IL276481A

IL276481A - Anti-b7-h1 and anti-ctla-4 antibodies for treating non-small cell lung cancer

Info

Publication number: IL276481A
Application number: IL276481A
Authority: IL
Original assignee: Medimmune Ltd
Priority date: 2014-05-13
Filing date: 2020-08-04
Publication date: 2020-09-30
Also published as: RU2016148645A3; KR20220162844A; CY1122642T1; CN106456756A; CN113230398A; SG10201810108PA; IL248528B; HRP20191449T1; EP3603748A1; EP3142751A1; AU2020230309A1; GB2531094A; PT3142751T; SI3142751T1; EP3142751B1; IL248528A0; RU2016148645A; CA2947471A1; KR20230165876A; RU2702332C2

Description

ANTI-B7-Hl AND ANTI-CTLA-4 ANTIBODIES FOR TREATING NON- SMALL CELL LUNG CANCER CROSS-REFERENCE TO RELATED APPLICATION 1. 1. id="p-1" id="p-1" id="p-1" id="p-1"

[0001] Application Serial No. 61/992,658, filed May 13, 2014, U.S. Provisional Patent Application Serial No. 62/105,992, filed January 21, 2015, and U.S. Provisional Patent Application Serial No. 62/114,336, filed February 10, 2015. The entire contents of each This application claims priority to and the benefit of U.S. Provisional Patent of these applications are hereby incorporated by reference herein.

BACKGROUND 2. 2. id="p-2" id="p-2" id="p-2" id="p-2"

[0002] treatment of cancer, there continues to be an unmet medical need for more effective and Cancer continues to be a major global health burden. Despite progress in the less toxic therapies, especially for those patients with advanced disease or cancers that are resistant to existing therapeutics. 3. 3. id="p-3" id="p-3" id="p-3" id="p-3"

[0003] tumor control is well recognized. There is mounting evidence that T cells control tumor The role of the immune system, in particular T cell—mediated cytotoxicity, in growth and survival in cancer patients, both in early and late stages of the disease.

However, tumor—specific T—cell responses are difficult to mount and sustain in cancer patients. 4. 4. id="p-4" id="p-4" id="p-4" id="p-4"

[0004] cytotoxic T lymphocyte antigen—4 (CTLA—4, CD152) and programmed death ligand 1 (PD—L1, also known as B7—H1 or CD274). . . id="p-5" id="p-5" id="p-5" id="p-5"

[0005] T cell responses in check following CD28—mediated T cell activation.

Two T cell pathways receiving significant attention to date signal through CTLA4 is expressed on activated T cells and serves as a co—inhibitor to keep CTLA4 is believed to regulate the amplitude of the early activation of naive and memory T cells following TCR engagement and to be part of a central inhibitory pathway that affects both antitumor immunity and autoimmunity. CTLA4 is expressed exclusively on T cells, and the expression of its ligands C D 8 0 (B7 . 1 ) and CD86 (B7.2), is largely restricted to antigen—presenting cells, T cells, and other immune mediating cells. Antagonistic anti—CTLA4 antibodies that block the CTLA4 signaling pathway have been reported to enhance T cell activation. One such antibody, ipilimumab, was approved by the FDA in 2011 for the treatment of metastatic melanoma. Another anti—CTLA4 antibody, WO 2015/173267 PCT/EP2015/060523 tremelimumab, was tested in phase III trials for the treatment of advanced melanoma, but did not significantly increase the overall survival of patients compared to the standard of care (temozolomide or dacarbazine) at that time. 6. 6. id="p-6" id="p-6" id="p-6" id="p-6"

[0006] PD—Ll is also part of a complex system of receptors and ligands that are involved in controlling T—cell activation. In normal tissue, PD—Ll is expressed on T cells, B cells, dendritic cells, macrophages, mesenchymal stem cells, bone marrow—derived mast cells, as well as various nonhematopoietic cells. Its normal function is to regulate the balance between T—cell activation and tolerance through interaction with its two receptors: programmed death 1 (also known as PD—1 or CD279) and CD80 (also known as B7—1 or B7.l). PD—Ll is also expressed by tumors and acts at multiple sites to help tumors evade detection and elimination by the host immune system. PD—Ll is expressed in a broad range of cancers with a high frequency. In some cancers, expression of PD—Ll has been associated with reduced survival and unfavorable prognosis. Antibodies that block the interaction between B7—H1 and its receptors are able to relieve PD—Ll — dependent immunosuppressive effects and enhance the cytotoxic activity of antitumor T cells in vitro. MEDI4736 is a human monoclonal antibody directed against human PD—Ll that is capable of blocking the binding of PD—Ll to both the PD—1 and CD80 receptors. 7. 7. id="p-7" id="p-7" id="p-7" id="p-7"

[0007] Despite the significant progress made over the past decade in developing strategies for combatting cancer and other diseases, patients with advanced, refractory and metastatic disease have limited clinical options. Chemotherapy, irradiation, and high dose chemotherapy have become dose limiting. There remains a substantial unmet need for new less—toxic methods and therapeutics that have better therapeutic efficacy, longer clinical benefit, and improved safety profiles, particularly for those patients with advanced disease or cancers that are resistant to existing therapeutics.

BRIEF SUMMARY 8. 8. id="p-8" id="p-8" id="p-8" id="p-8"

[0008] The invention provides a method of treating non—small cell lung cancer (NSCLC) in a human patient, comprising administering 1 mg/kg of MEDI4736 or an antigen—binding fragment thereof and 1 mg/kg tremelimumab or an antigen—binding fragment thereof to the patient. 9. 9. id="p-9" id="p-9" id="p-9" id="p-9"

[0009] The invention also provides a method of treating a NSCLC in a human patient, comprising administering 3 mg/kg of MEDI4736 or an antigen—binding fragment thereof and 1 mg/kg tremelimumab or an antigen—binding fragment thereof to the patient.

WO 2015/173267 PCT/EP2015/060523 . . id="p-10" id="p-10" id="p-10" id="p-10"

[0010] comprising administering 10 mg/kg of MEDI4736 or an antigen—binding fragment thereof The invention also provides a method of treating NSCLC in a human patient, and 1 mg/kg tremelimumab or an antigen—binding fragment thereof to the patient. 11. 11. id="p-11" id="p-11" id="p-11" id="p-11"

[0011] The invention also provides a method of treating NSCLC in a human patient, comprising administering 15 mg/kg of MEDI4736 or an antigen—binding fragment thereof and 1 mg/kg tremelimumab or an antigen—binding fragment thereof to the patient. 12. 12. id="p-12" id="p-12" id="p-12" id="p-12"

[0012] comprising administering 10 mg/kg of MEDI4736 or an antigen—binding fragment thereof The invention also provides a method of treating NSCLC in a human patient, and 3 mg/kg tremelimumab or an antigen—binding fragment thereof to the patient. 13. 13. id="p-13" id="p-13" id="p-13" id="p-13"

[0013] comprising administering 15 mg/kg of MEDI4736 or an antigen—binding fragment thereof The invention also provides a method of treating NSCLC in a human patient, and 3 mg/kg tremelimumab or an antigen—binding fragment thereof to the patient. 14. 14. id="p-14" id="p-14" id="p-14" id="p-14"

[0014] The invention also provides a method of treating NSCLC in a human patient, comprising administering 20 mg/kg of MEDI4736 or an antigen—binding fragment thereof and 1 mg/kg tremelimumab or an antigen—binding fragment thereof to the patient. . . id="p-15" id="p-15" id="p-15" id="p-15"

[0015] The invention also provides a method of treating NSCLC in a human patient, comprising administering 15 mg/kg of MEDI4736 or an antigen—binding fragment thereof and 10 mg/kg tremelimumab or an antigen—binding fragment thereof to the patient. 16. 16. id="p-16" id="p-16" id="p-16" id="p-16"

[0016] comprising administering 20 mg/kg of MEDI4736 or an antigen—binding fragment thereof The invention also provides a method of treating NSCLC in a human patient, and 3 mg/kg tremelimumab or an antigen—binding fragment thereof to the patient. 17. 17. id="p-17" id="p-17" id="p-17" id="p-17"

[0017] The invention also provides a method of treating NSCLC in a human patient, comprising administering 20 mg/kg of MEDI4736 or an antigen—binding fragment thereof and 10 mg/kg tremelimumab or an antigen—binding fragment thereof to the patient. 18. 18. id="p-18" id="p-18" id="p-18" id="p-18"

[0018] comprising administering 10 mg/kg of MEDI4736 or an antigen—binding fragment thereof The invention also provides a method of treating NSCLC in a human patient, and 10 mg/kg tremelimumab or an antigen—binding fragment thereof to the patient. 19. 19. id="p-19" id="p-19" id="p-19" id="p-19"

[0019] comprising administering 3 mg/kg of MEDI4736 or an antigen—binding fragment thereof The invention also provides a method of treating NSCLC in a human patient, and 3 mg/kg tremelimumab or an antigen—binding fragment thereof to the patient. . . id="p-20" id="p-20" id="p-20" id="p-20"

[0020] comprising administering 3 mg/kg of MEDI4736 or an antigen—binding fragment thereof The invention also provides a method of treating NSCLC in a human patient, and 10 mg/kg tremelimumab or an antigen—binding fragment thereof to the patient.

WO 2015/173267 PCT/EP2015/060523 21. 21. id="p-21" id="p-21" id="p-21" id="p-21"

[0021] comprising administering 1 mg/kg of MEDI4736 or an antigen—binding fragment thereof The invention also provides a method of treating NSCLC in a human patient, and 3 mg/kg tremelimumab or an antigen—binding fragment thereof to the patient. 22. 22. id="p-22" id="p-22" id="p-22" id="p-22"

[0022] The invention also provides a method of treating NSCLC in a human patient, comprising administering 1 mg/kg of MEDI4736 or an antigen—binding fragment thereof and 10 mg/kg tremelimumab or an antigen—binding fragment thereof to the patient. 23. 23. id="p-23" id="p-23" id="p-23" id="p-23"

[0023] MEDI4736 or an antigen—binding fragment thereof (e.g., at 1 mg/kg, 3 mg/kg, 10 mg/kg, The invention also provides a method of treatment comprising administering mg/kg, or 20 mg/kg), and tremelimumab or an antigen—binding fragment thereof (e.g., at 1 mg/kg, 3 mg/kg, 10 mg/kg) to a patient identified as having a PD—Ll' or PD—Ll+ NSCLC. 24. 24. id="p-24" id="p-24" id="p-24" id="p-24"

[0024] In particular embodiments of any of the previous methods, the MEDI4736 is administered every 4 weeks. In one particular embodiment, the MEDI4736 is administered every 4 weeks for 49 weeks. In particular embodiments of any of the previous methods, the MEDI4736 is administered every 2 weeks. In another embodiment, a total of 13 doses of MEDI4736 is administered. . . id="p-25" id="p-25" id="p-25" id="p-25"

[0025] In particular embodiments of the previous aspects, the tremelimumab is administered every 4 weeks for the first 21 weeks. In other embodiments of the previous aspects, the tremelimumab is administered every 12 weeks from weeks 25 to 49. In still other embodiments of the previous aspects, a total of 9 doses of tremelimumab is administered. 26. 26. id="p-26" id="p-26" id="p-26" id="p-26"

[0026] comprising administering 10 mg/kg of MEDI4736 or an antigen—binding fragment thereof The invention also provides a method of treating NSCLC in a human patient, and 1 mg/kg tremelimumab or an antigen—binding fragment thereof to the patient, where the MEDI4736 is administered every 2 weeks. 27. 27. id="p-27" id="p-27" id="p-27" id="p-27"

[0027] The invention also provides a method of treating NSCLC in a human patient, comprising administering 10 mg/kg of MEDI4736 or an antigen—binding fragment thereof and 3 mg/kg tremelimumab or an antigen—binding fragment thereof to the patient, where the MEDI4736 is administered every 2 weeks. 28. 28. id="p-28" id="p-28" id="p-28" id="p-28"

[0028] comprising administering 10 mg/kg of MEDI4736 or an antigen—binding fragment thereof The invention also provides a method of treating NSCLC in a human patient, and 10 mg/kg tremelimumab or an antigen—binding fragment thereof to the patient, wherein the MEDI4736 is administered every 2 weeks. l0 WO 2015/173267 PCT/EP2015/060523 29. 29. id="p-29" id="p-29" id="p-29" id="p-29"

[0029] administered every 4 weeks for the first 25 weeks. In other embodiments of the previous In particular embodiments of the previous aspects, the tremelimumab is aspects, the tremelimumab is administered every 12 weeks from weeks 25 to 49. In still other embodiments of the previous aspects, a total of 9 doses of tremelimumab is administered. . . id="p-30" id="p-30" id="p-30" id="p-30"

[0030] comprising administering MEDI4736 or an antigen—binding fragment thereof and The invention also provides a method of treating NSCLC in a human patient tremelimumab or an antigen—binding fragment thereof to the patient, wherein the administrations result in a tumor response. 31. 31. id="p-31" id="p-31" id="p-31" id="p-31"

[0031] tumor response as compared to the administration of either the MEDI4736 or an antigen- In the method of the invention, the administrations result in an increased binding fragment thereof or the tremelimumab or an antigen—binding fragment thereof alone. 32. 32. id="p-32" id="p-32" id="p-32" id="p-32"

[0032] or 10. In other embodiments, the tumor response can be detected by week 33. In other In some embodiments, the tumor response can be detected by week 2, 4, 6, 8, embodiments, the tumor response can be detected by week 50. 33. 33. id="p-33" id="p-33" id="p-33" id="p-33"

[0033] comprising administering MEDI4736 or an antigen—binding fragment thereof and The invention also provides a method of treating NSCLC in a human patient tremelimumab or an antigen—binding fragment thereof to the patient, wherein the administrations increase progression—free survival. In some embodiments, the administrations result in an increase in progression—free survival as compared to the administration of either the MEDI4736 or an antigen—binding fragment thereof or the tremelimumab or an anti gen—binding fragment thereof alone. 34. 34. id="p-34" id="p-34" id="p-34" id="p-34"

[0034] comprising administering MEDI4736 or an antigen—binding fragment thereof and The invention also provides a method of treating NSCLC in a human patient tremelimumab or an antigen—binding fragment thereof to the patient, wherein the administrations increase overall survival. In some embodiments, the administrations result in an increase in overall survival as compared to the administration of either the MEDI4736 or an antigen—binding fragment thereof or the tremelimumab or an antigen- binding fragment thereof alone. . . id="p-35" id="p-35" id="p-35" id="p-35"

[0035] result in a tumor response.

In some embodiments of the methods of the invention, the administrations In some embodiments, the administrations result in an increased tumor response as compared to the administration of either the MEDI4736 or an antigen—binding fragment thereof or the tremelimumab or an antigen—binding fragment WO 2015/173267 PCT/EP2015/060523 thereof alone. In some embodiments, the tumor response can be detected by week 8. In some embodiments, the tumor response can be detected by week 33. 36. 36. id="p-36" id="p-36" id="p-36" id="p-36"

[0036] increase progression—free survival. In some embodiments, the administrations result in an In some embodiments of the methods of the invention, the administrations increase in progression—free survival as compared to the administration of either the MEDI4736 or an antigen—binding fragment thereof or the tremelimumab or an antigen- binding fragment thereof alone. 37. 37. id="p-37" id="p-37" id="p-37" id="p-37"

[0037] increase overall survival. In some embodiments, the administrations result in an increase In some embodiments of the methods of the invention, the administrations in overall survival as compared to the administration of either the MEDI4736 or an antigen—binding fragment thereof or the tremelimumab or an antigen—binding fragment thereof alone. 38. 38. id="p-38" id="p-38" id="p-38" id="p-38"

[0038] administered every 4 weeks.

In particular embodiments of any of the previous methods, the MEDI4736 is In one particular embodiment, the MEDI4736 is administered every 4 weeks for 49 weeks. In another embodiment, a total of 13 doses of MEDI4736 is administered. 39. 39. id="p-39" id="p-39" id="p-39" id="p-39"

[0039] administered every 4 weeks for the first 21 weeks. In other embodiments of the previous In particular embodiments of the previous aspects, the tremelimumab is aspects, tremelimumab is administered every 12 weeks from weeks 25 to 49 or following the first 6 doses. In still other embodiments of the previous aspects, a total of 9 doses of tremelimumab is administered. 40. 40. id="p-40" id="p-40" id="p-40" id="p-40"

[0040] tremelimumab or an antigen—binding fragment thereof is administered about every 4 In some embodiments of the method of the invention, the administration of weeks for seven administrations and then every 12 weeks. 41. 41. id="p-41" id="p-41" id="p-41" id="p-41"

[0041] reduces soluble PD—Ll. In some embodiments, soluble PD—Ll is reduced by at least about 65%, 80%, 90%, 95% or 99%. 42. 42. id="p-42" id="p-42" id="p-42" id="p-42"

[0042] In some embodiments of the method of the invention, the administration In some embodiments of the methods of the invention, the tumor is refractory to at least one chemotherapeutic agent. Such chemotherapeutic agents may include, but are not limited to Vemurafenib, Erlotinib, Afatinib, Cetuximab, Carboplatin, Bevacizumab, Erlotinib, Gefitinib, or Pemetrexed. 43. 43. id="p-43" id="p-43" id="p-43" id="p-43"

[0043] Eastern Cooperative Oncology Group (ECOG) performance status of 0-1.

In some embodiments of the methods of the invention, the patient has an WO 2015/173267 PCT/EP2015/060523 44. 44. id="p-44" id="p-44" id="p-44" id="p-44"

[0044] In some embodiments of the methods of the invention, the patient is immunotherapy—naive prior to the administration of MEDI4736 or antigen—binding fragment thereof and tremelimumab or antigen—binding fragment thereof. 45. 45. id="p-45" id="p-45" id="p-45" id="p-45"

[0045] In some embodiments of the methods of the invention, the patient has received immunotherapy prior to the administration of MEDI4736 or antigen—binding fragment thereof and tremelimumab or antigen—bindin g fragment thereof. 46. 46. id="p-46" id="p-46" id="p-46" id="p-46"

[0046] MEDI4736 or an antigen—binding fragment thereof is by intravenous infusion. 47. 47. id="p-47" id="p-47" id="p-47" id="p-47"

[0047] In some embodiments of the methods of the invention, the administration of In some embodiments of the methods of the invention, the administration of tremelimumab or an anti gen—binding fragment thereof is by intravenous infusion. 48. 48. id="p-48" id="p-48" id="p-48" id="p-48"

[0048] reduce tumor size by at least about 10%, 25%, 50%, 75% or 100% relative to baseline. 49. 49. id="p-49" id="p-49" id="p-49" id="p-49"

[0049] has locally advanced unresectable or metastatic NSCLC. In particular embodiments of In other In particular embodiments of the methods of the invention, the administrations In particular embodiments of the methods of the invention, the human patient the methods of the invention, the NSCLC is squamous or non—squamous. embodiments of the methods of the invention, the NSCLC comprises a KRAS—mutation or an EGFR—mutation. 50. 50. id="p-50" id="p-50" id="p-50" id="p-50"

[0050] antigen—binding fragment thereof is MEDI4736 and wherein the tremelimumab or an In some embodiments of the methods of the invention, the MEDI4736 or an antigen—binding fragment thereof is tremelimumab. 51. 51. id="p-51" id="p-51" id="p-51" id="p-51"

[0051] MEDI4736 or an antigen—binding fragment of MEDI4736 in combination with In another aspect the invention provides for a method of treating cancer with tremelimumab or an antigen—binding fragment of tremelimumab. In some embodiments of the invention the cancer is selected from prostate cancer, breast cancer, triple negative breast cancer, colon cancer, lung cancer, NSCLC, head and neck cancer, melanoma, gastric cancer, pancreatic cancer, ovarian cancer, renal cell carcinoma, and hepatic cancer.

BRIEF DESCRIPTION OF THE DRAWINGS/FIGURES 52. 52. id="p-52" id="p-52" id="p-52" id="p-52"

[0052] Figure 1 shows the treatment schema. MTD=maximum tolerated dose. 53. 53. id="p-53" id="p-53" id="p-53" id="p-53"

[0053] Figure 2 shows the dose escalation and dose expansion schemas. 54. 54. id="p-54" id="p-54" id="p-54" id="p-54"

[0054] Figure 3 shows the dose escalation study design. DLT=dose limiting toxicity. l0 WO 2015/173267 PCT/EP2015/060523 55. 55. id="p-55" id="p-55" id="p-55" id="p-55"

[0055] Figure 4 provides a graph and a table showing the pharmacokinetic (PK) profile of MEDI4736. Q4W = every 4 weeks. LLOQ= Lower limit of Quantification.

