index" or from databases, e.g., Patents International (e.g., IMS World Publications).
Exemplary Immuno-Oncology agents [00344]In some embodiments, one or more other therapeutic agent is an immuno-oncology agent. As used herein, the term "an immuno-oncology agent" refers to an agent which is effective to enhance, stimulate, and/or up-regulate immune responses in a subject. In some embodiments, the administration of an immuno-oncology agent with a compound of the invention has a synergic effect in treating a cancer. [00345]An immuno-oncology agent can be, for example, a small molecule drug, an antibody, or a biologic or small molecule. Examples of biologic immuno-oncology agents include, but are not limited to, cancer vaccines, antibodies, and cytokines. In some embodiments, an antibody is a monoclonal antibody. In some embodiments, a monoclonal antibody is humanized or human. [00346]In some embodiments, an immuno-oncology agent is (i) an agonist of a stimulatory (including a co-stimulatory) receptor or (ii) an antagonist of an inhibitory (including a co- inhibitory) signal on T cells, both of which result in amplifying antigen-specific T cell responses. [00347]Certain of the stimulatory and inhibitory molecules are members of the immunoglobulin super family (IgSF). One important family of membrane-bound ligands that bind to co-stimulatory or co-inhibitory receptors is the B7 family, which includes B7-1, B7-2, B7-H(PD-L1), B7-DC (PD-L2), B7-H2 (ICOS-L), B7-H3, B7-H4, B7-H5 (VISTA), and B7-H6. Another family of membrane bound ligands that bind to co-stimulatory or co-inhibitory receptors is the TNF family of molecules that bind to cognate TNF receptor family members, which includes 109 WO 2022/120354 PCT/US2021/072684 CD40 and CD40L, OX-40, OX-40L, CD70, CD27L, CD30, CD30L, 4-1BBL, CD137 (4-1BB), TRAIL/Ap02-L, TRAILRI/DR4, TRAILR2/DR5, TRAILR3, TRAILR4, OPG, RANK, RANKL, TWEAKR/Fnl4, TWEAK, BAFFR, EDAR, XEDAR, TACI, APRIL, BCMA, LTBR, LIGHT, DcR3, HVEM, VEGI/TLIA, TRAMP/DR3, EDAR, EDAI, XEDAR, EDA2, TNFR1, Lymphotoxin a/TNFP, TNFR2, TNFa, LTBR, Lymphotoxin a1p2, FAS, FASL, RELT, DR6, TROY, NGFR. [00348]In some embodiments, an immuno-oncology agent is a cytokine that inhibits T cell activation (e.g., IL-6, IL-10, TGF־P, VEGF, and other immunosuppressive cytokines) or a cytokine that stimulates T cell activation, for stimulating an immune response. [00349]In some embodiments, a combination of a compound of the invention and an immuno- oncology agent can stimulate T cell responses. In some embodiments, an immuno-oncology agent is: (i) an antagonist of a protein that inhibits T cell activation (e.g., immune checkpoint inhibitors) such as CTLA-4, PD-1, PD-L1, PD-L2, LAG-3, TIM-3, Galectin 9, CEACAM-1, BTLA, CD69, Galectin-1, TIGIT, GDI 13, GPR56, VISTA, 2B4, CD48, GARP, PD1H, LAIRI, TIM-1, and TIM- 4; or (ii) an agonist of a protein that stimulates T cell activation such as B7-1, B7-2, CD28, 4-1BB (CD137), 4-1BBL, ICOS, ICOS-L, OX40, OX40L, GITR, GITRL, CD70, CD27, CD40, DR3 and CD28H. [00350]In some embodiments, an immuno-oncology agent is an antagonist of inhibitory receptors on NK cells or an agonist of activating receptors on NK cells. In some embodiments, an immuno-oncology agent is an antagonist of KIR, such as lirilumab. [00351]In some embodiments, an immuno-oncology agent is an agent that inhibits or depletes macrophages or monocytes, including but not limited to CSF-1R antagonists such as CSF-1R antagonist antibodies including RG7155 (WO11/70024, WO11/107553, WO11/131407, WO13/87699, WO13/119716, WO13/132044) or FPA-008 (WO11/140249; WO13169264; WO14/036357). [00352]In some embodiments, an immuno-oncology agent is selected from agonistic agents that ligate positive costimulatory receptors, blocking agents that attenuate signaling through inhibitory receptors, antagonists, and one or more agents that increase systemically the frequency of anti-tumor T cells, agents that overcome distinct immune suppressive pathways within the tumor microenvironment (e.g., block inhibitory receptor engagement (e.g., PD-L1/PD-interactions), deplete or inhibit Tregs (e.g., using an anti-CD25 monoclonal antibody (e.g., 110 WO 2022/120354 PCT/US2021/072684 daclizumab) or by ex vivo anti-CD25 bead depletion), inhibit metabolic enzymes such as IDO, or reverse/prevent T cell energy or exhaustion) and agents that trigger innate immune activation and/or inflammation at tumor sites. [00353]In some embodiments, an immuno-oncology agent is a CTLA-4 antagonist. In some embodiments, a CTLA-4 antagonist is an antagonistic CTLA-4 antibody. In some embodiments, an antagonistic CTLA-4 antibody is YERVOY (ipilimumab) or tremelimumab. [00354]In some embodiments, an immuno-oncology agent is a PD-1 antagonist. In some embodiments, a PD-1 antagonist is administered by infusion. In some embodiments, an immuno- oncology agent is an antibody or an antigen-binding portion thereof that binds specifically to a Programmed Death-1 (PD-1) receptor and inhibits PD-1 activity. In some embodiments, a PD-antagonist is an antagonistic PD-1 antibody. In some embodiments, an antagonistic PD-1 antibody is OPDIVO (nivolumab), KEYTRUDA (pembrolizumab), or MED1-0680 (AMP-514; WO2012/145493). In some embodiments, an immuno-oncology agent may be pidilizumab (CT- Oil). In some embodiments, an immuno-oncology agent is a recombinant protein composed of the extracellular domain of PD-L2 (B7-DC) fused to the Fc portion of IgGl, called AMP-224. [00355]In some embodiments, an immuno-oncology agent is a PD-L1 antagonist. In some embodiments, a PD-L1 antagonist is an antagonistic PD-L1 antibody. In some embodiments, a PD-L1 antibody is MPDL3280A (RG7446; WO2010/077634), durvalumab (MEDI4736), BMS- 936559 (WO2007/005874), and MSB0010718C (WO2013/79174). [00356]In some embodiments, an immuno-oncology agent is a LAG-3 antagonist. In some embodiments, a LAG-3 antagonist is an antagonistic LAG-3 antibody. In some embodiments, a LAG3 antibody is BMS-986016 (WO10/19570, WO14/08218), or IMP-731 or IMP-3(WO08/132601, WO009/44273). [00357]In some embodiments, an immuno-oncology agent is a CD137 (4-1BB) agonist. In some embodiments, a CD137 (4-1BB) agonist is an agonistic CD137 antibody. In some embodiments, a CD137 antibody is urelumab or PF-05082566 (WO12/32433). [00358]In some embodiments, an immuno-oncology agent is a GITR agonist. In some embodiments, a GITR agonist is an agonistic GITR antibody. In some embodiments, a GITR antibody is BMS-986153, BMS-986156, TRX-518 (WO006/105021, WO009/009116), or MK- 4166 (WO11/028683).
Ill WO 2022/120354 PCT/US2021/072684 id="p-359" id="p-359" id="p-359" id="p-359" id="p-359" id="p-359" id="p-359" id="p-359" id="p-359" id="p-359" id="p-359" id="p-359" id="p-359" id="p-359"
id="p-359"
[00359]In some embodiments, an immuno-oncology agent is an indoleamine (2,3)- dioxygenase (IDO) antagonist. In some embodiments, an IDO antagonist is selected from epacadostat (INCB024360, Incyte); indoximod (NLG-8189, NewLink Genetics Corporation); capmanitib (INC280, Novartis); GDC-0919 (Genentech/Roche); PF-06840003 (Pfizer); BMS:F001287 (Bristol-Myers Squibb); Phy906/KD108 (Phytoceutica); an enzyme that breaks down kynurenine (Kynase, Ikena Oncology, formerly known as Kyn Therapeutics); and NLG-9(WO09/73620, WO009/1156652, WO11/56652, WO12/142237). [00360]In some embodiments, an immuno-oncology agent is an OX40 agonist. In some embodiments, an OX40 agonist is an agonistic OX40 antibody. In some embodiments, an OXantibody is MEDI-6383 or MEDI-6469. [00361]In some embodiments, an immuno-oncology agent is an OX40L antagonist. In some embodiments, an OX40L antagonist is an antagonistic OX40 antibody. In some embodiments, an OX40L antagonist is RG-7888 (WO06/029879). [00362]In some embodiments, an immuno-oncology agent is a CD40 agonist. In some embodiments, a CD40 agonist is an agonistic CD40 antibody. In some embodiments, an immuno- oncology agent is a CD40 antagonist. In some embodiments, a CD40 antagonist is an antagonistic CD40 antibody. In some embodiments, a CD40 antibody is lucatumumab or dacetuzumab. [00363]In some embodiments, an immuno-oncology agent is a CD27 agonist. In some embodiments, a CD27 agonist is an agonistic CD27 antibody. In some embodiments, a CDantibody is varlilumab. [00364]In some embodiments, an immuno-oncology agent is MGA271 (to B7H3) (WO 11/109400). [00365]In some embodiments, an immuno-oncology agent is abagovomab, adecatumumab, afutuzumab, alemtuzumab, anatumomab mafenatox, apolizumab, atezolimab, avelumab, blinatumomab, BMS-936559, catumaxomab, durvalumab, epacadostat, epratuzumab, indoximod, inotuzumab ozogamicin, intelumumab, ipilimumab, isatuximab, lambrolizumab, MED14736, MPDL3280A, nivolumab, obinutuzumab, ocaratuzumab, ofatumumab, olatatumab, pembrolizumab, pidilizumab, rituximab, ticilimumab, samalizumab, or tremelimumab. [00366]In some embodiments, an immuno-oncology agent is an immunostimulatory agent. For example, antibodies blocking the PD-1 and PD-L1 inhibitory axis can unleash activated tumor- reactive T cells and have been shown in clinical trials to induce durable anti-tumor responses in 112 WO 2022/120354 PCT/US2021/072684 increasing numbers of tumor histologies, including some tumor types that conventionally have not been considered immunotherapy sensitive. See, e.g., Okazaki, T. et al. (2013) Nat. Immunol. 14, 1212-1218; Zou etal. (2016) Sci. Transl. Med. 8. The anti-PD-1 antibody nivolumab (OPDIVO®, Bristol-Myers Squibb, also known as ONO-4538, MDX1106 and BMS-936558), has shown potential to improve the overall survival in patients with RCC who had experienced disease progression during or after prior anti-angiogenic therapy. [00367]In some embodiments, the immunomodulatory therapeutic specifically induces apoptosis of tumor cells. Approved immunomodulatory therapeutics which may be used in the present invention include pomalidomide (POMALYST@@, Celgene); lenalidomide (REVLIMID@, Celgene); ingenol mebutate (PICATO®, LEO Pharma). [00368]In some embodiments, an immuno-oncology agent is a cancer vaccine. In some embodiments, the cancer vaccine is selected from sipuleucel-T (PROVENGE, Dendreon/Valeant Pharmaceuticals), which has been approved for treatment of asymptomatic, or minimally symptomatic metastatic castrate-resistant (hormone-refractory) prostate cancer; and talimogene laherparepvec (IMLYGIC@, BioVex/Amgen, previously known as T-VEC), a genetically modified oncolytic viral therapy approved for treatment of unresectable cutaneous, subcutaneous and nodal lesions in melanoma. In some embodiments, an immuno-oncology agent is selected from an oncolytic viral therapy such as pexastimogene devacirepvec (PexaVec/JX-594, SillaJen/formerly Jennerex Biotherapeutics), a thymidine kinase- (TK-) deficient vaccinia virus engineered to express GM-CSF, for hepatocellular carcinoma (NCT02562755) and melanoma (NCT00429312); pelareorep (REOLYSIN@, Oncolytics Biotech), a variant of respiratory enteric orphan virus (reovirus) which does not replicate in cells that are not RAS-activated, in numerous cancers, including colorectal cancer (NCTO1622543); prostate cancer (NCT01619813); head and neck squamous cell cancer (NCTO 1166542); pancreatic adenocarcinoma (NCT00998322); and non-small cell lung cancer (NSCLC) (NCT 00861627); enadenotucirev (NG-348, PsiOxus, formerly known as ColoAdl), an adenovirus engineered to express a full length CD80 and an antibody fragment specific for the T-cell receptor CD3 protein, in ovarian cancer (NCT02028117); metastatic or advanced epithelial tumors such as in colorectal cancer, bladder cancer, head and neck squamous cell carcinoma and salivary gland cancer (NCT02636036); ONCOS-1(Targovax/formerly Oncos), an adenovirus engineered to express GM-CSF, in melanoma (NCT03003676); and peritoneal disease, colorectal cancer or ovarian cancer (NCT02963831); GE- 113 WO 2022/120354 PCT/US2021/072684 ONC1 (GLV-lh68/GLV-lhl53, Genelux GmbH), vaccinia viruses engineered to express beta- galactosidase (beta-gal)/beta-glucoronidase or beta-gal/human sodium iodide symporter (hNIS), respectively, were studied in peritoneal carcinomatosis (NCT01443260); fallopian tube cancer, ovarian cancer (NCT 02759588); or CG0070 (Cold Genesys), an adenovirus engineered to express GM-CSF, in bladder cancer (NCT02365818). [00369]In some embodiments, an immuno-oncology agent is selected from JX-9(SillaJen/formerly Jennerex Biotherapeutics), a TK- and vaccinia growth factor-deficient vaccinia virus engineered to express cytosine deaminase, which is able to convert the prodrug 5- fluorocytosine to the cytotoxic drug 5-fluorouracil; TG01 and TG02 (Targovax/formerly Oncos), peptide-based immunotherapy agents targeted for difficult-to-treat RAS mutations; and TILT-1(TILT Biotherapeutics), an engineered adenovirus designated: Ad5/3-E2F-delta24-hTNFa-IRES- hIL20; and VSV-GP (ViraTherapeutics) a vesicular stomatitis virus (VSV) engineered to express the glycoprotein (GP) of lymphocytic choriomeningitis virus (LCMV), which can be further engineered to express antigens designed to raise an antigen-specific CD8+ T cell response. [00370]In some embodiments, an immuno-oncology agent is a T-cell engineered to express a chimeric antigen receptor, or CAR. The T-cells engineered to express such chimeric antigen receptor are referred to as a CAR-T cells. [00371]CARs have been constructed that consist of binding domains, which may be derived from natural ligands, single chain variable fragments (scFv) derived from monoclonal antibodies specific for cell-surface antigens, fused to endodomains that are the functional end of the T-cell receptor (TCR), such as the CD3-zeta signaling domain from TCRs, which is capable of generating an activation signal in T lymphocytes. Upon antigen binding, such CARs link to endogenous signaling pathways in the effector cell and generate activating signals similar to those initiated by the TCR complex. [00372]For example, in some embodiments the CAR-T cell is one of those described in U.S. Patent 8,906,682 (June et al.; hereby incorporated by reference in its entirety), which discloses CAR-T cells engineered to comprise an extracellular domain having an antigen binding domain (such as a domain that binds to CD 19), fused to an intracellular signaling domain of the T cell antigen receptor complex zeta chain (such as CD3 zeta). When expressed in the T cell, the CAR is able to redirect antigen recognition based on the antigen binding specificity. In the case of CD 19, the antigen is expressed on malignant B cells. Over 200 clinical trials are currently in 114 WO 2022/120354 PCT/US2021/072684 progress employing CAR-T in a wide range of indications. [https://clinicaltrials.gov/ct2/results?term=chimeric+antigen+receptors&pg=l ]. [00373]In some embodiments, an immunostimulatory agent is an activator of retinoic acid receptor-related orphan receptor y (RORyt). RORyt is a transcription factor with key roles in the differentiation and maintenance of Type 17 effector subsets of CD4+ (Thl7) and CD8+ (Tcl7) T cells, as well as the differentiation of IL-17 expressing innate immune cell subpopulations such as NK cells. In some embodiments, an activator of RORyt is LYC-55716 (Lycera), which is currently being evaluated in clinical trials for the treatment of solid tumors (NCT02929862). [00374]In some embodiments, an immunostimulatory agent is an agonist or activator of a toll- like receptor (TLR). Suitable activators of TLRs include an agonist or activator of TLR9 such as SD-101 (Dynavax). SD-101 is an immunostimulatory CpG which is being studied for B-cell, follicular and other lymphomas (NCTO2254772). Agonists or activators of TLR8 which may be used in the present invention include motolimod (VTX-2337, VentiRx Pharmaceuticals) which is being studied for squamous cell cancer of the head and neck (NCT02124850) and ovarian cancer (NCT02431559). [00375]Other immuno-oncology agents that can be used in the present invention include urelumab (BMS-663513, Bristol-Myers Squibb), an anti-CD137 monoclonal antibody; varlilumab (CDX-1127, Celldex Therapeutics), an anti-CD27 monoclonal antibody; BMS-986178 (Bristol- Myers Squibb), an anti-OX40 monoclonal antibody; lirilumab (IPH2102/BMS-986015, Innate Pharma, Bristol-Myers Squibb), an anti-KIR monoclonal antibody; monalizumab (IPH2201, Innate Pharma, AstraZeneca) an anti-NKG2A monoclonal antibody; andecaliximab (GS-5745, Gilead Sciences), an anti-MMP9 antibody; MK-4166 (Merck & Co.), an anti-GITR monoclonal antibody. [00376]In some embodiments, an immunostimulatory agent is selected from elotuzumab, mifamurtide, an agonist or activator of a toll-like receptor, and an activator of RORyt. [00377]In some embodiments, an immunostimulatory therapeutic is recombinant human interleukin 15 (rhIL-15). rhIL-15 has been tested in the clinic as a therapy for melanoma and renal cell carcinoma (NCT01021059 and NCT01369888) and leukemias (NCT02689453). In some embodiments, an immunostimulatory agent is recombinant human interleukin 12 (rhIL-12). In some embodiments, an IL-15 based immunotherapeutic is heterodimeric IL-15 (hetIL-15, Novartis/Admune), a fusion complex composed of a synthetic form of endogenous IL- 115 WO 2022/120354 PCT/US2021/072684 complexed to the soluble IL-15 binding protein IL-15 receptor alpha chain (IL15:sIL-15RA), which has been tested in Phase 1 clinical trials for melanoma, renal cell carcinoma, non-small cell lung cancer and head and neck squamous cell carcinoma (NCT02452268). In some embodiments, a recombinant human interleukin 12 (rhIL-12) is NM-IL-12 (Neumedicines, Inc.), NCT02544724, or NCT02542124. [00378]In some embodiments, an immuno-oncology agent is selected from those descripted in Jerry L. Adams et al., "Big opportunities for small molecules in immuno-oncology, " Cancer Therapy 2015,Vol. 14, pages 603-622, the content of which is incorporated herein by reference in its entirety. In some embodiments, an immuno-oncology agent is selected from the examples described in Table 1 of Jerry L. Adams et al. In some embodiments, an immuno-oncology agent is a small molecule targeting an immuno-oncology target selected from those listed in Table 2 of Jerry L. Adams et al. In some embodiments, an immuno-oncology agent is a small molecule agent selected from those listed in Table 2 of Jerry L. Adams et al. [00379]In some embodiments, an immuno-oncology agent is selected from the small molecule immuno-oncology agents described in Peter L. Toogood, "Small molecule immuno-oncology therapeutic agents," Bioorganic & Medicinal Chemistry Letters 2018,Vol. 28, pages 319-329, the content of which is incorporated herein by reference in its entirety. In some embodiments, an immuno-oncology agent is an agent targeting the pathways as described in Peter L. Toogood. [00380]In some embodiments, an immuno-oncology agent is selected from those described in Sandra L. Ross et al., "Bispecific T cell engager (BITE® ) antibody constructs can mediate bystander tumor cell killing ", PL0S ONE 12(8): 60183390, the content of which is incorporated herein by reference in its entirety. In some embodiments, an immuno-oncology agent is a bispecific T cell engager (BITE®) antibody construct. In some embodiments, a bispecific T cell engager (BITE®) antibody construct is a CD19/CD3 bispecific antibody construct. In some embodiments, abispecific T cell engager (BITE®) antibody construct is an EGFR/CD3 bispecific antibody construct. In some embodiments, abispecific T cell engager (BITE®) antibody construct activates T cells. In some embodiments, a bispecific T cell engager (BITE®) antibody construct activates T cells, which release cytokines inducing upregulation of intercellular adhesion molecule (ICAM-1) and FAS on bystander cells. In some embodiments, a bispecific T cell engager (BITE®) antibody construct activates T cells which result in induced bystander cell lysis. In some embodiments, the bystander cells are in solid tumors. In some embodiments, the bystander cells 116 WO 2022/120354 PCT/US2021/072684 being lysed are in proximity to the BITE®-activated T cells. In some embodiment, the bystander cells comprises tumor-associated antigen (TAA) negative cancer cells. In some embodiment, the bystander cells comprise EGFR-negative cancer cells. In some embodiments, an immuno- oncology agent is an antibody which blocks the PD-L1/PD1 axis and/or CTLA4. In some embodiments, an immuno-oncology agent is an ex vivo expanded tumor-infiltrating T cell. In some embodiments, an immuno-oncology agent is a bispecific antibody construct or chimeric antigen receptors (CARs) that directly connect T cells with tumor-associated surface antigens (TAAs).
