IL154544A - T CELL RECEPTOR Vbeta-Dbeta-Jbeta SEQUENCE AND METHODS FOR ITS DETECTION - Google Patents

Description

154544 |7'ji I 453349 IH T Jioa to νβ-ϋβ-Ιβ ^ip ηιη T CELL RECEPTOR Υβ-ϋβ-Ιβ SEQUENCE BAYLOR COLLEGE OF MEDICINE C:48043 154544/3 1. Field of the Invention The present invention relates generally to the field of treatment of autoimmune disease, such as multiple sclerosis (MS). More particularly, it concerns a T-cell receptor sequence found in some MS patients, and methods for its detection. 2. Description of Related Art In humans and other mammals, T cell receptors are found on T cells. T cell receptors comprise a and β chains, with β chains comprising the following regions from N-terminus to C- terminus: νβ-ϋβ-Ιβ-Οβ. T cell receptors naturally vary in the νβ-ϋβ-Ιβ regions.

When an antigen is presented to the T cells by an antigen-presenting cell (APC), a T cell receptor with- variable regions (including VP-DP-jp) that so happen' to recognize the antigen binds to the antigen on the APC. The T cell bearing the T cell receptor then undergoes activation (clonal expansion).

The pathogenesis of a number of autoimmune diseases is believed to lie in autoimmune T cell responses to antigens presented normally by the organism. An example of such a disease is multiple sclerosis (MS), which is generally held to arise in T cell responses to myelin antigens, in particular myelin basic protein (MBP). MBP-reactive T cells are found to undergo in vivo activation, and occur at a higher precursor frequency in blood and cerebrospinal fluid in patients with MS as opposed to control individuals. These MBP-reactive T cells produce Thl cytokines, e.g. IL-2, TNF, and γ-inlerferon. These Thl cytokines facilitate migration of inflammatory cells into the central nervous system and exacerbate myelin-destructive inflammatory responses in MS.

A number of regulatory mechanisms can be made use of in the treatment of MS. One such is vaccination with one or more of the limited number of T cell membrane-associated peptides with extracellular domains. Vandenbark, U.S. Patent 5,614,192, discloses treatment of - - autoimmune diseases by the use of immunogenic T cell receptor peptides of 15 to 30 amino acids comprising at least part of the second complementarity determining region (CDR2) of the T cell receptor. A copending U. S. Patent Application by Zhang (60/099,102), now published as US 6,303,314 and PCT Publication WO 00/50641, discloses treatment of autoimmune diseases by use of immunogenic T cell receptor peptides in combination with immunogenic T cell activation marker peptides.

One area in which vaccination with T cell receptor peptides can be improved is by determining which, if any, common motifs are found in the T cell receptors of a patient with an autoimmune disease such as MS. If such motifs are found, then the patient can be vaccinated with peptides identical to the motifs, in order to facilitate treatment.

Therefore, it is desirable to have the amino acid sequences of common motifs found in the T cell receptors of patients with autoimmune diseases. It is also desirable to be able to readily detect such motifs in a patient sample by a convenient method, such as PCR. In addition, it is desirable to use peptides identical to the detected motifs to treat a patient with the autoimmune disease.

The present invention discloses such a common motif found in the T cell receptors of a subset ofl3. I T cells, the"LGRAGLTY motif, which has the amino acid sequence Lue Gly Arg Ala Gly Leu Thr Tyr (SEQ ID NO: 3), as well as a method for its ready detection by PCR. This motif is found in some T cell receptors of some T cells that recognize amino acids 83-99 of MBP (hereinafter"MBP83-99"). The motif in the context of this subset of VBl 3. 1 T cells may hereinafter be referred to as"VBl 3. 1-LGRAGLTY.' eptides identical to the motif can be used to vaccinate patients in order to treat or prevent autoimmune diseases with which Vu 13. 1-LGRAGLTY is associated. One such autoimmune disease is MS.

Hong et al., Journal of Immunology, 163(6):3530-3538, 1999 discloses a peptide of 32 amino acids in length, but does not teach or suggest a peptide of twenty amino acids or less. Furthermore, Hong et al. does not provide the skilled person with any motivation to make or use the peptides of the invention in a multiple sclerosis vaccine, or any expectation that such a vaccine would be effective.