AUC=area under curve. 56. 56. id="p-56" id="p-56" id="p-56" id="p-56"

[0056] Figure 5 provides a graph and a table showing the pharmacokinetic profile of tremelimumab. 57. 57. id="p-57" id="p-57" id="p-57" id="p-57"

[0057] Figure 6 is a graph showing the absolute concentration of soluble PD—Ll profiles (sPD—Ll). 58. 58. id="p-58" id="p-58" id="p-58" id="p-58"

[0058] Figure 7 is a graph showing the percent suppression of soluble PD—Ll. 59. 59. id="p-59" id="p-59" id="p-59" id="p-59"

[0059] Figure 8 is a graph showing the pharmacokinetic (PK) parameters of MEDI4736 in individual patients. 60. 60. id="p-60" id="p-60" id="p-60" id="p-60"

[0060] Figure 9 is a graph showing the pharmacokinetic (PK) parameters of tremelimumab in individual patients. 61. 61. id="p-61" id="p-61" id="p-61" id="p-61"

[0061] Figures 10A and 10B are tables showing MEDI4736 and tremelimumab dose modification due to grade 1 or grade 2 toxicity (10A) and grade 3 or grade 4 toxicity (l0B). 62. 62. id="p-62" id="p-62" id="p-62" id="p-62"

[0062] Figure 11 is a table showing Study criteria. 63. 63. id="p-63" id="p-63" id="p-63" id="p-63"

[0063] Figure 12 shows study enrollment. 64. 64. id="p-64" id="p-64" id="p-64" id="p-64"

[0064] Figure 13 shows related adverse events (AE5) for patients dosed. 65. 65. id="p-65" id="p-65" id="p-65" id="p-65"

[0065] Figure 14 shows tumor size change from baseline in first four cohorts. 66. 66. id="p-66" id="p-66" id="p-66" id="p-66"

[0066] Figure 15 shows MEDI4736 and tremelimumab doses and schedules studied. 67. 67. id="p-67" id="p-67" id="p-67" id="p-67"

[0067] Figure 16 shows suppression of sPD—Ll in individual profiles receiving MEDI4736 and tremelimumab in combination. 68. 68. id="p-68" id="p-68" id="p-68" id="p-68"

[0068] Figure 17 shows suppression of sPD—Ll in individual profiles receiving MEDI4736 and tremelimumab in combination grouped by cohort. 69. 69. id="p-69" id="p-69" id="p-69" id="p-69"

[0069] Figure 18 shows an increase in CD4 Ki67+ and CD8 Ki67 proliferating cells from baseline in subjects receiving MEDI4736 and tremelimumab compared to increases in those receiving MEDI4736 alone. Increases in CD4 Ki67+ and CD8 Ki67 proliferating cells from baseline correlated with increasing tremelimumab dose. 70. 70. id="p-70" id="p-70" id="p-70" id="p-70"

[0070] Figure 19 shows an increase in CD4 ICOS+ and CD4 HLADR+ cells from baseline in subjects receiving MEDI4736 and tremelimumab compared to increases in those receiving MEDI4736 alone. Increases in CD4 ICOS+ and CD4 HLADR+ cells from baseline correlated with increasing tremelimumab dose. 71. 71. id="p-71" id="p-71" id="p-71" id="p-71"

[0071] Figure 20 shows an increase in CD4+ T effector cells from baseline in subjects receiving MEDI4736 and tremelimumab compared to the increase in those WO 2015/173267 PCT/EP2015/060523 receiving MEDI4736 alone. The increases in CD4+ T effector cells from baseline correlated with increasing tremelimumab dose. 72. 72. id="p-72" id="p-72" id="p-72" id="p-72"

[0072] MEDI4736 and tremelimumab compared to the increase in those receiving MEDI4736 Figure 21 shows an increase in Treg cells from baseline in subjects receiving alone. The increases in Treg cells from baseline correlated with increasing tremelimumab dose. 73. 73. id="p-73" id="p-73" id="p-73" id="p-73"

[0073] combination with tremelimumab compared to MEDI4736 monotherapy. [007 4] Figure 22 is a table showing the clinical activity of MEDI4736 therapy in Figure 23 are spider plots showing change in tumor size from baseline in cohorts anchored by tremelimumab dose: 1 mg/kg (upper left panel); 10 mg/kg (upper right panel); and 3 mg/kg (lower panel). 75. 75. id="p-75" id="p-75" id="p-75" id="p-75"

[0075] events (AE) in combination cohorts anchored by tremelimumab dose: Figure 24 is a graph showing time of onset of related 2 Grade 3 adverse 1 mg/kg; 10 mg/kg; and 3 mg/kg, compared to MEDI4736 monotherapy. 76. 76. id="p-76" id="p-76" id="p-76" id="p-76"

[0076] cohorts anchored by MEDI4736 dose: 10 mg/kg Q4W (upper left panel); 15 mg/kg Q4W (upper right panel); 20 rng/kg Q4W (lower left panel); and 10 mg/kg Q2W (lower right Figure 25 are spider plots showing change in tumor size from baseline in panel). 77. 77. id="p-77" id="p-77" id="p-77" id="p-77"

[0077] events (AE) in combination cohorts anchored by MEDI4736 dose: 1 mg/kg; 10 mg/kg; Figure 26 is a graph showing time of onset of related 2 Grade 3 adverse and 3 mg/kg, compared to MEDI4736 monotherapy. 78. 78. id="p-78" id="p-78" id="p-78" id="p-78"

[0078] selected cohorts of NSCLC patients receiving MEDI4736 and tremelimumab (left panel) compared to those receiving MEDI4736 (10 mg/kg Q4W) alone (right panel). 79. 79. id="p-79" id="p-79" id="p-79" id="p-79"

[0079] events (AE) in selected combination cohorts (left and right panels), compared to MEDI4736 monotherapy (left panel). 80. 80. id="p-80" id="p-80" id="p-80" id="p-80"

[0080] study cohorts of patients with NSCLC receiving MEDI4736 and tremelimumab. 81. 81. id="p-81" id="p-81" id="p-81" id="p-81"

[0081] selected cohorts of patients with PD—L1 negative NSCLC receiving MEDI4736 and Figure 27 are spider plots showing change in tumor size from baseline in Figure 28 are graphs showing time of onset of related 2 Grade 3 adverse Figure 29 are spider plots showing change in tumor size from baseline in all Figure 30 are spider plots showing change in tumor size from baseline in tremelimumab (left panel) compared to those receiving MEDI4736 (l0 mg/kg; CPl 108) alone (right panel).

I0 WO 2015/173267 PCT/EP2015/060523 82. 82. id="p-82" id="p-82" id="p-82" id="p-82"

[0082] selected cohorts of patients with PD—Ll positive NSCLC receiving MEDI4736 and Figure 31 are spider plots showing change in tumor size from baseline in tremelimumab (left panel) compared to those receiving MEDI4736 (I0 mg/kg; CPI I08) alone (right panel). 83. 83. id="p-83" id="p-83" id="p-83" id="p-83"

[0083] 1 mg/kg (left panel), 3 mg/kg (center panel), and 10 mg/kg (right panel) showing change in tumor size Figure 32 are spider plots anchored by tremelimumab dose: from baseline in selected cohorts of patients with PD—Ll negative NSCLC receiving MEDI4736 and tremelimumab. 84. 84. id="p-84" id="p-84" id="p-84" id="p-84"

[0084] Figure 33 are spider plots anchored by MEDI4736 dose: (upper left panel), 15 mg/kg (upper right panel), and 20 mg/kg (lower left panel) showing mg/kg Q4W change in tumor size from baseline in selected cohorts of patients with PD—Ll negative NSCLC receiving MEDI4736 and tremelimumab. 85. 85. id="p-85" id="p-85" id="p-85" id="p-85"

[0085] in NSCLC patients receiving MEDI4736 and tremelimumab in Figure 29, grouped according to NSCLC PD—Ll status: all NSCLC patients (34A); patients identified as having PD—Ll" NSCLC (34B); patients identified as having PD—LI+ NSCLC (34C); and patients with NSCLC PD—Ll status not available (34D).

Figures 34A-34D are spider plots showing change in tumor size from baseline 86. 86. id="p-86" id="p-86" id="p-86" id="p-86"

[0086] Figure 35 is a waterfall plot showing best change in tumor size from baseline in NSCLC patients receiving MEDI4736 and tremelimumab. 87. 87. id="p-87" id="p-87" id="p-87" id="p-87"

[0087] Figure 36 is a waterfall plot showing best change in tumor size from baseline in NSCLC patients receiving MEDI4736 and tremelimumab in Figure 35, identified according to PD—Ll status of the NSCLC. 88. 88. id="p-88" id="p-88" id="p-88" id="p-88"

[0088] patients receiving MEDI4736 and tremelimumab.

Figure 37 is a swimlane plot showing duration of follow—up in NSCLC DETAILED DESCRIPTION 89. 89. id="p-89" id="p-89" id="p-89" id="p-89"

[0089] entity; for example, "an antibody" is understood to represent one or more antibodies. As It is to be noted that the term "a" or "an" entity refers to one or more of that such, the terms "a" (or "an"), "one or more," and "at least one" can be used interchangeably herein. 90. 90. id="p-90" id="p-90" id="p-90" id="p-90"

[0090] using MEDI4736 and tremelimumab.

Provided herein are methods for treating non—small cell lung cancer (NSCLC) There are three main subtypes of NSCLC: squamous cell carcinoma, adenocarcinoma, and large cell (undifferentiated) carcinoma.

WO 2015/173267 PCT/EP2015/060523 Other subtypes include adenosquamous carcinoma and sarcomatoid carcinoma. NSCLC may comprise a mutation in KRAS or in the Epidermal Growth Factor receptor. Such mutations are known in the art and described, for example, by Riely et al., Proc Am Thorac Soc. 2009 Apr l5;6(2):20l—5, which is incorporated herein by reference. 91. 91. id="p-91" id="p-91" id="p-91" id="p-91"

[0091] growths using MEDI4736 and tremelimumamb. As used herein "cancer" refers to a In addition, provided herein are methods for treating cancer or neoplastic disease caused by an uncontrolled division of abnormal cells. Examples of cancer include prostate cancer, breast cancer, triple negative breast cancer, colon cancer, lung cancer, NSCLC, head and neck cancer, melanoma, gastric cancer, pancreatic cancer, ovarian cancer, renal cell carcinoma, and hepatic cancer. 92. 92. id="p-92" id="p-92" id="p-92" id="p-92"

[0092] MEDI4736 or an antigen—binding fragment thereof and tremelimumab or an antigen- The methods provided include administering an effective amount of binding fragment thereof. 93. 93. id="p-93" id="p-93" id="p-93" id="p-93"

[0093] that selectively binds a PD—Ll polypeptide and comprises at least a portion of a light By "MEDI4736" is meant an antibody or antigen binding fragment thereof chain variable region comprising the amino acid sequence of SEQ ID NO:l and/or at least a portion of a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:2. 94. 94. id="p-94" id="p-94" id="p-94" id="p-94"

[0094] use in the methods provided herein can be found in US Patent No. 8,779,108, the Information regarding MEDI4736 (or antigen—binding fragments thereof) for disclosure of which is incorporated herein by reference in its entirety. The fragment crystallizable (Fc) domain of MEDI4736 contains a triple mutation in the constant domain of the IgGl heavy chain that reduces binding to the complement component Clq and the Fcy receptors responsible for mediating antibody—dependent cell—mediated cytotoxicity (ADCC). MEDI4736 is selective for PD—Ll and blocks the binding of PD- L1 to the PD—1 and CD80 receptors. MEDI4736 can relieve PD—Ll—mediated suppression of human T—cell activation in vitro and inhibits tumor growth in a xenograft model via a T—cell dependent mechanism. 95. 95. id="p-95" id="p-95" id="p-95" id="p-95"

[0095] and a light chain or a heavy chain variable region and a light chain variable region. In a MEDI4736 for use in the methods provided herein comprises a heavy chain specific aspect, MEDI4736 or an antigen—binding fragment thereof for use in the methods provided herein comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO:1 and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:2. In a specific aspect, MEDI4736 or an antigen—binding ll WO 2015/173267 PCT/EP2015/060523 fragment thereof for use in the methods provided herein comprises a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises the Kabat—defined CDR1, CDR2, and CDR3 sequences of SEQ ID NOs:3—5, and wherein the light chain variable region comprises the Kabat—defined CDR1, CDR2, and CDR3 sequences of SEQ ID NOs:6—8. Those of ordinary skill in the art would easily be able to identify Chothia—defined, Abm—defined or other CDR definitions known to those of ordinary skill in the art. In a specific aspect, MEDI4736 or an antigen—binding fragment thereof for use in the methods provided herein comprises the variable heavy chain and variable light chain CDR sequences of the 2.14H9OPT antibody as disclosed in US Patent No. 8,779,108, which is herein incorporated by reference in its entirety. 96. 96. id="p-96" id="p-96" id="p-96" id="p-96"

[0096] By "Tremelimumab" is meant an antibody or antigen binding fragment thereof that selectively binds a CTLA4 polypeptide and comprises at least a portion of a light chain variable region comprising the amino acid sequence of SEQ ID NO:9 and/or at least a portion of a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:l0. Exemplary anti— CTLA4 antibodies are described for example at US Patent Nos. 6,682,736; 7,109,003; 7,123,281; 7,411,057; 7,824,679; 8,143,379; 7,807,797; and 8,491,895 (Tremelimumab is 11.2.1, therein), which are herein incorporated by reference.

Tremelimumab is an exemplary anti—CTLA4 antibody. Tremelimumab sequences are provided in the sequence listing below. 97. 97. id="p-97" id="p-97" id="p-97" id="p-97"

[0097] Information regarding tremelimumab (or antigen—binding fragments thereof) for use in the methods provided herein can be found in US 6,682,736 (where it is referred to as 11.2.1, the disclosure of which is incorporated herein by reference in its entirety.

Tremelimumab (also known as CP—675,206, CP—675, CP—675206, and ticilimumab) is a human IgG2 monoclonal antibody that is highly selective for CTLA4 and blocks binding of CTLA4 to CD80 (B7.1) and CD86 (B7.2). It has been shown to result in immune activation in vitro and some patients treated with tremelimumab have shown tumor regression. 98. 98. id="p-98" id="p-98" id="p-98" id="p-98"

[0098] Tremelimumab and antigen—binding fragments thereof for use in the methods provided herein comprises a heavy chain and a light chain or a heavy chain variable region and a light chain variable region. In a specific aspect, tremelimumab or an antigen—binding fragment thereof for use in the methods provided herein comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO:9 and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:l0. In a specific aspect, tremelimumab or an antigen—binding fragment thereof for use in the 12 100. 100. id="p-100" id="p-100" id="p-100" id="p-100"

[00100] 101. 101. id="p-101" id="p-101" id="p-101" id="p-101"

[00101] 102. 102. id="p-102" id="p-102" id="p-102" id="p-102"

[00102] WO 2015/173267 PCT/EP2015/060523 methods provided herein comprises a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises the Kabat—defined CDR1, CDR2, and CDR3 sequences of SEQ ID NOs:11—13, and wherein the light chain variable region comprises the Kabat—defined CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 14-16. Those of ordinary skill in the art would easily be able to identify Chothia— defined, Abm—defined or other CDR definitions known to those of ordinary skill in the art. In a specific aspect, tremelimumab or an antigen—binding fragment thereof for use in the methods provided herein comprises or the variable heavy chain and variable light chain CDR sequences of the 11.2.1 antibody as disclosed in US 6,682,736, which is herein incorporated by reference in its entirety. 99. 99. id="p-99" id="p-99" id="p-99" id="p-99"

[0099] The term "antigen binding fragment" refers to a portion of an intact antibody and/or refers to the antigenic determining variable regions of an intact antibody. It is known that the antigen binding function of an antibody can be perfonned by fragments of a ful1—length antibody. Examples of antibody fragments include, but are not limited to, Fab, Fab’, F(ab')2, and Fv fragments, linear antibodies, single chain antibodies, diabodies, and multispecific antibodies formed from antibody fragments.

In certain aspects, a patient presenting with a NSCLC is administered MEDI4736 or an antigen—binding fragment thereof and tremelimumab or an antigen- binding fragment thereof. MEDI4736 or an antigen—binding fragment thereof and tremelimumab or an antigen—binding fragment thereof can be administered only once or infrequently while still providing benefit to the patient. In further aspects the patient is administered additional follow—on doses. Follow—on doses can be administered at various time intervals depending on the patient's age, weight, clinical assessment, tumor burden, and/or other factors, including the judgment of the attending physician.

The intervals between doses of MEDI4736 or an antigen—binding fragment thereof can be every four weeks. The intervals between doses of tremelimumab or an antigen—binding fragment thereof can be every four weeks. The intervals between doses of tremelimumab or an antigen—bindin g fragment thereof can be every twelve weeks. The intervals between doses of tremelimumab or an antigen—binding fragment thereof can be every four weeks for six cycles and then every twelve weeks.

In certain aspects, MEDI4736 or an antigen—binding fragment thereof is administered about as frequently as tremelimumab or an antigen—binding fragment thereof. In certain aspects, MEDI4736 or an antigen—binding fragment thereof is 13 103. 103. id="p-103" id="p-103" id="p-103" id="p-103"

[00103] 104. 104. id="p-104" id="p-104" id="p-104" id="p-104"

[00104] 105. 105. id="p-105" id="p-105" id="p-105" id="p-105"

[00105] 106. 106. id="p-106" id="p-106" id="p-106" id="p-106"

[00106] WO 2015/173267 PCT/EP2015/060523 administered about three times as frequently as tremelimumab or an antigen—binding fragment thereof.

In some embodiments, at least two doses of MEDI4736 or an antigen—binding fragment thereof and tremelimumab or an antigen—binding fragment thereof are administered to the patient. In some embodiments, at least three doses, at least four doses, at least five doses, at least six doses, at least seven doses, at least eight doses, at least nine doses, at least ten doses, or at least fifteen doses or more can be administered to the patient. In some embodiments, MEDI4736 or an antigen—binding fragment thereof is administered over a four—week treatment period, over an eight—week treatment period, over a siXteen—week treatment period, over a twenty—week treatment period, over a twenty—four—week treatment period, or over a one—year or more treatment period. In some embodiments, tremelimumab or an antigen—binding fragment thereof is administered over a four—week treatment period, over an eight—week treatment period, over a twelve—week treatment period, over a sixteen—week treatment period, over a twenty—week treatment period, over a twenty—four—week treatment period, over a thirty—siX—week treatment period, over a forty—eight—weel< treatment period, or over a one—year or more treatment period.

In some embodiments, MEDI4736 or an antigen—binding fragment thereof and tremelimumab or an antigen—binding fragment thereof are administered on the same day.

In some embodiments, MEDI4736 or an antigen—binding fragment thereof is administered at the same time as tremelimumab or an antigen—binding fragment thereof. In other embodiments, MEDI4736 or an antigen—binding fragment thereof is administered about 1 hour following administration of tremelimumab or an antigen—bindin g fragment thereof.

The amount of MEDI4736 or an antigen—binding fragment thereof and the amount of tremelimumab or an antigen—binding fragment thereof to be administered to the patient will depend on Various parameters such as the patient's age, weight, clinical assessment, tumor burden and/or other factors, including the judgment of the attending physician.

In certain aspects the patient is administered one or more doses of MEDI4736 or an antigen—binding fragment thereof wherein the dose is about 1 mg/kg. In certain aspects the patient is administered one or more doses of MEDI4736 or an antigen—binding fragment thereof wherein the dose is about 3 mg/kg. In certain aspects the patient is administered one or more doses of MEDI4736 or an antigen—binding fragment thereof wherein the dose is about 10 mg/kg. In certain aspects the patient is administered one or 14 107. 107. id="p-107" id="p-107" id="p-107" id="p-107"

[00107] 108. 108. id="p-108" id="p-108" id="p-108" id="p-108"

[00108] 109. 109. id="p-109" id="p-109" id="p-109" id="p-109"

[00109] 110. 110. id="p-110" id="p-110" id="p-110" id="p-110"

[00110] WO 2015/173267 PCT/EP2015/060523 more doses of MEDI4736 or an antigen—binding fragment thereof wherein the dose is about 15 mg/kg. In certain aspects the patient is administered one or more doses of MEDI4736 or an antigen—binding fragment thereof wherein the dose is about 20 mg/kg.

In certain aspects the patient is administered at least two doses of MEDI4736 or an antigen—binding fragment thereof wherein the dose is about 1 mg/kg. In certain aspects the patient is administered at least two doses of MEDI4736 or an antigen—binding fragment thereof wherein the dose is about 3 mg/kg. In certain aspects the patient is administered at least two doses of MEDI4736 or an antigen—binding fragment thereof wherein the dose is about 10 mg/kg. In certain aspects the patient is administered at least two doses of MEDI4736 or an antigen—binding fragment thereof wherein the dose is about mg/kg. In certain aspects the patient is administered at least two doses of MEDI4736 or an antigen—binding fragment thereof wherein the dose is about 20 mg/kg. In some embodiments, the at least two doses are administered about four weeks apart.

In certain aspects the patient is administered at least three doses of MEDI4736 or an antigen—binding fragment thereof wherein the dose is about 1 mg/kg. In certain aspects the patient is administered at least three doses of MEDI4736 or an antigen- binding fragment thereof wherein the dose is about 3 mg/kg. In certain aspects the patient is administered at least three doses of MEDI4736 or an antigen—binding fragment thereof wherein the dose is about 10 mg/kg. In certain aspects the patient is administered at least three doses of MEDI4736 or an antigen—binding fragment thereof wherein the dose is about 15 mg/kg. In certain aspects the patient is administered at least three doses of MEDI4736 or an antigen—binding fragment thereof wherein the dose is about 20 mg/kg.