Exemplary Immune Checkpoint Inhibitors [00381]In some embodiments, an immuno-oncology agent is an immune checkpoint inhibitor as described herein. [00382]The term "checkpoint inhibitor " as used herein relates to agents useful in preventing cancer cells from avoiding the immune system of the patient. One of the major mechanisms of anti-tumor immunity subversion is known as "T-cell exhaustion, " which results from chronic exposure to antigens that has led to up-regulation of inhibitory receptors. These inhibitory receptors serve as immune checkpoints in order to prevent uncontrolled immune reactions. [00383]PD-1 and co-inhibitory receptors such as cytotoxic T-lymphocyte antigen 4 (CTLA-4, B and T Lymphocyte Attenuator (BTLA; CD272), T cell Immunoglobulin and Mucin domain-(Tim-3), Lymphocyte Activation Gene-3 (Lag-3; CD223), and others are often referred to as a checkpoint regulators. They act as molecular "gatekeepers " that allow extracellular information to dictate whether cell cycle progression and other intracellular signaling processes should proceed. [00384]In some embodiments, an immune checkpoint inhibitor is an antibody to PD-1. PD-binds to the programmed cell death 1 receptor (PD-1) to prevent the receptor from binding to the inhibitory ligand PDL-1, thus overriding the ability of tumors to suppress the host anti-turn or immune response. [00385]In one aspect, the checkpoint inhibitor is a biologic therapeutic or a small molecule. In another aspect, the checkpoint inhibitor is a monoclonal antibody, a humanized antibody, a fully human antibody, a fusion protein or a combination thereof. In a further aspect, the checkpoint inhibitor inhibits a checkpoint protein selected from CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, 117 WO 2022/120354 PCT/US2021/072684 BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK 1, CHK2, A2aR, B-7 family ligands or a combination thereof. In an additional aspect, the checkpoint inhibitor interacts with a ligand of a checkpoint protein selected from CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK 1, CHK2, A2aR, B-7 family ligands or a combination thereof. In an aspect, the checkpoint inhibitor is an immunostimulatory agent, a T cell growth factor, an interleukin, an antibody, a vaccine or a combination thereof. In a further aspect, the interleukin is IL-7 or IL-15. In a specific aspect, the interleukin is glycosylated IL-7. In an additional aspect, the vaccine is a dendritic cell (DC) vaccine. [00386]Checkpoint inhibitors include any agent that blocks or inhibits in a statistically significant manner, the inhibitory pathways of the immune system. Such inhibitors may include small molecule inhibitors or may include antibodies, or antigen binding fragments thereof, that bind to and block or inhibit immune checkpoint receptors or antibodies that bind to and block or inhibit immune checkpoint receptor ligands. Illustrative checkpoint molecules that can be targeted for blocking or inhibition include, but are not limited to, CTLA-4, PDL1, PDL2, PD1, B7-H3, B7- H4, BTLA, HVEM, GAL9, LAG3, TIM3, VISTA, KIR, 2B4 (belongs to the CD2 family of molecules and is expressed on all NK, y5, and memory CD8+ (aP) T cells), CD160 (also referred to as BY55), CGEN-15049, CHK 1 and CHK2 kinases, A2aR, and various B-7 family ligands. B7 family ligands include, but are not limited to, B7- 1, B7-2, B7-DC, B7-H1, B7-H2, B7-H3, B7- H4, B7-H5, B7-H6 and B7-H7. Checkpoint inhibitors include antibodies, or antigen binding fragments thereof, other binding proteins, biologic therapeutics, or small molecules, that bind to and block or inhibit the activity of one or more of CTLA-4, PDL1, PDL2, PD1, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD 160 and CGEN-15049. Illustrative immune checkpoint inhibitors include, but are not limited to, Tremelimumab (CTLA-4 blocking antibody), anti-OX40, PD-L1 monoclonal Antibody (Anti-B7-Hl; MEDI4736), MK-3475 (PD-1 blocker), Nivolumab (anti-PDl antibody), CT-011 (anti-PDl antibody), BY55 monoclonal antibody, AMP224 (anti-PDLl antibody), BMS- 936559 (anti-PDLl antibody), MPLDL3280A (anti-PDLl antibody), MSB0010718C (anti-PDLl antibody), and ipilimumab (anti-CTLA-4 checkpoint inhibitor). Checkpoint protein ligands include, but are not limited to PD-L1, PD-L2, B7-H3, B7- H4, CD28, CD86 and TIM-3. 118 WO 2022/120354 PCT/US2021/072684 id="p-387" id="p-387" id="p-387" id="p-387" id="p-387" id="p-387" id="p-387" id="p-387" id="p-387" id="p-387" id="p-387" id="p-387" id="p-387" id="p-387"
id="p-387"
[00387]In certain embodiments, the immune checkpoint inhibitor is selected from a PD-antagonist, a PD-L1 antagonist, and a CTLA-4 antagonist. In some embodiments, the checkpoint inhibitor is selected from the group consisting of nivolumab ( [00388]OPDIVO®), ipilimumab (YERVOY®), and pembrolizumab (KEYTRUDA@). In some embodiments, the checkpoint inhibitor is selected from nivolumab (anti-PD-1 antibody, OPDIVO®, Bristol-Myers Squibb); pembrolizumab (anti-PD-1 antibody, KEYTRUDA@, Merck); ipilimumab (anti-CTLA-4 antibody, YERVOY®, Bristol-Myers Squibb); durvalumab (anti-PD-Ll antibody, IMFINZI@, AstraZeneca); and atezolizumab (anti-PD-Ll antibody, TECENTRIQ®, Genentech). [00389]In some embodiments, the checkpoint inhibitor is selected from the group consisting of lambrolizumab (MK-3475), nivolumab (BMS-936558), pidilizumab (CT-011), AMP-224, MDX-1105, MEDI4736, MPDL3280A, BMS-936559, ipilimumab, lirlumab, IPH2101, pembrolizumab (KEYTRUDA®), and tremelimumab. [00390]In some embodiments, an immune checkpoint inhibitor is REGN2810 (Regeneron), an anti-PD-1 antibody tested in patients with basal cell carcinoma (NCT03132636); NSCLC (NCT03088540); cutaneous squamous cell carcinoma (NCT02760498); lymphoma (NCT02651662); and melanoma (NCT03002376); pidilizumab (CureTech), also known as CT- Oil, an antibody that binds to PD-1, in clinical trials for diffuse large B-cell lymphoma and multiple myeloma; avelumab (BAVENCIO@, Pfizer/Merck KGaA), also known as MSB0010718C), a fully human IgGl anti-PD-Ll antibody, in clinical trials for non-small cell lung cancer, Merkel cell carcinoma, mesothelioma, solid tumors, renal cancer, ovarian cancer, bladder cancer, head and neck cancer, and gastric cancer; or PDR001 (Novartis), an inhibitory antibody that binds to PD-1, in clinical trials for non-small cell lung cancer, melanoma, triple negative breast cancer and advanced or metastatic solid tumors. Tremelimumab (CP-675,206; Astrazeneca) is a fully human monoclonal antibody against CTLA-4 that has been in studied in clinical trials for a number of indications, including: mesothelioma, colorectal cancer, kidney cancer, breast cancer, lung cancer and non-small cell lung cancer, pancreatic ductal adenocarcinoma, pancreatic cancer, germ cell cancer, squamous cell cancer of the head and neck, hepatocellular carcinoma, prostate cancer, endometrial cancer, metastatic cancer in the liver, liver cancer, large B-cell lymphoma, ovarian cancer, cervical cancer, metastatic anaplastic thyroid cancer, urothelial cancer, fallopian tube cancer, multiple myeloma, bladder cancer, soft tissue sarcoma, and melanoma. AGEN-18 119 WO 2022/120354 PCT/US2021/072684 (Agenus) is an anti-CTLA4 antibody that is being studied in Phase 1 clinical trials for advanced solid tumors (NCT02694822). [00391]In some embodiments, a checkpoint inhibitor is an inhibitor of T-cell immunoglobulin mucin containing protein-3 (TIM-3). TIM-3 inhibitors that may be used in the present invention include TSR-022, LY3321367 and MBG453. TSR-022 (Tesaro) is an anti-TIM-3 antibody which is being studied in solid tumors (NCT02817633). LY3321367 (Eli Lilly) is an anti-TIM-antibody which is being studied in solid tumors (NCT03099109). MBG453 (Novartis) is an anti- TIM-3 antibody which is being studied in advanced malignancies (NCT02608268). [00392]In some embodiments, a checkpoint inhibitor is an inhibitor of T cell immunoreceptor with Ig and ITIM domains, or TIGIT, an immune receptor on certain T cells and NK cells. TIGIT inhibitors that may be used in the present invention include BMS-986207 (Bristol-Myers Squibb), an anti-TIGIT monoclonal antibody (NCT02913313); OMP-313M32 (Oncomed); and anti-TIGIT monoclonal antibody (NCTO3 119428). [00393]In some embodiments, a checkpoint inhibitor is an inhibitor of Lymphocyte Activation Gene-3 (LAG-3). LAG-3 inhibitors that may be used in the present invention include BMS- 986016 and REGN3767 and IMP321. BMS-986016 (Bristol-Myers Squibb), an anti-LAG-antibody, is being studied in glioblastoma and gliosarcoma (NCT02658981). REGN37(Regeneron), is also an anti-LAG-3 antibody, and is being studied in malignancies (NCT03005782). IMP321 (Immutep S.A.) is an LAG-3-Ig fusion protein, being studied in melanoma (NCT02676869); adenocarcinoma (NCT02614833); and metastatic breast cancer (NCT00349934). [00394]Checkpoint inhibitors that may be used in the present invention include OX40 agonists. OX40 agonists that are being studied in clinical trials include PF-04518600/PF-8600 (Pfizer), an agonistic anti-OX40 antibody, in metastatic kidney cancer (NCT03092856) and advanced cancers and neoplasms (NCT02554812; NCT05082566); GSK3174998 (Merck), an agonistic anti-OXantibody, in Phase 1 cancer trials (NCT02528357); MEDI0562 (Medimmune/AstraZeneca), an agonistic anti-OX40 antibody, in advanced solid tumors (NCTO23 18394 and NCT02705482); MEDI6469, an agonistic anti-OX40 antibody (Medimmune/AstraZeneca), in patients with colorectal cancer (NCT02559024), breast cancer (NCT01862900), head and neck cancer (NCT02274155) and metastatic prostate cancer (NCT01303705); and BMS-986178 (Bristol- Myers Squibb) an agonistic anti-OX40 antibody, in advanced cancers (NCT02737475). 120 WO 2022/120354 PCT/US2021/072684 id="p-395" id="p-395" id="p-395" id="p-395" id="p-395" id="p-395" id="p-395" id="p-395" id="p-395" id="p-395" id="p-395" id="p-395" id="p-395" id="p-395"
id="p-395"
[00395]Checkpoint inhibitors that may be used in the present invention include CD137 (also called 4-1BB) agonists. CD137 agonists that are being studied in clinical trials include utomilumab (PF-05082566, Pfizer) an agonistic anti-CD137 antibody, in diffuse large B-cell lymphoma (NCTO2951 156) and in advanced cancers and neoplasms (NCT02554812 and NCT05082566); urelumab (BMS-663513, Bristol-Myers Squibb), an agonistic anti-CD1antibody, in melanoma and skin cancer (NCT02652455) and glioblastoma and gliosarcoma (NCT02658981); and CTX-471 (Compass Therapeutics), an agonistic anti-CD137 antibody in metastatic or locally advanced malignancies (NCT03881488). [00396]Checkpoint inhibitors that may be used in the present invention include CD27 agonists. CD27 agonists that are being studied in clinical trials include varlilumab (CDX-1127, Celldex Therapeutics) an agonistic anti-CD27 antibody, in squamous cell head and neck cancer, ovarian carcinoma, colorectal cancer, renal cell cancer, and glioblastoma (NCT02335918); lymphomas (NCT01460134); and glioma and astrocytoma (NCT02924038). [00397]Checkpoint inhibitors that may be used in the present invention include glucocorticoid- induced tumor necrosis factor receptor (GITR) agonists. GITR agonists that are being studied in clinical trials include TRX518 (Leap Therapeutics), an agonistic anti-GITR antibody, in malignant melanoma and other malignant solid tumors (NCT01239134 and NCT02628574); GWN3(Novartis), an agonistic anti-GITR antibody, in solid tumors and lymphoma (NCT 02740270);INCAGN01876 (Incyte/Agenus), an agonistic anti-GITR antibody, in advanced cancers (NCT02697591 and NCT03126110); MK-4166 (Merck), an agonistic anti-GITR antibody, in solid tumors (NCT02132754) and MEDI1873 (Medimmune/AstraZeneca), an agonistic hexameric GITR-ligand molecule with a human IgGl Fc domain, in advanced solid tumors (NCT02583165). [00398]Checkpoint inhibitors that may be used in the present invention include inducible T- cell co-stimulator (ICOS, also known as CD278) agonists. ICOS agonists that are being studied in clinical trials include MEDI-570 (Medimmune), an agonistic anti-ICOS antibody, in lymphomas (NCT02520791); GSK3359609 (Merck), an agonistic anti-ICOS antibody, in Phase (NCT02723955); JTX-2011 (Jounce Therapeutics), an agonistic anti-ICOS antibody, in Phase (NCT02904226). [00399]Checkpoint inhibitors that may be used in the present invention include killer IgG-like receptor (KIR) inhibitors. KIR inhibitors that are being studied in clinical trials include lirilumab (IPH2102/BMS-986015, Innate Pharma/Bristol -Myers Squibb), an anti-KIR antibody, in 121 WO 2022/120354 PCT/US2021/072684 leukemias (NCT01687387, NCT02399917, NCT02481297, NCT02599649), multiple myeloma (NCT02252263), and lymphoma (NCT01592370); IPH2101 (1-7F9, Innate Pharma) in myeloma (NCT01222286 and NCT01217203); and IPH4102 (Innate Pharma), an anti-KIR antibody that binds to three domains of the long cytoplasmic tail (KIR3DL2), in lymphoma (NCT02593045). [00400]Checkpoint inhibitors that may be used in the present invention include CDinhibitors of interaction between CD47 and signal regulatory protein alpha (SIRPa). CD47/SIRPa inhibitors that are being studied in clinical trials include ALX-148 (Alexo Therapeutics), an antagonistic variant of (SIRPa) that binds to CD47 and prevents CD47/SIRPa-mediated signaling, in phase 1 (NCT03013218); TTI-621 (SIRPa-Fc, Trillium Therapeutics), a soluble recombinant fusion protein created by linking the N-terminal CD47-binding domain of SIRPa with the Fc domain of human IgGl, acts by binding human CD47, and preventing it from delivering its "do not eat" signal to macrophages, is in clinical trials in Phase 1 (NCT02890368 andNCT02663518); CC-90002 (Celgene), an anti-CD47 antibody, in leukemias (NCT02641002); and Hu5F9-G(Forty Seven, Inc.), in colorectal neoplasms and solid tumors (NCT02953782), acute myeloid leukemia (NCT02678338) and lymphoma (NCT02953509). [00401]Checkpoint inhibitors that may be used in the present invention include CDinhibitors. CD73 inhibitors that are being studied in clinical trials include MEDI94(Medimmune), an anti-CD73 antibody, in solid tumors (NCT02503774); and BMS-9861(Bristol-Myers Squibb), an anti-CD73 antibody, in solid tumors (NCT02754141). [00402]Checkpoint inhibitors that may be used in the present invention include agonists of stimulator of interferon genes protein (STING, also known as transmembrane protein 173, or TMEM173). Agonists of STING that are being studied in clinical trials include MK-14(Merck), an agonistic synthetic cyclic dinucleotide, in lymphoma (NCT03010176); and ADU- SI00 (MIW815, Aduro Biotech/Novartis), an agonistic synthetic cyclic dinucleotide, in Phase (NCT02675439 and NCT03172936). [00403]Checkpoint inhibitors that may be used in the present invention include CSF1R inhibitors. CSF1R inhibitors that are being studied in clinical trials include pexidartinib (PLX3397, Plexxikon), a CSF1R small molecule inhibitor, in colorectal cancer, pancreatic cancer, metastatic and advanced cancers (NCT02777710) and melanoma, non-small cell lung cancer, squamous cell head and neck cancer, gastrointestinal stromal tumor (GIST) and ovarian cancer (NCT02452424); and IMC-CS4 (LY3022855, Lilly), an anti-CSF-lR antibody, in pancreatic 122 WO 2022/120354 PCT/US2021/072684 cancer (NCT03153410), melanoma (NCT03101254), and solid tumors (NCT02718911); and BLZ945 (4-[2((lR,2R)-2-hydroxycyclohexylamino)-benzothiazol-6-yloxyl]-pyridine-2-carboxylic acid methylamide, Novartis), an orally available inhibitor of CSF1R, in advanced solid tumors (NCT02829723). [00404]Checkpoint inhibitors that can be used in the present invention include NKG2A receptor inhibitors. NKG2A receptor inhibitors that are being studied in clinical trials include monalizumab (IPH2201, Innate Pharma), an anti-NKG2A antibody, in head and neck neoplasms (NCT02643550) and chronic lymphocytic leukemia (NCT02557516). [00405]In some embodiments, the immune checkpoint inhibitor is selected from nivolumab, pembrolizumab, ipilimumab, avelumab, durvalumab, atezolizumab, or pidilizumab.
EXEMPLIFICATION [00406]The following examples are intended to illustrate the invention and are not to be construed as being limitations thereon. Unless otherwise stated, one or more tautomeric forms of compounds of the examples described hereinafter may be prepared in situ and/or isolated. All tautomeric forms of compounds of the examples described hereafter should be considered to be disclosed. Temperatures are given in degrees centigrade. If not mentioned otherwise, all evaporations are performed under reduced pressure, preferably between about 15 mm Hg and 1mm Hg (= 20-133 mbar). The structure of final products, intermediates and starting materials is confirmed by standard analytical methods, e.g., microanalysis and spectroscopic characteristics, e.g., MS, IR, NMR. Abbreviations used are those conventional in the art. [00407]All starting materials, building blocks, reagents, acids, bases, dehydrating agents, solvents, and catalysts utilized to synthesis the compounds of the present invention are either commercially available or can be produced by organic synthesis methods known to one of ordinary skill in the art. Further, the compounds of the present invention can be produced by organic synthesis methods known to one of ordinary skill in the art as shown in the following examples. Example 1: Synthesis of Exemplary Compounds [00408]Certain exemplary compounds are prepared following the following schemes. 1-1 123 WO 2022/120354 PCT/US2021/072684 Step 1: [3-(Trifluoromethyl)-l-bicyclo[l.Ll]pentanyl]methanol F HO [00409]To a solution of LiAlH4 (84.28 mg, 2.22 mmol, 2 eq) in THF (5 mL) was added 3- (trifluorom ethyl)bicyclo[ 1.1.1 ]pentane-1-carboxylic acid (200 mg, 1.11 mmol, 1 eq) at 0°C and stirred at 25°C for 2 h. TLC (PE/EtOAc = 1/1, Rr = 0.60) indicated the starting material was consumed completely and one new spot formed. The mixture was quenched by 10% aq. NaOH (0.5 mL) and the precipitated solid was filtered and the filtrate was concentrated to yield [3- (trifluorom ethyl)-l-bicyclo[l.l.l]pentanyl]methan 01 (180 mg, 975.08 umol, 87.8% yield, 90% purity) as colorless oil, which was used in the next step without further purification. 1HNMR (5MHz, CDC13) 8 ppm 3.67 (s, 2H), 1.92 (s, 6H).
Step 2: [3-(Trifluoromethyl)-l-bicyclo[l.Ll]pentanyl]methyl methanesulfonate F TsO [00410]To a solution of [3-(trifluorom ethyl)-l-bicyclo[l.l.l]pentanyl]methanol (180 mg, 975.08 umol, 90% purity, 1 eq) and Et3N (197.33 mg, 1.95 mmol, 271.44 pL, 2 eq) in DCM (mL) was added MsCl (170 mg, 1.48 mmol, 114.86 pL, 1.52 eq) dropwise at 0 °C and the mixture stirred at 25°C for 2 h. TLC (PE/EtOAc = 1/1, Rf = 0.67) indicated the starting material was consumed completely and one new spot formed. The mixture was quenched with sat. a^.NaHCO(10 mL) and extracted with DCM (15 mL x 2). The combined organic phase was dried over anhydrous Na2SO4, filtered and concentrated to yield [3-(trifluoromethyl)- 1- bicyclo[l.l.l]pentanyl]methyl methanesulfonate (230 mg, 894.65 pmol, 91.8% yield, 95.0% purity) as a colorless gum, which was used in the next step without further purification. 1H NMR (400 MHz, CDC13) 8 ppm 4.25 (s, 2H), 3.02 (s, 3H), 2.02 (s, 6H). 124 WO 2022/120354 PCT/US2021/072684 Step 3: -|(LS.5/?)-3-||3-( rrinuoromethyl)-l-hicyclo| 1.1.1 |pentanyl|methyl|-3- azabicyclo [3.1.0] hexan-6-yl] prop-2-enamide id="p-411" id="p-411" id="p-411" id="p-411" id="p-411" id="p-411" id="p-411" id="p-411" id="p-411" id="p-411" id="p-411" id="p-411" id="p-411" id="p-411"
id="p-411"
[00411]To a solution of A-[(lS,5A)-3-azabicyclo[3.1.0]hexan-6-yl]prop-2-enamide (120 mg, 360.61 umol, 80% purity, 1 eq, TFA) and [3-(trifluoromethyl)-l-bicyclo[l.l.l]pentanyl]methyl methanesulfonate (92.71 mg, 360.61 umol, 95% purity, 1 eq) in ACN (3 mL) were added K2CO3 (149.52 mg, 1.08 mmol, 3 eq) and KI (5.99 mg, 36.06 umol, 0.1 eq). The mixture was stirred at °C for 16 h. The solvent was removed to yield a residue which was purified by preparative HPLC (column: Welch Xtimate C18 150*25mm*5um; mobile phase: [water (10 mMNH4HCO3)- ACN]; B%: 48%-78%, lOmin), followed by lyophilization to yield A-[(lS,5A)-3-[[3- (trifluoromethyl)- 1-bicyclo[ 1.1. l]pentanyl]methyl]-3-azabicyclo[3. 1.0]hexan-6-yl]prop-2- enamide (18.28 mg, 60.87 umol, 16.9% yield, 100.0% purity) as a white solid. 1H NMR (5MHz, CDCI3) 8 ppm 6.26 (d, J= 16.9 Hz, 1H), 6.01 (dd, J= 10.4, 16.9 Hz, 1H), 5.61 (d, J= 10.Hz, 1H), 5.54 (br s, 1H), 3.17 (d, J= 8.9 Hz, 2H), 3.02 (d, J= 2.0 Hz, 1H), 2.51 (s, 2H), 2.37 (d, J= 8.4 Hz, 2H), 1.86 (s, 6H), 1.61 (s, 2H); ES-LCMS m/z 301.2 [M+H]+. id="p-412" id="p-412" id="p-412" id="p-412" id="p-412" id="p-412" id="p-412" id="p-412" id="p-412" id="p-412" id="p-412" id="p-412" id="p-412" id="p-412"
id="p-412"
[00412]To a solution of 4-(trifluoromethyl)bicyclo[2.2.2]octane-l-carboxylic acid (300 mg, 1.35 mmol, 1 eq) in THF (5 mL) was added LiAlH4 (102.49 mg, 2.70 mmol, 2 eq) at 25 °C. The mixture was stirred at 25 °C for 1 h. TLC (PE/EtOAc = 3/1, Rf = 0.59) indicated the starting material was consumed completely and one new spot formed. The mixture was quenched by 10% aq. NaOH (0.5 mL) and the precipitated solid was filtered and the filtrate was concentrated to yield [4-(trifluoromethyl)-l-bicyclo[2.2.2]octanyl]methanol (280 mg, 1.28 mmol, 94.6% yield, 95.0% purity) as colorless gum, which was used in the next step without further purification. 1H NMR 125 WO 2022/120354 PCT/US2021/072684 (400 MHz, CDC13) 8 ppm 3.30 (s, 2H), 1.76-1.65 (m, 6H), 1.51-1.41 (m, 6H).