SUMMARY OF THE INVENTION In one embodiment, the present invention is directed to a peptide of from 8 to approximately 32 amino acids which consists of amino acids 2-21 of SEQ ID NO: 32 .

In another embodiment, the present invention is directed to a peptide of from 8 to approximately 32 amino acids which consists of the sequence of SEQ ID NO: 3.

ADDITIONAL ASPECTS OF THE APPLICATION In one embodiment, the present invention is directed to an oligonucleotide from about 15 to 30 nucleotides in length which comprises at least 10 contiguous nucleotides of SEQ ID NO : 1, or a sequence complementary thereto or derived therefrom. Even more preferable is an oligonucleotide, of about 15 to 30 nucleotides in length, which comprises 1 1, 12, 13,14, 15,16, 17,18, 19,20, 21,22, or 23 contiguous nucleotides of SEQ ID NO:, or a sequence complementary thereto. Most preferable is an oligonucleotide, of about 15 to 30 nucleotides in length, which comprises the nucleotide sequence of SEQ ID NO: l , or the .sequence complementary thereto.

In a series of further embodiments, the oligonucleotide can be used in amplification or detection of a nucleic acid sequence found in Vp i3.1-LGRAGLTY T cells. In one subseries of such embodiments, the oligonucleotide is used in a primer pair, the primer pair comprising or derived from: (a) a first primer which is an oligonucleotide is from about 15 to 30 nucleotides in length and comprises at least 10 contiguous nucleotides of SEQ ID NO: l , or a sequence complementary thereto; and (b) a second primer which is an oligonucleotide of about 15 and 30 nucleotides in length that does not comprise the sequence (a), and said second primer sequence can be found in the region from νβ to jp of the Vpi3.1 gene (SEQ ID NO: 2) in T cell receptor T cells, wherein the sequences of (a) and (b) are not found on the same strand of the T cell receptor gene.

Preferably said first primer is an oligonucleotide, of about 15 to 30 nucleotides in length, which comprises 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, or 23 contiguous nucleotides of SEQ ID NO: l, or a sequence complementary thereto. Most preferable is an oligonucleotide, of about 15 to 30 nucleotides in length, which comprises the nucleotide sequence of SEQ ID NO: l, or the sequence complementary thereto.

In another subseries of such embodiments, the oligonucleotide is used as an oligonucleotide probe, the oligonucleotide probe comprising: (a) an oligonucleotide from about 15 to 30 nucleotides in length and comprises at least 10 contiguous nucleotides of SEQ ID NO: l, or a sequence complementary thereto; and (b) a labeling moiety.

Preferably, the oligonucleotide, is about 15 to 30 nucleotides in length, and comprises 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, or 23 contiguous nucleotides of SEQ ID NO: l, or a sequence complementary thereto. Most preferable is an oligonucleotide, of about 15 to 30 nucleotides in length, which comprises the nucleotide sequence of SEQ ID NO: l, or the sequence complementary thereto. The labeling moiety is preferably selected from j2P or digoxingenin.

In another embodiment, the present invention is directed to a method of detecting MBP83-99 VJ313.1 T cells expressing a LGRAGLTY motif, comprising: (i) obtaining a nucleic acid sample from MBP83-99 Vpi3.1 T cells; (ii) contacting the nucleic acid sample with a primer pair selected or derived from: (a) a first primer comprising an oligonucleotide of about 15 to 30 nucleotides in length and comprises at least 10 contiguous nucleotides of SEQ ID NO:l, or a sequence complementary thereto or derived therefrom; and (b) a second primer comprising and oligonucleotide of about 15 and 30 nucleotides in length that does not comprise the sequence of (a) and is found in the region from Vp to jp of the Vpl3.1 gene in Vpi3.1 T cells (SEQ ID NO:2), wherein the sequences of (a) and (b) are not found on the same strand of the Vpl3.1 gene; and, (iii) detecting the presence of the nucleic acid encoding the LGRAGLTY motif.