In some embodiments, the at least three doses are administered about four weeks apart.

In certain aspects the patient is administered one or more doses of tremelimumab or an antigen—binding fragment thereof wherein the dose is about 1 mg/kg.

In certain aspects the patient is administered one or more doses of tremelimumab or an antigen—binding fragment thereof wherein the dose is about 3 mg/kg. In certain aspects the patient is administered one or more doses of tremelimumab or an antigen—binding fragment thereof wherein the dose is about 10 mg/kg.

In certain aspects the patient is administered at least two doses of tremelimumab or an antigen—binding fragment thereof wherein the dose is about 1 mg/kg.

In certain aspects the patient is administered at least two doses of tremelimumab or an antigen—binding fragment thereof wherein the dose is about 3 mg/kg. In certain aspects the patient is administered at least two doses of tremelimumab or an antigen—binding l5 111. 111. id="p-111" id="p-111" id="p-111" id="p-111"

[00111] 112. 112. id="p-112" id="p-112" id="p-112" id="p-112"

[00112] 113. 113. id="p-113" id="p-113" id="p-113" id="p-113"

[00113] 114. 114. id="p-114" id="p-114" id="p-114" id="p-114"

[00114] 115. 115. id="p-115" id="p-115" id="p-115" id="p-115"

[00115] WO 2015/173267 PCT/EP2015/060523 fragment thereof wherein the dose is about 10 mg/kg. In some embodiments, the at least two doses are administered about four weeks apart. In some embodiments, the at least two doses are administered about twelve weeks apart.

In certain aspects the patient is administered at least three doses of tremelimumab or an antigen—binding fragment thereof wherein the dose is about 1 mg/kg.

In certain aspects the patient is administered at least three doses of tremelimumab or an antigen—binding fragment thereof wherein the dose is about 3 mg/kg. In certain aspects the patient is administered at least three doses of tremelimumab or an antigen—binding fragment thereof wherein the dose is about 10 mg/kg. In some embodiments, the at least three doses are administered about four weeks apart. In some embodiments, the at least three doses are administered about twelve weeks apart.

In certain aspects, administration of MEDI4736 or an antigen—binding fragment thereof and/or tremelimumab or an antigen—binding fragment according to the methods provided herein is through parenteral administration. For example, MEDI4736 or an antigen—binding fragment thereof and/or tremelimumab or an antigen—binding fragment can be administered by intravenous infusion or by subcutaneous injection. In some embodiments, the administration is by intravenous infusion.

In certain aspects, 1 mg/kg of MEDI4736 or an antigen—binding fragment thereof and 1 mg/kg of tremelimumab or an antigen—binding fragment thereof are administered to a patient. In certain aspects, 1 mg/kg of MEDI4736 or an antigen—binding fragment thereof and 3 mg/kg of tremelimumab or an antigen—binding fragment thereof are administered to a patient. In certain aspects, 1 mg/kg of MEDI4736 or an antigen- binding fragment thereof and 10 mg/kg of tremelimumab or an antigen—binding fragment thereof are administered to a patient.

In certain aspects, 3 mg/kg of MEDI4736 or an antigen—binding fragment thereof and 1 mg/kg of tremelimumab or an antigen—binding fragment thereof are administered to a patient. In certain aspects, 3 mg/kg of MEDI4736 or an antigen—binding fragment thereof and 3 mg/kg of tremelimumab or an antigen—binding fragment thereof are administered to a patient. In certain aspects, 3 mg/kg of MEDI4736 or an antigen- binding fragment thereof and 10 mg/kg of tremelimumab or an antigen—binding fragment thereof are administered to a patient.

In certain aspects, 10 mg/kg of MEDI4736 or an antigen—binding fragment thereof and 1 mg/kg of tremelimumab or an antigen—binding fragment thereof are administered to a patient. In certain aspects, 10 mg/kg of MEDI4736 or an antigen- 16 116. 116. id="p-116" id="p-116" id="p-116" id="p-116"

[00116] 117. 117. id="p-117" id="p-117" id="p-117" id="p-117"

[00117] 118. 118. id="p-118" id="p-118" id="p-118" id="p-118"

[00118] 119. 119. id="p-119" id="p-119" id="p-119" id="p-119"

[00119] 120. 120. id="p-120" id="p-120" id="p-120" id="p-120"

[00120] WO 2015/173267 PCT/EP2015/060523 binding fragment thereof and 3 mg/kg of tremelimumab or an antigen—binding fragment thereof are administered to a patient. In certain aspects, 10 mg/kg of MEDI4736 or an antigen—binding fragment thereof and 10 mg/kg of tremelimumab or an antigen—binding fragment thereof are administered to a patient.

In certain aspects, 15 mg/kg of MEDI4736 or an antigen—binding fragment thereof and 1 mg/kg of tremelimumab or an antigen—binding fragment thereof are administered to a patient. In certain aspects, 15 mg/kg of MEDI4736 or an antigen- binding fragment thereof and 3 mg/kg of tremelimumab or an antigen—binding fragment thereof are administered to a patient. In certain aspects, 15 mg/kg of MEDI4736 or an antigen—binding fragment thereof and 10 mg/kg of tremelimumab or an antigen—binding fragment thereof are administered to a patient.

In certain aspects, 20 mg/kg of MEDI4736 or an antigen—binding fragment thereof and 1 mg/kg of tremelimumab or an antigen—binding fragment thereof are administered to a patient. In certain aspects, 20 mg/kg of MEDI4736 or an antigen- binding fragment thereof and 3 mg/kg of tremelimumab or an antigen—binding fragment thereof are administered to a patient. In certain aspects, 20 mg/kg of MEDI4736 or an antigen—binding fragment thereof and 10 mg/kg of tremelimumab or an antigen—binding fragment thereof are administered to a patient.

The methods provided herein can decrease, retard or stabilize tumor growth.

In some aspects the reduction or retardation can be statistically significant. A reduction in tumor growth can be measured by comparison to the growth of patient's tumor at baseline, against an expected tumor growth, against an expected tumor growth based on a large patient population, or against the tumor growth of a control population. In certain aspects, a tumor response is measured using the Response Evaluation Criteria in Solid Tumors (RECIST).

In certain aspects, a tumor response is detectable at week 8. In certain aspects, a tumor response is detectable at week 33. In certain aspects, a tumor response is detectable at week 50.

In certain aspects, a tumor response is detectable after administration of administration of two doses of MEDI4736 or an antigen—binding fragment thereof and two doses of tremelimumab or an antigen—binding fragment thereof. In certain aspects, a tumor response is detectable after administration of administration of eight doses of MEDI4736 or an antigen—binding fragment thereof and seven doses of tremelimumab or an antigen—binding fragment thereof. In certain aspects, a tumor response is detectable l7 WO 2015/173267 PCT/EP2015/060523 after administration of administration of thirteen doses of MEDI4736 or an antigen- binding fragment thereof and nine doses of tremelimumab or an antigen—binding fragment thereof. 121. 121. id="p-121" id="p-121" id="p-121" id="p-121"

[00121] In certain aspects, a patient achieves disease control (DC). Disease control can be a complete response (CR), partial response (PR), or stable disease (SD). 122. 122. id="p-122" id="p-122" id="p-122" id="p-122"

[00122] (SD) can be determined as deﬁned in Table 1 below. 123. 123. id="p-123" id="p-123" id="p-123" id="p-123"

[00123] A "complete response" (CR), a "partial response" (PR), and "stable disease" In certain aspects, administration of MEDI4736 or an antigen—binding fragment thereof can increase pro gression—free survival (PFS). 124. 124. id="p-124" id="p-124" id="p-124" id="p-124"

[00124] In certain aspects, administration of MEDI4736 or an antigen—binding fragment thereof can increase overall survival (OS). 125. 125. id="p-125" id="p-125" id="p-125" id="p-125"

[00125] In some embodiments, the patient has previously received treatment with at least one chemotherapeutic agent. In some embodiments, the patient has previously received treatment with at least two chemotherapeutic agents. The chemotherapeutic agent can be, for example, and without limitation, Vemurafenib, Erlotinib, Afatinib, Cetuximab, Carboplatin, Bevacizumab, Erlotinib, Gefitinib, and/or Pemetrexed. 126. 126. id="p-126" id="p-126" id="p-126" id="p-126"

[00126] In some embodiments, the NSCLC is refractory or resistant to at least one chemotherapeutic agent. In some embodiments, the tumor is refractory or resistant to at least two chemotherapeutic agents. The tumor can be refractory or resistant to one or more of, for example, and without limitation, Vemurafenib, Erlotinib, Afatinib, Cetuximab, Carboplatin, Bevacizumab, Erlotinib, Gefitinib, and/or Pemetrexed. In some embodiments, the NSCLC is negative for PD—Ll. In some embodiments, the NSCLC is positive for PD—Ll. 127. 127. id="p-127" id="p-127" id="p-127" id="p-127"

[00127] Group (ECOG) (Oken MM, et al. Am. J. Clin. Oncol. 5: 649-55 (1982)) performance In some embodiments, the patient has an Eastern Cooperative Oncology status of 0 or 1 prior to the administration of MEDI4736 or an antigen—binding fragment thereof and tremelimumab or an anti gen—binding fragment thereof. 128. 128. id="p-128" id="p-128" id="p-128" id="p-128"

[00128] According to the methods provided herein, administration of MEDI4736 or an antigen—binding fragment thereof and tremelimumab or an antigen—binding fragment thereof can result in desirable pharmacokinetic parameters as shown in some early data.

"AUC (tau)" refers to AUC from time 0 to time ‘E, the dosing interval, whereas "AUC (inf)" Total drug exposure can be estimated using the "area under the curve" (AUC). refers to the AUC until infinite time. The administration can produce AUC (tau) of about 600 to about 3,000 ug/mL*day of MEDI4736 or antigen—binding fragment thereof and 18 129. 129. id="p-129" id="p-129" id="p-129" id="p-129"

[00129] 130. 130. id="p-130" id="p-130" id="p-130" id="p-130"

[00130] 131. 131. id="p-131" id="p-131" id="p-131" id="p-131"

[00131] WO 2015/173267 PCT/EP2015/060523 about 250 to about 350 ug/mL*day of tremelimumab or antigen—binding fragment thereof. The administration can produce a maximum observed concentration (Cmax) of about 60 to about 300 ug/mL MEDI4736 or antigen—binding fragment thereof and of about 25 to about 35 ug/mL tremelimumab or antigen—binding fragment thereof. The administration can produce a C trough (minimum plasma drug concentration) of about 5 to about 40 ug/mL MEDI4736 or antigen—binding fragment thereof and about 4 to about 6 ug/mL tremelimumab or antigen—binding fragment thereof.

As provided herein, MEDI4736 or an antigen—binding fragment thereof can also decrease free (soluble) PD—Ll levels. Free (soluble) PD—Ll refers to PD—Ll that is not bound (e.g., by MEDI4736). In some embodiments, PD—Ll levels are reduced by at least 65%. In some embodiments, PD—Ll levels are reduced by at least 80%. In some embodiments, PD—Ll levels are reduced by at least 90%. In some embodiments, PD—Ll levels are reduced by at least 95%. In some embodiments, PD—Ll levels are reduced by at least 99%. In some embodiments, PD—Ll levels are not detectable following administration of MEDI4736 or an antigen—binding fragment thereof and tremelimumab or an anti gen—binding fragment thereof.

In some embodiments, PD—Ll levels are reduced by at least 65% after a single administration of MEDI4736 or an antigen—binding fragment thereof. In some embodiments, PD—Ll levels are reduced by at least 80% after a single administration of MEDI4736 or an antigen—binding fragment thereof. In some embodiments, PD—Ll levels are reduced by at least 90% after a single administration of MEDI4736 or an antigen- binding fragment thereof. In some embodiments, PD—Ll levels are reduced by at least 95% after a single administration of MEDI4736 or an antigen—binding fragment thereof.

In some embodiments, PD—Ll levels are reduced by at least 99% after a single administration of MEDI4736 or an antigen—binding fragment thereof. In some embodiments, PD—Ll levels are not detectable following a single administration of MEDI4736 or an antigen—binding fragment thereof.

In some embodiments, PD—Ll levels are reduced by at least 65% after administration of two doses of MEDI4736 or an antigen—binding fragment thereof. In some embodiments, PD—Ll levels are reduced by at least 80% after administration of two doses of MEDI4736 or an antigen—binding fragment thereof. In some embodiments, PD- Ll levels are reduced by at least 90% after administration of two doses of MEDI4736 or an antigen—binding fragment thereof. In some embodiments, PD—Ll levels are reduced by at least 95% after administration of two doses of MEDI4736 or an antigen—binding l9 132. 132. id="p-132" id="p-132" id="p-132" id="p-132"

[00132] 133. 133. id="p-133" id="p-133" id="p-133" id="p-133"

[00133] 134. 134. id="p-134" id="p-134" id="p-134" id="p-134"

[00134] 135. 135. id="p-135" id="p-135" id="p-135" id="p-135"

[00135] WO 2015/173267 PCT/EP2015/060523 fragment thereof. In some embodiments, PD—Ll levels are reduced by at least 99% after administration of two doses of MEDI4736 or an antigen—binding fragment thereof. In some embodiments, PD—Ll levels are not detectable following administration of two doses of MEDI4736 or an antigen—binding fragment thereof.

Treatment of a patient with a solid tumor using both MEDI4736 or an antigen- binding fragment thereof and tremelimumab or an antigen—binding fragment thereof (i.e., co—therapy) as provided herein can result in an synergistic effect. As used herein, the term "synergistic" refers to a combination of therapies (e. g., a combination of MEDI4736 or an antigen—binding fragment thereof and tremelimumab or an antigen—binding fragment thereof) which is more effective than the additive effects of the single therapies.

A synergistic effect of a combination of therapies (e.g., a combination of a MEDI4736 or an antigen—binding fragment thereof and tremelimumab or an antigen- binding fragment thereof) permits the use of lower dosages of one or more of the therapeutic agents and/or less frequent administration of said therapeutic agents to a patient with a solid tumor. The ability to utilize lower dosages of therapeutic agents and/or to administer said therapies less frequently reduces the toxicity associated with the administration of said therapies to a subject without reducing the efficacy of said therapies in the treatment of a solid tumor. In addition, a synergistic effect can result in improved efficacy of therapeutic agents in the management, treatment, or amelioration of an solid tumor. The synergistic effect of a combination of therapeutic agents can avoid or reduce adverse or unwanted side effects associated with the use of either single therapy.

In co—therapy, MEDI4736 or an antigen—binding fragment thereof can be optionally included in the same pharmaceutical composition as the tremelimumab or an antigen—binding fragment thereof, or may be included in a separate pharmaceutical composition. In this latter case, the pharmaceutical composition comprising MEDI4736 or an antigen—binding fragment thereof is suitable for administration prior to, simultaneously with, or following administration of the pharmaceutical composition comprising tremelimumab or an antigen—binding fragment thereof. In certain instances, the MEDI4736 or an antigen—binding fragment thereof is administered at overlapping times as tremelimumab or an anti gen—binding fragment thereof in a separate composition.

Subjects suffering from lung cancer (e. g., non—small cell lung cancer) may be tested for PD—Ll polynucleotide or polypeptide expression in the course of selecting a treatment method. Patients identified as having tumors that are negative for PD—Ll (e. g., as defined by Ct or IHC—M score) or by having reduced or undetectable levels of PD—Ll WO 2015/173267 PCT/EP2015/060523 relative to a reference level are identified as responsive to treatment with a combination of an anti—PD—Ll antibody and tremelimumab. Such patients are administered an MEDI4736, or an antigen—binding fragment thereof in combination with tremelimumab or an antigen—binding fragment thereof.

EXAMPLES EXAMPLE 1: Patients and Methods (a) SUBJECTS 136. 136. id="p-136" id="p-136" id="p-136" id="p-136"

[00136] histologically— or cytologically—confirmed non—small cell lung cancer (NSCLC; squamous Subjects in this study are required to be 18 years of age or older and have and non—squamous), with at least one measurable lesion according to Response Evaluation Criteria in Solid Tumors (RECIST) guidelines V1.1, which is herein incorporated by reference in its entirety. 137. 137. id="p-137" id="p-137" id="p-137" id="p-137"

[00137] For both the dose—escalation and dose—expansion phases, cohort—specific prior immunotherapy requirements are as follows: a) immunotherapy—naive cohort: must have no prior exposure to immunotherapy, such as, but not limited to, other anti—CTLA—4, anti- PD—l, or anti—PD—Ll antibodies excluding vaccines; and b) immunotherapy—pretreated cohort: must have had prior exposure to immunotherapy, such as, but not limited to, other anti—CTLA—4, anti—PD—1, or anti—PD—Ll antibodies excluding vaccines greater than 28 days prior to the first dose of MEDI4736 and tremelimumab. 138. 138. id="p-138" id="p-138" id="p-138" id="p-138"

[00138] relapsed following standard treatment, declined standard treatment, or have not been The subjects are also required to have failed to respond to standard treatment, eligible for standard treatment. Subjects will have an Eastern Cooperative Oncology Group (ECOG) performance status of 0-1. 139. 139. id="p-139" id="p-139" id="p-139" id="p-139"

[00139] at day 1 of the study. In addition, by day 1, there must be at least 28 weeks without Subjects with central nervous system (CNS) metastases must be asymptomatic progression of CNS metastases as evidenced by magnetic resonance imaging (MRI)/computed tomography (CT) after last day of treatment with radiation and at least 14 days since last dose of corticosteroids. 140. 140. id="p-140" id="p-140" id="p-140" id="p-140"

[00140] marrow function. Adequate organ and marrow function are defined as: hemoglobin 2 9 The subjects are also required to have adequate organ (hepatic and renal) and g/dL; absolute neutrophil count > 1,500/mm3; platelet count > 100,000/mm3; total bilirubin g 1.5 x upper limit of normal (ULN), unless associated with Gilbert's syndrome 21 141. 141. id="p-141" id="p-141" id="p-141" id="p-141"

[00141] 142. 142. id="p-142" id="p-142" id="p-142" id="p-142"

[00142] WO 2015/173267 PCT/EP2015/060523 or liver metastasis (for these subjects, baseline total bilirubin must be S 3.0 mg/dL); alanine aminotransferase (ALT) and aspartate arninotransferase (AST) must be S 2.5 x ULN unless associated with hepatic metastases (for these subjects, ALT and AST must be S 5 X ULN); and serum creatinine S 2.0 mg/dL.

Subjects are not able to participate if they are on any concurrent chemotherapy, immunotherapy, biologic, or hormonal therapy for cancer treatment.

Subjects are not able to participate if they have taken any investigational anticancer therapy within 28 days prior to the first dose of MEDI4736 and tremelimumab. Subjects are not able to participate if they have any prior Grade 2 3 immune—related adverse event (irAE) while receiving immunotherapy, including anti—CTLA—4 treatment, or any unresolved irAE > Grade 1. Subjects are also not able to participate if they have undergone a major surgical procedure (as defined by the investigator) within 28 days prior to the first dose of MEDI4736 and tremelimumab or if they are still recovering from prior surgery. Subjects are also not able to participate if they have unresolved toxicities from prior anticancer therapy, defined as having not resolved to National Cancer Institute Common Terminology Criteria for Adverse Events (NCI CTCAE) V4.03 Grade 0 or 1 with the exception of alopecia and laboratory values listed per the inclusion criteria.

Subjects with irreversible toxicity that is not reasonably expected to be exacerbated by MEDI4736 and tremelimumab may be included. Subjects are also excluded if they are currently using, or have used immunosuppressive medication within 14 days before the first dose of MEDI4736 and tremelimumab with the exceptions of intranasal and inhaled corticosteroids or systemic corticosteroids at physiologic doses not to exceed 10 mg/day of prednisone or equivalent.