Step 2: 4-(Trifluoromethyl)bicyclo[2.2.2]octane-l-carbaldehyde ^CF3 id="p-413" id="p-413" id="p-413" id="p-413" id="p-413" id="p-413" id="p-413" id="p-413" id="p-413" id="p-413" id="p-413" id="p-413" id="p-413" id="p-413"
id="p-413"
[00413]To a solution of [4-(trifluoromethyl)-l-bicyclo[2.2.2]octanyl]methanol (50 mg, 228.pmol, 95% purity, 1 eq) in DCM (3 mL) was added PCC (98.35 mg, 456.25 umol, 2 eq). The mixture was stirred at 25 °C for 1 h. TLC (PE/EtOAc = 3/1, Rf = 0.75) indicated the starting material was consumed completely and one new spot formed. The solvent was removed to yield a residue which was purified by flash silica gel chromatography (from PE/EtOAc =2/1, TLC: PE/EtOAc = 3/1, Rf = 0.75) to yield 4-(trifluoromethyl)bicyclo[2.2.2]octane-l-carbaldehyde (mg, 223.08 pmol, 97.8% yield, 92.0% purity) as yellow oil. 1H NMR (400 MHz, CDCI3) 8 ppm 9.47 (s, 1H), 1.76-1.69 (m, 12H).
Step 3: -|( 1/?.5.S)-3-||4-( rrinuoromethyl)-l-hicyclo|2.2.2|octanyl|methyl|-3- azabicyclo [3.1.0] hexan-6-yl] prop-2-enamide id="p-414" id="p-414" id="p-414" id="p-414" id="p-414" id="p-414" id="p-414" id="p-414" id="p-414" id="p-414" id="p-414" id="p-414" id="p-414" id="p-414"
id="p-414"
[00414]To a solution of A-[(lS,5A)-3-azabicyclo[3.1.0]hexan-6-yl]prop-2-enamide (120 mg, 360.61 pmol, 80% purity, 1 eq, TFA) and TEA (36.49 mg, 360.61 pmol, 50.19 pL, 1 eq) inMeOH (10 mL) was added 4-(trifluoromethyl)bicyclo[2.2.2]octane-l-carbaldehyde (47.43 mg, 211.pmol, 92% purity). The mixture was stirred at 25 °C for 2 h. NaBH3CN (67.98 mg, 1.08 mmol, eq) was added and the mixture was stirred at 25 °C for 16 h. The solvent was removed to yield a residue which was purified by preparative HPLC (column: Agela DuraShell C150*25mm*5um;mobile phase: [water(0.05% NH3H20+10 mM NH4HCO3)-ACN];B%: 51%- 81%,10min), followed by lyophilization to yield N-[(IR,5S)-3-[[4-(trifluoromethyl)-1- bicyclo[2.2.2]octanyl]methyl]-3-azabicyclo[3.1.0]hexan-6-yl]prop-2-enamide (24.64 mg, 71.pmol, 20.0% yield, 100.0% purity) as a white solid. 1HNMR (400 MHz, CDC13) 8 ppm 6.31-6.(m, 1H), 6.01 (dd, J= 10.3, 17.1 Hz, 1H), 5.61 (dd,J= 1.1, 10.1 Hz, 1H), 5.49 (br s, 1H), 3.13 (d, J=8.8Hz, 2H), 3.02 (d, J= 1.7 Hz, 1H), 2.48 (d, 8.3 Hz, 2H), 2.13 (s, 2H), 1.68-1.59 (m, 6H), 126 WO 2022/120354 PCT/US2021/072684 1.49 (s, 2H), 1.43-1.32 (m, 6H); ES-LCMS m/z 343.2 [M+H]+. 1-9 DIEA, DCM Sn(n-Bu)3Pd(dppf)CI 2, DMF Step 1: tert-Butyl (2-bromo-4-nitrophenyl)(4-(trifluoromethyl)benzyl)carbamate id="p-415" id="p-415" id="p-415" id="p-415" id="p-415" id="p-415" id="p-415" id="p-415" id="p-415" id="p-415" id="p-415" id="p-415" id="p-415" id="p-415"
id="p-415"
[00415]To a solution of 2-bromo-4-nitro-A-[[4-(trifluoromethyl)phenyl]methyl]aniline (1.g, 2.67 mmol, 91.1% purity, 1 eq) in DCM (10 mL) was added (Boc)2O (1.75 g, 8.00 mmol, 1.mL, 3 eq) and DMAP (325.66 mg, 2.67 mmol, 1 eq). The mixture was stirred at 25 °C for 12 h. The reaction mixture was concentrated to yield a residue which was purified by flash silica gel chromatography (from PE/EtOAc = 1/0 tol0/l, TEC: PE/EtOAc =10/1, Rf = 0.51) to yield tert- butyl A-(2-bromo-4-nitro-phenyl)-A-[[4-(trifluoromethyl)phenyl]methyl]carbamate (1.15 g, 2.mmol, 89.9% yield, 98.7% purity) as a white solid. 1H NMR (400 MHz, CDC13) 5 ppm 8.49 (br s, 1H), 8.06 (d, J = 7.8 Hz, 1H), 7.57 (d, J = 7.4 Hz, 2H), 7.36 (d, J = 8.2 Hz, 2H), 5.20 (d, J = 14.Hz, 1H), 4.39 (d, J= 15.7 Hz, 1H), 1.57-1.40 (m, 9H); ES-LCMS m/z 375.3[M-B0c+H] +.
Step 2: tert-Butyl (4-amino-2-bromophenyl)(4-(trifluoromethyl)benzyl)carbamate id="p-416" id="p-416" id="p-416" id="p-416" id="p-416" id="p-416" id="p-416" id="p-416" id="p-416" id="p-416" id="p-416" id="p-416" id="p-416" id="p-416"
id="p-416"
[00416]To a solution of tert-butyl A-(2-bromo-4-nitro-phenyl)-A-[[4- (trifluoromethyl)phenyl]methyl]carbamate (1.11 g, 2.31 mmol, 98.7%, 1 eq) in EtOH (5 mL) and H2O (5 mL) was added Fe (646.28 mg, 11.57 mmol, 5 eq) andNH4Cl (1.24 g, 23.15 mmol, 10 eq). 127 WO 2022/120354 PCT/US2021/072684 The mixture was stirred at 80 °C for 1 h. The reaction mixture was quenched by addition of water (40 mL) and extracted with EtOAc (30 mL x 3). The combined organic layers were washed with brine (10 mL), dried over Na2SO4, filtered and concentrated under reduced pressure to yield tert- butyl A-(4-amino-2-bromo-phenyl)-7V-[[4-(trifluoromethyl)phenyl]methyl]carbamate (1.01 g, 2.06 mmol, 89.1% yield, 91.0% purity) as a yellow solid, which was used in the next step without further purification. 1H NMR (400 MHz, CDCI3) 8 ppm 7.54 (d, J = 7.8 Hz, 2H), 7.39 (s, 2H), 6.95-6.88 (m, 1H), 6.58 (d, J = 8.6 Hz, 1H), 6.50-6.39 (m, 1H), 5.20 (d, J = 14.9 Hz, 1H), 4.27- 4.20 (m, 1H), 3.72 (s, 2H), 1.38 (s, 9H); ES-LCMS m/z 391.0 [M-Boc+H] +.
Step 3: tert-Butyl (4-acrylamido-2-bromophenyl)(4-(trifluoromethyl)benzyl)carbamate Br H [00417]To a solution of tert-butyl 7V-(4-amino-2-bromo-phenyl)-7V-[[4- (trifluoromethyl)phenyl]methyl]carbamate (250 mg, 539.00 umol, 96% purity, 1 eq) in DCM (mL) was added acryloyl chloride (73.18 mg, 808.49 umol, 65.92 pL, 1.5 eq) and DIEA (139.mg, 1.08 mmol, 187.77 pL, 2 eq). The mixture was stirred at 25 °C for 1 h. The reaction mixture was quenched by addition of water (50 mL) and extracted with DCM (50 mL x 3). The combined organic layers were washed with brine (10 mL), dried 0verNa2S04, filtered and concentrated under reduced pressure to yield a residue which was purified by flash silica gel chromatography (from PE/EtOAc = 1/0 to 3/1, TLC: PE/EtOAc = 3/1, Rf = 0.43) to yield tert-butyl A-[2-bromo-4-(prop- 2-enoylamino)phenyl]-A-[[4-(trifluoromethyl)phenyl]methyl]carbamate (243 mg, 486.66 pmol, 90.2% yield, 100% purity) as colorless oil. 1HNMR (400 MHz, CDCI3) 8 ppm 7.60-7.53 (m, 2H), 7.40-7.29 (m, 3H), 7.26-7.18 (m, 1H), 6.92-6.75 (m, 1H), 6.46 (d, J= 16.8 Hz, 1H), 6.21 (dd, J = 10.6, 16.8 Hz, 1H), 5.84-5.74 (m, 1H), 5.21 (d, J= 15.3 Hz, 1H), 4.30 (s, 1H), 4.26 (s, 1H), 4.(q, J = 7.2 Hz, 1H), 2.06 (s, 1H), 1.63-1.52 (m, 9H), 1.33-1.25 (m, 2H); ES-LCMS m/z 521.[M+H]+.
Step 4: tert-Butyl (4-acrylamido-2-( 1-met hyl-l//-imidazol-4-yl )phenyl )(4- (trifluoromethyl)benzyl)carbamate 128 WO 2022/120354 PCT/US2021/072684 H id="p-418" id="p-418" id="p-418" id="p-418" id="p-418" id="p-418" id="p-418" id="p-418" id="p-418" id="p-418" id="p-418" id="p-418" id="p-418" id="p-418"
id="p-418"
[00418]To a solution of tert-butyl 7V-[2-bromo-4-(prop-2-enoylamino)phenyl]-7V-[[4- (trifluoromethyl)phenyl]methyl]carbamate (200 mg, 400.54 umol, 100%, 1 eq) and tributyl-(!- methylimidazol-4-yl)stannane (234.73 mg, 600.82 umol, 95%, 1.5 eq) in DMF (7 mL) was added Pd(dppf)C12 (29.31 mg, 40.05 umol, 0.1 eq). The mixture was stirred under N2 atmosphere at 1°C for 1 h. The reaction mixture was quenched by addition of water (50 mL) and extracted with EtOAc (50 mL x 3). The combined organic layers were washed with brine (20 mL), dried over Na2SO4, filtered and concentrated under reduced pressure to yield a residue which was purified by flash silica gel chromatography (from PE/EtOAc = 1/0 to 4/5, TLC: PE/EtOAc = 3/1, Rf = 0.20) to yield tert-butyl A-[2-(l-methylimidazol-4-yl)-4-(prop-2-enoylamino)phenyl]-A-[[4- (trifluoromethyl)phenyl]methyl]carbamate (100 mg, 199.80 umol, 49.8% yield, 100.0% purity) as a yellow solid. 1H NMR (400 MHz, CDCI3) 8 ppm 7.86 (s, 1H), 7.55-7.43 (m, 4H), 7.34 (d, J = 7.8 Hz, 3H), 6.88 (br s, 1H), 6.73 (d, J =7.0 Hz, 1H), 6.45-6.35 (m, 1H), 6.25-6.14 (m, 1H), 5.(d,J = 10.6Hz, 1H), 5.18 (d, J= 14.5 Hz, 1H), 4.18-4.07 (m, 1H),4.11 (d,J = 13.7Hz, 1H), 3.(s, 3H), 1.26 (s, 9H); ES-LCMS m/z 501.2 [M+H]+.
Step 5: -(3-( 1-Methyl-1//-ini id1؛zol-4-yl)-4-((4- (trifluoromethyl)benzyl)amino)phenyl)acrylamide id="p-419" id="p-419" id="p-419" id="p-419" id="p-419" id="p-419" id="p-419" id="p-419" id="p-419" id="p-419" id="p-419" id="p-419" id="p-419" id="p-419"
id="p-419"
[00419]To a solution of tert-butyl A-[2-(l-methylimidazol-4-yl)-4-(prop-2- enoylamino)phenyl]-A-[[4-(trifluoromethyl)phenyl]methyl]carbamate (100 mg, 199.80 umol, 100%, 1 eq) in DCM (3 mL) was added TEA (3.08 g, 27.01 mmol, 2.00 mL, 135.20 eq). The 129 WO 2022/120354 PCT/US2021/072684 mixture was stirred at 25 °C for 1 h. The reaction mixture was quenched by addition of water (mL) and extracted with EtOAc (30 mL x 3). The combined organic layers were washed with brine (10 mL), dried over Na2SO4, filtered and concentrated under reduced pressure to yield a residue which was purified by preparative HPLC (column: Agela DuraShell C18 150*25mm*5pm; mobile phase: [water (0.05% NH3H2O+10mM NH4HCO3)-ACN]; B%: 40%-70%, lOmin), followed by lyophilization to yield A-[3-(l-methylimidazol-4-yl)-4-[[4-(trifluoromethyl)phenyl]methylamino]phenyl]prop-2-enamide (10.48 mg, 26.17 umol, 13.1% yield, 100.0% purity) as a yellow solid. 1H NMR (400 MHz, CDCI3) 8 ppm 8.35 (br s, 1H), 7.(s, 1H), 7.57-7.45 (m, 5H), 7.24 (br s, 1H), 7.08-6.94 (m, 2H), 6.47-6.36 (m, 2H), 6.26-6.14 (m, 1H), 5.71 (d, J= 11.3 Hz, 1H), 4.53 (s, 2H), 3.74 (s, 3H); ES-LCMS m/z 401.2 [M+H]+. 1-10 and 1-11 (isomers of 1-25) Step 1: A-[(4-Methoxyphenyl)methyl]-A-methyl-4-[[5-(trifluoromethyl)-2-pyridyl]amino]-3- vinyl-benzenesulfonamide id="p-420" id="p-420" id="p-420" id="p-420" id="p-420" id="p-420" id="p-420" id="p-420" id="p-420" id="p-420" id="p-420" id="p-420" id="p-420" id="p-420"
id="p-420"
[00420]To a solution of 3-bromo-A-[(4-methoxyphenyl)methyl]-A-methyl-4-[[5- (trifluoromethyl)-2-pyridyl]amino]benzenesulfonamide (600 mg, 1.13 mmol, 1 eq) and 4,4,5,5- tetramethyl-2-vinyl-l,3,2-dioxaborolane (348.48 mg, 2.26 mmol, 383.79 pL, 2 eq) in 1,4-dioxane (10 mL) and H2O (2 mL) was added C82CO3 (737.21 mg, 2.26 mmol, 2 eq) and Pd(dppf)C12 (82. 130 WO 2022/120354 PCT/US2021/072684 mg, 113.13 umol, 0.1 eq). The mixture was stirred under N2 atmosphere at 100 °C for 12 h. The reaction mixture was quenched by addition of water (50 mL) and extracted with EtOAc (50 mL x 3). The combined organic layers were washed with brine (30 mL), dried over Na2SO4, filtered and concentrated under reduced pressure to yield a residue which was purified by flash silica gel chromatography (from PE/EtOAc = 1/0 to 2/1, TEC: PE/EtOAc = 1/1, Rr = 0.59) to yield A-[(4- methoxyphenyl)methyl]-A-methyl-4-[[5-(trifluoromethyl)-2-pyridyl]amino]-3-vinyl- benzenesulfonamide (500 mg, 1.04 mmol, 91.6% yield, 98.9% purity) as a white solid. 1HNMR (400 MHz, CDCI3) 8 ppm 8.53 (s, 1H), 7.98-7.90 (m, 2H), 7.76 (dt, J= 2.2, 8.9 Hz, 2H), 7.25 (d, J= 8.6 Hz, 2H), 6.93-6.82 (m, 5H), 5.83 (d, J= 17.6 Hz, 1H), 5.58 (d, J= 11.0 Hz, 1H), 4.13 (s, 2H), 3.81 (s, 3H), 2.63 (s, 3H); ES-LCMS m/z 478.6 [M+H]+.
Step 2: A-Methyl-4-[[5-(trifluoromethyl)-2-pyridyl]amino]-3-vinyl-benzenesulfonamide id="p-421" id="p-421" id="p-421" id="p-421" id="p-421" id="p-421" id="p-421" id="p-421" id="p-421" id="p-421" id="p-421" id="p-421" id="p-421" id="p-421"
id="p-421"
[00421]To a solution of A-[(4-methoxyphenyl)methyl]-A-methyl-4-[[5-(trifluoromethyl)-2- pyridyl]amino]-3-vinyl-benzenesulfonamide (500 mg, 1.04 mmol, 98.9% purity, 1 eq) in DCM (mL) was added TEA (1.52 g, 13.37 mmol, 989.70 pL, 12.90 eq). The mixture was stirred at 25 °C for 2 h. The reaction mixture was quenched by addition of water (50 mL) and extracted with EtOAc (30 mL x 3). The combined organic layers were washed with brine (20 mL), dried over Na2SO4, filtered and concentrated under reduced pressure to yield a residue which was purified by flash silica gel chromatography (from PE/EtOAc = 1/0 to 2/1, TLC: PE/EtOAc = 2/1, Rf = 0.49) to yield A-methyl-4-[[5-(trifluoromethyl)-2-pyridyl]amino]-3-vinyl-benzenesulfonamide (300 mg, 805.umol, 77.7% yield, 95.9% purity) as colorless oil. 1HNMR (400 MHz, CDC13) 8 ppm 8.50 (s, 1H), 7.97 (d, J= 2.0 Hz, 1H), 7.89 (d, J= 8.6 Hz, 1H), 7.77 (dt, J= 2.1, 8.5 Hz, 2H), 6.94 (s, 1H), 6.90- 6.80 (m, 2H), 5.83 (d, J= YlAHz, 1H), 5.56 (d, J = 11.2 Hz, 1H), 4.51 (q,J=5.1 Hz, 1H), 2.(d, J = 5.4 Hz, 3H); ES-LCMS m/z 358.1 [M+H]+. 131 WO 2022/120354 PCT/US2021/072684 Step 3: 3-[(5S)-3-Bromo-4,5-dihydroisoxazol-5-yl]-/V-methyl-4-[[5-(trifluoromethyl)-2- pyridyljaminojbenzenesulfonamideand 3-[(5R)-3-bromo-4,5-dihydroisoxazol-5-yl]-/V- methyl-4-[[5-(trifluoromethyl)-2-pyridyl]amino]benzenesulfonamide id="p-422" id="p-422" id="p-422" id="p-422" id="p-422" id="p-422" id="p-422" id="p-422" id="p-422" id="p-422" id="p-422" id="p-422" id="p-422" id="p-422"
id="p-422"
[00422]To a stirred solution of A-methyl-4-[[5-(trifluoromethyl)-2-pyridyl]amino]-3-vinyl- benzenesulfonamide (270 mg, 724.58 umol, 95.9%, 1 eq) and dibromomethanone oxime (293.mg, 1.45 mmol, 2 eq) in EtOAc (10 mL) was added NaHCO3 (608.70 mg, 7.25 mmol, 281.80 pL, eq). The reaction mixture was stirred at 25 °C for 2 h. The reaction mixture was quenched by addition of water (50 mL) and extracted with EtOAc (50 mL x 3). The combined organic layers were washed with brine (50 mL), dried over Na2SO4, filtered and concentrated under reduced pressure to yield a residue which was purified by preparative HPLC (column: Agela DuraShell C18 150*25mm*5pm; mobile phase: [water (0.05% NH3 H2O+10mM NH4HCO3)-ACN]; B%: 40%-70%, lOmin), followed by lyophilization to yield the mixture which was separated by chiral SEC column: DAICEL CHIRALPAK IG (250mm*30mm, 10pm); mobile phase: [0.1% NH3 H2O MEOH]; B%: 40%-40%) to yield Peak 1 and Peak 2. Peak 1 was concentrated under reduced pressure to yield a residue which was dissolved in MeCN (10 mL) and H2O (20 mL) and lyophilized to yield 3-[(5S)-3-bromo-4,5-dihydroisoxazol-5-yl]-7V-methyl-4-[[5-(trifluoromethyl)- 2-pyridyl]amino]benzenesulfonamide (44.51 mg, 92.87 pmol, 12.8% yield, 100.0% purity, SFC: Rt = 1.658, ee = 100%, [a]314D = -44.4 (CH OH, c = 0.054 g/100 mL)) as a yellow solid. 1HNMR (400 MHz, CDCI3) 8 ppm 8.51 (s, 1H), 8.19 (d, J= 8.6 Hz, 1H), 7.88 (dd, J= 2.1, 8.7 Hz, 1H), 7.84-7.76 (m, 2H), 7.40 (s, 1H), 6.81 (d, J= 8.8 Hz, 1H), 5.81 (t, J= 11.1 Hz, 1H), 4.41 (s, 1H), 3.62-3.52 (m, 1H), 3.49-3.38 (m, 1H), 2.71 (d, J = 5.4 Hz, 3H); ES-LCMS m/z 479.0 481.[M+H]+. Peak 2 was concentrated under reduced pressure to yield a residue which was dissolved in MeCN (10 mL) and H2O (20 mL) and lyophilizedto yield 3-[(5A)-3-bromo-4,5- dihydroisoxazol-5-yl]-A-methyl-4-[[5-(trifluoromethyl)-2-pyridyl]amino]benzenesulfonamide (48.81 mg, 101.84 pmol, 14.1% yield, 100.0% purity, SFC: Rt = 1.982, ee = 100%, [a]314D = + 40.0 (CH3OH, c = 0.050 g/100 mL)) as a yellow solid. 1H NMR (400 MHz, CDC13) 8 ppm 8.51 132 WO 2022/120354 PCT/US2021/072684 (s, 1H), 8.20 (d,J= 8.6 Hz, 1H), 7.89 (dd, J= 22, 8.6 Hz, 1H), 7.83-7.76 (m, 2H), 7.39 (s, 1H), 6.81 (d, J = 8.8 Hz, 1H), 5.81 (t, J = 11.1 Hz, 1H), 4.35 (d, J = 4.9 Hz, 1H), 3.62-3.51 (m, 1H), 3.49-3.39 (m, 1H), 2.71 (d, J= 5.4 Hz, 3H); ES-LCMS m/z 479.1, 481.1 [M+H]+. 1-12 and 1-13 (isomers of 1-26) Chiral SFC Step 1: 5-Bromo-2-iodo-N-[[4-(trifluoromethyl)phenyl]methylaniline id="p-423" id="p-423" id="p-423" id="p-423" id="p-423" id="p-423" id="p-423" id="p-423" id="p-423" id="p-423" id="p-423" id="p-423" id="p-423" id="p-423"
id="p-423"
[00423]To a solution of 5-bromo-2-iodo-aniline (2.5 g, 8.39 mmol, 1 eq) and 4- (trifluoromethyl)benzaldehyde (4.38 g, 25.17 mmol, 3.37 mL, 3 eq) in MeOH (25 mL) was added AcOH (50.39 mg, 839.16 umol, 47.99 pL, 0.1 eq). The mixture was stirred at 60 °C for 4 h. NaBH3CN (2.64 g, 41.96 mmol, 5 eq) was added at 25 °C. The mixture was stirred at 60 °C for h. The solvent was removed and the residue was quenched by addition of water (200 mL) and extracted with EtOAc (100 mL x 3). The combined organic layers were washed with brine (mL), dried over Na2SO4, filtered and concentrated under reduced pressure to yield a residue which was purified by flash silica gel chromatography (from PE/EtOAc = 1/0 to 5/1, TLC: PE/EtOAc = 133 WO 2022/120354 PCT/US2021/072684 /1, Rf= 0.70) to yield 5-bromo-2-iodo-A-[[4-(trifluoromethyl)phenyl]methyl]aniline (1.88 g, 3.mmol, 43.7% yield, 89.0% purity) as yellow oil. 1H NMR (400 MHz, CDC13) 8 ppm 7.64 (d, J = 8.1 Hz, 2H), 7.52 (d, J= 8.3 Hz, 1H), 7.47 (d,J=7.8 Hz, 2H), 6.64-6.58 (m, 2H), 4.72 (s, 1H), 4.47 (d, J= 5.6 Hz, 2H); ES-LCMS m/z 455.9, 457.9 [M+H]+.