Preferably the first primer is an oligonucleotide, of about 15 to 30 nucleotides in length, which comprises 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, or 23 contiguous nucleotides of SEQ ID NO:l, or a sequence complementary thereto. Most preferable is an oligonucleotide, of about 15 to 30 nucleotides in length, which comprises the nucleotide sequence of SEQ ID NO:l, or the sequence complementary thereto.

Another embodiment of the present invention is directed to peptides, of from 8 to' approximately 45 amino acid residues in length, comprising the LGRAGLTY motif (i.e. comprising the sequence of SEQ ID NO: 3). In various aspects of this embodiment, of the invention, the peptide comprises 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 or 32 contiguous arnino acids of the sequence of SEQ ID NO:32. Preferably the peptide sequence is SEQ ID NO:3 or the sequence is residues 2-21 of SEQ ID NO:32. Most preferably the peptide sequences is residues 2-21 of SEQ ID NO:32.

In yet another embodiment, the present invention is directed to a method of treating an autoimmune disease, comprising: (a) obtaining MBP83-99 Vpi3.1 T cells from a human; (b) detecting the presence of a nucleic acid encoding the LGRAGLTY motif by the method described above; and, if the nucleic acid is detected, (c) administering one or more peptides of from 9 to approximately 45 amino acid residues in length, each comprising the LGRAGLTY motif, to the human. In various aspects of this embodiment, of the invention, the peptides a In a still further embodiment, the present invention is directed to a method of monitoring an autoimmune disease, comprising: (a) obtaining MBP83-99 νβ13.1 T cells from a human; (b) detecting the presence of a nucleic acid encoding the LGRAGLTY motif by the method described above; and, if the nucleic acid is detected, (c) quantifying the nucleic acid.

BRIEF DESCRIPTION OF THE DRAWINGS The following drawings form part of the present specification and are included to further demonstrate certain aspects of the present invention. The invention may be better understood by reference to one or more of these drawings in combination with the detailed description of specific embodiments presented herein.

Figure 1 shows the experimental procedure for cloning and sequencing of PBMC-derived PCR products. cDNA derived from PBMC specimens were amplified by the 5'νβ13.1 primer and the 3Ίβ primer from four PBMC specimens positive for the expression of the LGRAGLTY motif were ligated into the TA cloning vector pCR2.1 and transformed into E. coli. Plasmid DNA was screened by PCR with a Ml 3 primer and the LGRAGLTY-specific primer. The positive plasmids that showed visible amplification by PCR were sequenced for νβϋβΐβ sequences with a νβ13.1 primer.

Figure 2 shows reactivity patterns of two MBP83-99 T cell clones to analog peptides with single alanine substitutions. Two pairs of MBP83-99 T cell clones that exhibited identical νβ13.1 rearrangements (for MS7-E2.6 and MS27-C3.1) and a similar Va-Ja junctional sequence (for MS7-E2.6 and MS7-E3.1) were examined for reactivity to a panel of alanine substituted peptides in [3H]-thymidine incorporation assays. A mouse fibroblast cell line - 6 - expressing DRB1*1501 was used as a source of antigen-presenting cells. The proliferative responses of the clones to each analog peptide were measured after 72 hours and the results are presented as CPM incorporated. The shaded boxes represent > 50% decrease in the proliferation of the T cell clones in response to analog peptides.

Figure 3 shows cross-examination of the specificity of CDR3 oligonucleotides with original and unrelated T cell clones. A set of oligonucleotides specific for TCR VDJ region of were examined for their specificity in detecting known target DNA sequences present in original MBP83-99 T cell clones as well as in unrelated MBP83-99 T cell clones derived from the same and different individuals. PCR reactions using CDR3-specific oligonucleotides as the forward primers and a 3'-Cp primer as the reverse primer performed. Solid boxes represent positive detection of DNA sequences present in original T cell clones or T cell clone(s) sharing the same CDR3 sequences. All primers were also examined for their binding to DNA products of randomly selected T cell clones that had unrelated CDR3 sequences (shaded boxes).