Subjects are not able to participate if they have active or prior autoimmune disease, including inﬂammatory bowel disease, diverticulitis, irritable bowel disease, celiac disease, Wegener syndrome, and Hashimoto syndrome, within the past 3 years, except for vitiligo, alopecia, Graves disease, or psoriasis not requiring systemic treatment (within the past 3 years). Subjects are also not able to participate if they have a history of primary immunodeficiency or tuberculosis, if they have known active or chronic viral hepatitis A, B, or C; if they have human immunodeficiency virus (HIV); other active serious illnesses or uncontrolled inter—current illnesses; have received live, attenuated vaccine within 28 days prior to the first dose of MEDI4736 and tremelimumab; have other invasive malignancy within 5 years; or known allergy or hypersensitivity to study drug formulations. 22 143. 143. id="p-143" id="p-143" id="p-143" id="p-143"

[00143] 144. 144. id="p-144" id="p-144" id="p-144" id="p-144"

[00144] 145. 145. id="p-145" id="p-145" id="p-145" id="p-145"

[00145] WO 2015/173267 PCT/EP2015/060523 Subjects are also not able to participate if they have advanced NSCLC with tumors harboring anaplastic lymphoma receptor tyrosine kinase (ALK) gene rearrangements or epidermal growth factor receptor (EGFR)—sensitizing mutations and have not received appropriate tyrosine kinase inhibitor (TKI) therapy. These subjects can be enrolled after documented progression or intolerance to appropriate TKIs. (b) DESIGN OF THE STUDY The study is an open—label Phase lb study of the combination of MEDI4736 and tremelimumab (Figure 1). Key study criteria for cohorts is shown at Figure ll. The study will enroll approximately 36 subjects in the dose escalation phase and in the dose- expansion phase and a minimum of 20 subjects each in immunotherapy—na'1‘ve and immunotherapy—pretreated cohorts. The maximum tolerated dose (MTD) or highest protocol—defined dose for each agent in the absence of exceeding the MTD detennined for the immunotherapy—naive cohort during the dose—escalation phase will serve as the starting dose for the subjects enrolled in the immunotherapy—pretreated cohort as part of the dose—escalation phase. Does exploration for the immunotherapy—pretreated cohort will be conducted in parallel with the dose—expansion phase for the immunotherapy—naive cohort.

DOSE—ESCALATION PHASE Immunotherapv—na1've Cohort In the dose—escalation phase of the study, MEDI4736 and tremelimumab will be administered initially in sequential cohorts of 3-6 subjects who are immunotherapy- naive with each subject receiving tremelimumab Q4W for 6 doses and every 12 weeks (Ql2W) for 3 doses (i.e., tremelimumab Dose 7 given at 4 weeks from Dose 6 and Dose 8 given at 12 weeks from Dose 7) and MEDI4736 Q4W for 13 doses via IV infusion for a total of one year (Figure 2). Each cohort will enroll a minimum of 3 subjects, according to a standard 3+3 design and a modified zone—based design. Subjects in the first cohort (Cohort 1) will receive a dose of 3 mg/kg MED4736 and 1 mg/kg of tremelimumab. If 2 2 dose limiting toxicities (DLTs) are observed in the first dose cohort, the starting dose will be de—escalated per Figure 1. If no more than 1 out of 6 subjects experiences a DLT in a given dose cohort, dose—escalation will continue. 23 l0 146. 146. id="p-146" id="p-146" id="p-146" id="p-146"

[00146] 147. 147. id="p-147" id="p-147" id="p-147" id="p-147"

[00147] 148. 148. id="p-148" id="p-148" id="p-148" id="p-148"

[00148] 149. 149. id="p-149" id="p-149" id="p-149" id="p-149"

[00149] WO 2015/173267 PCT/EP2015/060523 Subsequent cohorts will receive tremelimumab administered Q4W for 6 doses followed by Ql2W for 3 doses and MEDI4736 administered Q4W for 13 doses until an MTD or the highest protocol—defined dose for each agent in the absence of exceeding the MTD is identified.

The expansion phase for the immunotherapy—na'1've cohort (see Figure 1) will begin once the MTD or highest protocol—defined dose for each agent in the absence of exceeding the MTD is determined in the immunotherapy—na'1've subjects during the dose- escalation phase. Additional dose(s) from the intermediate zone—based cohort(s) that do not exceed the MTD can be evaluated in the expansion phase based on evaluation of PK and pharmacodynamics, safety and efficacy parameters in the immunotherapy—naive cohort from the dose—expansion phase.

Immunotherapypretreated Cohort The MTD or highest protocol—defined dose for each agent in the absence of exceeding the MTD determined for the immunotherapy—naive cohort (see Figure 1) during the dose escalation phase will serve as the starting dose for subjects enrolled in the immunotherapy—pretreated cohort as part of the dose—escalation phase. The dose exploration for the immunotherapy—pretreated cohort using 3+3 design will be conducted in parallel with the dose—expansion phase for the immunotherapy—naive cohort. The dose- expansion phase for the immunotherapy—pretreated cohort can begin once the MTD or highest protocol—defined dose for each agent in the absence of exceeding the MTD is determined in the immunotherapy—pretreated subjects during the dose—escalation phase.

Additional dose(s) from the intermediate zone—based cohort(s) that do not exceed the MTD can be evaluated in the dose—expansion phase based on evaluation of PK and pharmacodynamics, safety and efficacy parameters in the immunotherapy—pretreated cohort from the dose—expansion phase.

DOSE—EXPANSlON PHASE Two dose—expansion cohorts will be used: immunotherapy—naive and immunotherapy—pretreated (see Figure 1). The MTD or highest protocol—defined dose for each agent in the absence of exceeding the MTD identified during the dose—escalation phase will be used for both cohorts in the dose—expansion phase. In addition, dose(s) from the intermediate zone—based cohort(s) that do not exceed the MTD can be included as an additional dose(s) for the immunotherapy—pretreated and immunotherapy—naive cohorts in 24 150. 150. id="p-150" id="p-150" id="p-150" id="p-150"

[00150] 152. 152. id="p-152" id="p-152" id="p-152" id="p-152"

[00152] 153. 153. id="p-153" id="p-153" id="p-153" id="p-153"

[00153] WO 2015/173267 PCT/EP2015/060523 the dose—expansion phase based on emerging subject data, including safety, PK, pharmacodynamics, biomarker, and response as well as data present from ongoing trials.

Initially approximately 20 subjects with NSCLC will be enrolled in each of the immunotherapy—naive cohort and the immunotherapy—pretreated cohort. Additional subjects, up to a total of 60 subjects each can be enrolled for the immunotherapy—naive cohort in the dose—expansion phase dependent on emerging subject data, including safety, PK, pharmacodynamics, biomarker, and response as well as data present from ongoing trials.

TREATMENT REGIMEN 151. 151. id="p-151" id="p-151" id="p-151" id="p-151"

[00151] Subjects will be treated in either the dose—escalation or the dose—expansion phase of the study. In the dose—escalation and dose—expansion phases of the study, tremelimumab will be administered every four weeks (Q4W) for 6 doses followed by every twelve weeks (Q12W) for 3 doses in which Dose 7 is given 4 weeks after Dose 6 and Dose 8 is given 12 weeks after Dose 7. MEDI4736 will be administered Q4W for 13 doses. Both agents will be administered via IV infusion for a total of one year (Figure 2).

Tremelimumab will be administered intravenously in 250 mL of 0.9% sodium chloride. MEDI4736 will be administered intravenously in 250 ml of 0.9% sodium chloride. Tremelimumab will be administered first. MEDI4736 infusion will start approximately 1 hour after the end of tremelimumab infusion. In Cohort l, the first IV infusion of tremelimumab will be approximately 1 hour in duration and the first IV infusion of MEDI4736 will be approximately 4 hours in duration; subsequent infusions for subjects in this cohort and all infusions for the remaining cohorts will be approximately 1 hour in duration.

Subjects who achieve and maintain disease control (DC) (i.e., complete response (CR), partial response (PR), or stable disease (SD)) through to the end of the 12- month MEDI4736 and tremelimumab treatment period will enter follow—up. Upon evidence of progressive disease (PD) during follow—up, subjects may be re—administered MEDI4736 and tremelimumab for up to another 12 months with the same treatment guidelines followed during the initial 12-month period if the subject has not received other treatments for their disease and still meet inclusion and exclusion criteria for the study protocol. Only one round of retreatment with MEDI4736 and tremelimumab will be allowed. 154. 154. id="p-154" id="p-154" id="p-154" id="p-154"

[00154] 155. 155. id="p-155" id="p-155" id="p-155" id="p-155"

[00155] 156. 156. id="p-156" id="p-156" id="p-156" id="p-156"

[00156] 157. 157. id="p-157" id="p-157" id="p-157" id="p-157"

[00157] 158. 158. id="p-158" id="p-158" id="p-158" id="p-158"

[00158] WO 2015/173267 PCT/EP2015/060523 The study utilizes a 3+3 dose—escalation phase and will follow the scheme depicted in Figure 3. A minimum of three subjects will be enrolled in each dose cohort.

If 0 out of the 3 patients in a dose cohort have a dose limiting toxicity (DLT), the next dose—escalation cohort will be started. If 1 out of the 3 patients has a DLT, an additional 3 patients will be enrolled in the same cohort. If no more than 1 of 6 subjects experiences a DLT, the next dose—escalation cohort will be started. If 2 or more patients in a dose cohort experience a DLT during the evaluation period, then no further subjects will be enrolled in that dose cohort.

The maximum tolerated dose (MTD) is defined as the highest dose of tremelimumab or MEDI4736 within a cohort where no more than 1 of 6 patients experiences a DLT. This is determined for both the immunotherapy—naive and pretreated cohorts during the dose—escalation phase. Patients in the expansion phase (immunotherapy—naive and immunotherapy—pretreated cohorts) will be treated at the MTD level determined in the dose—escalation phase.

MEDI4736 and tremelimumab administration can be modified or discontinued as a result of toxicities as described in Figures 10A and 10B. Dose modifications will not be required for adverse events (AEs) that are clearly not attributed to MEDI4736 or tremelimumab (such as an accident) or for laboratory abnormalities that are not deemed to be clinically significant. (c) PHAMACOKINETIC, ANTI—TUMOR, BIOMARKER, SOLUBLE FACTOR, AND SAFETY ASSESSMENTS Measurement of MEDI4736 and tremelimumab concentrations in serum will be performed using a validated immunoassay.

Blood samples for pharmacokinetic assessment will be collected on the following days during the dose—escalation phase: day 1 (pre—dose and end of infusion), day 8 ( 1 1 day), day 15 ( 1 1 day), day 29 (pre—dose and end of infusion; 1 3 days), day 57 (pre—dose and end of infusion; 1 3 days), day 85 (pre—dose and end of infusion; 1 3 days), day ll3 (pre—dose and end of infusion; 1 3 days), day l4l (pre—dose and end of infusion; 1 3 days), day 169 (pre—dose and end of infusion; 1 3 days), day 197 (pre—dose and end of infusion; 1 3 days; MEDI4736 only), day 225 (pre—dose and end of infusion; 1 3 days; MEDI4736 only), day 253 (pre—dose and end of infusion; 1 3 days), day 281 (pre- dose and end of infusion; 1 3 days; MEDI4736 only), day 309 (pre—dose and end of 26 l0 159. 159. id="p-159" id="p-159" id="p-159" id="p-159"

[00159] 160. 160. id="p-160" id="p-160" id="p-160" id="p-160"

[00160] 161. 161. id="p-161" id="p-161" id="p-161" id="p-161"

[00161] 162. 162. id="p-162" id="p-162" id="p-162" id="p-162"

[00162] WO 2015/173267 PCT/EP2015/060523 infusion; 1 3 days), day 337 (pre—dose and end of infusion; 1 3 days), at the end of treatment, 60 days after end of treatment, and 90 days after end of treatment.

Blood samples for pharmacokinetic assessment will be collected on the following days during the dose—eXpansion phase: day l (pre—dose and end of infusion), day 29 (1 3 days), day 57 (1 3 days), day 85 (1 3 days), day 113 (1 3 days), day 141 (1 3 days), day 169 (1 3 days); day 197 (1 3 days; MEDI4736 only), day 225 Q 3 days; MEDI4736 only), day 253 (1 3 days), day 281 (1 3 days; MEDI4736 only), day 309 (1 3 days; MEDI4736 only), day 337 (1 3 days), at the end of treatment, 60 days after end of treatment, and 90 days after end of treatment.

The presence of anti—drug antibodies (ADA) will be assessed on Day 1 and Days 29 (1 3 days), 85 (1 3 days), 141 (1 3 days), 169 (1 3 days), 253 (1 3 days), and 337 (1 3 days), at the end of treatment, 60 days after the end of treatment, and 90 days after the end of treatment. Validated electrochemiluminescence assays using a Meso Scale Discovery platform will be used for the determination of anti—MEDI4736 antibodies in human serum and for determination of anti—tremelimumab antibodies in human serum.

Blood samples will be collected for analysis of circulating soluble factors including soluble PD—Ll (sPD—Ll). During the dose—escalation phase, levels of sPD—Ll will be assessed on day 1, day 8 (1 1 day), day 15 (1 1 day), day 29 (1 3 days), day 57 (1 3 days), day 85 (1 3 days), day ll3 (1 3 days), day 141 (1 3 days), day 169 (1 3 days); day 197 (1 3 days), day 225 (1 3 days), day 253 (+ 3 days), day 281 (+ 3 days), day 309 (+ 3 days), day 337 (+ 3 days), at the end of treatment, 60 days after end of treatment, and 90 days after end of treatment. During the dose—eXpansion phase, levels of sPD—Ll will be assessed on day 1, day 29 (+ 3 days), day 57 (+ 3 days), day 85 (+ 3 days), day 113 (+ 3 days), day 141 (+ 3 days), day 169 (+ 3 days); day 197 (+ 3 days), day 225 (1 3 days), day 253 (1 3 days), day 281 (1 3 days), day 309 (1 3 days), day 337 (1 3 days), at the end of treatment, 60 days after end of treatment, and 90 days after end of treatment.

Tumor assessments will be performed during screening (day -28 to day -1), at week 8 (day 50 1 3 days), and at week 33 (day 225 1 3 days) in the dose—escalation phase.

Tumor assessments will be based on RECIST guidelines v1.1 with modifications and include the following evaluations: physical examination (with photograph and measurement of skin lesions as applicable), CT, or MRI scan of the chest, abdomen, and pelvis, and CT or MRI scan of the brain. Computed tomography or MRI scan of the brain is performed only at screening. 27 WO 2015/173267 PCT/EP2015/060523 163. 163. id="p-163" id="p-163" id="p-163" id="p-163"

[00163] lesions, the evaluation of target lesions, the evaluation of non—target lesions, and the Assessments of anti—tumor activity are based on the measurement of tumor appearance of new lesions.

Target Lesion Evaluation 164. 164. id="p-164" id="p-164" id="p-164" id="p-164"

[00164] disappearance of all target lesions. Any pathological lymph nodes (whether target or non- For the evaluation of target lesions, complete response is defined as the target) must have reduction in short axis to < 10 mm (the sum may not be "0" if there are target nodes). 165. 165. id="p-165" id="p-165" id="p-165" id="p-165"

[00165] % decrease in the sum of the diameters of target lesions, taking as reference the For the evaluation of target lesions, partial response is defined as at least a baseline sum diameters. 166. 166. id="p-166" id="p-166" id="p-166" id="p-166"

[00166] % increase in the sum of diameters of target lesions, taking as reference the smallest For the evaluation of target lesions, progressive disease is defined as at least a sum on study (this includes the baseline sum if that is the smallest on study). In addition to the relative increase of 20%, the sum must also demonstrate an absolute increase of at least 5 mm. The appearance of one or more new lesions is also considered progression. 167. 167. id="p-167" id="p-167" id="p-167" id="p-167"

[00167] For the evaluation of target lesions, stable disease (SD) is neither sufficient shrinkage to qualify for PR nor sufficient increase to qualify for PD, taking as reference the smallest sum of diameters while on study.

Non—target Lesion Evaluation 168. 168. id="p-168" id="p-168" id="p-168" id="p-168"

[00168] the disappearance of all non—target lesions. All lymph nodes must be < 10 mm in short For the evaluation of non—target lesions, complete response (CR) is defined as axis. 169. 169. id="p-169" id="p-169" id="p-169" id="p-169"

[00169] progressive disease is defined as the persistence of one more non—target lesions and/or For the evaluation of non—target lesions, non—compete response/non- maintenance of tumor marker level above the normal limits. 170. 170. id="p-170" id="p-170" id="p-170" id="p-170"

[00170] overall level of substantial worsening in non—target disease such that, even in presence of For the evaluation of non—target lesions, progressive disease is deﬁned as the SD or PR in target disease, the overall tumor burden has increased sufficiently to merit discontinuation of therapy. In the absence of measurable disease, change in non- measurable disease comparable in magnitude to the increase that would be required to declare PD for measurable disease.

New Lesion 28 WO 2015/173267 PCT/EP2015/060523 171. 171. id="p-171" id="p-171" id="p-171" id="p-171"

[00171] The appearance of new lesions is considered PD according to RECIST guidelines vl.l. Considering the unique response kinetics that have been observed with immunotherapy, new lesions may not represent true disease progression. In the absence of rapid clinical deterioration, subjects may continue to receive treatment with MEDI4736 and tremelimumab.

Overall Response 172. 172. id="p-172" id="p-172" id="p-172" id="p-172"

[00172] Confirmation of CR, PR, as well as PD is required by a repeat, consecutive assessment no less than 4 weeks from the date of first documentation. The evaluation of overall response based on target lesion, non—target lesion, and new lesion evaluation is determined as in Table 1 below.

Table 1: Evaluation of Overall Response Target Lesions Non—target lesions New Lesions Overall Response Complete Response Complete Response No Complete Response No target lesiona Complete Response No Complete Response Complete Response Not evaluableb No Partial Response Complete Response Non—complete No Partial Response response/ non- progressive disease Partial Response Non—progressive No Partial Response disease and not evaluableb Stable Disease Non—progressive No Stable Disease disease and not evaluableb Not all evaluated Non—progressive No Not evaluable disease No target lesiona Not all evaluated No Not evaluable No target lesiona Non—complete No Non—complete response/ non— response/ non- progressive disease progressive disease Progressive Any Yes or No Progressive Disease Disease Any Progressive Disease Yes or No Progressive Disease 29 173. 173. id="p-173" id="p-173" id="p-173" id="p-173"

[00173] 174. 174. id="p-174" id="p-174" id="p-174" id="p-174"

[00174] 175. 175. id="p-175" id="p-175" id="p-175" id="p-175"

[00175] WO 2015/173267 PCT/EP2015/060523 Any Any Yes Progressive Disease No target lesiona Unequivocal Yes or No Progressive Disease progressive disease No target lesiona Any Yes Progressive Disease aDefined as no target lesions at baseline. bNot evaluable is defined as either when no or only a subset of lesion measurements are made at an assessment.

Adverse events are monitored following administration of MEDI4736. Other assessments include physical examination, vital sign monitoring, and laboratory measurements.

EXAMPLE 2: Results (a) ENROLLMENT AND FOLLOW—UP Twelve subjects were treated with 3 subjects each in Cohort la (1 mg/kg tremelimumab and 3 mg/kg MEDI4736), Cohort 2a (1 mg/kg tremelimumab and 10 mg/kg MEDI4736), Cohort 3a (1 mg/kg tremelimumab and 15 mg/kg MEDI4736), and Cohort 3b (3 mg/kg tremelimumab and 10 mg/kg MEDI4736). Two subjects in Cohort 1a (one subject withdrew consent after 2 doses of both agents) completed approximately 115 days of follow—up; Cohort 2a subjects completed approximately 56 days of follow- up; and subjects in Cohorts 3a and 3b completed 28 days of follow up (Figure 12). (b) PHARMACOKINETICS The pharmacokinetic data resulting from administration of MEDI4736 at 3 mg/kg and 10 mg/kg (in combination with 1 mg/kg tremelimumab) is summarized in Figure 4. Individual PK parameters resulting from the administration of MEDI4736 are shown in Figure 8. In this early data from first dose, the average Cmax for subjects receiving 3 mg/kg MEDI4736 was 67.36 pg/ml. The average AUCT for subjects receiving 3 mg/kg MEDI4736 was 625.3 ug/ml*day. The average Ctrough for subjects receiving 3 mg/kg MEDI4736 was 8.85 ug/ml. The average Cmax for subjects receiving mg/kg MEDI4736 was 266.7 ug/ml. The average AUCI for subjects receiving 10 mg/kg MEDI4736 was 2860 pg/ml*day. The average Ctmugh for subjects receiving 10 l0 WO 2015/173267 PCT/EP2015/060523 mg/kg MEDI4736 was 35.65 pg/1’1’1l. MEDI4736 exhibited a more than dose—proportional increase in AUC indicating non—linear PK. See Figure 4. 176. 176. id="p-176" id="p-176" id="p-176" id="p-176"

[00176] mg/kg (in combination with either 3 mg/kg MEDI4736 or 10 mg/kg MEDI4736) is The pharmacokinetic data resulting from administration of tremelimumab at l summarized in Figure 5. Individual PK parameters resulting from the administration of tremelimumab are shown in Figure 9. 177. 177. id="p-177" id="p-177" id="p-177" id="p-177"

[00177] combination with 3 mg/kg MEDI4736 was 27.07 [lg/1’I1l. The average Cmax for subjects The average Cmax for subjects receiving 1 mg/kg tremelimumab in receiving 1 mg/kg tremelimumab in combination with 10 mg/kg MEDI4736 was 30.40 ug/ml. 178. 178. id="p-178" id="p-178" id="p-178" id="p-178"

[00178] combination with 3 mg/kg MEDI4736 was 262.2 ug/ml*day. The average AUC1: for The average AUCT for subjects receiving 1 mg/kg tremelimumab in subjects receiving 1 mg/kg tremelimumab in combination with 10 mg/kg MEDI4736 was 338.8 ug/ml*day. 179. 179. id="p-179" id="p-179" id="p-179" id="p-179"

[00179] combination with 3 mg/kg MEDI4736 was 4.21 pg/ml. The average Ctwugh for subjects The average Cmmgh for subjects receiving 1 mg/kg tremelimumab in receiving 1 mg/kg tremelimumab in combination with 10 mg/kg MEDI4736 was 5.33 ug/ml. (c) SOLUBLE PD—Ll ASSESSMENT 180. 180. id="p-180" id="p-180" id="p-180" id="p-180"

[00180] mg/kg and tremelimumab at 1 mg/kg is shown in Figures 6 (absolute concentration), 7 The sPD—Ll data resulting from administration of MEDI4736 at 3 and 10 and 8 (suppression, % of baseline). Following MEDI4736 administration, complete sPD—Ll suppression was observed in 5 of 6 subjects. In one subject, sPD—Ll suppression of approximately 65% was observed by the second dose of MEDI4736. (d) SAFETY 181. 181. id="p-181" id="p-181" id="p-181" id="p-181"

[00181] Ten of twelve subjects reported a treatment—emergent adverse event (TEAE).