Step 2: tert-Butyl N-(5-bromo-2-iodo-phenyl)-N-1[4- (trifluoromethyl)phenyl] methyl] carbamate id="p-424" id="p-424" id="p-424" id="p-424" id="p-424" id="p-424" id="p-424" id="p-424" id="p-424" id="p-424" id="p-424" id="p-424" id="p-424" id="p-424"
id="p-424"
[00424]To a solution of 5-bromo-2-iodo-A-[[4-(trifluoromethyl)phenyl]methyl]aniline (1.88 g, 3.67 mmol, 89%, 1 eq) in THF (20 mL) was added DMAP (448.24 mg, 3.67 mmol, 1 eq) and B0C20 (2.40 g, 11.01 mmol, 2.53 mL, 3 eq). The mixture was stirred at 20 °C for 12 h. The solvent was removed to yield a residue which was purified by flash silica gel chromatography (from PE/EtOAc = 1/0 to 10/1, TEC: PE/EtOAc = 10/1, Rf = 0.8) to yield tert-butyl A-(5-bromo-2-iodo- phenyl)-A-[[4-(trifluoromethyl)phenyl]methyl]carbamate (2.23 g, crude) as a green solid. 1H NMR (400 MHz, CDCI3) 8 ppm 7.71 (d, J= 8.3 Hz, 1H), 7.59 (d, J=3. ר Hz, 2H), 7.38 (d, J= 7.Hz, 2H), 7.12 (d, J= 7.8 Hz, 1H), 6.97 (s, 1H), 5.16 (d, J= 15.2 Hz, 1H), 4.27 (d, J= 14.9 Hz, 1H), 1.57 (s, 9H); ES-LCMS m/z 499.9, 421.9 [M-LBu+H]+.
Step 3: tert-Butyl A-[5-bromo-2-(l-methylimidazol-4-yl)phenyl]-A-[[4- (trifluoromethyl)phenyl] methyl] carbamate Br [00425]A mixture of tert-butyl A-(5-bromo-2-iodo-phenyl)-A-[[4-(trifluoromethyl)phenyl]methyl]carbamate (1 g, 1.73 mmol, 96.3% purity, 1 eq), tributyl-(!- methylimidazol-4-yl)stannane (662.53 mg, 1.73 mmol, 97% purity, 1 eq) and Pd(dppf)C12 (126. 134 WO 2022/120354 PCT/US2021/072684 mg, 173.15 umol, 0.1 eq) in DMF (10 mL) was degassed and purged with N2 for 3 times and the mixture was stirred under N2 atmosphere at 120 °C for 4 h. The reaction mixture was quenched by addition of water (100 mL) and extracted with EtOAc (50 mL x 3). The combined organic layers were washed with brine (20 mL), dried over Na2SO4, filtered and concentrated under reduced pressure to yield a residue which purified by flash silica gel chromatography (from PE/EtOAc = 1/0 to 3/1, TLC: PE/EtOAc = 3/1, Rf = 0.40) to yield tert-butyl A-[5-bromo-2-(l-methylimidazol- 4-yl)phenyl]-A-[[4-(trifluoromethyl)phenyl]methyl]carbamate (530 mg, 934.66 umol, 54.0% yield, 90.0% purity) as black brown oil. 1HNMR (400 MHz, CDC13) 8 ppm 7.97 (d, J = 7.6 Hz, 1H), 7.55 (d, J= 8.1 Hz, 2H), 7.46 (s, 2H), 7.35 (d, J= 6.8 Hz, 2H), 6.94 (s, 1H), 6.82 (s, 1H), 5.15 (d, J= 14.4 Hz, 1H), 4.18 (d, J= 14.9 Hz, 1H), 3.66 (s, 3H), 1.26 (s, 9H); ES-LCMS m/z 510.1, 512.1 [M+H]+.
Step 4: tert-Butyl A-[2-(l-methylimidazol-4-yl)-5-vinyl-phenyl]-A-[[4- (trifluoromethyl)phenyl] methyl] carbamate id="p-426" id="p-426" id="p-426" id="p-426" id="p-426" id="p-426" id="p-426" id="p-426" id="p-426" id="p-426" id="p-426" id="p-426" id="p-426" id="p-426"
id="p-426"
[00426]A mixture of tert-butyl A-[5-bromo-2-(l-methylimidazol-4-yl)phenyl]-A-[[4- (trifluoromethyl)phenyl]methyl]carbamate (530 mg, 934.66 umol, 90%, 1 eq), 4,4,5,5- tetramethyl-2-vinyl-l,3,2-dioxaborolane (287.90 mg, 1.87 mmol, 317.07 pL, 2 eq), Pd(dppf)C(68.39 mg, 93.47 umol, 0.1 eq), C82CO3 (761.33 mg, 2.34 mmol, 2.5 eq) in 1,4-dioxane (4.5 mL) and H2O (1.5 mL) was degassed and purged with N2 for 3 times and the mixture was stirred under N2 atmosphere at 100 °C for 12 h. The reaction mixture was quenched by addition of water (mL) and extracted with EtOAc (30 mL x 3). The combined organic layers were washed with brine (10 mL), dried over Na2SO4, filtered and concentrated under reduced pressure to yield a residue which was purified by flash silica gel chromatography (from PE/EtOAc = 1/0 to 3/1, TLC: PE/EtOAc =3/1, Rf = 0.40) to yield tert-butyl A-[2-(l-methylimidazol-4-yl)-5-vinyl-phenyl]-A- [[4-(trifluoromethyl)phenyl]methyl]carbamate (219 mg, 464.34 umol, 49.7% yield, 97.0% purity) 135 WO 2022/120354 PCT/US2021/072684 as yellow oil. 1H NMR (400 MHz, CDCl3) 8 ppm 8.05 (d, J = 8.1 Hz, 1H), 7.54 (d, J= 7.8 Hz, 3H), 7.47 (s, 1H), 7.38 (d, J=3. ר Hz, 3H), 6.85 (s, 1H), 6.74 (s, 1H), 6.57 (dd, J= 10.9, 17.5 Hz, 1H), 5.55 (d,J= 17.4 Hz, 1H), 5.18 (d, J= 10.8 Hz, 1H), 5.22-5.15 (m, 1H), 3.67 (s, 3H), 1.25 (s, 9H); ES-LCMS m/z 458.1 [M+H]+.
Step 5: tert-Butyl /V-[2-(l-methylimidazol-4-yl)-5-vinyl-phenyl]-/V-[[4- (trifluoromethyl)phenyl] methyl] carbamate id="p-427" id="p-427" id="p-427" id="p-427" id="p-427" id="p-427" id="p-427" id="p-427" id="p-427" id="p-427" id="p-427" id="p-427" id="p-427" id="p-427"
id="p-427"
[00427]To a solution of tert-butyl 7V-[2-(l-methylimidazol-4-yl)-5-vinyl-phenyl]-7V-[[4- (trifluoromethyl)phenyl]methyl]carbamate (169 mg, 358.33 umol, 97%, 1 eq) and dibromomethanone oxime (109.02 mg, 537.49 umol, 1.5 eq)inEtOAc(3 mL)was added NaHCO(301.02 mg, 3.58 mmol, 10 eq). The mixture was stirred at 25 °C for 4 h. The reaction mixture was quenched by addition of water (50 mL) and extracted with EtOAc (30 mL x 3). The combined organic layers were washed with brine (10 mL), dried 0verNa2S04, filtered and concentrated under reduced pressure to yield tert-butyl A-[5-(3-bromo-4,5-dihydroisoxazol-5-yl)-2-(l- methylimidazol-4-yl)phenyl]-A-[[4-(trifluoromethyl)phenyl]methyl]carbamate (248 mg, crude) as a yellow solid which was used in the next step without further purification. 1H NMR (400 MHz, CDC13) 8 ppm 8.10 (s, 1H), 7.64 (s, 2H), 7.60 (d, J= 8.3 Hz, 2H), 7.51-7.47 (m, 1H), 6.95-6.(m, 2H), 6.68 (s, 1H), 5.54 (d, J= 8.8 Hz, 1H), 5.30-5.08 (m, 2H), 3.71 (s, 3H), 3.59-3.45 (m, 2H), 1.54 (s, 9H).
Step 6: (.S)-5-(3-Bromo-4.5-dihydroisoxazol-5-yl)-2-( 1-methyl-l H-imidazol-4-yl)- -(4- (trifluoromethyl)benzyl)anilineand (l?)-5-(3-bromo-4,5-dihydroisoxazol-5-yl)-2-(l-methyl- 1 H-imidazol-4-yl)--(4-(trinuoromethyl)henzyl)aniline 136 WO 2022/120354 PCT/US2021/072684 cf 3 id="p-428" id="p-428" id="p-428" id="p-428" id="p-428" id="p-428" id="p-428" id="p-428" id="p-428" id="p-428" id="p-428" id="p-428" id="p-428" id="p-428"
id="p-428"
[00428]To a solution of tert-butyl 7V-[5-(3-bromo-4,5-dihydroisoxazol-5-yl)-2-(l- methylimidazol-4-yl)phenyl]-A-[[4-(trifluoromethyl)phenyl]methyl]carbamate (248 mg, 428.pmol, 1 eq) in DCM (3 mL) was added TFA (184.80 mg, 1.62 mmol, 120 pL, 3.79 eq). The mixture was stirred at 25 °C for 1 h. The reaction mixture was quenched by addition of water (1mL) and extracted with EtOAc (60 mL x 3). The combined organic layers were washed with brine (20 mL), dried over Na2SO4, filtered and concentrated under reduced pressure to yield a residue which was purified by flash silica gel chromatography (from PE/EtOAc = 100/1 to 3/1, TLC: PE/EtOAc = 3/1, Rf = 0.05)to yield the compound which was separated by SEC (column: DAICEL CHIRALPAK AD (250mm*30mm, 10pm); mobile phase: [0.1% NH3H2O ETOH]; B%: 50%- 50%) to yield Peak 1 and Peak 2. Peak 1 was purified by preparative HPLC (column: Agela DuraShell C18 150*25mm*5pm; mobile phase: [water (0.05% NH3H2O+10mM NH4HCO3)- ACN]; B%: 52%-82%, lOmin) and lyophilized to yield (JS)-5-(3-bromo-4,5-dihydroisoxazol-5-yl)- 2-(l-methyl-lH-imidazol-4-yl)-A-(4-(trifluoromethyl)benzyl)aniline (10.44 mg, 21.35 pmol, 5.0% yield, 98.5% purity, SFC : Rt = 2.143, ee = 98.2%, [a]32 0D= + 180.0 (MeOH, c = 0.02 g/1mL)) as a white solid. 1H NMR (400 MHz, CDCh) 8 ppm 8.52 (s, 1H), 7.60-7.56 (m, 2H), 7.54- 7.50 (m, 2H), 7.47 (s, 1H), 7.39 (d, J= 7.8 Hz, 1H), 7.18 (s, 1H), 6.61 (d, J= 7.8 Hz, 1H), 6.47 (s, 1H), 5.57-5.47 (m, 1H), 4.55 (s, 2H), 3.77 (s, 3H), 3.50 (dd, J= 10.9, 17.2 Hz, 1H), 3.07 (dd,J= 8.9, 17.2 Hz, 1H); ES-LCMS m/z 478.8, 480.8 [M+H]+. Peak 2 was purified by preparative HPLC (column: Agela DuraShell C18 150*25mm*5pm; mobile phase: [water (0.05% NH3H2O+10mM NH4HCO3)-ACN]; B%: 51%-81%, 10 min) and lyophilized to yield (A)-5-(3-bromo-4,5- dihydroisoxazol-5-yl)-2-(l-methyl-lH-imidazol-4-yl)-A-(4-(trifluoromethyl)benzyl)aniline (9.mg, 18.99 pmol, 4.4% yield, 95.9% purity, SFC : Rt = 2.482, ee = 98.8%, ee = 98.8%, [a]32 °d= - 187.5(MeOH, c = 0.016 g/100 mL)) as a white solid. 1H NMR (400 MHz, CDCh) 8 ppm 8.52 (s, 1H), 7.60-7.56 (m, 2H), 7.53-7.50 (m, 2H), 7.47 (s, 1H), 7.39 (d,J=7.8 Hz, 1H), 7.18 (d, J= 1. 137 WO 2022/120354 PCT/US2021/072684 Hz, 1H), 6.61 (d, J= 7.8 Hz, 1H), 6.47 (s, 1H), 5.52 (dd, J= 8.9, 10.9 Hz, 1H), 4.55 (s, 2H), 3.(s, 3H), 3.50 (dd,J= 10.9, 17.2 Hz, 1H), 3.07 (dd, J= 8.8, 17.1 Hz, 1H); ES-LCMS m/z 479.0, 481.0 [M+H]+. 1-14 id="p-429" id="p-429" id="p-429" id="p-429" id="p-429" id="p-429" id="p-429" id="p-429" id="p-429" id="p-429" id="p-429" id="p-429" id="p-429" id="p-429"
id="p-429"
[00429]To a solution of 5-(trifluoromethyl) pyridin-2-amine (1.84 g, 11.36 mmol, 1 eq) in THF (30 mL) was added NaH (1.36 g, 34.09 mmol, 60%, 3 eq) at 0 °C. The mixture was stirred for min. 2-Bromo-l-fluoro-4-nitro-benzene (2.5 g, 11.36 mmol, 1 eq) was added at 0 °C and the mixture was stirred at 25 °C for 12 h. The reaction mixture was quenched with water (50 mL) and extracted with EtOAc (50 mL x 3). The combined organic layers were dried over Na2SO4, filtered and concentrated under reduced pressure to yield a residue which was purified by flash silica gel chromatography (from PE/EtOAc = 100/1 to 10/1, TLC: PE/EtOAc = 5/1, Rf = 0.65) to yield N- (2-bromo-4-nitro-phenyl)-5-(trifluoromethyl)pyridin-2-amine (850 mg, 2.00 mmol, 17.6% yield, 85.0% purity) as a yellow solid. 1H NMR (400 MHz, CDCI3) 8 ppm 8.76 (d, J= 9.3 Hz, 1H), 8.(s, 1H), 8.52 (d, J= 2.4 Hz, 1H), 8.24 (dd, J= 2.4, 9.3 Hz, 1H), 7.87 (dd, 2.2, 8.8 Hz, 1H), 7.54 (s, 1H), 7.00 (d, J= 8.8 Hz, 1H); ES-LCMS m/z 363.9 [M+H]+.
Step 2: 2-(l-Methyl-lH-imidazol-4-yl)-A1-(5-(trifluoromethyl)pyridin-2-yl)benzene-l,4- diamine id="p-430" id="p-430" id="p-430" id="p-430" id="p-430" id="p-430" id="p-430" id="p-430" id="p-430" id="p-430" id="p-430" id="p-430" id="p-430" id="p-430"
id="p-430"
[00430]To a solution of A-(2-bromo-4-nitro-phenyl)-5-(trifluoromethyl)pyridin-2-amine (7 138 WO 2022/120354 PCT/US2021/072684 mg, 1.93 mmol, 1 eq) and tributyl-(l-methylimidazol-4-yl)stannane (1.58 g, 3.87 mmol, 91%, eq) in DMF (15 mL) was added Pd(dppf)C12 (70.73 mg, 96.66 umol, 0.05 eq) under Natmosphere. The mixture was stirred under N2 atmosphere at 130 °C for 12 h. The reaction mixture was partitioned between water (50 mL) and EtOAc (100 mL x 3). The organic phase was separated, washed with brine (50 mL), dried over Na2SO4, filtered and concentrated under reduced pressure to yield a residue which was purified by silica gel column chromatography (from pure PE to PE/EtOAc = 0/1, TLC: PE/EtOAc = 0/1, Rf = 0.34) to yield 2-(l-methylimidazol-4-yl)-A 1-[5- (trifluoromethyl)-2-pyridyl]benzene-l,4-diamine (300 mg, 648.04 umol, 33.5% yield, 72.1% purity) as a yellow oil. 1H NMR (400 MHz, CDC13) 8 ppm 9.41 (s, 1H), 8.40 (s, 1H), 7.72 (d, J= 8.6 Hz, 1H), 7.59-7.43 (m, 2H), 7.27 (s, 1H), 7.18-7.01 (m, 2H), 6.74-6.57 (m, 2H), 3.71 (s, 3H); ES-LCMS m/z 334.3 [M+H]+.
Step 3: A-(3-(l-Methyl-lH-imidazol-4-yl)-4-((5-(trifluoromethyl)pyridin-2- yl)amino)phenyl)acrylamide id="p-431" id="p-431" id="p-431" id="p-431" id="p-431" id="p-431" id="p-431" id="p-431" id="p-431" id="p-431" id="p-431" id="p-431" id="p-431" id="p-431"
id="p-431"
[00431]To a solution of 2-(l-methylimidazol-4-yl)-A 1-[5-(trifluoromethyl)-2- pyridyl]benzene-l,4-diamine (230 mg, 496.83 umol, 72%, 1 eq) and Et3N (150.82 mg, 1.49 mmol, 207.46 pL, 3 eq) in DCM (3 mL) was added prop-2-enoyl chloride (58.46 mg, 645.88 umol, 52.pL, 1.3 eq) under N2 atmosphere at 0 °C. The mixture was stirred at 25 °C for 2 h. The reaction mixture was partitioned between water (30 mL) and EtOAc (50 mL x 3). The organic phase was separated, washed with brine (30 mL), dried over Na2SO4, filtered and concentrated under reduced pressure to yield a residue which was purified by preparative HPLC (column: Agela DuraShell C18 150*25 mm*5 pm; mobile phase: [water (0.05% NH3H2O + 10 mM NH4HCO3)-ACN]; B%: 38%-68%, 10 min) to yield A-[3-(l-methylimidazol-4-yl)-4-[[5-(trifluoromethyl)-2-pyridyl]amino]phenyl]prop-2-enamide (85.15 mg, 215.43 pmol, 43.4% yield, 98.2% purity) as a white solid. 1HNMR (500 MHz, CDCh) 8 ppm 11.30 (s, 1H), 8.44 (s, 1H), 8.38 (d, J= 8.9 Hz, 1H), 8.17 (d, J= 2.0 Hz, 1H), 7.74 (s, 1H), 7.60 (dd, J= 2.0, 8.9 Hz, 1H), 7.47 (s, 1H), 7.18 (s, 139 WO 2022/120354 PCT/US2021/072684 2H), 6.82 (d,J=8.7 Hz, 1H), 6.49-6.40 (m, 1H), 6.35-6.24 (m, 1H), 5.75 (d, J= 10.4 Hz, 1H),3.68 (s, 3H); ES-LCMS m/z 388.2 [M+H]+. 1-15 and 1-16 (isomers of 1-27) Step 1: 3-[(5S)-3-Chloro-4,5-dihydroisoxazol-5-yl]-A-methyl-4-[[5-(trifluoromethyl)-2- pyridyl]amino]benzenesulfonamide id="p-432" id="p-432" id="p-432" id="p-432" id="p-432" id="p-432" id="p-432" id="p-432" id="p-432" id="p-432" id="p-432" id="p-432" id="p-432" id="p-432"
id="p-432"
[00432]To a solution of 3-(3-bromo-4,5-dihydroisoxazol-5-yl)-7V-methyl-4-[[5- (trifluoromethyl)-2-pyridyl]amino]benzenesulfonamide (900 mg, 723.35 umol, 38.5% purity, eq) in 1,4-dioxane (10 mL) was added aq. HC1 (2 mL). The mixture was stirred at 40 °C for 12 h. The reaction mixture was quenched by addition of saturated NaHCO3 (100 mL) and extracted with EtOAc (50 mL x 3). The combined organic layers were washed with brine (50 mL), dried over Na2SO4, filtered and concentrated under reduced pressure to yield a residue which was purified by preparative HPLC (column: Agela DuraShell C18 150*25mm*5pm; mobile phase: [water (0.05%NH3 H20+10mM NH4HCO3)-ACN]; B%: 40%-70%, 10 min), followed by lyophilization to yield the mixture which was separated by chiral SEC (column: column: DAICEL CHIRALPAK AS(250mm*30mm,10|1m); mobile phase: [0.1% NH3 H2O EtOH]; B%: 25%-20%) to yield Peak and Peak 2. Peak 1 was concentrated under reduced pressure to yield a residue which was dissolved in MeCN (10 mL) and H2O (20 mL) then lyophilized to yield 3-[(5,S)-3-chloro-4,5- dihydroisoxazol-5-yl]-A-methyl-4-[[5-(trifluoromethyl)-2-pyridyl]amino]benzenesulfonamide (48.36 mg, 111.22 pmol, 15.4% yield, 100.0% purity, SFC: Rt = 1.382, ee = 99.84%, [a]314D = - 46.15 (CH OH, c = 0.052 g/100 mL)) as a white solid. 1H NMR (400 MHz, CDC13) 8 ppm 8.(s, 1H), 8.19 (d, J= 8.8 Hz, 1H), 7.89 (dd, J= 2.1, 8.7 Hz, 1H), 7.82-7.77 (m, 2H), 7.42 (s, 1H), 140 WO 2022/120354 PCT/US2021/072684 6.82 (d,J= 8.8 Hz, 1H), 5.88 (t, J= 11.1 Hz, 1H), 4.46-4.33 (m, 1H), 3.56-3.37 (m, 2H), 2.71 (d, J= 5.1 Hz, 3H); ES-LCMS m/z 435.1, 437.1 [M+H]+. 1-17 and 1-18 (isomers of 1-28) PMB ^BPinPd(dppf)CI 21 Cs2CO3 Pd(OAc)2, XantphosCs2CO3, anisole Chiral SFC Step 1: 5-Bromo-6-chloro-/V-[(4-methoxyphenyl)methyl]-/V-methyl-pyridine-3-sulfonamide id="p-433" id="p-433" id="p-433" id="p-433" id="p-433" id="p-433" id="p-433" id="p-433" id="p-433" id="p-433" id="p-433" id="p-433" id="p-433" id="p-433"
id="p-433"
[00433]To a solution of 5-bromo-6-chloro-pyridine-3-sulfonyl chloride (1.0 g, 3.44 mmol, eq) and Et3N (695.58 mg, 6.87 mmol, 956.78 pL, 2 eq) in THE (10 mL) was added l-(4- methoxyphenyl)-7V-methyl-methanamine (571.67 mg, 3.78 mmol, 1.1 eq). The mixture was stirred at -30 °C for 1 h. TEC (PE/EtOAc = 3/1, Rf = 0.56) indicated the starting material was consumed completely and one new spot formed. The mixture was poured into water (50 mL) and the precipitated solid was filtered and dried to yield 5-bromo-6-chloro-7V-[(4-methoxyphenyl)methyl]- 7V-methyl-pyridine-3-sulfonamide (1.1 g, 2.49 mmol, 72.6% yield, 92.0% purity) as a light yellow solid, which was used in the next step without further purification. 1H NMR (500 MHz, CDCl3) <) ppm 8.71 (d,J=2.1 Hz, 1H), 8.23 (d, J= 2.1 Hz, 1H), 7.21 (d, J= 8.7 Hz, 2H), 6.90-6.85 (m, 2H), 4.18 (s, 2H), 3.81 (s, 3H), 2.70 (s, 3H); ES-LCMS m/z 405.0, 407.0 [M+H]+.