Figure 4 shows detection of target DNA sequence complementary to motif Vpi3.1-LGRAGLTY in randomly selected PBMC specimens derived from patients with MS. cDNA prepared from PBMC specimens from randomly selected MS patients (n = 48) were first amplified in RT-PCR using a 5'-Vpi3.1 specific primer and a 3'-Cp primer. The amplified PCR products were then hybridized subsequently with a digoxigenin-labeled oligonucleotide probe specific for the LGRAGLTY motif. The original MBP83-99 clone (MS7-E2.6) and an unrelated T cell clone (MS32-B9.8) were used as positive and negative controls, respectively. MS-7 and MS-27 were the original PBMC specimens from which clone MS7-E2.6 (MS-7 in Table 1) and clone MS27-C3.1 (MS-27 in Table 1) were derived. Asterisks indicate positive expression of DRB1*1501.

Figure 5 shows detection of the Vpi 3.1 -LGRAGLTY motif in randomly selected PBMC specimens derived from normal subjects. PBMC specimens obtained from 20 normal subjects (NS) were analyzed under the same condition as described in the Figure 4 legend. The original clone (MS7-E2.6) and an unrelated T cell clone (MS32-B9.8) were used as positive and negative controls, respectively. Asterisks indicate positive expression of DRB1*1501.

Figure 6 shows semi-quantitative comparison of the expression of the LGRAGLTY motif in PBMC specimens derived from MS patients and normal subjects. The expression of motif Vpi3.1-LGRAGLTY was analyzed by semi-quantitative PCR relative to the CP - 7 - expression in each cDNA derived from PBMC of MS and normal individuals. The relative expression level was calculated as (expression of the LGRAGLTY motif/Expression of Οβ) x 100%.

Figure 7 shows detection of the Vpi3.1-LGRAGLTY motif in short-term MBP83-99 T cell lines derived from patients with MS. A panel of independent short-term MBP83-99 T cell lines were generated from five patients with MS using a synthetic 83-99 peptide of MBP. All these T cell lines were confirmed for their specific reactivity to MBP83-99 peptide (CPM in response to MBP83-99 / control CPM > 5). cDNA products were amplified using a 5'-Vpi3.1 specific primer and a 3'-C primer in PCR. The amplified PCR products were hybridized subsequently with a digoxigenin-labeled oligonucleotide probe corresponding to the Vpl3.1-LGRAGLTY motif in a Southern blot analysis. cDNA products derived from the original MBP83-99 clone (MS7-E2.6) and a unrelated T cell clone (MS32-B9.8) were used as positive and negative controls, respectively.

Figure 8 shows the proliferative responses of PBMCs (peripheral blood mononuclear cells) to the immunizing MBP-reactive T cell clones and the TCR peptides in relationship to the frequency of MBP-reactive T cells in immunized MS patients. 8A: The proliferative responses of PBMCs obtained from two immunized patients are expressed as stimulation indices, which were defined as follows. Counts/minute (CPM) of PBMC cultured with irradiated immunizing MBP-reactive T cell clones expressing the common CDR3 sequence (motif-positive T cell-clones, MS7-D2.2 and MS27-D4.4)/the sum of CPM of PBMC cultured alone and CPM of irradiated T cells cultured alone. The proliferative response to the motif-positive peptide (amino acids 2-21 of SEQ ID NO: 32) and a control TCR peptide (amino acids 1-20 of SEQ ID NO: 48) were determined in proliferation assays in which PBMCs were cultured at 100,000 cells/well with the TCR peptides (20 μg/ml), respectively, for 5 days. All experiments were performed at two time points corresponding to baseline (before) and 2 months after the fourth vaccination (after). 8B: The precursor frequency of T cells specific for MBP was estimated at.the same time points. NS = normal subjects.

Figure 9 shows the estimated precursor frequency of B cells producing anti-idiotypic antibodies to the TCR peptide in PBMCs of immunized patients. PBMCs were obtained from two immunized MS patients and two randomly selected healthy individuals that were not immunized. Cells were cultured in the presence of supematants derived from an EBV- producing cell line and Cyclosporin A (Sandoz, Basel, Switzerland). All growth-positive wells were screened for the presence of antibodies reactive to the motif-positive TCR peptide and the control TCR peptide in ELISA. The precursor frequency of B cells producing anti-idiotypic antibodies to the TCR peptide was estimated by dividing the number of positive wells by the total number of PBMC initially plated.

Description of Illustrative Embodiments To aid in understanding the invention, several terms are defined below.