The most frequently reported TEAEs were fatigue (41.7%; 5 subjects), increased amylase (25.0%; 3 subjects), pruritus and upper respiratory tract infection (16.7%; 2 subjects each). No subject experienced a dose—limiting toxicity. Nine of ten subjects who experienced TEAEs had events that were Grade 1 or 2 in severity. One subject (Cohort 2a) experienced Grade 3 increased aspartate aminotransferase (AST) and increased 31 WO 2015/173267 PCT/EP2015/060523 alanine aminotransferase (ALT) and a fatal (Grade 5) myasthenia gravis. Two of the twelve subjects experienced treatment—emergent serious adverse events (SAEs). Two subjects discontinued treatment due to TEAEs. Figure 13 shows related adverse events. 182. 182. id="p-182" id="p-182" id="p-182" id="p-182"

[00182] 14. Reductions in tumor size were seen in patients in the 1 mg/kg (T) + 10 mg/kg (M), 1 mg/kg (T) + 15 mg/kg (M) and 3 mg/kg (T) + 10 mg/kg (M) groups. 183. 183. id="p-183" id="p-183" id="p-183" id="p-183"

[00183] pharrnacokinetic properties and the combination of agents suppresses sPD—Ll. In Early results showing change of tumor size from baseline are shown in Figure This study demonstrates that MEDI4736 and tremelimumab have favorable addition, MEDI4736 is well tolerated in most of the subjects currently being treated.

EXAMPLE 3: Phase 1b, open—label study of MEDI4736 in combination with Tremelimumab in patients with advanced NSCLC 184. 184. id="p-184" id="p-184" id="p-184" id="p-184"

[00184] T cell activation. MEDI4736 (M) is a human IgG1 monoclonal antibody that blocks PD—L1 binding to PD—l and CD—80. Tremelimumab (T) is a human IgG2 monoclonal antibody targeting CTLA—4. Both MEDI4736 and Tremelimumab have demonstrated The inhibitory PD—L1 and CTLA—4 pathways play a major role in controlling encouraging safety profiles and promising clinical activity as single agents; as they block distinct interactions contributing to immunosuppression, combination MEDI4736 + Tremelimumab therapy may provide greater antitumor activity compared with either agent alone in patients (pts) with advanced non—small cell lung cancer. 185. 185. id="p-185" id="p-185" id="p-185" id="p-185"

[00185] phamiacokinetics (PK) and immunogenicity of MEDI4736 + Tremelimumab This Phase 1 study is assessing the safety/tolerability, antitumor activity, combination therapy in patients with advanced NSCLC. The study has dose- escalation and —eXpansion phases. 186. 186. id="p-186" id="p-186" id="p-186" id="p-186"

[00186] Results: As of December 4, 2014, 61 patients have been treated (Table 2).

Table 2 Cohort Dose 1a 3 mg/kg M q4w + 1 mg/kg T 2a 10 mg/kg M q4w + 1 mg/kg T 3a 15 mg/kg M q4w + 1 mg/kg T 3b 10 mg/kg M q4w + 3 mg/kg T 4 20 mg/kg M q4w + 1 mg/kg T 32 WO 2015/173267 PCT/EP2015/060523 4a 15 mg/kg M q4w + 3 mg/kg T 15 mg/kg M q4w +10 mg/kg T 5a 20 mg/kg M q4w + 3 mg/kg T 6 20 mg/kg M q4w + 10 mg/kg T 8 10 mg/kg M q2w + 1 mg/kg T 9 10 mg/kg M q2w + 3 mg/kg T 10 mg/kg Mq2w+ 10 mg/kgT MEDI4736 (M) + Tremelimumab (T) Q4W = every 4 weeks; Q2W = every 2 weeks 187. 187. id="p-187" id="p-187" id="p-187" id="p-187"

[00187] Overall, the most frequent drug—related AEs for all grades (Z10% pts) were diarrhea, fatigue, pruritis, increased alanine transaminase (ALT) and amylase; that were manageable with standard treatment guidelines including steroids. The most frequent 2Grade 3 drug—related AES (25%) across all patients were colitis, diarrhea, increased aspartate aminotransferase (AST) and ALT. Drug—related AEs leading to discontinuation were colitis (6.6%), diarrhea (3.3%), pneumonitis (3.3%), increased AST (3.3%) and ALT (1.6%), cough (1.6%) and dyspnea (1.6%); there was 1 treatment—related death (polymyositis) in the 10 mg/kg M q4w + 1 mg/kg T cohort. Of 31 subjects with at least one 8 week scan, the best overall response was reported in 8 patients (26%); stable disease was reported in 11 pts (36%). 188. 188. id="p-188" id="p-188" id="p-188" id="p-188"

[00188] These promising results indicate that the MEDI4736 + Tremelimumab combination has a manageable safety profile and early clinical activity. 189. 189. id="p-189" id="p-189" id="p-189" id="p-189"

[00189] Results: As of January 27, 2015, 74 patients across 10 cohorts have been treated (Table 3). 33 PCT/EP201S/060523 W0 2015/173267 $0.0N0 0 $0.0 0 0 $N.NNO 0 $0.000 N $0.000 N 0 $0.000 0 $0.0 0 0 $0.000 0 $0.00 0 $0.00 0 N m:wEHO®m UHE®um>m $N.NNO 0 $003 0 0 $N.NNO 0 $0.0 0 0 $0.000 3 3 eo3en3 we emnesz $003 0 03 $0.000 N $0.000 03 $003 0 0 $0.000 N emeoem ueweezoiemeeom $0.0 0 0 $0.000 3 $0.030 0 $0.0 0 0 $0.000 3 wweoem $52 \3eo3md.3 meﬂoem 0 0 0 0 0 93300303 $0.0 0 0 $0.0 0 0 $0.0 0 0 $0.00 0 $0.000 N eeoexea $0.0 0 0 $0.0 0 0 $0.0 0 3 $0.0 0 0 $0.0 0 0 $030 $0.000 N3 $003 0 0 $0.000 03 $0.000 N $0.00 0 83303:: oz $0.0 0 3 $0.0 0 0 $0.00 3 $0.000 3 $0.000 3 0053 $0.0 0 0 $0.0 0 0 $0.0 0 0 $0.0 0 0 $0.0 0 0 M34 $0.030 N $0.0 0 0 $3.330 N $0.0 0 0 $0.0 0 0 mmwm 030.30 503803332 $.00 $.N0 30.0N $.00 $.0N3 .000 33.00 00.0N0 $.00 $.00 3803 5320 00.03 00.33 00.03 00.N0 00.03 emdooz 00.03 00.03 0N.N0 30.0 0N.03 am 00.03 00.03 00.mN 0N.00 00.03 :82 3m£u:oZ0 p:oEum®3H >U:um op WHWOCUMHQ 03 0 03 0 0 0 3033333 ooe3m oeﬂ 0 0 0 0 0 93003: $0.000 03 $003 0 0 $0.000 03 $0030 0 $0.000 N msoempmmxeoz $0.0 0 3 $0.0 0 0 $0.0 0 3 $0.0 0 0 $0.000 3 msoemswm \3mo3o3m3m $N.N00 03 $0.000 3 $N.N00 03 $0.000 3 $0030 0 3 $0.0N0 0 $0.000 N $$.0N0 0 $0.000 N $0.0 0 0 0 0530 ooum oeﬂommm $0.000 0 $0.000 N $0.000 0 $0.000 3 $0.000 N o3meom $0.000 03 $0.000 3 $0.000 0 $0.000 N $0.000 3 e30: xom $0 .000 $0 .000 $0 .000 330 .000 $0 .300 38: 5320 0.00 0.00 0.00 0.00 0.N0 emdooz 0.0 0.03 3.0 0.0 0.0 mm N.00 0.00 N.00 0.00 0.00 :82 03 0 03 0 0 e $38030 omm $3uz0 30uz0 $3uz0 $uz0 $uz0 o3um3eo3omemeo 200 mime 0N 0,3 :00 mime 03 2 300 mime 03 2 30m mime 03 03 :00 mime 0 03 mime 3 0 mime 0 0 mime 3 0 mime 3 0 mime 3 0 0 00 m0 mN m3 mo33mH3®uom3m£U mdﬂammmm Ucm mUH£QNHUOE®Q 0 QHQMH 34 PCT/EP201S/060523 W0 2015/173267 $0.0 V 0 $0.0NV 0 $0.08 0 $N.NNV N $0.0NV N 0 $0.8: 0 $0.0NV 0 $0.0 V 0 $N.NNV N $0.0NV N N mcoaamom oaﬁoummm $00.05 0 33.0 V N $0.08 N $N.NNV N $0.08 0 N 2oNNnN No 28222 $0.N: 0 $0.08 0 $0.08 0 $0.08 0 $0.08 NN N9No20 22o2N:o:Nm22o2 $00.05 0 $0.08 0 $0.08 N $N.NNV N $0.0NV N 09620 uﬁaswz 220232 029620 0 0 0 0 0 wzNmmN2 $0.0 V 0 $0.NNV 0 $0.0 V 0 $0.0V 0 $0.NNV 0 2205.20 $0.0 V 0 $0.0 V 0 $0.0 V 0 $N.NNV N $N.0V N $220 $0.81 0 $0.N$ 0 $0.08 0 $0.00V 0 $N.08 0 203322 oz $0.00V 0 $0.0NV N $0.00V N $0.00V 0 $0.0NV N 0&2 $N.0 V N $0.0 V 0 $0.0 V 0 $0.0 V 0 $0.0 V 0 222 $N.0 V N $0.NNV 0 $0.0NV N $N.NNV N $0.0V 0 mmwm mzumum 2oNumN22 N0.N0 00.NV $.20 .0.0V NN.0NN .N.0NV ?.N0 .0.0V 20.00 00.NV C82 .2N2V 0N.0N 00.: 0N.0N 02.0N 0N.0N 20:82 00.0N «N.0N 00.00 00.0N N0.0N om 0N.0N 0N.0N 00.00 00.0N N0.0N 232 Am£uQoZV ucwﬁummmw >U5pm op mamodvmam NN NN 0 0 0N 2 NmNNN2N 83,0 o2N.N 0 0 0 0 0 ozN00N2 $0.00V 0N $0.03 NN $00N V 0 $00N V 0 $0.NOV 0N m:o2m500«2oz $N.0 V N $0.NNV 0 $0.0 V 0 $0.0 V 0 $N.0 V N 9020000 20oNoNmN2 $0.00V 0N $0.m$ 0 $0.08 0 $0.08 0 $N.08 0 N $N.0 V N $N.08 0 1.00.08 N $N.NNV N $0.NN: 0 0 0350 082 o2NNommm $0.05 0 $0.08 0 $0.08 0 $0.08 0 $0.0NV 0 oNm2orN $0.N0V 0 $0.08 0 $0.08 0 $043: 0 $0.NOV 0N 302 50 N00 .NNV N00 .m$ $0 .08 NP :8 N00 .08 C82 .2N2V 0.00 0.00 0.00 0.00 0.00 20282 0.0N 0.0N N.0N 0.0 0.0 20 0.00 0.00 N00 0.00 0.00 282 NN 0N 0 0 «N 2 $283 004 NNNu2V $NuzV N0uzV N0uzV $NuzV oNpmNNmuom2m2u 2N0 9:02 0N 2 2N0 9:02 0N 2 200 9:02 0N 2 200 9:02 0N 2 200 9:02 0N 2 9:02 0 N 9:02 N N 9:02 0 H 9:02 0N N 9:02 0 N 0 0 00 0 00 moaumauwpomnmno wcﬁammmm Ucm moanmmuooemm 0 OHQMH W0 2015/173267 moaumauouomumnu ocﬁaommm Una moanmmumoeom m ®HQmH $m.§V «N m A$.RV pm N mdmadumm oﬁﬁoummm $w.NmV mm H Moﬂm we M02232 $w.$V Hm umxoem ucouuzuxumeuom Emmdd ma Umxoem .H®>®Z >MOHmHI mcaxoem m wzHmmHz Emma V w E50515 Awﬁm V m M930 $m.mmV om 533:: oz $>.SV S mmmm $04 V H mam Qmqd S mmwm mzumum coﬂmuzz Saﬁ 5.: ca: EEV 8.3 cmﬂwwz mm.mm mm moém cmoz AmcU.:oEV u.:®Eum®MH 39.0% op mﬂmoﬂvmﬁm Hm Q .mm..G...BH oocﬁm 02.? m ozHmmHz $».8V mm msoamswmucoz ?mm.w V w mzoamsvm >0o.ﬁoum.E Awiws mm a Aomm..TmV am 0 msumum DOOM ocﬂommm A$.§V ﬂu oamaom A$.mmV mm odmz xom 8w .mmV GEE EHZV o.$ cmduoz ms am m.m@ cmmz mm C Amummb ®®< |amuzV| uﬂmﬂouomumno AMNHOH 36 190. 190. id="p-190" id="p-190" id="p-190" id="p-190"

[00190] 191. 191. id="p-191" id="p-191" id="p-191" id="p-191"

[00191] 192. 192. id="p-192" id="p-192" id="p-192" id="p-192"

[00192] 193. 193. id="p-193" id="p-193" id="p-193" id="p-193"

[00193] 194. 194. id="p-194" id="p-194" id="p-194" id="p-194"

[00194] WO 2015/173267 PCT/EP2015/060523 Various doses and schedules of MEDI4736 and tremelimumab administered in combination were examined (Figure 15). MEDI4736 doses and scheduling included 3 mg/kg, 10 mg/kg, 15 mg/kg, and 20 mg/kg every 4 weeks (q4w) and 10 mg/kg every 2 weeks (q2w). Tremelimumab doses and scheduling included 1 mg/kg, 3 mg/kg, and 10 mg/kg every 4 weeks (q4w X 6 doses) and every 12 weeks (q12w x 3 doses).

Complete sPD—L1 suppression at doses 2 15 mg/kg Q4W MEDI4736 was observed (Figure 16). One subject each at 10 mg/kg Q4W and 15 mg/kg Q4W showed partial sPD—L1 suppression at some visits followed by complete suppression after repeated dosing. One subject following 15 mg/kg Q4W was not suppressed at Day 29. By comparison, complete suppression was observed with single—agent MEDI4736 (Study 1108) at doses > 3 mg/kg Q2W. When individual sPD—L1 profiles by cohort were examined, complete sPD—L1 suppression was observed in >95% of subjects following 10 mg/kg Q2W dose (Figure 17).

Increased proliferation of T cells was also observed when MEDI4736 and tremelimumab were administered in combination (Figure 18). Cells were sorted by FACS analysis for the markers CD4 and CD8 in combination with Ki67, a marker of cell proliferation. A monotonic increase in peak CD4+Ki67+ cells was observed with increasing tremelimumab dose, which was greater than the increase in peak CD4+Ki67+ observed with MEDI4736 alone. The CD8+ proliferative response was greater with combinations of MEDI4736 and tremelimumab than with MEDI4736 alone.

Increases in CD4 ICOS+ and CD4 HLADR+ cells was observed in subjects receiving MEDI4736 and tremelimumab compared to MEDI4736 alone (Figue 19). Minimal changes in CD4+ICOS+ cells and CD4+HLADR+ cells was observed with MEDI4736 alone and all tested combination doses had a pattern distinguishable from MEDI4736. Maximal increases in CD4+ICOS+ cells and CD4+HLADR+ cells were observed with a 10mg/kg tremelimumab dose. Increase in CD4+ T effector cells and Treg cells (CD25hi CD127lo phenotype may also include some activated T cells) were also observed in subjects receiving MEDI4736 and tremelimumab compared to MEDI4736 alone (Figues 20 and 21).

Clinical activity in NSCLC was observed with treatment with MEDI4736 and tremelimumab (all doses) showed increases in overall response rate, compared to treatment with MEDI4736 monotherapy (10 mg/kg Q2W (Figure 22). Response was evaluable in 37 195. 195. id="p-195" id="p-195" id="p-195" id="p-195"

[00195] 196. 196. id="p-196" id="p-196" id="p-196" id="p-196"

[00196] 197. 197. id="p-197" id="p-197" id="p-197" id="p-197"

[00197] WO 2015/173267 PCT/EP2015/060523 treated patients with measurable disease at baseline + 21 follow—up scan (includes discontinuations due to disease progression or death prior to first follow—up scan). For MEDI4736 NSCLC (CP1108), only patients with 2 12 weeks follow—up were included.

Overall response rate (ORR) includes confirmed and unconfirmed complete response (CR) or partial response (PR). For MEDI4736 NSCLC monotherapy (CP1108, 10 mg/kg Q2W), best overall response (BOR) of stable disease (SD) with minimum duration of 12 weeks is presented. For the combination of MEDI4736 and tremelimumab, BOR of SD with minimum duration of 7 weeks is presented.

Decreases in or stabilization of tumor size was seen in the majority of NSCLC patients administered MEDI4736 and tremelimumab at tremelimumab doses of 1 mg/kg; 3 mg/kg; and 10 mg/kg (Figure 23). The onset of grade 3 adverse events showed that increasing the dosage of tremelimumab also decreased the time of onset of an adverse event (Figure 24). Decreases in or stabilization of tumor size was seen in the majority of NSCLC patients administered MEDI4736 and tremelimumab at MEDI4736 doses of 10 mg/kg; 315 mg/kg; and 20 mg/kg at Q4W or 10 mg/kg at Q2W (Figure 25). The onset of grade 3 adverse events showed that increasing the dosage of tremelimumab affected the time of onset of an adverse event than increasing the dosage of MEDI4736 (Figure 26). Thus, selection of MEDI4736 and tremelimumab dosages will take into account efficacy and safety.

Exposure data from single—agent tremelimumab in cancer therapy has supported that higher exposures (>30 mg/mL) are needed to maximize efficacy. These levels are attained, on average, at doses 3 3 mg/kg. The exposure achieved following tremelimumab at 1 mg/kg is expected to produce less toxicity than 3 mg/kg based on an analysis of single- agent exposure—safety relationships. Without being bound to a particular theory, tremelimumab at 1 mg/kg partially inhibits CTLA4, as immune—mediated adverse effects are still observed at 1 mg/kg (albeit at lower incidence). Tremelimumab at 1 mg/kg could be optimal in combination with MEDI4736 if synergistic efficacy is observed and the safety profile is improved relative to higher tremelimumab doses.

In one study, complete suppression of the PD—L1 sink and sPD—L1 in serum was observed at doses 2 3 mg/kg Q2W MEDI4736. A dose of 10 mg/kg Q2W was chosen for use as a single agent based on achieving >99% saturation of the sink in the majority of subjects, with drug levels producing maximum tumor growth inhibition (TGI) in mouse 38 198. 198. id="p-198" id="p-198" id="p-198" id="p-198"

[00198] 199. 199. id="p-199" id="p-199" id="p-199" id="p-199"

[00199] WO 2015/173267 PCT/EP2015/060523 models (100 mg/mL identified as the minimum target trough concentration). Following 10 mg/kg Q4W in combination with tremelimumab, suppression of sPD—L1 was observed in some subjects. Dose density was higher with MEDI4736 Q2W and Cmax was higher with Q4W. Scheduling with Q4W may provide greater convenience. In other subjects, incomplete suppression was observed, possibly due to upregulation of PD—L1 combined with suboptimal trough levels achieved at this dose level. MEDI4736 at 10 mg/kg Q4W, evaluated in combination with tremelimumab, produced trough concentrations below the target of 100 mg/mL. However, target levels were achieved with MEDI4736 at 15 and 20 mg/kg Q4W, and the higher doses of MEDI4736 maintained sPD—L1 suppression in all subjects evaluated to date. MEDI4736 at 10 mg/kg or higher could be optimal in combination with tremelimumab if synergistic efficacy is observed and the safety profile is improved.

Overall, the trend for the combination of MEDI4736 and tremelimumab was to decrease or stabilize disease compared to MEDI4736 monotherapy, and MEDI4736 and tremelimumab at the highest doses tested was associated with increased incidence of adverse events. (Figures 27-29). These results indicate that the a combination of MEDI4736 and tremelimumab is well—tolerated and has the potential to be an effective therapy for NSCLC.

EXAMPLE 4: Treatment of PD—L1 negative tumors in N SCLC with MED14736 and Tremelimumab.