Step 2: 6-Amino-5-bromo-/V-[(4-methoxyphenyl)methyl]-/V-methyl-pyridine-3-sulfonamide 141 WO 2022/120354 PCT/US2021/072684 id="p-434" id="p-434" id="p-434" id="p-434" id="p-434" id="p-434" id="p-434" id="p-434" id="p-434" id="p-434" id="p-434" id="p-434" id="p-434" id="p-434"
id="p-434"
[00434]To a solution of 5-bromo-6-chloro-7V-[(4-methoxyphenyl)methyl]-7V-methyl-pyridine- 3-sulfonamide (950 mg, 2.15 mmol, 92% purity, 1 eq) in THF (5 mL) was added NH3.H:O (1.mL, 28% purity, 5 eq). The mixture was stirred under microwave at 100 °C for 12 h. TLC (PE/EtOAc = 1/1, Rr = 0.31) indicated the starting material was consumed completely and one new spot formed. The solvent was removed to yield 6-amino-5-bromo-7V-[(4- methoxyphenyl)methyl]-7V-methyl-pyridine-3-sulfonamide (860 mg, 2.12 mmol, 98.2% yield, 95.0% purity) as a yellow solid, which was used in the next step without further purification. 1H NMR (500 MHz, DMSO-t/6) 8 ppm 8.33 (d, J= 2.0 Hz, 1H), 7.99 (d,J=2.0 Hz, 1H), 7.31 (br s, 2H), 7.23 (d, J= 8.4 Hz, 3H), 6.92 (d, J= 8.5 Hz, 2H), 3.75 (s, 3H).
Step 3: 5-Bromo-A-[(4-methoxyphenyl)methyl]-A-methyl-6-[4- (trifluoromethyl)anilino]pyridine-3-sulfonamide 1 OPMB [00435]To a solution of 6-amino-5-bromo-7V-[(4-methoxyphenyl)methyl]-7V-methyl-pyridine- 3-sulfonamide (510 mg, 1.25 mmol, 95% purity, 1 eq) and l-iodo-4-(trifluoromethyl)benzene (409.42 mg, 1.51 mmol, 221.31 pL, 1.2 eq) in anisole (20 mL) were added Pd(OAc)2 (42.24 mg, 188.15 umol, 0.15 eq), xantphos (72.58 mg, 125.43 umol, 0.1 eq) and C82CO3 (613.02 mg, 1.mmol, 1.5 eq). The mixture was stirred under N2 atmosphere at 130 °C for 16 h. The solvent was removed and the residue was treated with EtOAc (30 mL). The mixture was filtered and the filtrate was concentrated to yield a residue which was purified by flash silica gel chromatography (from PE/EtOAc = 1/0 to 3/1, TLC: PE/EtOAc = 3/1, Rf = 0.57) to yield 5-bromo-A-[(4- methoxyphenyl)methyl]-A-methyl-6-[4-(trifluoromethyl)anilino]pyridine-3-sulfonamide (5mg, 1.05 mmol, 83.8% yield, 95.0% purity) as a yellow solid. 1HNMR (500 MHz, CDC13) 8 ppm 8.61 (d, J = 1.8 Hz, 1H), 8.12 (d, J = 1.8 Hz, 1H), 7.81 (d, J = 8.5 Hz, 2H), 7.64 (d,J=8.4 Hz, 2H), 7.51 (s, 1H), 7.23 (d, J= 8.5 Hz, 2H), 6.88 (d, J= 8.5 Hz, 2H), 4.14 (s, 2H), 3.81 (s, 3H), 142 WO 2022/120354 PCT/US2021/072684 2.65 (s, 3H); ES-LCMS m/z 530.0, 532.0 [M+H]+.
Step 4: N-I(4-Methoxyphenyl)methyl]-N-methyl-6-[4-(trifluoromethyl)anilino]-5-vinyl- pyridine-3-sulfonamide id="p-436" id="p-436" id="p-436" id="p-436" id="p-436" id="p-436" id="p-436" id="p-436" id="p-436" id="p-436" id="p-436" id="p-436" id="p-436" id="p-436"
id="p-436"
[00436]To a solution of 5-bromo-7V-[(4-methoxyphenyl)methyl]-7V-methyl-6-[4- (trifluoromethyl)anilino]pyridine-3-sulfonamide (587 mg, 1.05 mmol, 95% purity, 1 eq) and 4,4,5,5-tetramethyl-2-vinyl-l,3,2-dioxaborolane (323.88 mg, 2.10 mmol, 356.70 pL, 2 eq) in 1,4- dioxane (18 mL) and H2O (3 mL) were added Pd(dppf)C12 (76.94 mg, 105.15 umol, 0.1 eq) and C82CO3(685.17 mg, 2.10 mmol, 2 eq). The mixture was stirred under N2 atmosphere at 90 °Cfor h. The solvent was removed and the residue was treated with EtOAc (20 mL). The mixture was filtered and the filtrate was concentrated to yield a residue which was purified by flash silica gel chromatography (from PE/EtOAc = 1/0 to 3/1, TEC: PE/EtOAc = 3/1, Rf = 0.49) to yield A-[(4- methoxyphenyl)methyl]-A-methyl-6-[4-(trifluoromethyl)anilino]-5-vinyl-pyridine-3-sulfonamide (350 mg, 732.99 umol, 69.7% yield, 100.0% purity) as a yellow solid. 1HNMR(500 MHz, CDC13) d ppm 8.62 (d, J= 2.3 Hz, 1H), 7.89 (d, J= 2.3 Hz, 1H), 7.75 (d, J= 8.5 Hz, 2H), 7.61 (d, J= 8.Hz, 2H), 7.23 (d, J= 8.5 Hz, 2H), 6.87 (d, J= 8.5 Hz, 3H), 6.75 (dd, J= 11.1, 17.3 Hz, 1H), 5.(d, 17.2 Hz, 1H), 5.71 (d, J= 11.1 Hz, 1H), 4.13 (s, 2H), 3.80 (s, 3H), 2.63 (s, 3H); ES-LCMS m/z 478.2 [M+H]+.
Step 5: A-Methyl-6-[4-(trifluoromethyl)anilino]-5-vinyl-pyridine-3-sulfonamide id="p-437" id="p-437" id="p-437" id="p-437" id="p-437" id="p-437" id="p-437" id="p-437" id="p-437" id="p-437" id="p-437" id="p-437" id="p-437" id="p-437"
id="p-437"
[00437]To a solution of A-[(4-methoxyphenyl)methyl]-A-methyl-6-[4- (trifluoromethyl)anilino]-5-vinyl-pyridine-3-sulfonamide (300 mg, 628.27 umol, 100% purity, eq) in DCM (5 mL) was added TEA (1.5 mL). The mixture was stirred at 25 °C for 16 h. TLC 143 WO 2022/120354 PCT/US2021/072684 (PE/EtOAc = 1/1, Rf = 0.58) indicated the starting material was consumed completely and one new spot formed. The mixture was concentrated to yield A-methyl-6-[4-(trifluoromethyl)anilino]- 5-vinyl-pyridine-3-sulfonamide (330 mg, 616.07 umol, 98.1% yield, 88.0% purity, TFA) as an off-white solid, which was used in the next step without further purification. 1H NMR (500 MHz, CD3OD) 8 ppm 8.50 (d, J= 2.3 Hz, 1H), 8.09 (d, J= 2.1 Hz, 1H), 7.85 (d, J= 8.5 Hz, 2H), 7.(d,J=8.5Hz, 2H), 7.05 (dd,J=10.9, 17.2 Hz, 1H), 5.91 (d, J= 17.1 Hz, 1H), 5.62 (d,J=11.Hz, 1H), 2.59 (s, 3H).
Step 6: 5-(3-Bromo-4,5-dihydroisoxazol-5-yl)-A-methyl-6-[4- (trifluoromethyl)anilino]pyridine-3-sulfonamide id="p-438" id="p-438" id="p-438" id="p-438" id="p-438" id="p-438" id="p-438" id="p-438" id="p-438" id="p-438" id="p-438" id="p-438" id="p-438" id="p-438"
id="p-438"
[00438]To a solution of A-methyl-6-[4-(trifluoromethyl)anilino]-5-vinyl-pyridine-3- sulfonamide (330 mg, 616.07 umol, 88% purity, 1 eq, TFA) and dibromomethanone oxime (249.92 mg, 1.23 mmol, 2 eq) inEtOAc (20 mL) was added NaHCO3 (517.54 mg, 6.16 mmol, eq). The mixture was stirred at 25 °C for 3 h. TEC (PE/EtOAc = 1/1, Rf = 0.78) indicated the starting material was consumed completely and one new spot formed. The mixture was filtered and the filtrate was concentrated to yield a residue which was purified by flash silica gel chromatography (from PE/EtOAc = 1/0 to 2/1, TEC: PE/EtOAc = 1/1, Rf = 0.78) to yield 5-(3- bromo-4,5-dihydroisoxazol-5-yl)-A-methyl-6-[4-(trifluoromethyl)anilino]pyridine-3- sulfonamide (290 mg, 574.83 umol, 93.3% yield, 95.0% purity) as a yellow solid. 1H NMR (4MHz, CDC13) 8 ppm 8.71 (d, J= 2.2 Hz, 1H), 7.85 (d, J= 2.0 Hz, 1H), 7.74-7.66 (m, 2H), 7.64- 7.57 (m, 2H), 5.77 (t, J= 11.2 Hz, 1H), 4.39 (q, J= 5.4 Hz, 1H), 4.12 (q, J= 7.1 Hz, 1H), 3.(dd, J= 1.8, 11.4 Hz, 2H), 2.71 (d, J= 5.4 Hz, 3H); ES-LCMS m/z 479.0, 481.0 [M+H]+.
Step 7: (S)-5-(3-Bromo-4,5-dihydroisoxazol-5-yl)-N-methyl-6-((4- (trifluoromethyl)phenyl)amino)pyridine-3-sulfonamide 144 WO 2022/120354 PCT/US2021/072684 id="p-439" id="p-439" id="p-439" id="p-439" id="p-439" id="p-439" id="p-439" id="p-439" id="p-439" id="p-439" id="p-439" id="p-439" id="p-439" id="p-439"
id="p-439"
[00439]The compound 5 -(3 -bromo-4, 5 -dihydroi soxazol-5 -yl)-7V-methyl-6- [4-(trifluoromethyl)anilino]pyridine-3-sulfonamide (100 mg, 198.22 umol, 95% purity, 1 eq) was separated by chiral SFC (column: DAICEL CHIRALPAK AD(250mm*30mm,10um);mobile phase: [0.1%NH3H2O EtOH]; B%: 30%-30%) to yield Peak 1 and Peak 2. Peak 1 was concentrated under reduced pressure to yield a residue which was dissolved in MeCN (10 mL) and H2O (mb) and lyophilized to yield (،S)-5-(3-bromo-4,5-dihydroisoxazol-5-yl)-7V-methyl-6-((4- (trifluoromethyl)phenyl)amino)pyridine-3-sulfonamide (32.79 mg, 68.42 umol, 34.5% yield, 100.0% purity, SFC: Rt = 1.372, ee = 100%, [a]286D = -5.00 (MeOH, c = 0.08 g/100 mL) as a white solid. 1HNMR (500 MHz, CDCI3) 3 ppm 8.71 (d,J=2.1Hz, 1H), 7.85 (d,J=2.1Hz, 1H), 7.72-7.65 (m, 3H), 7.64-7.58 (m, 2H), 5.77 (t, J = 11.2 Hz, 1H), 4.44 (q, J = 5.2 Hz, 1H), 3.62- 3.51 (m, 2H), 2.71 (d, J = 5.3 Hz, 3H); ES-LCMS m/z 478.9, 480.9 [M+H]+ and Peak 2 was concentrated under reduced pressure to yield a residue which was dissolved in MeCN (10 mL) and H2O (20 mL) and lyophilized to yield (R)-5-(3-bromo-4,5-dihydroisoxazol-5-yl)-7V-methyl-6-((4- (trifluoromethyl)phenyl)amino)pyridine-3-sulfonamide (31.64 mg, 66.02 umol, 33.3% yield, 100.0% purity, SFC: Rt = 1.596, ee = 100%, [a]28 8D = +6.67 (MeOH, c = 0.09 g/100 mL) as a white solid. 1HNMR (500 MHz, CDCI3) 3 ppm 8.70 (d, J= 2.3 Hz, 1H), 7.86 (d, J= 2.1 Hz, 1H), 7.72-7.65 (m, 3H), 7.63-7.59 (m, 2H), 5.77 (t, J= 11.1 Hz, 1H), 4.48 (q, J= 5.3 Hz, 1H), 3.62- 3.51 (m, 2H), 2.70 (d, J= 5.3 Hz, 3H); ES-LCMS m/z 479.0, 481.0 [M+H]+. 1-19 and 1-20 (isomers of 1-29) 145 WO 2022/120354 PCT/US2021/072684 Step 1: 4-Bromo-2-(l-methylimidazol-4-yl)aniline id="p-440" id="p-440" id="p-440" id="p-440" id="p-440" id="p-440" id="p-440" id="p-440" id="p-440" id="p-440" id="p-440" id="p-440" id="p-440" id="p-440"
id="p-440"
[00440]To a mixture of 4-bromo-2-iodo-aniline (2 g, 6.71 mmol, 1 eq) and tributyl-(!- methylimidazol-4-yl)stannane (2.72 g, 6.71 mmol, 91.5%, 1 eq) in DMF (20 mL) was added Pd(dppf)C12 (491.22 mg, 671.32 umol, 0.1 eq). The mixture was stirred under N2 atmosphere at 130 °C for 12 h. The mixture was diluted with water (100 mL) and extracted with EtOAc (100 mL x 3). The combined organic phase was washed with brine (50 mL), dried over anhydrous Na2SO4, filtered and concentrated in vacuum to yield a residue which was purified by flash silica gel chromatography (from PE/EtOAc = 100/1 to 0/1, TLC: PE/EtOAc = 0/1, Rf = 0.30) to yield 4- bromo-2-( l-methylimidazol-4-yl)aniline (1 g, 3.25 mmol, 48.5% yield, 82.0% purity) as yellow oil. 1HNMR (400 MHz, CDCI3) 8 ppm 7.47-7.42 (m, 2H), 7.13-7.06 (m, 2H), 6.58 (d, J= 8.6 Hz, 1H), 5.72-5.34 (m, 2H), 3.72 (s, 3H); ES-LCMS m/z 252.0, 254.0 [M+H]+.
Step 2: 2-(l-Methylimidazol-4-yl)-4-vinyl-aniline id="p-441" id="p-441" id="p-441" id="p-441" id="p-441" id="p-441" id="p-441" id="p-441" id="p-441" id="p-441" id="p-441" id="p-441" id="p-441" id="p-441"
id="p-441"
[00441]To a solution of 4-bromo-2-(l-methylimidazol-4-yl)aniline (1 g, 3.25 mmol, 82.0%, 146 WO 2022/120354 PCT/US2021/072684 eq) and 4,4,5,5-tetramethyl-2-vinyl-l,3,2-dioxaborolane (1.00 g, 6.51 mmol, 1.10 mL, 2 eq) in 1,4-dioxane (30 mL) and H2O (6 mL) was added Pd(dppf)C12 (237.99 mg, 325.25 umol, 0.1 eq) and C82CO3 (3.18 g, 9.76 mmol, 3 eq). The mixture was stirred under N2 atmosphere at 100 °C for h. The mixture was diluted with water (100 mL) and extracted with EtOAc (100 mL x 3). The combined organic phase was washed with brine (50 mL), dried over anhydrous Na2SO4, filtered and concentrated in vacuum to yield a residue which was purified by flash silica gel chromatography (from PE/EtOAc = 100/1 to 0/1, TLC: PE/EtOAc = 0/1, Rf= 0.35) to yield 2-(l- methylimidazol-4-yl)-4-vinyl-aniline (500 mg, 2.16 mmol, 66.4% yield, 86.0% purity) as brown oil. 1HNMR (400 MHz, DMSO-d) 8 ppm 7.68 (s, 1H), 7.56 (d, J= 1.2 Hz, 1H), 7.46 (d, J= 2.Hz, 1H), 7.06 (dd, 2.0, 8.2 Hz, 1H), 6.62 (d,J=8.2Hz, 1H), 6.55 (dd, J= 11.0, 17.6 Hz, 1H), 6.43 (s, 2H), 5.53 (dd, J= 1.2, 17.6 Hz, 1H), 4.94 (dd, J= 1.0, 10.8 Hz, 1H), 3.70 (s, 3H); ES- LCMS m/z 200.3 [M+H]+.