Twelve subjects were treated, with 3 subjects each in Cohort la (1 mg/kg tremelimumab and 3 mg/kg MEDI4736), Cohort 2a (1 mg/kg tremelimumab and 10 mg/kg MEDI4736), Cohort 3a (1 mg/kg tremelimumab and 15 mg/kg MEDI4736), and Cohort 3b (3 mg/kg tremelimumab and 10 mg/kg MEDI4736). Two subjects in Cohort la (one subject withdrew consent after 2 doses of both agents) completed approximately 115 days of follow- up; Cohort 2a subjects completed approximately 56 days of follow—up; and subjects in Cohorts 3a and 3b completed 28 days of follow up. 39 200. 200. id="p-200" id="p-200" id="p-200" id="p-200"

[00200] Baseline levels of PD—Ll tumor expression data for 7 subjects on the study are provided at Table 4 (below). Additional information is provided at Table 5.

PD—L1 Result BOR (cut-off 6-4- Best Change in M S .

Cohort core (@25% M 2014) target LBSIOI1 Cohort 5 (15 ME D|4736/ 10 Treme) 13 NEG No Assessments NA Cohort 3a (15 MED|4736/1 Treme) 0 NEG Unconfirmed PR 65.2% Decrease Cohort 2a (10 MED|4736/1 Treme) 0 NEG PD 3.7% Increase Cohort 2a (10 MED|4736/1 Treme) 7 NEG SD 1.6% Increase Cohort 3a (15 MED|4736/1 Treme) 2 NEG SD 267% Decrease Cohort 3b (10 MED|4736/ 3 Treme) 2 NEG Unconfirmed PR 38.9% Decrease Cohort 3b (10 MED|4736/ 3 Treme) 0 NEG PD 23.5% Increase 40 RE . 3 mxuws w E EuE.mu._. =0 mm$§__ .\.m mm on. w _m:< S .1 :2. 9 omz o o o o o Soooooom A052... n Bm::n_ms_ as an tocoo .m._uu.s 3 E _cuE_uu.= :0 mmmeumo o\om.mm ma _umE__.:8:: n E03 .. 7.57m. omz N _ _ o m Sumoooom Ausuﬁ m Em$_n_ms_ as an tozno Am as ﬂaw; w E .:uE.mu.= =0 ammeumo oxohmu om BE:.m_ v _.:=?m_ omz N o N o v Somoooom Aucﬁﬁ CunS_n_ms_ m: an tosnu dw .33; E =._vE—wv.= :0 wmmw_o:_ 4.3 om ——m:< —m V 7.579 wmz N N m o Bowooooow AuEw._._. :@nhQ_Dm=>_ :5 an :9_ao .3 guns mmmm_o:_ o\.n.w on. N :m_2nm « _.:3..n.: omz o o o o vooouoooom AuEu._._. :wnD:n_m_2 a: mu tocoo E :o_mmv._mo._n .23 —:mE_wo.= :0 mzmum mmmmsmo «ammo mm _umE:.:8:: w Emacs .. 7.57m. omz o o o o mooomoooom .uEu.F Imntznms m: an tozno cw sue; .2 m 25 .EuE_au.: :0 . mzaom <2 mEmEmmmmm< oz w :o_ W X00; he m:=_u>> .—CU—.—.:ﬂU¥ Co m:==m .:u.,5o co_mu._ .um._£ :. E~._..w =e.=§ mom m:. :_ mmcwzc ﬁmm zoFom._._oo . . ._OE3.—. I ..oE:_ +v 5:5. +w zsmur ~._.3L m 9:5 41 WO 2015/173267 PCT/EP2015/060523 201. 201. id="p-201" id="p-201" id="p-201" id="p-201"

[00201] Subject tissue of NSCLC patients was characterized for PD—Ll expression by immunohistochemistry in formalin fixed and paraffin embedded tissue samples. A sample was determined to be "PD—L1 positive" if the sample contained 25% or more tumor cells with PD—Ll membrane staining. This is expressed as immunohistochemistry membrane (M)- score. All samples were scored as "negative" for PD—Ll expression. Tumor assessments are available on 6 of 7 patients. Three patients treated with a combination of tremelimumab and MEDI4736. 202. 202. id="p-202" id="p-202" id="p-202" id="p-202"

[00202] Two patients were identified as unconfirmed partial responders (PR), two had stable disease (SD), and two had progressive disease (PD). In all 6 patients, tumor samples were collected >6 months prior to analysis for PD—Ll expression, and 3 of 6 biopsy samples were collected more than 2 years prior to analysis. These data indicate that a combination of MEDI4736 and tremelimumab is active in PD—Ll negative NSCLC based on stored tissue samples. 203. 203. id="p-203" id="p-203" id="p-203" id="p-203"

[00203] When administered MEDI4736 and tremelimumab, most patients having PD—Ll negative NSCLC responded to combination therapy, and showed decreases in or stabilization of tumor size, compared to MEDI4736 monotherapy (CPl 108, 10 mg/kg QZW) (Figure 30).

Patients having PD—Ll positive NSCLC also responded to the combination of MEDI4736 and tremelimumab compared to MEDI4736 monotherapy, and showed decreases in or stabilization of tumor size (Figure 31). When the results of the patients having PD—Ll negative NSCLC were grouped by the dose of tremelimumab, 1 mg/kg tremelimumab or 3 mg/kg tremelimumab administered in combination with MEDI4736 at 10 mg/kg Q4W or 15 mg/kg Q4W were effective at controlling or reducing disease (Figure 32). When the results were grouped by the dose of MEDI4736, the results also showed that tremelimumab at 1 mg/kg to 3 mg/kg administered in combination with MEDI4736 at 10 mg/kg Q4W to 15 mg/kg Q4W was effective at controlling or reducing disease (Figure 33). Analysis of all NSCLC patients receiving MEDI4736 and tremelimumab showed that PD—Ll— and PD—Ll+ NSCLC patients responded to treatment (Figures 34A—34D and 35-37; Tables 6-9). 42 NNN.mNV NN NNN.NNV N NNO.ONV N NNm.mmV N mNgmsNm>m uoz Awo.mmV Om AwN.NNV N NNO.OmV m Aw>.©NV N ommomNm o>NmmmNmoNm NNN.NNV ON Awm.NNV N NNO.OmV m NNm.mmV N ommmmNO oNamNm Aww.NNV ON NNN.NNV N NNO.O V O Aw>.wNV N mmcommwm NNNNNNN NNO.O V O NNO.O V O NNO.O V O NNO.O V O omsommom oumNmaoo Onuz Ouz ONuz Ouz muuonou NN< BNO BNO zNo NNV ON\we m NNV mN\me N NNV wx\mE M + NzV mN\me ON + N2V ON\me ON + NzV mx\ma ON O O mm Nuonou NNV ame:eNNmeoNN cam NzV ONONNNN Nwo.o V O NNN.mNV N NNN.ONV N Nwo.o V O NNO.mNV m NNO.O V O Nwo.o V O mN2m:Nm>m Noz NwO.mmV O NNO.OmV N NNN.OmV N NNm.mmV N NNm.O V N Nwm mmV N NNOON V N ommomNa o>NmmoNOoNm NwN.NNV N NNN.mNV N NNN.ONV N NNm.mmV N NNm.mmV N NNm.mmV N NNO.O V O ommomNO oNOmpm Nwm.mNV N NNO.OmV N Nwm.>NV N NNm.mmV N NNm.mmV N NNm.mmV N NNO.O V O mmcommom NNNNNNN NNO.O V O NNO.O V O NNO.O V O NNO.O V O NNO.O V O Awo.o V O NNO.O V O omcommmm mNoNmeoo Ouz mNuz NNuz muz NNuz mu mu BNO BNO BNO zNo BNO sNo BNO NNV ON\ms ON NNV Ox\Os m NNV ON\wa N NNV ON\Oe m NNV Ox\Os N NNV Og\we N NNV ON\ms N + NSV ON\Oe mN + NzV Ox\Oa mN + NZV ON\wg ON + NZV ON\Oe ON + NzV Ox\Oa mN + NZV ON\wg ON + N2V mN\Oe m m mN N am mm mN «N uuocou NNV Ome:eNNmswNN can NzV ONONNNN coaumaﬁmom ®aQmSHm>m wmcogmwm muoonnsw QHQNSHMRW Hﬁﬂ I OWCOQWOM HH®.H®>O ummm w wHQmH 43 A00.0EV m A00.mmV E A00.0 V 0 A00 0mV E mEgmsEm>m uoz A0m.NEV N A00.0 V 0 A000E V E A00.0 V 0 om0wmEm ®>Ewm®EmoEm A0m.EmV m A00.mmV E A00.0 V 0 A00 omV E wmmmmEa wEgmpm A0m.0mV 0 A00.0mV N A00.0 V 0 A00.0 V 0 omcommwm EmE0Emm A00.0 V 0 A00.0 V 0 A00.0 V 0 A00.0 V 0 omcommom o0mEmeoo 0Euz 002 Euz muz muuonoo EE< 300 300 300 EV mv + AEAV E502 0E + AEAV mVvA\mVE 0E + AzV mv 0 0 mm uuogou EV 0AmE:EEEwEwEE new AZV 0m$EA.Em_E>A coﬂumaﬂmom ®Hﬂm5HN>W mmcommwm muomnnsm ®>EuHmOm aqlmm I wmcommom ﬁHNH®>O ummm A00.0 V 0 A00.0 V 0 A00 0 V 0 A00.0 V 0 A00.0mV E A00.0 V 0 A00.0 V 0 mEnm:Em>m Eoz A0m.mmV E A00.0 V 0 A00.0 V 0 A00.0 V 0 A00 0 V 0 A00 0 V 0 A00.0 V 0 ommomEm o>EwwoumoEm A0m.mmV E A00.0 V 0 A00.mmV E A00.0 V 0 A00.0mV E A00 0 V 0 A00.0 V 0 mmmmmEe oEg0Em A0m.mmV E A00 0 V 0 A00.m0V m A00.0 V 0 A00.0 V 0 A00 0 V 0 A00.0 V 0 wmcommmm EmEEumm A00.0 V 0 A00.0 V 0 A00 0 V 0 A00.0 V 0 A00.0 V 0 A00 0 V 0 A00.0 V 0 omcommmm o0mEmaoo muz 0uz wuz 0uz Nuz 0uz 0uz 300 200 300 300 200 300 300 AEV 00\oa 0E AEV m0\0a m AEV m0\wg E AEV 00\mE m AEV m0\0a E AEV m0\wg E AEV m0\me E + A2V m0\mE mE + AzV mx\mE mE + AzV m0\wE 0N + A2V m0\mE 0E + AzV mx\mE mE + AzV m0\we 0E + AEV m0\mE m m 00 0 gm mm mm «E MEOLOU ARV QMESEHHOEQEH Ucm RSV 0m00Emm Eoﬂumaﬂmom ®anmSHm>m wmcommwm wwowmnﬂm ®>EwHmom ﬁﬂlﬂm I wmcommwm HHmH®>O wmmm 0 wHQmH 44 "$E.EEV 0 "$0.0 V 0 "$0.NNV E "$0.0 V 0 mEnm:Em>m uoz "$E.ENV NE "$0.0 V 0 "$0.NNV E "$0.0NV E om$wmEm ®>Emm®EmoEm "$E.NNV 0 "$00E V E "$0.0NV N "$0.0NV E wm$mmEa wEgmpm "$E.NNV 0 "$0.0 V 0 "$0.0 V 0 "$0.0 V 0 omcommwm E$E$Emm "$0.0 V 0 "$0.0 V 0 "$0.0 V 0 "$0.0 V 0 omcommom o$mEmeoo NNuz Euz «Hz Nuz muuonoo EE< BNO BNO 300 "EV miwe N "EV 9%: E "EV maﬁa N + "EV 332 0E + ":0 Evzme 0E + ":0 mﬁms 0N 0 N mN MEOLOU "EV QmE5EHHwEwEH Ucm "EV omwwwmm coﬂumaﬂmom ®Hﬂm5HN>W mmcommwm muomnﬂﬂm ®>Humm®Z aqlam I wmcommom HHmE®>O umwm "$0.0 V 0 "$E.NEV E "$0.0NV E "$0.0 V 0 "$E.NEV E "$0.0 V 0 "$0.0 V 0 mEn$:Em>m Eoz "$E.NNV N "$E.NEV E "$0.0NV N "$N.NNV E "$E.NEV E "$N.NNV E "$00E V N om$omEm o>EwwoumoEm "$0.0 0 0 "$E.NEV E "$0.0NV E "$N.NNV E "$E.NEV E "$N.NNV E "$0.0 V 0 mm$mmEe oEg$EN "$N.NNV E "$0.0NV N "$0.0 V 0 "$N.NNV E "$0.0NV N "$N.NNV E "$0.0 V 0 wmcommmm EmEEu$m "$0.0 V 0 "$0.0 V 0 "$0.0 V 0 "$0.0 V 0 "$0.0 V 0 "$0.0 V 0 "$0 0 V 0 omcommmm o$mEmaoo Nuz Nuz Nuz Nuz Nuz Nuz Nuz 300 200 300 300 200 300 300 "EV 0$\oa 0E "EV m$\Na N "EV m$\wg E "EV N$\mE N "EV m$\Na E "EV m$\wg E "EV m$\me E + "2V mx\mE NE + "zV mx\mE NE + "zV m$\wE 0N + "EV mx\mE 0E + "zV mx\mE NE + "zV m$\we 0E + "EV mx\mE N N $0 0 QM mN mN $E MEOLOU "EV QMESEHHOEQEH Ucm "EV ©m>wHDm Eoﬂumaﬂmom ®anmSHm>m wmcommwm muowmnﬂm ®>Eumm®Z ﬁﬂlﬂm I wmcommwm HHmH®>O umom w wHQmH 45 Awm.eHV m Awe e V e Awe.eNV H Awe emV H mHgm:Hm>m uoz Awe.mmV mH AweeH V w Awe.eeV m Awe.e V e ommwmHm o>HmmwHmoHm Awe.eHV m Awe.e V e Awe.emV H Awe.e V e wmmomHa wHQmpm Awe.eHV m Awe.e V e Awe.e V e Awe.emV H omcommwm HmHHHmm Awe.e V e Awe.e V e Awe.e V e Awe.e V e omcommmm oumHmaoo wmuz wuz muz muz muuonoo HH< zmo smo awe AHV mw\we m AHV ew\me H AHV mw\es m + AzV mw\mE eH + AzV mw\me eH + AzV mw\ms em e e an uuogoo AHV nma:eHHmewHH can AzV emewHmm coﬂumaﬂmom ®Hﬂm5HN>W mmcommwm mwowmndw <2 ﬁ.H|QAm I OMCOQWOM HHmwH®>O ummm Awe.e V e Awm.wHV H Awe emV H Awe.e V e Awe.mNV H Awe e V e Awe.e V e mHnm:Hm>m Hoz AweeH V m Awm.meV m Awe.emV H Awe e V e Awe e V e Awe.e V e AweeH V H wmmmmHm o>HwmoMmoHm Awe.e V e Awe.emV N Awe.e V e Awe e V e Awe emV N Awe.e V e Awe.e V e ommomHa oHQmpm Awe.e V e Awm.wHV H Awe.e V e Awe.e V e Awe.mmV H Awe.e V e Awe.e V e wmcommwm HmHHHmm Awe.e V e Awe.e V e Awe e V e Awe.e V e Awe e V e Awe.e V e Awe.e V e mmcommmm owmHmEoo muz euz NHZ euz wuz euz HHZ sea awe awe sea awe awe sea AHV ew\oa eH AHV mw\wa m AHV mw\wg H AHV ew\mE m AHV mw\wa H AHV mw\wg H AHV mw\me H + A2V mw\mE mH + AzV mx\mE mH + AzV mx\wE em + A2V mw\mE eH + AzV mx\mE mH + AzV mx\we eH + AEV mw\mE m m we w mm mm aw «H uuonou AHV Qma:eHHoEmHH cam AzV emewHmm Eoeumaﬂmom ®anmSHm>m wmcommwm MPUQFOEDW I OMCOQWQM ;_mﬁNM@>O uamwm e ®HQmH 46 WO 2015/173267 PCT/EP2015/060523 204. 204. id="p-204" id="p-204" id="p-204" id="p-204"

[00204] Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific aspects of the disclosure described herein. Such equivalents are intended to be encompassed by the following claims. 205. 205. id="p-205" id="p-205" id="p-205" id="p-205"

[00205] Various publications are cited herein, the disclosures of which are incorporated by reference in their entireties. 206. 206. id="p-206" id="p-206" id="p-206" id="p-206"

[00206] Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, it will be obvious that certain changes and modifications can be practiced within the scope of the appended claims. 47 WO 2015/173267 PCT/EP2015/060523 SEQUENCE LISTING SEQ ID NO:1 MEDI4736 VL E IVLTQSPGTLSLSPGERATLSCRASQRVSSSYLAWYQQKP GQAPRLLIYDASSR ATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSLPWTFGQGTKVEIK SEQ ID NO:2 MEDI4736 VH EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYWMSWVRQAP GKGLEWVANIKQDG SEKYYVDSVKGRFT I SRDNAKNSLYLQMNSLRAEDTAVYYCAREGGWFGELAFDY WGQGTLVTVSS SEQ ID NO:3 - MEDI4736 VH CDR1 RYWMS SEQ ID NO:4 — MEDI4736 VH CDR2 NI KQDGSEKYYVD SVKG SEQ ID NO:5 — MEDI4736 VH CDR3 EGGWFGELAFDY SEQ ID NO:6 — MEDI4736 VL CDR1 RASQRVS S SYLA SEQ ID NO:7 — MEDI4736 VL CDR2 DAS S RAT SEQ ID NO:8 — MEDI4736 VL CDR3 QQYGSLPWT SEQ ID NO:9 Tremelimumab VL PSSLSASVGDRVTITCRASQSINSYLDWYQQKPGKAPKLLIYAASSLQSGVPSRF SGSGSGTDFTLTISSLQPEDFATYYCQQYYSTPFTFGPGTKVEIKRTVAAPSVFI FPP SDEQLKSGTASVVCLLNNFYPREAKV 48 WO 2015/173267 PCT/EP2015/060523 SEQ ID NO:10 Tremelimumab VH GVVQP GRS LRLS CAAS GFTF S SYGMHWVRQAP GKGLEWVAVIWYDGSNKYYAD SV KGRFT I SRDNSKNTLYLQMNSLRAEDTAVYYCARDPRGATLYYYYYGMDVWGQGT TVTVS SASTKGP SVFP LAPCSRSTSE S TAALGCLVKDYFPEPVTVSWNSGALTS G VI-I SEQ ID NO:11 - Tremelimumab VH CDR1 GFTFSSYGMH SEQ ID NO:12 — Tremelimumab VH CDR2 VIWYDGSNKYYAD SV SEQ ID NO:13 — Tremelimumab VH CDR3 TAVYYCARDPRGATLYYYYYGMDV SEQ ID NO:14 — Tremelimumab VL CDR1 RASQS INSYLD SEQ ID NO:15 — Tremelimumab VL CDR2 AASSLQS SEQ ID NO:16 — Tremelimumab VL CDR3 QQYYSTPFT 49 1/41 FIG. 1 Dose-escalation Phase lmmunotherapy-naive Subjects Dose(s) that could be used in expansion: 1. MTD or highest protocol-defined dose for each agent in the absence of exceeding the MTD and/or 2. Intermediate dosing based on modified zone-based design Dose-expansion Phase lmmunotherapy-naive Cohort Dose-escalation Phase Immunotherapy-pretreated Cohort Dose(s) that could be used in expansion: 1. MTD or highest protocol-defined dose for each agent in the absence of exceeding the MTD and/or 2. Intermediate dosing based on modified zone-based design Dose-expansion Phase Immunotherapy-pretreated Cohort SUBSTITUTE SHEET (RULE 26) 2/41 mxmgs NF E96 u 250 Emma w E96 u >30 "mmmmm__u m>_m$5oa u n_n_ Awmmou mv>>m_o omoo nmE=E__oEe._ Eamon 8>>vo mmoo nmE=E__mE¢¢ _ 3 3 2 R 8 am 2 rm 5 3 m m V v_$>> mvmN_¢_96 338 E Ea $8 £§B_>_ < % 26__ou_ _m>_>Sm n m_n_ 5 m£:oE N_, .8 women m 5.. >>N—.O Em mmmou m 5.. >>vO 5mE:E__mE2._. cocoa. 80,8 2 .2 Eu "©§_n_m__>_ 2 2 F mic H m:_:$.ow E + cocoa E258: £85 NF 5% ommmma m>_m.oémen_ 83¢ _2__m m__2__o _.:mEE§mm_ ;o__£ N .0_u_ SUBSTITUTE SHEET (RULE 26) WO 2015/173267 PCT/EP2015/060523 3/41 3 Cohort1a Tremelimumab 1 mg/kg MED|4736 3 mg/kg I Cohort 0 _>_ 2 DLT's ?? YES — Tremelimumab 1 mg/kg MEDI47361 mg/kg NO I Cohort 2a Tremelimumabt mg/kg MED|4736 10 mg/kg Go back to Cohort 1a 2 2 DLT's ?? YES — and evaluate for | MTD NO Cohort 3a Cohort 3b Tremelimumab 1 mg/kg Tremelimumab 3 mg/kg MED|4736 15 mg/kg MED|4736 10 mg/kg YES 2 2 DLT's ?? Both Cohorts Z 2 DLT's ?? YES must be cleared prior to escalation to Cohort 4a If 32 DLT's only in If 2 2 DLT's only in Cohort 3a then stop Cohort 3b then stop further escalation to N0 further escalation to Cohort 4a and then I Cohort 4a and then gg to Cohan 3b and Cohort 4a go to Cohort 3a and evamate for MTD Tremelimumab 3 mg/kg evaluate for MTD MED|4736 15 mg/kg I Go back to Cohort s 2 2 632.32% Tremelimumab 10 mg/kg J...