Step 3: 4-(3-Bromo-4,5-dihydroisoxazol-5-yl)-2-(l-methylimidazol-4-yl)aniline id="p-442" id="p-442" id="p-442" id="p-442" id="p-442" id="p-442" id="p-442" id="p-442" id="p-442" id="p-442" id="p-442" id="p-442" id="p-442" id="p-442"
id="p-442"
[00442]To a solution of 2-(l-methylimidazol-4-yl)-4-vinyl-aniline (500 mg, 2.16 mmol, 86.0%, 1 eq) in EtOAc (10 mL) was added NaHCO3 (1.81 g, 21.58 mmol, 839.35 pL, 10 eq) and dibromomethanone oxime (656.59 mg, 3.24 mmol, 1.5 eq). The mixture was stirred at 25 °C for h. The reaction mixture was filtered and concentrated under reduced pressure to yield a residue which was purified by preparative TLC (PE/EtOAc = 0/1, TLC: PE/EtOAc = 0/1, Rf = 0.20) to yield 4-(3-bromo-4,5-dihydroisoxazol-5-yl)-2-(l-methylimidazol-4-yl)aniline (150 mg, 434.umol, 20.1% yield, 93.0% purity) as yellow oil. 1HNMR (500 MHz, CDC13) 8 ppm 7.47 (s, 1H), 7.34 (d,J= 1.8 Hz, 1H), 7.17 (s, 1H), 7.01-6.99 (m, 1H), 6.71 (d,J=8.2Hz, 1H), 5.57 (t,J= 10.Hz, 2H), 3.80-3.71 (m, 3H), 3.51 (dd, J= 10.8, 17.3 Hz, 1H), 3.23 (dd,J=9.8, 17.3 Hz, 1H), 2.98- 1.99 (m, 1H); ES-LCMS m/z 321.1, 323.1 [M+H]+. 147 WO 2022/120354 PCT/US2021/072684 Step 4: 4-[(51y)-3-Bromo-4,5-dihydroisoxazol-5-yl]-2-(l-methylimidazol-4-yl)-/V-[[4- (trifluoromethyl)phenyl]methyl]anilineand 4-[(51?)-3-bromo-4,5-dihydroisoxazol-5-yl]-2-(l- methylimidazol-4-yl)-/V-[[4-(trifluoromethyl)phenyl]methyl]aniline id="p-443" id="p-443" id="p-443" id="p-443" id="p-443" id="p-443" id="p-443" id="p-443" id="p-443" id="p-443" id="p-443" id="p-443" id="p-443" id="p-443"
id="p-443"
[00443]To a solution of 4-(3-bromo-4,5-dihydroisoxazol-5-yl)-2-(l-methylimidazol-4- yl)aniline (120 mg, 347.48 umol, 93.0%, 1 eq) in THF (5 mL) was added DIEA (134.73 mg, 1.mmol, 181.57 pL, 3 eq) and l-(bromomethyl)-4-(trifluoromethyl)benzene (166.12 mg, 694.umol, 107.17 pL, 2 eq). The mixture was stirred at 25 °C for 12 h. The mixture was diluted with water (30 mL) and extracted with EtOAc (30 mL x 3). The combined organic phase was washed with brine (20 mL), dried over anhydrous Na2SO4, filtered and concentrated in vacuum to yield a residue which was purified by preparative HPLC (column: Boston Prime C18 150*30 mm*5 pm; mobile phase: [water (0.05% NH3 H2O+10 mM NH4HCO3)-ACN]; B%: 60%-90%, 10 min), followed by lyophilization to yield a product. The product was separated by SFC (column: DAICEL CHIRALPAK IG (250 mm*50 mm, 10 pm); mobile phase: [0.1%NH3 H2O EtOH]; B%: 60%-60%) to yield peak 1 and peak 2. Peak 1 was concentrated under reduced pressure to yield a residue which was dissolved in MeCN (20 mL) and H2O (40 mL) and lyophilized to yield 4-[(55)- 3-bromo-4,5-dihydroisoxazol-5-yl]-2-(l-methylimidazol-4-yl)-A-[[4-(trifluoromethyl)phenyl]methyl]aniline (24.61 mg, 50.72 pmol, 14.6% yield, 98.8% purity, SFC: Rt = 2.248, ee = 100%, [a]26 8D = +140.000 (MeOH, c = 0.180 g/100 mL)) as a white solid. 1H NMR (500 MHz, CDCI3) 8 ppm 8.52 (s, 1H), 7.57 (d, J= 8.1 Hz, 2H), 7.49 (d, J= 10.2 Hz, 3H), 7.39 (d, J= 2.0 Hz, 1H), 7.23 (s, 1H), 7.00 (dd, J= 2.1, 8.5 Hz, 1H), 6.49 (d, =8.4 Hz, 1H), 5.(t, J= 10.2 Hz, 1H), 4.56 (s, 2H), 3.77 (s, 3H), 3.50 (dd, J= 10.7, 17.4 Hz, 1H), 3.23 (dd, J= 9.8, 17.3 Hz, 1H); ES-LCMS m/z 478.9, 480.9 [M+H]+. Peak 2 was concentrated under reduced pressure to yield a residue which was dissolved in MeCN (20 mL) and H2O (40 mL) and lyophilized to yield 4-[(5A)-3-bromo-4,5-dihydroisoxazol-5-yl]-2-(l-methylimidazol-4-yl)-A-[[4- (trifluoromethyl)phenyl]methyl]aniline (24.58 mg, 50.61 pmol, 14.6% yield, 98.7% purity, SFC: 148 WO 2022/120354 PCT/US2021/072684 Rt = 3.301, ee= 100%, [a]26.8D=-198.71 (MeOH, c = 0.155 g/100 mL)) asawhite solid. 1HNMR (500 MHz, CDCh) 8 ppm 8.54 (s, 1H), 7.58-7.55 (m, 2H), 7.49 (d, J= 9.2 Hz, 3H), 7.39 (d, J = 2.0 Hz, 1H), 7.23 (s, 1H), 7.00 (dd, J= 2.0, 8.4 Hz, 1H), 6.49 (d, J= 8.5 Hz, 1H), 5.57 (t, J= 10.Hz, 1H), 4.56 (s, 2H), 3.77 (s, 3H), 3.50 (dd, J= 10.8, 17.3 Hz, 1H), 3.23 (dd, J= 9.8, 17.3 Hz, 1H); ES-LCMS m/z 478.9, 480.9 [M+H]+. 1-21 and 1-22 (isomers of 1-30) 1 Step 1: (، V)-5-(3-Chloro-4,5-dihydroisoxazol-5-yl)-/V-methyl-6-((4- (trifluoromethyl)phenyl)amino)pyridine-3-sulfonamide id="p-444" id="p-444" id="p-444" id="p-444" id="p-444" id="p-444" id="p-444" id="p-444" id="p-444" id="p-444" id="p-444" id="p-444" id="p-444" id="p-444"
id="p-444"
[00444]To a solution of 5-(3-bromo-4,5-dihydroisoxazol-5-yl)-7V-methyl-6-[4- (trifluoromethyl)anilino]pyridine-3-sulfonamide (185 mg, 366.70 umol, 95% purity, 1 eq) in 1,4- dioxane (10 mL) was added HC1 (4 M, 0.5 mL). The mixture was stirred at 40 °C for 16 h. The solvent was removed and the residue was treated with water (10 mL), adjusted to pH 8 with sat. aq. NaHCO3 and extracted with EtOAc (20 mL x 2). The combined organic layers were washed with brine (20 mL), dried over Na2SO4, filtered and concentrated under reduced pressure to yield a residue which was purified by preparative TLC (PE/EtOAc = 1/1, Rf = 0.71) to yield a product which was separated by chiral SEC (column: DAICEL CHIRALPAK AD(250mm*30mm,10um); mobile phase: [0.1%NH3H2O EtOH];B%: 35%-35%) to yield Peak 1 and Peak 2. Peak 1 was concentrated under reduced pressure to yield a residue which was dissolved in MeCN (10 mL) and H2O (20 mL) and lyophilized to yield (،3)-5-(؟-chloro-4,5-dihydroisoxazol-5-yl)-A-methyl-6-((4- (trifluoromethyl)phenyl)amino)pyridine-3-sulfonamide (43.65 mg, 97.09 umol, 26.5% yield, 96.7% purity, SFC: Rt = 1.279, ee = 99.4%, [a]244D = -24.24 (MeOH, c = 0.0825 g/100 mL) as a white solid. 1HNMR (500 MHz, CDCh) 8 ppm 8.71 (d, J= 2.4 Hz, 1H), 7.85 (d, J= 2.3 Hz, 1H), 149 WO 2022/120354 PCT/US2021/072684 7.70-7.68 (m, 3H), 7.64-7.58 (m, 2H), 5.84 (t,J=11.2Hz, 1H), 4.41 (br s, 1H), 3.62-3.41 (m, 2H),2.71 (d, J= 5.3 Hz, 3H); ES-LCMS m/z 435.0 [M+H]+. 1-23 and 1-24 (isomers of 1-31) Step 1: 5-Bromo-/V-[(4-methoxyphenyl)methyl]-/V-methyl-6-[[5-(trifluoromethyl)-2- pyridyl]amino]pyridine-3-sulfonamide id="p-445" id="p-445" id="p-445" id="p-445" id="p-445" id="p-445" id="p-445" id="p-445" id="p-445" id="p-445" id="p-445" id="p-445" id="p-445" id="p-445"
id="p-445"
[00445]To a solution of 5-(trifluoromethyl)pyridin-2-amine (91.11 mg, 562.00 umol, 1.5 eq) in DMF (3 mL) was added NaH (59.94 mg, 1.50 mmol, 60% purity, 4 eq) and the mixture was stirred at 0 °C for 0.5 h. 5-Bromo-6-chloro-7V-[(4-methoxyphenyl)methyl]-7V-methyl-pyridine-3- sulfonamide (160 mg, 374.67 umol, 95% purity, 1 eq) was added and the mixture was stirred at °C for 3 h. The reaction mixture was diluted with H2O (20 mL) and extracted with EtOAc (mL x 3). The combined organic phases were washed with brine (20 mL), dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure to yield a residue. To the residue was added MeOH (5 mL) and the mixture was stirred at 25 °C for 2 h. The slurry was filtered and the cake was rinsed with MeOH (3 mL x 2). The solid was collected and dried in vacuo to yield 5- bromo-7V-[(4-methoxyphenyl)methyl]-7V-methyl-6-[[5-(trifluoromethyl)-2- pyridyl]amino]pyridine-3-sulfonamide (160 mg, 301.12 umol, 80.8% yield, 100.0% purity) as a white solid. 1HNMR (400 MHz, DMSO-d6) 8 ppm 9.21 (s, 1H), 8.72 (s, 1H), 8.68 (d, J= 2.2 Hz, 1H), 8.41 (d, J= 2.2 Hz, 1H), 8.28-8.19 (m, 2H), 7.24 (d, J= 8.6 Hz, 2H), 6.93 (d, J= 8.6 Hz, 2H), 4.16 (s, 2H), 3.74 (s, 3H), 2.60 (s, 3H); ES-LCMS m/z 533.0 [M+H]+. 150 WO 2022/120354 PCT/US2021/072684 Step 2: N-I(4-Methoxyphenyl)methyl]-N-methyl-6-1[5-(trifluoromethyl)-2-pyridylamino]-5- vinyl-pyridine-3-sulfonamide id="p-446" id="p-446" id="p-446" id="p-446" id="p-446" id="p-446" id="p-446" id="p-446" id="p-446" id="p-446" id="p-446" id="p-446" id="p-446" id="p-446"
id="p-446"
[00446]To a solution of 5-bromo-A-[(4-methoxyphenyl)methyl]-A-methyl-6-[[5- (trifluoromethyl)-2-pyridyl]amino]pyridine-3-sulfonamide (260 mg, 489.32 umol, 100% purity, eq) in 1,4-dioxane (6 mL) and H2O (1 mL) was added 4,4,5,5-tetramethyl-2-vinyl-l,3,2- dioxaborolane (301.45 mg, 1.96 mmol, 331.99 pL, 4 eq), Pd(dppf)C12 (35.80 mg, 48.93 umol, 0.eq) and C82CO3 (318.86 mg, 978.64 umol, 2 eq). The mixture was stirred under N2 atmosphere at °C for 12 h. The reaction mixture was diluted with H2O (20 mL) and extracted with EtOAc (mL x 3). The combined organic phases were washed with brine (20 mL), dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure to yield a residue which was purified by flash silica gel chromatography (from PE/EtOAc = 1/0 to 5/1, TLC: PE/EtOAc = 5/1, Rf = 0.35) to yield A-[(4-methoxyphenyl)methyl]-A-methyl-6-[[5-(trifluoromethyl)-2-pyridyl]amino]-5- vinyl-pyridine-3-sulfonamide (200 mg, 409.62 umol, 83.7% yield, 98.0% purity) as a yellow solid. 1HNMR (400 MHz, CDC13) 8 ppm 8.69 (d, J= 2.3 Hz, 1H), 8.64 (d, J= 8.8 Hz, 1H), 8.55 (s, 1H), 8.01-7.91 (m, 2H), 7.79 (s, 1H), 7.24 (d, J= 8.8 Hz, 2H), 6.95-6.86 (m, 2H), 6.82 (dd, J = 11.0, 17.3 Hz, 1H), 5.86 (d, J= 17.3 Hz, 1H), 5.74 (d, J= 11.0 Hz, 1H), 4.16 (s, 2H), 3.81 (s, 3H), 2.(s, 3H); ES-LCMS m/z 479.6 [M+H]+.
Step 3: A-Methyl-6-[[5-(trifluoromethyl)-2-pyridyl]amino]-5-vinyl-pyridine-3-sulfonamide id="p-447" id="p-447" id="p-447" id="p-447" id="p-447" id="p-447" id="p-447" id="p-447" id="p-447" id="p-447" id="p-447" id="p-447" id="p-447" id="p-447"
id="p-447"
[00447]To a solution of A-[(4-methoxyphenyl)methyl]-A-methyl-6-[[5-(trifluoromethyl)-2- 151 WO 2022/120354 PCT/US2021/072684 pyridyl]amino]-5-vinyl-pyridine-3-sulfonamide (200 mg, 409.62 pmol, 98% purity, 1 eq) in DCM (3 mL) was added TFA (1.51 g, 13.24 mmol, 980.00 pL, 32.31 eq). The mixture was stirred at °Cfor 3 h. The solvent was removed to yield A-methyl-6-[[5-(trifluoromethyl)-2-pyridyl]amino]- 5-vinyl-pyridine-3-sulfonamide (140 mg, crude) as a yellow solid. 1HNMR (400 MHz, CDC13) § ppm 8.71 (d, J= 2.0 Hz, 1H), 8.52 (s, 1H), 8.37 (d, J= 8.8 Hz, 1H), 8.28 (s, 1H), 8.19 (d, J= 7.Hz, 1H), 6.75 (s, 1H), 6.61 (s, 1H), 5.94 (d, J= 16.9 Hz, 1H), 5.78 (d, J= 11.0 Hz, 1H), 3.99 (s, 3H); ES-LCMS m/z 359.2 [M+H]+.
Step 4: 5-[(5S)-3-Bromo-4,5-dihydroisoxazol-5-yl]-N-methyl-6-[[5-(trifluoromethyl)-2- pyridyl]amino]pyridine-3-sulfonamideand 5-[(5R)-3-bromo-4,5-dihydroisoxazol-5-yl]-/V- methyl-6-[[5-(trifluoromethyl)-2-pyridyl]amino]pyridine-3-sulfonamide id="p-448" id="p-448" id="p-448" id="p-448" id="p-448" id="p-448" id="p-448" id="p-448" id="p-448" id="p-448" id="p-448" id="p-448" id="p-448" id="p-448"
id="p-448"
[00448]To a solution of 7V-methyl-6-[[5-(trifluoromethyl)-2-pyridyl]amino]-5-vinyl-pyridine- 3-sulfonamide (140 mg, 390.69 pmol, 1 eq) in EtOAc (10 mL) was added NaHCO3 (328.22 mg, 3.91 mmol, 151.95 pL, 10 eq) and dibromomethanone oxime (158.49 mg, 781.38 pmol, 2 eq). The mixture was stirred at 25 °C for 6 h. The mixture was filtered and the filtrate was concentrated to yield a residue which was purified by flash silica gel chromatography (from PE/EtOAc = 1/0 to 1/1, TEC: PE/EtOAc = 1/1, Rf = 0.32) to yield a product which was separated by chiral SEC (column: DAICEL CHIRALPAK AD(250mm*30mm,10um);mobile phase: [0.1%NH3H2O MeOH]; B%: 55%-55%) to yield Peak 1 and Peak 2. Peak 2 was concentrated under reduced pressure to yield 5-[(5A)-3-bromo-4,5-dihydroisoxazol-5-yl]-A-methyl-6-[[5-(trifluoromethyl)-2- pyridyl]amino]pyridine-3-sulfonamide (39.4 mg, 81.48 pmol, 20.9% yield, 99.3% purity, SFC: Rt = 4.427, ee = 99.9%, [a]24 5D = +39.22 (MeOH, c = 0.051 g/100 mL) as a white solid. 1H NMR (500 MHz, DMSO-t/6) § ppm 9.73 (s, 1H), 8.68-8.55 (m, 2H), 8.14-8.07 (m, 1H), 8.06-7.98 (m, 2H), 7.63 (q, J= 4.8 Hz, 1H), 6.19 (dd,J= 7.9, 11.0 Hz, 1H), 3.92 (dd, J= 11.0, 17.5 Hz, 1H), 3.43-3.39 (m, 1H), 2.45 (d, J= 4.9 Hz, 3H); ES-LCMS m/z 480.1 [M+H]+. 152 WO 2022/120354 PCT/US2021/072684 1-33 and 1-34 (isomers of 1-32) Step 1: 3-Bromo-A-methyl-4-[[4-(trifluoromethyl)cyclohexyl]amino]benzenesulfonamide id="p-449" id="p-449" id="p-449" id="p-449" id="p-449" id="p-449" id="p-449" id="p-449" id="p-449" id="p-449" id="p-449" id="p-449" id="p-449" id="p-449"
id="p-449"
[00449]To a solution of 4-(trifluoromethyl)cyclohexanamine (748.24 mg, 4.48 mmol, 1.5 eq) in DMSO (25 mL) was added 3-bromo-4-fluoro-A-methyl-benzenesulfonamide (800 mg, 2.mmol, 100.0% purity, 1 eq). The reaction mixture was stirred under N2 atmosphere at 140 °C for h. The reaction mixture was diluted with H2O (30 mL) and extracted with EtOAc (60 mL x 3). The combined organic layers were washed with brine (50 mL), dried over Na2SO4, filtered and concentrated under reduced pressure to yield a residue which was purified by flash silica gel chromatography (from PE/EtOAc = 100/1 to 3/1, TLC: PE/EtOAc = 3/1, Rf = 0.36) to yield the crude product which was further purified by preparative HPLC(column: Boston Green ODS 150*30mm*5|1m; mobile phase: [water (0.05% HC1)-ACN]; B%: 53%-83%, 10 min) to yield 3- bromo-A-methyl-4-[[4-(trifluoromethyl)cyclohexyl]amino]benzenesulfonamide (250 mg, 571.umol, 19.2% yield, 95.0% purity) as a white solid. 1H NMR (500 MHz, CDC13) § ppm 7.92 (d, J = 2.1 Hz, 1H), 7.65 (dd, J= 2.1, 8.7 Hz, 1H), 6.65 (d, J= 8.7 Hz, 1H), 4.68 (s, 1H), 4.20 (s, 1H), 3.38-3.34 (m, 1H), 2.71-2.58 (m, 3H), 2.27 (d, J= 11.0 Hz, 2H), 2.15-2.03 (m, 3H), 1.55-1.47 (m, 2H), 1.34-1.25 (m, 2H); ES-LCMS m/z 415.2, 417.2 [M+H]+.
Step 2: A-Methyl-4-[[4-(trifluoromethyl)cyclohexyl]amino]-3-vinyl-benzenesulfonamide 153 WO 2022/120354 PCT/US2021/072684 id="p-450" id="p-450" id="p-450" id="p-450" id="p-450" id="p-450" id="p-450" id="p-450" id="p-450" id="p-450" id="p-450" id="p-450" id="p-450" id="p-450"
id="p-450"
[00450] To a solution of 3-bromo-A-methyl-4-[[4-(trifluoromethyl)cyclohexyl]amino]benzenesulfonamide (210 mg, 441.64 umol, 1 eq, HC1) and 4,4,5,5-tetramethyl-2-vinyl-l,3,2-dioxaborolane (102.03 mg, 662.45 umol, 112.36 pL, 1.5 eq) in 1,4-dioxane (6 mL) and H2O (2 mL) was added Pd(dppf)C12 (32.31 mg, 44.16 umol, 0.1 eq) and C82CO3 (359.73 mg, 1.10 mmol, 2.5 eq). The mixture was stirred under N2 atmosphere at 100 °C for 2 h. The mixture was diluted with water (30 mL) and extracted with EtOAc (30 mL x 3). The organic layer was washed with brine (30 mL x 2), dried over Na2SO4, filtered and concentrated under reduced pressure to yield a residue which was purified by flash silica gel chromatography (from PE/EtOAc = 100/1 to 1/1, TLC: PE/EtOAc = 1/1, Rf = 0.60) to yield A-methyl-4-[[4- (trifluoromethyl)cyclohexyl]amino]-3-vinyl-benzenesulfonamide (160 mg, 435.75 umol, 98.7% yield, 98.7% purity) as yellow oil. 1H NMR (400 MHz, CDC13) 8 ppm 7.72-7.56 (m, 2H), 6.71- 6.54 (m, 2H), 5.67 (d, J= YlAHz, 1H), 5.44 (d, J= 11.0 Hz, 1H), 4.20-4.14 (m, 1H), 4.12 (d, J= 7.1 Hz, 1H), 3.35 (m,J= 4.0, 7.4, 11.2 Hz, 1H), 2.64 (d, J = 5.4 Hz, 3H), 2.26 (d, J = 12.0 Hz, 2H), 2.08 (s, 1H), 2.04 (s, 2H), 1.54-1.42 (m, 2H), 1.26-1.22 (m, 2H); ES-LCMS m/z 363.[M+H]+.
Step 3: 3-[(5S)-3-Bromo-4,5-dihydroisoxazol-5-yl]-A-methyl-4-[[4- (trifluoromethyl)cyclohexyl]amino]benzenesulfonamide id="p-451" id="p-451" id="p-451" id="p-451" id="p-451" id="p-451" id="p-451" id="p-451" id="p-451" id="p-451" id="p-451" id="p-451" id="p-451" id="p-451"
id="p-451"
[00451]To a solution of A-methyl-4-[[4-(trifluoromethyl)cyclohexyl]amino]-3-vinyl- benzenesulfonamide (110 mg, 297.45 umol, 1 eq) and in EtOAc (5 mL) was added dibromomethanone oxime (90.50 mg, 446.18 umol, 1.5 eq) andNaHCO3 (249.88 mg, 2.97 mmol, eq). The mixture was stirred at 40 °C for 12 h. TLC (PE/EtOAc = 1/1, Rf = 0.72) showed the starting material was consumed completely and one new spot was detected. The mixture was 154 WO 2022/120354 PCT/US2021/072684 diluted with water (50 mL) and extracted with EtOAc (50 mL x 3). The organic layer was washed with brine (50 mL x 2), dried over Na2SO4, filtered and concentrated under reduced pressure to yield a residue which was purified by flash silica gel chromatography (from PE/EtOAc = 100/1 to 1/1, TEC: PE/EtOAc = 1/1, Rf = 0.60) and by preparative SEC (column: DAICEL CHIRALPAK AD (250 mm*30 mm, 10 um); mobile phase: [0.1% NH3HO ETOH]; B%: 25%-25%) to yield Peak 1 and Peak 2. Peak 1 was concentrated under reduced pressure to yield a residue which was dissolved in MeCN (20 mL) and H2O (20 mL) and lyophilized to yield 3-[(5,S)-3-bromo-4,5- dihydroisoxazol-5-yl]-A-methyl-4-[[4-(trifluoromethyl)cyclohexyl]amino]benzenesulfonamide (60 mg, 122.40 pmol, 41.1% yield, 98.8% purity, SFC: Rt = 1.414, ee = 100%, [a]244D = -23.(MeOH, c = 0.026 g/100 mL)) as a yellow solid. 1H NMR (400 MHz, CDCI3) 8 ppm 7.71 (d, J = 8.6 Hz, 1H), 7.55 (s, 1H), 6.75 (d, J= 8.8 Hz, 1H), 5.66 (t, J= 11.2 Hz, 1H), 4.60 (d, J= 7.1 Hz, 1H), 4.22 (q,J=4.9 Hz, 1H), 3.55-3.40 (m, 2H), 3.38-3.29 (m, 1H), 2.66-2.61 (m, 3H), 2.24 (s, 2H), 2.07 (d, J = 12.5 Hz, 3H), 1.53-1.44 (m, 2H), 1.29-1.17 (m, 2H); ES-LCMS m/z 486.[M+H]+.
Example 2. TEAD inhibition Assay [00452]TEAD inhibition can be assayed using Hippo Pathway TEAD Reporter - MCF7 Cell Line (BPS Bioscience, Catalog #: 60618). Background [00453]The Hippo pathway regulates cell proliferation and cell death. It is activated by high cell density and cell stress to stop cell proliferation and induce apoptosis. The mammalian Hippo pathway comprises MST kinases and LATS kinases. When the Hippo pathway is activated, MST kinases phosphorylate LATS kinases, which phosphorylate transcriptional co-activators YAP and TAZ. Unphosphorylated YAP and TAZ can translocate to the nucleus and interact with TEAD/TEF transcriptional factors to turn on cell cycle-promoting gene transcription. However, when phosphorylated, YAP and TAZ are recruited from the nucleus to the cytosol, so that the YAP and TAZ-dependent gene transcription is turned off. Dysfunction of the Hippo pathway is frequently detected in human cancer and its down-regulation correlates with the aggressive properties of cancer cells and poor prognosis. Description [00454]The TEAD Reporter - MCF7 cell line contains the firefly luciferase gene under the 155 WO 2022/120354 PCT/US2021/072684 control of TEAD responsive elements stably integrated into the human breast cancer cell line, MCF7. Inside the cells, basal unphosphorylated YAP/TAZ remains in the nucleus and induces the constitutive expression of luciferase reporter. The cell line is validated for the inhibition of the expression of luciferase reporter by the activators of the Hippo pathway. Application • Monitor Hippo pathway activity.• Screen for activators or inhibitors of the Hippo pathway. Format [00455]Each vial contains ~1.5 X106cells in 1 ml of 10% DMSO. Storage [00456]Immediately upon receipt, store in liquid nitrogen. General Culture Conditions [00457] Thaw Medium 1 (BPS Bioscience #60187) + 10 ug/ml of Insulin (Sigma-Aldrich # 10516): MEMmedium (Hyclone #SH30024.01) supplemented with 10%FBS (Invitrogen #26140- 079), 1% non-essential amino acids (Hyclone #SH30238.01), 1 mM Na pyruvate (Hyclone #SH30239.01), 1% Penicillin/Streptomycin (Hyclone SV30010.01), plus 10 ug/ml of insulin (Sigma-Aldrich # 10516) [00458] Growth Medium IB (BPS Bioscience #79531) + 10 ug/ml of Insulin (Sigma- Aldrich # 10516):Thaw Medium 1 (BPS Cat. #60187) + 10 ug/ml of insulin (Sigma-Aldrich # 10516), and 400 ug/ml of Geneticin (Invitrogen #11811031). [00459]Cells should be grown at 37°C with 5% CO2 using Growth Medium IB with 10 ug/ml of Insulin. It may be necessary to adjust the percentage of CO2 in the incubator depending on the NaHCO3 level in the basal medium. [00460]To thaw the cells, it is recommended to quickly thaw the frozen cells from liquid nitrogen in a 37°C water-bath, transfer to a tube containing 10 ml of Thaw Medium 1 + Insulin (no Geneticin), spin down cells, resuspend cells in pre-warmed Thaw Medium 1 + Insulin (no Geneticin), transfer resuspended cells to a T25 flask and culture in a CO2 incubator at 37°C overnight. The next day, replace the medium with fresh Thaw Medium 1 + Insulin (no Geneticin), and continue growing culture in a CO2 incubator at 37°C until the cells are ready to be split. At first passage, switch to Growth Medium IB + 10 ug/ml of Insulin (includes Thaw Medium 1, Insulin, and Geneticin). Cells should be split before they reach complete confluence. 156 WO 2022/120354 PCT/US2021/072684 id="p-461" id="p-461" id="p-461" id="p-461" id="p-461" id="p-461" id="p-461" id="p-461" id="p-461" id="p-461" id="p-461" id="p-461" id="p-461" id="p-461"
id="p-461"
[00461]To passage the cells, rinse cells with phosphate buffered saline (PBS), and detach cells from the culture vessel with 0.25% Trypsin/EDTA. Add Growth Medium IB + 10 ug/ml of Insulin (Includes Thaw Medium 1, Insulin, and Geneticin) and transfer to a tube, spin down the cells, then, resuspend cells and seed appropriate aliquots of cell suspension into new culture vessels. Sub cultivation ration: 1:5 to 1:10 weekly. [00462]To freeze down the cells, rinse cells with phosphate buffered saline (PBS), and detach cells from culture vessel with Trypsin/EDTA. Add Growth Medium IB + 10 ug/ml of Insulin (Includes Thaw Medium 1, Insulin, and Geneticin) and transfer to a tube, spin down cells, and resuspend in freezing medium (10% DMSO + 90% FBS). Place at -80°C overnight and place in liquid nitrogen the next day. Alternatively, vials may be placed directly in liquid nitrogen. Functional Validation and Assay Performance [00463]The following assays are designed for 96-well format. To perform the assay in different tissue culture formats, the cell number and reagent volume should be scaled appropriately. Materials Required but Not Supplied for Cell Culture • Thaw Medium 1 (BPS Bioscience #60187) + 10 ug/ml of insulin• Growth Medium IB (BPS Bioscience #79531) + 10 ug/ml of insulin* Insulin Solution from Bovine Pancreas (Sigma-Aldrich #: 10516)Materials Required but Not Supplied for Cellular Assay• H2O2: activator of Hippo pathway (activate MST kinases)• Insulin• Assay Medium: Thaw Medium 1 (BPS Cat. #60187) + 10 ug/ml of insulin* Insulin Solution from Bovine Pancreas (Sigma-Aldrich Cat#: 10516)• Okadaic acid (BPS bioscience #27047): activator of Hippo pathway (activate MST kinases). Prepare 10 mM stock in DMSO.• 96-well tissue culture plate or 96-well tissue culture-treated white clear-bottom assay plate • ONE-StepTM Luciferase Assay System (BPS, Cat. #60690)• Luminometer Mycoplasma testing [00464]The cell line has been screened using the PCR-based VenorGeM Mycoplasma Detection kit (Sigma-Aldrich) to confirm the absence of Mycoplasma species. 157 WO 2022/120354 PCT/US2021/072684 Inhibition of TEAD reporter activity by activator of Hippo pathway in TEAD Reporter - MCF7 cells 1) Harvest TEAD Reporter - MCF7 cells from culture in growth medium and seed cells at a density of 35,000 cells per well into white clear-bottom 96-well microplate in 45 pl of assay medium.2) Incubate cells at 37°C in a CO2 incubator for overnight.3) Dilute the activators (H2O2 or okadaic acid) stock in assay medium. Add 5 pl of diluted activators to the wells. The final concentration of DMSO in assay medium is 0.1%.4) Add 5 pl of assay medium with same concentration of DMSO without activator to control wells.5) Add 50 pl of assay medium with DMSO to cell-free control wells (for determining background luminescence).6) Set up each treatment in at least triplicate.7) Incubate cells at 37°C in a CO2 incubator for 5-6 hours.8) Perform luciferase assay using the ONE-StepTM Luciferase Assay System following the protocol provided: Add 100 pl of ONE-StepTM Luciferase reagent per well and rock at room temperature for ~15 minutes. Measure luminescence using a luminometer.9) Data Analysis: Obtain the background-subtracted luminescence by subtracting the average background luminescence (cell-free control wells) from the luminescence reading of all wells. id="p-465" id="p-465" id="p-465" id="p-465" id="p-465" id="p-465" id="p-465" id="p-465" id="p-465" id="p-465" id="p-465" id="p-465" id="p-465" id="p-465"
id="p-465"
[00465]Certain compounds were tested in TEAD reporter assay, and in H226 and H28. The data are listed in Table 2 below. A:EC50 <0.1 uM; B:0.1 uM < EC50 < 0.5 uM; C:EC50 > 0.uM. Table 2. In vitro Data of Certain Exemplary Compounds. I# H226 EC50 (uM) TEAD Reporter Assay EC50 (uM) C B C C c C c C c C c C 158 WO 2022/120354 PCT/US2021/072684 7 C C A A A A isomer 1 of 1-25 A C Isomer 2 of 1-25 C C isomer 1 of 1-26 A A Isomer 2 of 1-26 B C A A isomer 1 of 1-27 B C Isomer 2 of 1-27 C C isomer 1 of 1-28 B C Isomer 2 of 1-28 C C isomer 1 of 1-29 A B isomer 2 of 1-29 B B isomer 1 of 1-30 A C isomer 2 of 1-30 C C isomer 1 of 1-31 C C isomer 2 of 1-31 B C isomer 1 of 1-32 C A isomer 2 of 1-32 B C Example 3: Mouse Pharmacokinetics Study [00466]Formulated compounds are administered intravenously or orally via gavage to BALB/c mice. Typically, at 0.167, 0.5, 1, 2, 4, 6, 12, and 24 hours post-dose, blood is collected and processed to plasma by centrifugation and stored at -80 °C until analysis. Internal standard is added to each sample prior to protein precipitation with acetonitrile or TCA. The precipitates are filtered through a filter plate and the samples are analyzed by LC/MS/MS. A standard curve is prepared in plasma from typically from 1.0 ng/mL to 3000 ng/mL and processed in the same manner as the samples. Sample analysis is typically performed on a suitable LC/MS/MS system fitted with an analytical UPLC column and compounds eluted from the analytical column with a gradient from 30-95% 0.1 % formic acid (v/v) in ACN: 0.1 % formic acid (v/v) in water. Mass spectrometric 159 WO 2022/120354 PCT/US2021/072684 detection of test compound and the internal standard is performed by MRM in positive mode. The pharmacokinetics of each compound are analyzed by Phoenix WinNonlin software (Pharsight, St. Louis, MO) via noncompartmental analysis.
Example 4. CTGF Data Analysis [00467]NU/NU nude female mice are obtained from Charles River Laboratories and subcutaneously injected with NCI-H226 (ATCC) human mesothelioma cells. Once tumors grow to an average size of 350-400 mm 3, mice are randomized into each treatment group. NCI-H2tumor bearing mice are treated by oral gavage with Vehicle (5%DMSO/95% PEG 400) or a TEAD inhibitor for a total of 3 administrations. 4 hours post-third administration, mice are euthanized and tumors collected for isolation of RNA for pharmacodynamic (PD) analysis. [00468]RNA is extracted from the tumors utilizing the QIAZOL (Qiagen) lysis reagent, tissues are then homogenized for 10 minutes using TissueLyser II (Qiagen). Once sample disruption and digestion is complete, chloroform is added to each sample, the homogenate is separated into aqueous and organic phases by centrifugation. [00469]RNA is then isolated from samples using the KingFisher Flex automated extraction system and MagMAX mirvana total RNA isolation kit. Manufacturer ’s recommended protocol for high-throughput isolation of RNA from tissue samples is followed for RNA extraction. [00470]Expression of the YAP/TEAD-regulated gene, CCN2 that encodes CTFG (Connective Tissue Growth Factor), and the housekeeping gene, human glyceraldehyde 3-phosphate dehydrogenase (GAPDH), are quantified by qRT-PCR analysis using the TaqMan Gene Expression Master Mix and TaqMan probes. CTGF and GAPDH cycle threshold (Ct) values for tumor cDNA samples are determined, and CTGF expression is normalized to GAPDH as an internal control. [00471]The relative CTGF mRNA expression levels for each treatment group from tumor tissues are normalized to the vehicle control group. For comparisons between vehicle control and TEAD inhibitor treatment groups, an independent sample t-test is used for statistical analysis.
Example 5. Anti-Proliferation Assay [00472]Individual cell lines are grown in medium according to supplier instructions and seeded into 96-well plates at a density that ensures logarithmic growth over 72-96 hours. TEAD inhibitor 160 WO 2022/120354 PCT/US2021/072684 compounds are administered to cells at a top concentration of 10 pm and subsequently a 10 point 3-fold serial dilution is conducted. After 72-96 hours, proliferation is quantified using Cell TITERGLO™ (Promega, Inc.) and compared to vehicle control. IC50 and EC50 values are generated using Prism or XLFit curve fitting software.
Example 6. In vivo Inhibition of Tumor Growth NCI-H226 in vivo Efficacy Studies [00473] 6-8 week old nu/nu nude mice (CRL) are inoculated subcutaneously with 5 xlO6 NCI-H226 human mesothelioma tumor cells in the right flank. Tumor growth is monitored twice per week using vernier calipers and mean tumor volume (MTV) calculated using the formula V= WxL/2. [00474]When the MTV reaches approximately 150-200 mm 3, animals are randomized into treatment groups (n=8-10/group) and dosed per os (PO) on a once everyday (QD) schedule for 27- days with either Vehicle (5% DMSO + 95% PEG 400) or TEAD inhibitors. [00475]Randomization and treatments start on Day 0 and % Tumor Growth Inhibition is calculated on the last day of the study (when the control MTV reaches maximum allowable tumor volume), and the following calculation is performed. [00476]%TGI= 100 - [MTV treated / MTV control] x 100 [00477]Tumor growth and body weight change are measured twice per week. [00478]For comparisons between vehicle control and TEAD inhibitor treatment groups, an independent sample t-test is used for statistical analysis. MSTO-211H in vivo efficacy studies [00479] 6-8 week old SCID mice (CRL) are inoculated subcutaneously with 5 xlO6 MSTO-211H human mesothelioma tumor cells in the right flank. Tumor growth is monitored twice per week using vernier calipers and mean tumor volume (MTV) is calculated using the formula V= W2 x L/2. [00480]When the MTV reached approximately 150-200 mm 3, animals are randomized into treatment groups (n=6-8/group) and dosed per os (PO) on a once everyday (QD) schedule for 22- days with either Vehicle (5% DMSO + 95% PEG 400) or TEAD inhibitors. 161 WO 2022/120354 PCT/US2021/072684 id="p-481" id="p-481" id="p-481" id="p-481" id="p-481" id="p-481" id="p-481" id="p-481" id="p-481" id="p-481" id="p-481" id="p-481" id="p-481" id="p-481"
id="p-481"
[00481]Randomization and treatments started on Day 0 and % Tumor Growth Inhibition is calculated on the last day of the study (when the control MTV reaches maximum allowable tumor volume), the following calculation is performed. [00482]%TGI= 100 - [MTV treated / MTV control] x 100 [00483]Tumor growth and body weight change are measured twice per week. [00484]For comparisons between vehicle control and TEAD inhibitor treatment groups, an independent sample t-test is used for statistical analysis.
Example ר. TEAD Selectivity Assays [00485]The TEAD targeting selectivity profiles of the TEAD inhibitor compounds described herein can be determined by any of the exemplary assays provided herein designed to monitor the interaction of TEAD isoforms or variants, e.g., human TEAD1 (UniProt KB ID P28347-1 (SEQ ID NO: 1)), human TEAD2 (UniProtKB ID Q15562 (SEQ ID NO: 2)), human TEAD(UniProtKB ID Q99594 (SEQ ID NO: 3)), and human TEAD4 (UniProtKB ID QI5561 (SEQ ID NO: 4), and YAP1 or TAZ. While co-immunoprecipitation techniques can be used to monitor protein-protein interactions, it is difficult to increase the throughput based on the basic methodology required. Accordingly, alternative but complementary assays are employed to monitor the interaction of the different TEAD isoforms or variants, e.g., human TEAD1 (UniProt KB ID P28347-1 (SEQ ID NO: 1)), human TEAD2 (UniProtKB ID Q15562 (SEQ ID NO: 2)), human TEAD3 (UniProtKB ID Q99594 (SEQ ID NO: 3)), and human TEAD4 (UniProtKB ID Q15561 (SEQ ID NO: 4), and YAP1 (or TAZ). [00486]The first exemplary assay is an in vitro biochemical fluorescent polarization assay using recombinantly expressed and purified YAP-binding domains of individual TEAD isoforms and a fluorescently labeled peptide derived from the primary sequence of YAP 1. (Bum-Erdene et at, Cell Chem Biol. 2019 Mar 21;26(3):378-389.el3, the contents of which are herein incorporated by reference in their entireties). Compounds are incubated with individual TEAD isoform proteins and the fluorescent peptide and potency is determined by quantifying the displacement of the peptide. [00487]The second exemplary assay is a cell-based assay employing the split luciferase reporter system (Hall et al., ACS Chem. Biol. 2012, 7, 11, 1848-1857, the contents of which are herein incorporated by reference in their entireties). Briefly, the YAP-binding domain of each 162 WO 2022/120354 PCT/US2021/072684 TEAD isoform is transiently co-expressed with the TEAD-binding domain or either YAP1 or TAZ in HEK293 cells and the proximity of the two chimeric gene fusion products is monitored by luciferase activity (Nouri et al. Cancers (Basel). 2019 Oct 19; 11(10), the contents of which are herein incorporated by reference in their entireties). Compounds that interfere with the interaction of a TEAD isoform and YAP1 (or TAZ) decrease the resulting luciferase activity relative to vehicle treated controls. Similar in process to the fluorescent polarization assay, these chimeric gene fusions are recombinantly expressed in bacteria or insect cells and employed as an in vitro biochemical assay with a similar luciferase readout as the cell-based assay. [00488]Another exemplary assay is a thiol conjugation assay that monitors prevention of covalent binding of a fluorescence turn-on probe to a cysteine in the central pocket of TEAD isoforms by small molecules, as described in Karatas et al., "Discovery of Covalent Inhibitors Targeting the Transcriptional Enhanced Associate Domain (TEAD) Central Pocket, " J. Med. Chem. 2020, the contents of which are herein incorporated by reference in their entireties. Briefly, the thiol reactive pro-fluorescent probe, N-(4-(7-diethylamino-4-methylcoumarin-3-yl) phenyl) maleimide (CPM) is used. The fluorescence in CPM is quenched due to the maleimide substitution on the phenyl group that modulates the resonance between the coumarin carbonyl and 7-amino groups. However, upon reaction with a thiol, CPM fluorescence increases strongly. CPM can be used to investigate TEAD inhibition because reaction of a free cysteine residue in the TEAD central pocket yields a fluorescence signal, such that small molecules that bind to the TEAD central pocket with appreciable potency prevents covalent labeling of the cysteine by CPM. Thus, in thiol conjugation assays, freshly prepared TEAD protein solutions are added and incubated at room temperature with test compounds in assay buffer, followed by the addition of a CPM solution and fluorescence is measured (Ex/Em: 380/470 nm). Any test compounds that bind the TEAD central pocket with appreciable potency show less fluorescence or inhibition of fluorescence relative to compounds that do not bind the TEAD central pocket.
Example 8. Inhibition of malignant mesothelioma tumor cell growth [00489]The tumor cell growth inhibitory activity of the TEAD inhibitors described herein is evaluated in NCI-H2052 mesothelioma cell line harboring a NF2 mutation. This cell line is selected, in part, based on its mutational status and the ability of a siRNA directed against YAP, TAZ or TEAD1-TEAD4 to inhibit cell proliferation. The nuclear localization of YAP at 163 WO 2022/120354 PCT/US2021/072684 confluence is also taken into account. 10,000 cells/well are plated in a 96-well black plate with clear flat bottom TC-Treated Imaging plate in regular medium with serum, which is replaced the day after with starvation medium containing 1% serum. After one day growth in the starvation medium, cells are incubated with TEAD inhibitor compounds. The starting concentration is 30 pM and serial dilutions in DMSO and medium are performed until 0.1 pM to achieve a final DMSO concentration of 0.5%. The cells are then allowed to grow for 3 days, and then, EdU (Invitrogen, Molecular Probe) is added in each well at a final concentration of 10 mM and the cells are returned to the incubator for an additional 24h. The starvation medium is removed and 100 pl of PF A 4% containing Hoechst dye is added in each well to fix the cells. Plates are then incubated at room temperature for 15 min, washed twice with PBS, and the cells permeabilized by adding 100 pl per well of triton- 100 containing 0.3% BSA. After 20 min, cells are washed with PBS and EdU detection is performed according to the instructions of the manufacturer. Image acquisition is performed, for example, using the ImageXpress Micro and analyzed using the MetaXpress software (Molecular Device). id="p-490" id="p-490" id="p-490" id="p-490" id="p-490" id="p-490" id="p-490" id="p-490" id="p-490" id="p-490" id="p-490" id="p-490" id="p-490" id="p-490"
id="p-490"
[00490]While we have described a number of embodiments of this invention, it is apparent that our basic examples may be altered to provide other embodiments that utilize the compounds and methods of this invention. Therefore, it will be appreciated that the scope of this invention is to be defined by the application and appended claims rather than by the specific embodiments that have been represented by way of example.
Claims (53)
1. A compound of Formula I: or a pharmaceutically acceptable salt thereof, wherein:L1 is a covalent bound, or a C1-6 bivalent straight or branched hydrocarbon chain wherein 1, 2, ormethylene units of the chain are independently and optionally replaced with -N(R)-, -O-, or-C(O)-; Ring A is selected from each of which is optionally substituted; 165 WO 2022/120354 PCT/US2021/072684 each R2 is independently is selected from -OR, -C(O)NR2, optionally substituted -C1-6 aliphatic, each Y is independently N or CR5;each R2 3 is independently H, or optionally substituted -C1-6 aliphatic;each R4 is independently -S(O)2NR2, -S(O)2R, -C(O)NR2, -C(O)R, or optionally substituted -C1-aliphatic;each R5 is independently R, -CN, -C(O)R, -C(O)NR2, or optionally substituted 5-6 membered heteroaryl having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur;each m is independently 0, 1, or 2;p is 0, 1, or 2; andeach R is independently H, optionally substituted -C1-6 aliphatic, optionally substituted 3-membered saturated or partially unsaturated monocyclic carbocyclyl, or optionally substituted 3-8 membered saturated or partially unsaturated monocyclic heterocyclyl having 1-heteroatoms independently selected from nitrogen, oxygen, or sulfur.
2. The compound of claim 1, or a pharmaceutically acceptable salt thereof, wherein L1 is Ci- bivalent straight or branched hydrocarbon chain, wherein 1, 2, or 3 methylene units of the chain are replaced with -N(R)-.
3. The compound of claims 1 or 2, or a pharmaceutically acceptable salt thereof, wherein Ring A is =/ , which is optionally substituted.
4. The compound of claims 1 or 2, or a pharmaceutically acceptable salt thereof, wherein Ring A is , which is optionally substituted. 166 WO 2022/120354 PCT/US2021/072684
5. The compound of claims 1 or 2, or a pharmaceutically acceptable salt thereof, wherein Ring A is , which is optionally substituted.
6. The compound of claims 1 or 2, or a pharmaceutically acceptable salt thereof, wherein Ring A is , which is optionally substituted.
7. The compound of any one of claims 1-6, or a pharmaceutically acceptable salt thereof,
8.The compound of any one of claims 1-7, or a pharmaceutically acceptable salt thereof, 8.
9. The compound of claim 1, which is a compound of formulas: 167 WO 2022/120354 PCT/US2021/072684 168 WO 2022/120354 PCT/US2021/072684 II-S Il-t or a pharmaceutically acceptable salt thereof, wherein each R1 is independently R, halogen, -CN, -C(O)R, -C(O)NR2, -OR, -SR, -S(O)2NR2, or -S(O)2R, and each n is independently 0, 1, 2, or 3.
10. The compound of claim 1, which is a compound of formulas: 169 WO 2022/120354 PCT/US2021/072684 170 WO 2022/120354 PCT/US2021/072684 171 WO 2022/120354 PCT/US2021/072684 or a pharmaceutically acceptable salt thereof, wherein each R1 is independently R, halogen, -CN, -C(O)R, -C(O)NR2, -OR, -SR, -S(O)2NR2, or -S(O)2R, and each n is independently 0, 1, 2, or 3.
11. The compound of claim 1, which is a compound of formulas: IV-a IV-b 172 WO 2022/120354 PCT/US2021/072684 IV-k IV-1 173 WO 2022/120354 PCT/US2021/072684 174 WO 2022/120354 PCT/US2021/072684 or a pharmaceutically acceptable salt thereof, wherein each R1 is independently R, halogen, -CN, -C(O)R, -C(O)NR2, -OR, -SR, -S(O)2NR2, or -S(O)2R, and each n is independently 0, 1, 2, or 3.
12. The compound of claim 1, which is a compound of formulas: 175 WO 2022/120354 PCT/US2021/072684 V-m V-0 , or a pharmaceutically acceptable salt thereof, wherein each R1 is independently R, halogen, -CN, -C(O)R, -C(O)NR2, -OR, -SR, -S(O)2NR2, or -S(O)2R.
13. The compound of claim 1, which is a compound of formulas:»w RW R י R VI-a Vl-b 176 WO 2022/120354 PCT/US2021/072684 WO 2022/120354 PCT/US2021/072684 or a pharmaceutically acceptable salt thereof, wherein each R1 is independently R, halogen, -CN, -C(O)R, -C(O)NR2, -OR, -SR, -S(O)2NR2, or -S(O)2R, and each n is independently 0, 1, 2, or 3.
14. The compound of claim 1, which is a compound of formulas:Rw VH-a Vll-i 178 WO 2022/120354 PCT/US2021/072684 Vll-m or a pharmaceutically acceptable salt thereof, wherein each R1 is independently R, halogen, -CN, -C(O)R, -C(O)NR2, -OR, -SR, -S(O)2NR2, or -S(O)2R, and each n is independently 0, 1, 2, or 3.
15. The compound of claim 1, which is a compound of Formulas: VIII-g VIII-hor a pharmaceutically acceptable salt thereof, wherein each R1 is independently R, halogen, -CN, -C(O)R, -C(O)NR2, -OR, -SR, -S(O)2NR2, or -S(O)2R, and each n is independently 0, 1, 2, or 3.
16. The compound of any one of the preceding claims, which is selected from the compounds of Table 1, or a pharmaceutically acceptable salt thereof. 179 WO 2022/120354 PCT/US2021/072684
17. A pharmaceutical composition comprising the compound of any one of the preceding claims, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier, adjuvant, or vehicle.
18. A method for treating cancer in a patient, comprising administering to the patient the compound of any one of claims 1-16, or a pharmaceutically acceptable salt thereof, or the pharmaceutical composition of claim 17.
19. The method of claim 18, wherein the cancer is associated with increased TEAD expression.
20. The method of claims 18 or 19, wherein the cancer is associated with increased TEADactivity.
21. A method for inhibiting the progress of cancer in a patient, comprising administering to the patient the compound of any one of claims 1-16, or a pharmaceutically acceptable salt thereof, or the pharmaceutical composition of claim 17.