MED|4736 15 mg/kg N0 SUBSTITUTE SHEET (RULE 26) WO 2015/173267 PCT/EP2015/060523 4/41 FIG. 4 MED|4736 PK Proﬁle (Q4W dosing) 1000 100 _\ Z ———————————————————— —— LLOQ (<0.05pg/mL) MEDl4736 Serum Concentrations (pg/mL) 6 2 1'4 2'1 23 Time (Day) A Cohort1 [3 mg/kg (MED|4736) +1 mg/kg (Treme)] v Cohort 2 [10 mg/kg (MEDl4736) +1 mg/kg (Treme)] MED|4736 PK Parameters Cmax AUCT Ctrough C h rt ,, ° ° (M9/m|-) mg/mL day) rug/mt) 1 (3 mg/kg) 67.36 625.3 8.85 (N=3) (7.085) (47.98) 1.80 2 (10 mg/kg) 266.7 2860 35.65 (N=2) (72.15) (286.2) (4.65) SUBSTITUTE SHEET (RULE 26) WO 2015/173267 PCT/EP2015/060523 /41 FIG. 5 Tremelimumab PK Profile (Q4W dosing) C -.2 100 3 § . 8 A 10 '3 E E‘ ? 3 E’ 3 Q ‘s./ E 1 E E g 01 " _____________________ __ LLOQ (<0.156 pg/mL) :5 ' 0 7 1'4 2'1 23 Time (Day) A C0hort1 [3 mg/kg (MED|4736) +1 mg/kg (Treme)] V Cohort 2 [10 mg/kg (MED|4736) +1 mg/kg (Treme)] Tremelimumab PK Parameters C max AUCT Ctrough °°"°" (M9/ml-) <09/mL*day> <09/mL> 1 (1 mg/kg) 27.07 262.2 4.21 (N=3) (3.669) (9.347) (1.05) 2 (1mg/kg) 30.40 333.3 5.33 (N=2) (0.6557) (27.20) (0.75) SUBSTITUTE SHEET (RULE 26) WO 2015/173267 PCT/EP2015/060523 6/41 FIG. 6 Soluble PDL 1 proﬁles (Absolute) 300 l\D © 3 100 sPDL1 Concentrations (pg/mL) ———————— —— - LLOQ (<15.60 pg/mL) 0 EOI 7 1'4 21 28 Time (Day) + 2000002001 :[ Cohort 1 [3 mg/kg (MED|4736) 1 2000062002 -A‘ 2000062003 *1 '"9’k9 (T"""""’)] 1 Cohort 2 [10 mg/kg (MEDl4736) + 2000062007 +3 mg/k0 (Treme)] SUBSTITUTE SHEET (RULE 26) WO 2015/173267 PCT/EP2015/060523 7/41 FIG. 7 Soluble PDL1 profiles (% of baseline) E‘ g 150 S §°, 100 U) E 7* ‘E3 50 j"<§ 0 § ——— ————————— ——j— LLOQ(<15.60pg/mL) G) 0 I I I I I "L 050' 7 14 21 28 Time (Day) 0- 2000002001 I Cohort 1 [3 mg/kg (MEDI4736) 1 2000002002 ar 2000002003 *1 mg/kg (T""’"‘*)] 1 Cohort 2 [10 mg/kg (MEDI4736) + 2000062007 +3 mg/k9 (Treme)] SUBSTITUTE SHEET (RULE 26) WO 2015/173267 PCT/EP2015/060523 8/41 FIG. 8 MED|4736 Individual PK Profiles MEDI4736 Concentrations (pg/mL) -l— 2000062002 - 2000062003 1 Cohort 2 [10 mg/kg (MED|4736) + 2000062007 +1 mg/kg (Treme)] +1 mg/kg (Treme)] + 2000062001 1 Cohort 1 [3 mg/kg (MEDl4736) SUBSTITUTE SHEET (RULE 26) WO 2015/173267 PCT/EP2015/060523 9/41 FIG. 9 Tremelimumab Individual PK Profiles 100 Tremelimumab Serum Concentration (M9/mi-i 3?‘ 0 I I I I 0 7 14 21 23 Time (Day) + I Cohort 1 [3 mg/kg (MED|4736) "- 75 2000062003 *1 '"9’'‘9 ("email j Cohort 2 [10 mg/kg (MED|4736) + 2000002007 +1 mg/kg (Treme)] SUBSTITUTE SHEET (RULE 26) /41 .m_ema8om w_ cm_..__8% mmE§mE_F 9: E Eccms m_£ =_ cmmmcme mm_<.__ Fo :o_E_o$m .Fmm_£8o:__ooc:m 8.. éemg Ememomae mcozzoc .223 m:o_=8_8E m>_mmma%wo§EE_ B :o_F§m_:_Eum 2:52 >mE mm_<__ .5 Emeommcmz m ._m_Eo= .5 :E__ 3%: u 2.5 €m>m m2m>um uBm_m._-m::EE_ u m_<__ _Em>m m2m>um u m_< emE=E__oE§ Em ©m§mm._>_ m::_Eoom_c gas om =_£_>> :58 6: 88 F muse w 9 :o_5_om$ .__ mc__m...,.8 5 F 890 w 9 :o_S_owe __E: %e2=__¢e§ Em ©m§E_2 go: m_<§=o __< mmmou Emsammgsm 9 BE :o_.mo_8Eoa Egmcoo §%_.$>___ 2: .5 :o_§om_u m£ Fm Emccsm _mco_§=m:_ .3 8§m_:_Ecm 8 Fae $:_E9m_F__Em __o\9_m :m_ao:_E98< E®>m we .6 :o_S_82 __=5 8a=.:mE_ >___m._8E9 8 exam 3 cmmmeomn 8 >9: QmE=E__mEm: 8 ©m§m.u=>_ .5 £9 co_m:E_ oi |.|||"w:o_Fomm_ c9m_e-:o_m:.E_ _on_ n_mE:E__mE§ Em om§om__>_ m=:_Eoom_u ﬂan om :_£_2::8o 6: 8% F muse w 9 =o_E_om2 F.

F @920 w B :o_S_omm_ __E: %§.E__¢e§ Em 8§Ss_ go: m_<___ __m E QmE:E__®E®b Em cm_F:om_s_ o::_Eoom_c _om_Em£o .38 8_=8;om ca: Fm co_F§m_:_F%m nm:SE__oEm: Em ©m.§am_>_ mcsme »F%_o§moo_:oo m:_n:_o:_V 9.8 m>_:8%m _mE_xmE Fo :o_§F_:_ 9: .5 mama m :_£_>> 2:80 F $.20 w 9 :o_S_8e .__ F $85 w B :o_S_ow9_ __E: gmE:E__mEm: Em .,§F_om__>_ 20: m_F_:oE=m.a _on_ 8% e§=e__me§ Em BEBE 22 §_ 8 mm_<__ o_mo_9m§% Bu.

%E=e__me§ Em ©m§gm__>_ magma. 6m__o._E8 m_ >£8o:__oon$ :m;>> %§e__oe§ Em ©m§n_.u__>_ 20: N 2.90 8:38. .a,_ Ememsﬁm $8 8 "m.u_<_m£o __m _ou_ mmmou Emscmmgsm 9 BE cozmoﬁmama agmcoo §mm=mm>:_ 9: .5 :o_§om_u 9: Fm Emccﬁm _m:o_§_Fm:_ .8 ce9m_:_Ecm 8 .35 mm:_EEw_;_Em 56cm $_ao:_ES8< E®>m 9.: U5 :o_S_om2 Es: 8a::mE_ >__§8E9 5 $093 cmmmmhomn 8 Fae pmE:E__mE®.: 8 ©m§am_F>_ Fo BE :o_m=.a_ 9: Hmcosome u9m_2-:o_m:E_ _ou_ mcoz F @920 bUBST|TUTE SHEET (RULE 26) 255 550 __< m m: 3_$>mm <2 .O_n_ 11/41 .m3ma8om 2 om_.=om% wmE@_.5E= 9: E $5.9: 25 :_ cmmmcme mm_<__ .5 :o_5_o$m _Amm_£8ocEoP_m 5.. ‘E99: EmE8m_Q2 m:oE§_ §c:£ m:o=mo_8E m>_w$a%mo:=EE_ .5 :o=§w_=_Ecm 2:52 22: mm_<__ .5 EmEomm:m_>_ m ._m::o: ho :E__ .53: u 2.5 :55 memém u9m_m_-m_SEE_ u m_<__ £65 memém u m_< SUBSTITUTE SHEET (RULE 26) m2 .O_u_ gmE:E__mE§ Em ©mEB_>_ 2a_E8w_o nmE:E__®E®.: Em mm§n_m__>_ m::_E8w_n_ V @920 pmE:E__mE§ new ©m§n_m_>_ m:c_Eoow_o .".m..m_..:<._._.._.m.__...W.._._.m.._.oIu_.

QmE:E__mE®b Em ©m§om_>_ o::_Eoow_u ,z._: x m A c_£:___p :29 c_ m:o:m>m_m:_on_ . pmE:E__mE§ Em mm§n_m__2 m:c_Eoom_c .mw_>am£o $8 cm_%m%w :8: gm co:§w_:_Ecm QmE:E__®EmE Em mm§n_.u=>_ mE:m$ ,%mu 3 :_£_>> mc__mw8 E V ago w 9 mzowe Lo 98 N c_£_>> 2.5 x m vv N @920 w 9 %maE>o_o wco_E>m_m .__ .mc__mmB 5 F $90 w 9 :o_S_ow2 __E: pmE:E__mE§ Em ©m:_nm_s_ 22 .z._: x m w :_£:___g E9 :_ m:o:m>o_m _o.._ . |1u1c_p=____p E9 c_ w:o_ﬁ>m_o _o.._ QmE:E__®Emb Em mm§am__>_ o:c_Eoow_c .25 x w A $mm:_Emwc§ c_ w:o_ﬁ>m_m:o.._ .

QmE:E__®Emb Em ©m§nm__>_ m::_Eoow_c ,mm_>>._m£o $8 cm_%mEm ca: Hm :o_§ﬁ_c_Enm %E:E__mE§ Em mm.§n_ms_ Esme .93 E c_£_>> ¢c__mwB 5 V 2.90 w 9 m>_ow$ 5 93¢ .\. :_£_>> N mgeo w 9 %$mc_sou w:o:m>m_m .__ .mc__mmE .6 _ muse w 9 co_S_owe __E: %:5E__mE§ Em ©m§n_m_>_ 22 _z._: x w w mmwmc_Emmc§ c_ mco_§6_m _on_ . %§e__me§ Em mm§B_>_ 2a_z§__o ,$_>$eo .38 _8_=_8§ %E:E__mEm: :8: E :o=§m_:_Ecm QmE:E__mE§ Em ©m_§om=>_ cm 2:: c8m_ is c_ _2:8_oo oc wmo mg mwm _o m S n o co_ 3 owe Esme inc 3 :_£_>> m:__mm8 5 F anew w 9 game a %§B_>_ _H .3 u om _£_ H _o __ 3 V _o o v H L _ D; _o £8 N :_£_>> N anew w 9 %Emc>>oc E5 wm_<_ou_ mc__mmB Lo _ @926 w 9 co_S_ome __E: QmE:E__mE§ Em ©m§om__>_ go: . mc__mw8 5 F muse m_<__ o_ o_9m::% ._ou_ w 9 :o_S_ome __E: %e§__¢g§ Em ©m§nm__>_ go: . $8 _8_=_8§ "wm_<$£o __m _on_ use Hm :o:§w_c_Ecm pmE:E__mE§ Em ©m§om_>_ Esme .co__eE8 w_ §mQoc__oon:m $55 gmE:E__mE.nE Em ©m§B_>_ %:_E8w_n_ . gmE:E__mE§ Em mm§n_m=>_ c_o_._ . :88 859 -:o_wec_ Em H_>=_wcm2m Eon_ m %Eo $55. 6:6 __< m we: a_a$m 12/41 m=o_..mm_..._uoE £5, E ._m_om_m_ Em: mxmma w >_m>m m_.mEm mmcommm. bmE_._n_ e m__mEo mmcoammm xmma _ am>m NE m_m>o .m Emma N; bm>m "m-m m_m>o N mxmm; V 5.. >_v_mm>> "_. m_m>o e mEmEmmmmm< ammmm oEv_n_ .b_mm:mmo§EE_ _>.._>__mm ._oE3_E< émccommm .N m__._.oa bmmmm m£ Em n_.:2 m£ msummmxm E mmcmmnm me. E Emmm 5mm 8.. mmmu nm:___mc-_82oa .mm;m_; 5 n_._._>_ _emE_i 4 258.30 mtocoo cmmmm_.¢m.n_ Em m>_mz EEm£o:=EE_ .m a2m§mm_%mmqm_mm_ mo._omz m_§.mEm_>_ .5 mamﬁmmmza umm:m>u< >__mmo._ .—. :o_m:mem_ m>_mz €m_m£o:=EE_ .N e2m§mm\umm%_mm_ mo._omz m_§mm.m_>_ .6 msﬁmmmmaa mmm:m>n< >__mmo._ ._ :o__.m_mmmm_ a___%_m_ >8. m_§__m zém E \—\—\—C‘OCO8 c,)$LO©l{)l.D 'T"'1—"T"""—' mag m X E5 Em mmmou mx >30 nm.E=E__mEm._._. $8,. NF x mm§om__>_ (UCU(U_C)€ULo T"C\lC"3CO<' team I‘ .®_u_ SUBSTITUTE SHEET (RULE 26) 13/41 283 w am>m u >25 _.EmE__o.Em as B v_$>> as E v_$>> 8Em_n_ :28 $2 928 928 SE :_ m_< mac 9 SE 5 m< 95 2 in V £2. mm 26 ..2.=2x$ mm as 8.223 8 mm 8 25 U 200888 mm 2009.23 mm _o . n_ ._.._n_ 339.8 3.3: 2:2,: 2525 E25 >__a :28 N m N o EmEHm¢.: co momzsw 82: E8: m<5: cm-:oz-m .cw-coz-N .3; cw-=oz-m .cm-=oz-N .3; ._oE=._.

Q E 2: Q3 Q2 8:: .5 dz % .5 V_$>> m m m m 8:25 §_§ Sc 33 Ea Ea Ea E Ems m E 2% .0, E 335 F E 9.? _ E 39.. _ E 9.? 2 E 39.. 2 as gas 9 E gas 2 E 39.. m S em 3 mm 2 :28 _..28 :8 .8 __a< 8._omz =_ E %e__e__$a.: Em E 8:._om__2 NV .O_n_ SUBSTITUTE SHEET (RULE 26) 14/21 05 9 m_< $ 8 -)3 '3‘ -13 T % ? E8 _§m_§ m< Emma ? 05 S .u._< -)6 ‘_.. m_ m_< Saw 5 E m_< 22 A 5% x3; _§.aE «"2 E 9.? m E E2. 2 W2 E 32. .9.

E gas 2 muz E 39. _ E 9.? 3 W2 E Ems .

E gas 2 muz E 93: .

E 935 m 3 3 mm Eﬁo =33 :8 .2 __a< ...m< Emma >23 E %§e__m§E Em E 8En_m_s_ 2 .0_n_ SUBSTITUTE SHEET (RULE 26) WO 2015/173267 PCT/EP2015/060523 /41 Tumor Size Change from Baseline (First Four Cohorts) 100 - E 2 50 - § 8 0 , E —-I:I 2 2» -50 — \\ 2 o "100 _ I I I I I I I I I I I I 024681012141618202224 Time(weeks) —o— 1 MG/KG TREME + 3 MG/KG MED|4736 -0- 1 MG/KG TREME + 10 MG/KG MED|4736 —o— 1 MG/KG TREME + 15 MG/KG MED|4736 -0- 3 MG/KG TREME + 10 MG/KG MED|4736 n-/n = 5/11 0 One additional subject in Cohort 3b with 38% reduction at week 7 SUBSTITUTE SHEET (RULE 26) 16/41 2 NE: NE: N2: >>mO 22 395 mmmoc m x BN3 Em memos m x 3.} QmE:E__wEm._._. S" 2 2 2 8 2 2 m m m m 8 2 9 m E _ _ _ _ 8 9 2 m E E0 Ea 2,3 Ea 82 £2 22 3 ©§_nm__>_ E ._U_u_ $_%m%m\mmmoQ 8u.|8J_|_ SUBSTITUTE SHEET (RULE 26) WO 2015/173267 PCT/EP2015/060523 17/41 FIG. 16 Individual sPD-L1 Profiles in Combination 400 Total # of subjects = 69 ,,1o mg/kg Q4W MEDl4736 //15 mg/kg Q4W MED|4736 " ,15 mg/kg Q4W MED|4736 ’/ I sPDL1 Concentrations (pg/mL) I : o BLQ (‘(37.1 pg/mL) |‘ '2'8' ' 5'6’ 1 '8'4' .112‘ 'iAb‘1'éé '1'é6"2'2'4' '2é'2' '2§3o'éos'3':§éléé4's§a'2 E0‘ Time (Day) 0 Complete sPD-L1 suppression at doses 2 15 mg/kg Q4W MEDI4736 o 1 subject each at 10 mg/kg Q4W and 15 mg/kg Q4W showed partial sPD-L1 suppression at some visits followed by complete suppression after repeated dosing o 1 subject following 15 mg/kg Q4W was not suppressed at Day 29 (limited data available) 0 Complete suppression observed with single-agent MED|4736 (Study 1108) at doses > 3 mg/kg Q2W SUBSTITUTE SHEET (RULE 26) 18/41 $8 >>~0 9:9: 2 9__;o__2 mﬁmazm .6 ..\ommA E nmammno :o_mmma%.o. Sn_n_m Boaeoo Ems me: 2.: can gm 2.: ﬁ_. _ _ _ _ _ om: 0% OE 2.: A_.

I | |- I I I - $8 - $8 - -8.‘ - $8 sag 952 3 Sag ov_a_>_ no sag 95.). E oo_.l I | I I | I | II |||| -|||| I SN - - O8 - - ST - Sm - - _ $.59 m_§a_»_ 3. _ S/mg o_v_\o5_ 3 _ _;>N€ ov_\_os_ o_.2 _ 02 8m 8m 2: a so: See :28 3 wm__..§n_ 35% _m%_>_E_ 8§Es_ .0_u_ ('|w/5d)uoneJ1uaouo3 L1-ads SUBSTITUTE SHEET (RULE 26) 19/41 CD4 Ki67+ and CD8_Ki67 proliferating cells: All MED|4736 doses combined 2000. CD4_Ki67 CD CP1108 MEDl4736 E 1750' "F MED|4736, Treme 1 mg/kg § 1500- H —'— MED|4730, Treme 3 mglkg "0 A 5 -l‘ MED|4736, Treme 10 mg/kg E E 1250- ; :, ‘'‘‘ "3 :' ‘i a E 1000- % 8 ; i, E 750' ,: § 500- ".

‘D :' 0- 250'; 0 CD8_Ki67 1750 - E, .. CP1108 MED|4736 1500 ' -°— MED|4736, Treme 1 mg/kg ? -0- MED|4736, Treme 3 mg/kg E E 1250 ' MED|4736, Treme 10 mg/kg 9 LU _ CD <3 1000 O) C E 8 750 ' E E‘ 500 ' § ': 250 ' o Monotonic increase in peak CD4+Ki67+ cells with increasing treme dose o Increase greater than observed with MED|4736 alone 0 CD8+ proliferative response is greater with combinations than that observed with MED|4736 alone SEM only provided for time points with n_>3 SUBSTITUTE SHEET (RULE 26) WO 2015/173267 PCT/EP2015/060523 /41 CD4+|COS+ cells and CD4+HLADR+ cells: All MEDI4736 doses combined CD4_|COS 300- *‘ CP1108 MEDI4736 é’ 250- "— MEDI4736, Treme 1 mg/kg § H ""' MEDI4736, Treme 3 mg/kg C0 A 200- ""' MEDI4736, Treme 10 mg/kg CD ‘it 150‘ CD C '1 \ Q E I," ‘.