22. The method of claim 21, wherein the cancer is associated with increased TEAD expression.
23. The method of claims 21 or 22, wherein the cancer is associated with increased TEADactivity.
24. A method of treating a patient having a disease or disorder associated with increased TEAD expression comprising the step of administering to a patient in need thereof a therapeutically effective amount of the compound of any one of claims 1-16, or a pharmaceutically acceptable salt thereof, or the pharmaceutical composition of claim 17.
25. A method of treating a patient having a disease or disorder associated with increased TEAD activity comprising the step of administering to a patient in need thereof a therapeutically effective 180 WO 2022/120354 PCT/US2021/072684 amount of the compound of any one of claims 1-16, or a pharmaceutically acceptable salt thereof, or the pharmaceutical composition of claim 17.
26. A method of treating a disease or disorder in which inhibition of TEAD activity is beneficial comprising the step of administering to a patient in need thereof a therapeutically effective amount of the compound of any one of claims 1-16, or a pharmaceutically acceptable salt thereof, or the pharmaceutical composition of claim 17.
27. A method of treating a disease or disorder in which Hippo pathway inhibition is beneficial comprising the step of administering to a patient in need thereof a therapeutically effective amount of the compound of any one of claims 1-16, or a pharmaceutically acceptable salt thereof, or the pharmaceutical composition of claim 17.
28. The method of any one of claims 24-27, wherein the disease or disorder is a cellular proliferative disorder.
29. The method of claim 28, wherein the cellular proliferative disorder is cancer.
30. The method of any one of claims 18-23 and 29, wherein the cancer is a cancer in whichYAP is localized in the nucleus of cells of the cancer.
31. The method of any one of claims 19, 20, and 22-25, wherein the increased TEAD expression or increased TEAD activity is increased TEAD1 expression or increased TEADactivity.
32. The method of any one of claims 19, 20, and 22-25, wherein the increased TEAD expression or increased TEAD activity is increased TEAD2 expression or increased TEADactivity. 181 WO 2022/120354 PCT/US2021/072684
33. The method of any one of claims 19, 20, and 22-25, wherein the increased TEAD expression or increased TEAD activity is increased TEAD3 expression or increased TEADactivity.
34. The method of any one of claims 19, 20, and 22-25, wherein the increased TEAD expression or increased TEAD activity is increased TEAD4 expression or increased TEADactivity.
35. The method of any one of claims 19, 20, and 22-25, wherein the increased TEAD expression or increased TEAD activity is increased TEAD1 expression or increased TEADactivity; increased TEAD2 expression or increased TEAD2 activity; increased TEAD3 expression or increased TEAD3 activity; increased TEAD4 expression or increased TEAD4 activity; or any combination thereof.
36. Use of the compound of any one of claims 1-16, or a pharmaceutically acceptable salt thereof, or the pharmaceutical composition of claim 17, for treating cancer in a patient.
37. The use of claim 36, wherein the cancer is associated with increased TEAD expression.
38. The use of claims 36 or 37, wherein the cancer is associated with increased TEAD activity.
39. Use of the compound of any one of claims 1-16, or a pharmaceutically acceptable salt thereof, or the pharmaceutical composition of claim 17, for inhibiting the progress of cancer in a patient.
40. The use of claim 39, wherein the cancer is associated with increased TEAD expression.
41. The use of claims 39 or 40, wherein the cancer is associated with increased TEAD activity. 182 WO 2022/120354 PCT/US2021/072684
42. Use of the compound of any one of claims 1-16, or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition of claim 17, for treating a disease or disorder associated with increased TEAD expression.
43. Use of the compound of any one of claims 1-16, or a pharmaceutically acceptable salt thereof, or the pharmaceutical composition of claim 17, for treating a disease or disorder associated with increased TEAD activity.
44. Use of the compound of any one of claims 1-16, or a pharmaceutically acceptable salt thereof, or the pharmaceutical composition of claim 17, for treating a disease or disorder in which inhibition of TEAD activity is beneficial.
45. Use of a compound of any one of claims 1 -16, or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition of claim 17, for treating a disease or disorder in which Hippo pathway inhibition is beneficial.
46. The use of any one of claims 42-45, wherein the disease or disorder is a cellular proliferative disorder.
47. The use of claim 46, wherein the cellular proliferative disorder is cancer.
48. The use of any one of claims 36-41 and 47, wherein the cancer is a cancer in which YAP is localized in the nucleus of cells of the cancer.
49. The use of any one of claims 37, 38, and 40-43, wherein the increased TEAD expression or increased TEAD activity is increased TEAD1 expression or increased TEAD1 activity.
50. The use of any one of claims 37, 38, and 40-43, wherein the increased TEAD expression or increased TEAD activity is increased TEAD2 expression or increased TEAD2 activity. 183 WO 2022/120354 PCT/US2021/072684
51. The use of any one of claims 37, 38, and 40-43, wherein the increased TEAD expression or increased TEAD activity is increased TEAD3 expression or increased TEAD3 activity.
52. The use of any one of claims 37, 38, and 40-43, wherein the increased TEAD expression or increased TEAD activity is increased TEAD4 expression or increased TEAD4 activity.
53. The use of any one of claims 37, 38, and 40-43, wherein the increased TEAD expression or increased TEAD activity is increased TEAD1 expression or increased TEAD1 activity; increased TEAD2 expression or increased TEAD2 activity; increased TEAD3 expression or increased TEAD3 activity; increased TEAD4 expression or increased TEAD4 activity; or any combination thereof. 184
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202063120441P | 2020-12-02 | 2020-12-02 | |
| PCT/US2021/072684 WO2022120354A1 (en) | 2020-12-02 | 2021-12-02 | Tead inhibitors and uses thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| IL303376A true IL303376A (en) | 2023-08-01 |
Family
ID=79283210
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| IL303376A IL303376A (en) | 2020-12-02 | 2021-12-02 | TEAD inhibitors and their uses |
Country Status (8)
| Country | Link |
|---|---|
| EP (1) | EP4255895A1 (en) |
| JP (1) | JP2023553866A (en) |
| KR (1) | KR20230131189A (en) |
| CN (1) | CN117015531A (en) |
| AU (1) | AU2021392040A1 (en) |
| CA (1) | CA3200814A1 (en) |
| IL (1) | IL303376A (en) |
| WO (1) | WO2022120354A1 (en) |
Families Citing this family (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| BR112021024108A2 (en) | 2019-05-31 | 2022-03-22 | Ikena Oncology Inc | Tead inhibitors and uses thereof |
| TW202108559A (en) | 2019-05-31 | 2021-03-01 | 美商醫肯納腫瘤學公司 | Tead inhibitors and uses thereof |
| WO2023060227A1 (en) | 2021-10-07 | 2023-04-13 | Ikena Oncology, Inc. | Tead inhibitors and uses thereof |
| KR20230110448A (en) * | 2022-01-14 | 2023-07-24 | 주식회사 대웅제약 | A novel aminobenzene derivative having a cancer cell growth inhibitory effect and a preventive or therapeutic pharmaceutical composition containing the same as an active ingredient |
| WO2023173057A1 (en) | 2022-03-10 | 2023-09-14 | Ikena Oncology, Inc. | Mek inhibitors and uses thereof |
| WO2023173053A1 (en) | 2022-03-10 | 2023-09-14 | Ikena Oncology, Inc. | Mek inhibitors and uses thereof |
| EP4524134A1 (en) * | 2022-05-09 | 2025-03-19 | TYK Medicines Inc. | Polycyclic compound and use thereof |
| TW202404581A (en) | 2022-05-25 | 2024-02-01 | 美商醫肯納腫瘤學公司 | Mek inhibitors and uses thereof |
| JP2025534549A (en) | 2022-09-29 | 2025-10-16 | インシリコ メディシン アイピー リミテッド | TEAD inhibitors and methods of use thereof |
| WO2024077085A1 (en) * | 2022-10-07 | 2024-04-11 | Memorial Sloan-Kettering Cancer Center | Targeting phospholipase a2 (pla2) in cancer |
| WO2024092116A1 (en) | 2022-10-26 | 2024-05-02 | Ikena Oncology, Inc. | Combination of tead inhibitors and egfr inhibitors and uses thereof |
| WO2024105610A1 (en) | 2022-11-18 | 2024-05-23 | Novartis Ag | Pharmaceutical combinations and uses thereof |
| WO2024173761A1 (en) | 2023-02-17 | 2024-08-22 | Ikena Oncology, Inc. | Combinations comprising mek inhibitors for use in the treatment of cancer |
| CN120659608A (en) | 2023-02-23 | 2025-09-16 | 诺华股份有限公司 | TEAD inhibitor and KRAS G12D inhibitor combination for the treatment of cancer |
| WO2024176130A1 (en) | 2023-02-23 | 2024-08-29 | Novartis Ag | Tead- and her2-inhibitor combinations for treating cancer |
| CN117844981B (en) * | 2024-01-10 | 2024-08-23 | 首都医科大学附属北京儿童医院 | Application of TEAD4 and related genes/proteins thereof in virus infection diseases |
| TW202547484A (en) | 2024-04-10 | 2025-12-16 | 瑞士商諾華公司 | Pharmaceutical combinations and uses thereof |
Family Cites Families (67)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3120564A (en) * | 1960-01-13 | 1964-02-04 | American Cyanamid Co | Alkenoylamino benzophenones |
| ZA825719B (en) * | 1981-09-03 | 1983-06-29 | Recordati Chem Pharm | Alkanoylanilides |
| JPS58179838A (en) * | 1982-04-14 | 1983-10-21 | Konishiroku Photo Ind Co Ltd | Formation of image |
| PT1382339E (en) | 1999-12-10 | 2008-02-06 | Pfizer Prod Inc | Compositions containing pyrrolo ¬2,3-d pyrimidine derivatives |
| PE20020354A1 (en) | 2000-09-01 | 2002-06-12 | Novartis Ag | HYDROXAMATE COMPOUNDS AS HISTONE-DESACETILASE (HDA) INHIBITORS |
| JP3836436B2 (en) | 2001-04-27 | 2006-10-25 | 全薬工業株式会社 | Heterocyclic compounds and antitumor agents containing the same as active ingredients |
| TWI329105B (en) | 2002-02-01 | 2010-08-21 | Rigel Pharmaceuticals Inc | 2,4-pyrimidinediamine compounds and their uses |
| DK1536827T3 (en) | 2002-08-14 | 2009-04-20 | Silence Therapeutics Ag | Use of protein kinase N-beta |
| JP2006523237A (en) | 2003-04-03 | 2006-10-12 | セマフォア ファーマシューティカルズ, インコーポレイテッド | PI-3 kinase inhibitor prodrug |
| JP4980715B2 (en) | 2003-05-30 | 2012-07-18 | ジェミン エックス ファーマシューティカルズ カナダ インコーポレイテッド | Tricyclic heterocyclic compounds, compositions and methods for treating cancer or viral diseases |
| JP2007524397A (en) | 2003-07-03 | 2007-08-30 | ザ・トラスティーズ・オブ・ザ・ユニバーシティ・オブ・ペンシルベニア | Inhibition of SYK kinase expression |
| PL1761540T3 (en) | 2004-05-13 | 2017-06-30 | Icos Corporation | Quinazolinones as inhibitors of human phosphatidylinositol 3-kinase delta |
| JP4163738B2 (en) | 2004-06-11 | 2008-10-08 | 日本たばこ産業株式会社 | 5-Amino-2,4,7-trioxo-3,4,7,8-tetrahydro-2H-pyrido'2,3-d for the treatment of cancer! Pyrimidine derivatives and related compounds |
| TWI309240B (en) | 2004-09-17 | 2009-05-01 | Hoffmann La Roche | Anti-ox40l antibodies |
| CN1944398A (en) * | 2005-01-11 | 2007-04-11 | 中国医学科学院药物研究所 | New benzoyl amide compounds and its preparing method and medicine use |
| CN101115761B (en) | 2005-01-19 | 2012-07-18 | 里格尔药品股份有限公司 | Prodrugs of 2,4-pyrimidinediamine compounds and their uses |
| WO2006105021A2 (en) | 2005-03-25 | 2006-10-05 | Tolerrx, Inc. | Gitr binding molecules and uses therefor |
| PT1888550E (en) | 2005-05-12 | 2014-09-03 | Abbvie Bahamas Ltd | Apoptosis promoters |
| GB0510390D0 (en) | 2005-05-20 | 2005-06-29 | Novartis Ag | Organic compounds |
| EA019344B1 (en) | 2005-07-01 | 2014-03-31 | МЕДАРЕКС, Эл.Эл.Си. | Human monoclonal antibodies to programmed death ligand 1 (pd-l1) and uses thereof |
| US7402325B2 (en) | 2005-07-28 | 2008-07-22 | Phoenix Biotechnology, Inc. | Supercritical carbon dioxide extract of pharmacologically active components from Nerium oleander |
| ES2513165T3 (en) | 2005-10-07 | 2014-10-24 | Exelixis, Inc. | N- (3-amino-quinoxalin-2-yl) -sulfonamide derivatives and their use as phosphatidylinositol-3-kinase inhibitors |
| NZ567851A (en) | 2005-11-01 | 2011-09-30 | Targegen Inc | Bi-aryl meta-pyrimidine inhibitors of kinases |
| TWI630207B (en) | 2005-12-13 | 2018-07-21 | 英塞特控股公司 | Heteroaryl-substituted pyrrolo[2,3-b]pyridine and pyrrolo[2,3-b]pyrimidine as inhibitors of JANUS KINASE |
| JO2660B1 (en) | 2006-01-20 | 2012-06-17 | نوفارتيس ايه جي | PI-3 Kinase inhibitors and methods of their use |
| KR101533461B1 (en) | 2006-04-26 | 2015-07-02 | 에프. 호프만-라 로슈 아게 | The thieno [3,2-D] pyrimidine derivatives useful as PI3K inhibitors |
| EA018573B1 (en) | 2006-09-22 | 2013-09-30 | Фармасайкликс, Инк. | BLUTON TYROSINKINASE INHIBITORS |
| KR101737753B1 (en) | 2007-03-12 | 2017-05-18 | 와이엠 바이오사이언시즈 오스트레일리아 피티와이 엘티디 | Phenyl amino pyrimidine compounds and uses thereof |
| WO2008118802A1 (en) | 2007-03-23 | 2008-10-02 | Regents Of The University Of Minnesota | Therapeutic compounds |
| EP1987839A1 (en) | 2007-04-30 | 2008-11-05 | I.N.S.E.R.M. Institut National de la Sante et de la Recherche Medicale | Cytotoxic anti-LAG-3 monoclonal antibody and its use in the treatment or prevention of organ transplant rejection and autoimmune disease |
| PE20090717A1 (en) | 2007-05-18 | 2009-07-18 | Smithkline Beecham Corp | QUINOLINE DERIVATIVES AS PI3 KINASE INHIBITORS |
| CA2693677C (en) | 2007-07-12 | 2018-02-13 | Tolerx, Inc. | Combination therapies employing gitr binding molecules |
| EP2044949A1 (en) | 2007-10-05 | 2009-04-08 | Immutep | Use of recombinant lag-3 or the derivatives thereof for eliciting monocyte immune response |
| EP2227233B1 (en) | 2007-11-30 | 2013-02-13 | Newlink Genetics | Ido inhibitors |
| PL2288610T3 (en) | 2008-03-11 | 2017-12-29 | Incyte Holdings Corporation | Azetidine and cyclobutane derivatives as jak inhibitors |
| JP2011523616A (en) | 2008-05-29 | 2011-08-18 | サン−ゴバン サントル ドゥ ルシェルシェ エ デトゥードゥ ユーロペン | Porous structure containing aluminum titanate |
| US8338439B2 (en) | 2008-06-27 | 2012-12-25 | Celgene Avilomics Research, Inc. | 2,4-disubstituted pyrimidines useful as kinase inhibitors |
| AR072999A1 (en) | 2008-08-11 | 2010-10-06 | Medarex Inc | HUMAN ANTIBODIES THAT JOIN GEN 3 OF LYMPHOCYTARY ACTIVATION (LAG-3) AND THE USES OF THESE |
| HUE065752T2 (en) | 2008-12-09 | 2024-06-28 | Hoffmann La Roche | Anti-pd-l1 antibodies and their use to enhance t-cell function |
| RU2595409C2 (en) | 2009-09-03 | 2016-08-27 | Мерк Шарп И Доум Корп., | Anti-gitr antibodies |
| WO2011056652A1 (en) | 2009-10-28 | 2011-05-12 | Newlink Genetics | Imidazole derivatives as ido inhibitors |
| AU2010329934B2 (en) | 2009-12-10 | 2015-05-14 | F. Hoffmann-La Roche Ag | Antibodies binding preferentially human CSF1R extracellular domain 4 and their use |
| CA2789071C (en) | 2010-03-05 | 2018-03-27 | F. Hoffmann-La Roche Ag | Antibodies against human csf-1r and uses thereof |
| MX355418B (en) | 2010-05-04 | 2018-04-18 | Five Prime Therapeutics Inc | Antibodies that bind csf1r. |
| CN103221428B (en) | 2010-09-09 | 2016-02-10 | 辉瑞公司 | 4-1BB binding molecule |
| NO2694640T3 (en) | 2011-04-15 | 2018-03-17 | ||
| JP6072771B2 (en) | 2011-04-20 | 2017-02-01 | メディミューン,エルエルシー | Antibodies and other molecules that bind to B7-H1 and PD-1 |
| KR101981873B1 (en) | 2011-11-28 | 2019-05-23 | 메르크 파텐트 게엠베하 | Anti-pd-l1 antibodies and uses thereof |
| US10023643B2 (en) | 2011-12-15 | 2018-07-17 | Hoffmann-La Roche Inc. | Antibodies against human CSF-1R and uses thereof |
| EP2812355A4 (en) | 2012-02-06 | 2016-03-02 | Hoffmann La Roche | COMPOSITIONS AND METHODS OF USING CSF1R INHIBITORS |
| AR090263A1 (en) | 2012-03-08 | 2014-10-29 | Hoffmann La Roche | COMBINED ANTIBODY THERAPY AGAINST HUMAN CSF-1R AND USES OF THE SAME |
| JP2015517490A (en) | 2012-05-11 | 2015-06-22 | ファイブ プライム セラピューティックス インコーポレイテッド | Method of treating a condition using an antibody that binds colony stimulating factor 1 receptor (CSF1R) |
| UY34887A (en) | 2012-07-02 | 2013-12-31 | Bristol Myers Squibb Company Una Corporacion Del Estado De Delaware | OPTIMIZATION OF ANTIBODIES THAT FIX THE LYMPHOCYTE ACTIVATION GEN 3 (LAG-3) AND ITS USES |
| SG10201906328RA (en) | 2012-08-31 | 2019-08-27 | Five Prime Therapeutics Inc | Methods of treating conditions with antibodies that bind colony stimulating factor 1 receptor (csf1r) |
| CN106905316B (en) | 2013-04-18 | 2021-06-01 | 上海复尚慧创医药研究有限公司 | protein kinase inhibitor |
| WO2016035008A1 (en) | 2014-09-04 | 2016-03-10 | Lupin Limited | Pyridopyrimidine derivatives as mek inhibitors |
| WO2016168704A1 (en) | 2015-04-16 | 2016-10-20 | Icahn School Of Medicine At Mount Sinai | Ksr antagonists |
| CN110770211B (en) * | 2017-06-23 | 2023-09-19 | 协和麒麟株式会社 | Alpha, beta unsaturated amide compound |
| US11524943B1 (en) * | 2017-12-06 | 2022-12-13 | Vivace Therapeutics, Inc. | Benzocarbonyl compounds |
| AU2019362788A1 (en) * | 2018-10-15 | 2021-04-15 | Dana-Farber Cancer Institute, Inc. | Transcriptional enhanced associate domain (TEAD) transcription factor inhibitors and uses thereof |
| WO2020087063A1 (en) * | 2018-10-26 | 2020-04-30 | The Trustees Of Indiana University | Compounds and methods to attenuate tumor progression and metastasis |
| CN112912380B (en) | 2018-12-21 | 2023-08-11 | 基石药业(苏州)有限公司 | Crystal form and amorphous form of MEK inhibitor and application thereof |
| TW202108559A (en) * | 2019-05-31 | 2021-03-01 | 美商醫肯納腫瘤學公司 | Tead inhibitors and uses thereof |
| EP4058435A1 (en) * | 2019-11-13 | 2022-09-21 | Genentech, Inc. | Therapeutic compounds and methods of use |
| US20230381180A1 (en) | 2020-01-08 | 2023-11-30 | Icahn School Of Medicine At Mount Sinai | Small molecule modulators of ksr-bound mek |
| AU2021206684B2 (en) | 2020-01-10 | 2024-01-18 | Immuneering Corporation | MEK inhibitors and therapeutic uses thereof |
| AR121078A1 (en) | 2020-01-22 | 2022-04-13 | Chugai Pharmaceutical Co Ltd | ARILAMIDE DERIVATIVES WITH ANTI-TUMOR ACTIVITY |
-
2021
- 2021-12-02 CN CN202180091724.XA patent/CN117015531A/en not_active Withdrawn
- 2021-12-02 IL IL303376A patent/IL303376A/en unknown
- 2021-12-02 KR KR1020237021880A patent/KR20230131189A/en active Pending
- 2021-12-02 JP JP2023533707A patent/JP2023553866A/en active Pending
- 2021-12-02 CA CA3200814A patent/CA3200814A1/en active Pending
- 2021-12-02 WO PCT/US2021/072684 patent/WO2022120354A1/en not_active Ceased
- 2021-12-02 AU AU2021392040A patent/AU2021392040A1/en not_active Abandoned
- 2021-12-02 EP EP21839798.2A patent/EP4255895A1/en not_active Withdrawn
Also Published As
| Publication number | Publication date |
|---|---|
| AU2021392040A1 (en) | 2023-06-29 |
| AU2021392040A9 (en) | 2024-02-08 |
| KR20230131189A (en) | 2023-09-12 |
| CN117015531A (en) | 2023-11-07 |
| JP2023553866A (en) | 2023-12-26 |
| CA3200814A1 (en) | 2022-06-09 |
| WO2022120354A1 (en) | 2022-06-09 |
| EP4255895A1 (en) | 2023-10-11 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12577208B2 (en) | TEAD inhibitors and uses thereof | |
| IL303376A (en) | TEAD inhibitors and their uses | |
| WO2022120353A1 (en) | Tead inhibitors and uses thereof | |
| WO2022120355A1 (en) | Tead degraders and uses thereof | |
| KR20220034739A (en) | TEAD inhibitors and uses thereof | |
| US12459895B2 (en) | MEK inhibitors and uses thereof | |
| EP3846793A1 (en) | Eif4e inhibitors and uses thereof | |
| WO2023173053A1 (en) | Mek inhibitors and uses thereof | |
| WO2023173057A1 (en) | Mek inhibitors and uses thereof | |
| US20240208961A1 (en) | Eif4e inhibitors and uses thereof | |
| KR20240119141A (en) | How to treat cancer | |
| WO2022187849A1 (en) | Salinomycin derivatives and uses thereof | |
| EA047483B1 (en) | TEAD INHIBITORS AND THEIR APPLICATIONS | |
| WO2023211889A1 (en) | Polymorphic compounds and uses thereof |