E :' CD 0. 450 _ CD4_HLADR 40O_ -0- CP1108 MEDI4736 ~'— MEDI4736, Treme 1 mg/kg -+-- MEDI4736, Treme 3 mg/kg --+-- MEDI4736, Treme 10 mg/kg (.0 O‘! (D I O0 l\J (l\/lean:SEl\/I) G CRT!) © ‘.3 C.’ ‘.3 150- 1003 50- -50 Percent Change from Baseline 0 Minimal change was observed with MEDI4736 alone 0 All tested combination doses have a pattern distinguishable from MEDI4736 o Maximal increase observed with 10mg Treme SUBSTITUTE SHEET (RULE 26)ided for time points with n_>3 WO 2015/173267 PCT/EP2015/060523 21/41 FIG. 20 CD4+T effector cells: All MED|4736 doses combined CD4_T effector memory Percent Change from Baseline (Mean iSEM) "‘ CP1108 l\/lED|4736 ‘°— MEDI4736, Treme 1 mg/kg ""' MED|4736, Treme 3 mg/kg ""' MED|4736, Treme 10 mg/kg o Increase in CD4+ effector memory cells is greater with combination doses than that observed with MED|4736 alone SEM only provided for time points with n_>3 SUBSTITUTE SHEET (RULE 26) WO 2015/173267 PCT/EP2015/060523 22/41 FIG. 21 Treg cells: All MED|4736 doses combined T reg 175 ' 150 - 125 - 100 - (mean:SEM) Percent Change from Baseline "" CP1108 MED|4736 "— MED|4736, Treme 1 mg/kg ""' MED|4736, Treme 3 mg/kg ""' MED|4736, Treme 10 mg/kg o Treme dose-dependent increase in Treg ce|ls* *CD25hi CD127lo phenotype may also include some activated T cells 0 T Increase greater than observed with MEDl4736 alone SEM only provided for time points with n23 SUBSTITUTE SHEET (RULE 26) 23/41 Qmm; N .5 cozmsc E2E_2_E 522 am 20 mom .8228 mEmE©m§nm__>_ 5". 282, S .6 2o__.$2c E:E_:_E £22 8 .5 mom .2 8:202 382 82282 ._o.:._ .22 8 mo 8§__2_§_= 25 22.2228 mm_o2_o2_ 220 . .8c2_o2_ em; %-26__o._ $322 NVA £22 mEm_23 220 .6o:n_ov o._omz ©m§Qm__>_ ._ou_ émom %-22o__o2 E2 9 .22 £82 .5 coammaoa mwmmac 9 26 m2o=m_.2.__Eoom_c w%2_o2_V 28m %.>>o__e 2m + m2__mm8 E owmmgc msmsmmme £22 m_.2m__.mg swam: "m_2m2_m>m_ mmcogmmm . .a2Eo:om2 2§_nm__2 5.. :8 .5 50 20 mm 9.8 .888 ¢2eE.E2B2 5.. 28 5 2% .6 mm 38 .

Sam .22 2.: 2:2 .22 2.2 3.: .29 2% E2 .2: 2.: E2 E2 22 22 222.222 :9 3.22 .28 222 :9 .3 E :3 2%: 2.2 :22 .29 2.3 $22 $2 ER 222 .:.E 212 .32 2.2 2% .3: 2% as .32 2% $8 .2: 2.8 $2 $22 :2 :2 +3.2 .2.. .3: 22m 22: .3: 2.3 82. .3: 22m 8% .3: 2.2m 8:: 82% $22 $22 o_§_§m_ $2382 2.0.222 .2. .22 2.0229 .2. .22 2.02.22 2. .22 2_o..$e 2. .22 am 220 am 220 82822 8:20 238 22 2,8 2222 2 82282 828 m2§2§_om_2 >n_<2mEo2o_2 222282 w> 2o:<2_m__2oo "b_>_2o< _82__o NN .0_n_ SUBSTITUTE SHEET (RULE 26) 24/41 Eooav oE_.— mv ow mm vw 8 m o .8? Wu. -8- w Ezmc 22 1T . um: ..E>>§.:s_... IIIII II o w 235 82 1. - 8 ma E23 22 :T -2: H mtogoo 9:95 meat. /o/m Awxmmav mE_._ Emmi mE:. m... ow mm vw 8 m o ma ow mm xm 8 m o uoo_.-Wu. ol/... 0 +- -o2-Wuu -8- % v.|.|.§u|Io/ uomu % I or H... H...

| I I I I I I I I I I | I O W I I I l O M % :.;>~o es. LT % AU AU - m W -8 W mE>>3 22 + o W H \e; A % - mx no: .2: ( mtocoo BEES wee» 2: :.\>>vo 22 mtogoo 9:95 meat S 9 m 9., V E 8._oco=m mew: £3. mtocou co_E:_nEoo _3o_n_ ._%_Qm mm .O_u_ SUBSTITUTE SHEET (RULE 26) /41 N N m m m N E a I o::2.om:2_>_ m N w 2 2 mm mm 8 - S + Eoozaéom m:2_>_ m N : 2 t 2 mm mm In : + amcozavcow €22 E E 8 E E m: at we I: oS_>_:§2_>_ 8 aw 2 8 Na mm 3 o E 5 2333 .5 3, _ - __ M _ _ _. _ _ H _ 4---. _ _ +|L _ _ - 3 o:+§om:2_>_ I _ .& + ;Noo:§ooN m:2_>_ I- _ . : + amoozéoom 25:). II - w G 252 + ;82s_ I SUBSTITUTE SHEET (RULE 26) 8§om__>_ as2§o_\,_ 9 2 9 m 2, _ Hm _um._o_._o:m mEm._._. £_>> mtosoo cozmcseoo :_ m_m_< m5uA u2m_mm_ .5 E20 .6 wE_._. Emeesm >_m._mm E ..U_..._ 26/41 Emmi mE_._ Emmi mE:. mm pm Nm mm m._ mm m m mm pm mm mm m__ w o mm 52. w $2- w 2 8 m. ../r 8 w, | | | | | | | I | | | ll w I I | | | | | | | ll m W0 m . O m E>>No2s_+ -3 w E35 oN_>_+ -8 m E>>82_>_... -2: W E23 857.. -2: W % % @050 38 Ease mmEmm_>_ ( E200 Em Ememm mﬂsmmz ( Emmi mE_._. Emmi mE:. mm ow mm mm 8 mm o mm. pm mm mm m__ m o % $2.0 87 m -8- m m, ----- O m --- - O m w B oE.\>>v0m:>_uT .8 W mEa.o2_>_ :T \b/ 8 W m._.\>>vOm_‘_>_lT W _.._.\>>¢Oo:>_ 1?. 2:. W E23 ms... -2: m W 2.200 23 Emea mm§mm_>_ W mteom Ea 93:2 mm§mm_>_ >>NO 2 2,3 om m> 2 m> 2 E mm._o_Em mm:._mm_s_ £5, €28 8_§__eEm "mHo_n_ _m%m mm .0_u_ SUBSTITUTE SHEET (RULE 26) 27/41 3? $oe_>_ I . I mE+§o8_2 nil: o:+§c.:_>_ I 2:+§c2_>_ | mE+§oe_>_ | V F .0, N. 9 F m w 2 3 N N m N N m o m 8 mm m w v v @ mm a 2 mm NF . ._ _.. . I ._4_.+_II.__. it _______i__;m" BN0 2 m> >30 om w> 3 9., S E 8§_2a mE._B_>_ 55, 2.28 .s_§_._e8 m_...._< m._OuA ne.m_mm_ .5 E30 .5 mE_.r ucmecsm amhmm om .0_n_ o.o -~o -vo -co -oo + N¢Oo:>_ 2: + Eoomz E... + ice: 2: + §o2s_ 2: + >éOo:>_ v_w__ E ﬂomzsm .6 gm SUBSTITUTE SHEET (RULE 26) 28/41 Aﬁmoémec.

N." mm 8 E 3 NF 0 o 3 2. 8 E S w o _ _ _ _ _ _ _ _ _ _ _ _ _ $2- .8: MI)! 00/ '. |oml W lomu ‘ M P nluw ;4.%3../ e \ lru\..‘I1§’./o¢1.r////Am/. n... ,//o W - ..... -- O -.\n.‘v LU g m.

\ RT. m \w .. 8 M -8 :.:$us.= U W m._.\>>NOowS_L1| Ioo—. 2: E>>N0o:>_:mu Ease 82+ E55 o~_>_:? oE>>§2_>_... §\me2-3omzV E>>§2_>_.? E>a.o2_>_+ mtocoo swam §.._2_.o:o_2 8§Bs_ 9 cozsseoo "a_>_s< _8_=__o R ..0_u_ (%) euueseg u1oJ,t eﬁueuo SUBSTITUTE SHEET (RULE 26) 29/41 , N W N N W W III 3 N N N N N N 2 : N N N N N N N N |Nﬁ+§oN§_ _ _ N N N N ll E;No2_>_ N N N N N : : :|N¢§cN§_ E E NN E E N: N: NN_n|2s_>_:_,NoN§_ _ N N N N N N? N_|E§.oN§_ ENE NE_._. NE. E m_._omE:m No u ENE mE_._. v_N_._ E NENENN .5 N, No NN NN NN N_N N_N NN N.N E N _ _ _ NN _ 1. _ _ Z. _ _ -N.N _ _ _ _ _ . . _ _ I . _ _ _ _ _ vo " _ _ -N.N H W _ -. _ L. _ L _ NN .|.|._|. 7 _ . _ N:§aNN_2I.| uwo oE+3.Nom:>_| -w.o _ N:;No2_>_ II Ntioez I _ _.t>>v0o~_>_ II . E352 I E>>N0o:>_| -3 2s_>_ENo2_>_ | - E NNEN_m_s_ >%_N_%8_>_ .N> Ntocoo :o_E_3Eoo ngoemw 5 N_m_< m._0nA c9m_Nm 05 E20 .5 oE_._. Emeesm >_.o._N.m mm .0_..._ SUBSTITUTE SHEET (RULE 26) /41 E23 22 1».

E23 251"? E23 82 AT CE23 22 II.

E23 .u,§_..T E23 2% .0. E23 22 41.

E23 2.2.? E23 22 .? E23 22 L1! A9_mo2cmE_._ mm 2m 8 m o _ _ _ _ 2:- 0! I0! in..|..ﬂ//?w/ ;. IIII I IH..L._._..lLun\wIl\1\\Ilnp ,ﬁs.v\ » \\ :8 4 -22 oc__mwmm Ea: $220 oN_m ._oE:._. mm .O_n_ (%) euneseg tum; eﬁueqg SUBSTITUTE SHEET (RULE 26) 31/41 Awxoaav mE_._ §_.%¢z 3-8-9:? 2 - 3%; 32 E9 0%: (%) euueseg LuoJ; eﬁueug om .®_..._ 2 m Amxomé ¢E_._. m_¢ ow mm v_N . // I o L‘? m.:>>NO o F _>_ nxl _,.:>>NO 2: LT m._.\>>vO oN_>_:<: _::>>vO oN_>_ Io: oE>>3 32+ .E>2.a 22 non E.\>>vO 2s_... 2,_=§z :-E-w_§_oo 52% 858 CD I C) LO -2: (%) auueseg um; aﬁueqg SUBSTITUTE SHEET (RULE 26) Emmav mE_._. ww ow mm E S I o L‘? CD E23 0 :2 .f - 8. Ease 22 .? Ezec 82+ OE23 22 .? E23 32... §___8n_ 3.2 9.? 2 - odmzv %%_=m ¢>=_§ 3-2 as E8 2.as_ SE8 .O_n_ I C) LO -2: (%) euneseg um; eﬁueqo SUBSTITUTE SHEET (RULE 26) 33/41 Emmi mE_._. w_¢ o_v N_m NN w__ m o -87 w P. ./ -8- m T .......... LY -8 W M oEE.o£_>_+ -2: M mtogoo 9_ae2 mEm._._. ( E35 mE_._ Emmi me: 3 2. mm E E o me. ow mm wm 8 m o _ _ _ _ _ I©©_‘u nd I©©—... nUJu W o/r - W ...D 4 4 o - 5 M a now. W... O‘|I?|.|.|O/ -8- W... m w m:>>~o2_>_.T 9 .1 III: I 9 E23 m§_...u I I o m Ezao 22 \./ o W n E23 22 .1 1.. m.

«E30 oN_>_|T W 9 m:>>52_>_... -8 J Ease oNs_..: -% 0,.

HM E23 22 uol ,m.\ -2: -2: mtogoo 9_\mEm oE9._. mtocoo BEEF mEm._._. %m_§.m 2,_..%mz 3-8 mm .0_n_ SUBSTITUTE SHEET (RULE 26) 34/41 A235 mE_._ mv ow mm vw m__ m o -87 0 m3m__m>m Emu Emewmmmmm M mmmmwﬁ oc__om2-..m8 £_>> uom. % €28 2,3 9.352 m.E_Bs_ n. c_ wﬁmasm 2,32. _,._-n_n_ oz IIIIIIIII I I go we Du Eéa 82 .7 -8 r:>>¢0 as IT - 2: ‘W @950 23 3358 8:_B_>_ P Emmi oeﬁ Emmi me.» an 3 mm .& S w o mv ow N.» XN o__ m 9 _ _ _ _ _ _ I —.u 0 I T nU.:u wu. w I©©n w I©®n m; I I | O % I l O U Cu m:>a.o2_>_.T -8 m -8 m oE.\>>vOm:>_uT E>>§2_>_H -2: _.._.\>>vOm_‘_>_I..I uoow \o/M E>>§2_>_ W @200 Ea 2352 8§om__>_ mtgoo Ea 93:2 8:._Bs_ 2...o_§.m éamz 3-2 mm .®_n_ SUBSTITUTE SHEET (RULE 26) /41 Emmi mE_._. (%) euueseg um; eﬁueqg SUBSTITUTE SHEET (RULE 26) aw ow mm vm on M_w o - 2:- Cl! C y II (‘.1 .. . . 9 9 I o u 0 a I o/ 1! o JIa,I1q4.n..» 4./.

I I I | ||o,|| - ... III. o . 0 :1.I.u1 -.unrrT.l!T T E. 2 5-8 lul A\ . - 3-2 Jwl I cow + :9 |.| m:__ommm E0... mmcmco mum ._oE:._. 36/41 m.:>>NO 22 ..E>a.o 8.2 ..E>>3 m :2 E>a.a 2.2 E.\>>vO 22 E.\>>NO 2.5. o E.\>>vO m §_ E.\>>vO as _,._.\>>vO m :2 E.\>>vO 22 Emmi mE_._. 9. N». E S —$ mﬁmssm m>__\mmmz _.._-m_n_ - m:__mmmm E9: @920 ®N_m ._oE:._. mam .O_u_ (%) euuasea um; eﬁueug SUBSTITUTE SHEET (RULE 26) 37/41 Eamc es. _.._.\>>mO es.

Ezec oN_>_ oﬁsqo .:_>_ E.\>>v0 om: E.\>>vO m§_ mﬁmssm m>=_mon_ _\n_-m_n_ - mémmmm E0: @920 mum 5:5... 0% .0_u_ (0/0) eunesea um; eﬁueug SUBSTITUTE SHEET (RULE 26) 38/41 m.:>>NG es.

E.\>>m0 22 «:23 82 oE>>3 22 22,3 22 E.\>>vO 82 _.:>>.nO £2 E.\>>vO ms.

Emmi ¢E_._. mﬁmssw <2 _..._-n_n_ .. m=__mmmm Eoc mmcmzo mum. ._oE:._. 9% .0_u_ (%) euueseg um; eﬁueuo SUBSTITUTE SHEET (RULE 26) 39/41 mczaa 22 E.\>>m0 22 m._.\>>¢O 82 oE§o 22 350 ..,§_ E.\>>vO as.

Ease es.

E.\>>vO 22 E.\>>v0 o_,_>_ E.\>>vO as IEEEDE o:__mmmm E9: mum ._oE:._. :_ mmcmgo "mam mm .O_n_ 2:- ca "? G LO 2: (%) euuaseg u1oJ;e6ueL|31seg SUBSTITUTE SHEET (RULE 26) F I G. 36 Best Change in Tumor size from Baseline 40/41 Z PD-L1+ R PD-L1- El PD-L1na 3 3 L0 % euneseg U.|OJ,l6‘5UBL|()1S9Q $ L0 100 -100 SUBSTITUTE SHEET (RULE 26) 41/41 S__m=_:_ Em§me._. 8% £8 Q3 N8 8m 8m EN we 5 F 8 o _ _ _ _ _ _ _ _ CE oa %%_a E $8 53 o >25 .5 A mtaao 22 _U E.\>>NO 22 E m.:>>vO as. BH_HHE_ o_.._.\>>vO £2 E m.:>>vO 92 w\\\\§ _,._.\>>vO oN_>_ E m._.\>>vO o_‘_>_ m.§.~.§ E.\>>vO m:>_ E E.\>>vO 22 _:_.\>>vO 22 . \_ A. ., ,/4_ 49494o49494o4040404949494¢«o«¢4¢«o4o4¢4¢4¢4« A 3.~.«.~.«...w.«.«.«.u 4 . , o A u.munu.»m.Ks.4.ans.v».».vvv».vvv».£».~.vvv£.» wasa.mamma«Wum«wanmm»ummamww«mmmammwwwwwwwwww.wwwwwwwwwwwuwwww«mwwwwuﬂ . / A A «X L A—/// / // /// /// //V//C /// /// /// /// /// /// /// /// xxgxx / %->>o__ou_ B cozmso Em .®_u_ SUBSTITUTE SHEET (RULE 26) 276481 /3

Claims

CLAIMS:

1. MEDl4736 or an antigen-binding fragment thereofand tremelimumab or an antigen-binding fragment for use in a method of treating non-small cell lung carcinoma (NSCLC) in a human patient, the method comprising administering MEDl4736 or an antigen-binding fragment thereofand tremelimumab or an antigen- binding fragment thereof to the patient; wherein the dose of MEDl4736 or antigen-binding fragment thereof is 20-fold the dose of tremelimumab or antigen-binding fragment thereof; wherein the MEDl4736 or antigen-binding fragment thereof is administered 1 hour following administration of the tremelimumab or antigen-binding fragment thereof; and wherein the MEDl4736 or antigen-binding fragment thereof and the tremelimumab or an antigen-binding fragment thereof are administered every 4 weeks for at most 16 weeks, wherein the dose of MEDl4736 or antigen-binding fragment thereof is 1500 mg and the dose of tremelimumab or antigen-binding fragment thereof is 75 mg.

2. The MEDl4736 or an antigen-binding fragment thereof and tremelimumab or an antigen-binding fragment for use of claim 1, wherein the total length of treatment is 52 weeks.

3. The MEDl4736 or an antigen-binding fragment thereof and tremelimumab or an antigen-binding fragment for use of claim 1, wherein the NSCLC is refractory to at least one chemotherapeutic agent priorto the administration of MEDl4736 or antigen-binding fragment thereof and tremelimumab or antigen-binding fragment thereof.

4. The MEDl4736 or an antigen-binding fragment thereof and tremelimumab or an antigen-binding fragment for use of claim 3, wherein the chemotherapeutic agent is Vemurafenib, Erlotinib, Afatinib, Cetuximab, Carboplatin, Bevacizumab, Erlotinib, Gefitinib, or Pemetrexed.

5. The MEDl4736 or an antigen-binding fragment thereof and tremelimumab or an antigen-binding fragment for use of claim 1, wherein the patient is immunotherapy-naive prior to the administration of MEDl4736 or antigen-binding fragment thereof and tremelimumab or antigen-binding fragment thereof.

6. The MEDl4736 or an antigen-binding fragment thereof and tremelimumab or an antigen-binding fragment for use of claim 1, wherein the administration of MEDl4736 or antigen-binding fragment thereof is by intravenous infusion.

7. The MEDl4736 or an antigen-binding fragment thereof and tremelimumab or an antigen-binding fragment for use of claim 1, wherein the administration of tremelimumab or antigen-binding fragment thereof is by intravenous infusion.

8. The MEDl4736 or an antigen-binding fragment thereof and tremelimumab or an antigen-binding fragment for use of claim 1, wherein the administration of MEDl4736 or antigen-binding fragment thereof and tremelimumab or antigen-binding fragment thereof reduce tumor size by at least 10% relative to tumor size as measured priorto the administration of MEDl4736 or antigen-binding fragment thereof and tremelimumab or antigen-binding fragment thereof.

9. The MEDl4736 or an antigen-binding fragment thereof and tremelimumab or an antigen-binding fragment for use of claim 1, wherein the administration of MEDl4736 or antigen-binding fragment thereof and tremelimumab or antigen-binding 50 276481 /3 fragment thereof reduce tumor size by at least 25% or 50% relative to tumor size as measured priorto the administration of MEDl4736 or antigen-binding fragment thereof and tremelimumab or antigen-binding fragment thereof.

10. The MEDl4736 or an antigen-binding fragment thereof and tremelimumab or an antigen-binding fragment for use of claim 1, wherein the human patient has locally advanced unresectable or metastatic NSCLC.

11. The MEDl4736 or an antigen-binding fragment thereof and tremelimumab or an antigen-binding fragment for use of claim 10, wherein the NSCLC is squamous or non-squamous. 51