"PCR" means the polymerase chain reaction, for example, as generally described in U.S. Patent No. 4,683,202 (issued July 28, 1987 to Mullins), which is incorporated herein by reference. PCR is an amplification technique wherein selected oligonucleotides, or primers, are hybridized to nucleic acid templates in the presence of a polymerization agent (such as polymerase) and four nucleotide triphosphates, and extension products are formed from the primers. These products are then denatured and used as templates in a cycling reaction that amplifies the number and amount of existing nucleic acids to facilitate their subsequent detection. A variety of PCR techniques are available and may be used with the methods according to the invention.

"Primer" means an oligonucleotide, whether natural or synthetic, capable of acting as a point of initiation of DNA synthesis complementary to a specific DNA sequence on a template molecule.

"Derived from," in the context of the term "primer(s) or probe(s) derived from,'" means that the primer or probe is not limited to the nucleotide sequence(s) listed, but also includes variations in the listed nucleotide sequence(s) including nucleotide additions, deletions, or substitutions to the extent that the variations to the listed sequence(s) retain the ability to act as a primer in the detection of T cell receptor DNA encoding the V i j . l -LGRAGLTY sequence, i.e. Lue Gly Arg Ala Gly Leu Thr Tyr (SEQ ID NO: 3).

"Immunogenic," when used to describe a peptide, means the peptide is able to induce an immune response, either T cell mediated, antibody, or both. "Antigenic" means the peptide can be recognized in a free form by antibodies and in the context of MHC molecules in the case of antigen-specific T cells.

"Immune-related disease" means a disease in which the immune system is involved in the pathogenesis of the disease. A subset of immune-related diseases are autoimmune diseases.

Autoimmune diseases contemplated by the present invention include, but are not limited to, rheumatoid arthritis, myasthenia gravis, multiple sclerosis, systemic lupus erythematosus, autoimmune thyroiditis (Hashimoto's thyroiditis), Graves' disease, inflammatory bowel disease, autoimmune uveoretinitis, polymyositis, and certain types of diabetes. In view of the present disclosure, one skilled in the art can readily perceive other autoimmune diseases treatable by the compositions and methods of the present invention. "T cell mediated disease" means a disease brought about in an organism as a result of T cells recognizing peptides normally found in the organism.

"Treatment" or "treating," when referring to protection of an animal from a disease, means preventing, suppressing, or repressing the disease. Preventing the disease involves administering a composition of the present invention to an animal prior to induction of the disease. Suppressing the disease involves administering a composition of the present invention to an animal after induction of the disease but before its clinical appearance. Repressing the disease involves administering a composition of the present invention to an animal after clinical appearance of the disease. It will be appreciated that in human medicine it cannot always be known when in the course of disease induction a composition of the present invention will be administered.

In one aspect, the present invention is directed to a primer pair comprising the sequence of or derived from: (a) a first primer which is an oligonucleotide of about 15 to 30 nucleotides in length, comprising at least 10 contiguous nucleotides of SEQ ID NO: 1, or the nucleic acid sequence complementary thereto; and (b) a second primer which is an oligonucleotide of about 15 and 30 nucleotides in length that does not comprise a sequence of (a) and is found in the region from νβ to Ιβ of the T cell receptor gene in νβ13.1 T cells, wherein the sequences of (a) and (b) are not found on the same strand of the T cell receptor gene.

Preferably, said first primer is an oligonucleotide, of about 15 to 30 nucleotides in length, which comprises 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, or 23 contiguous nucleotides of SEQ ID NO:, or a sequence complementary thereto. Most preferable is an oligonucleotide, of - 10 - about 15 to 30 nucleotides in length, which comprises the nucleotide sequence of SEQ ID NO:l, or the sequence complementary thereto.

The primers according to the invention are designed to amplify a fragment of a gene encoding T cell receptor of human νβ13.1 T cells, the fragment comprising an amino acid motif Lue Gly Arg Ala Gly Leu Thr Tyr (SEQ ID NO: 3). The gene from Vpl3.1 T cells encoding the T cell receptor comprising the LGRAGLTY motif has been submitted to GenBank, accession number AFl 17132. The sequence of the gene from νβ13.1 T cells encoding the T cell receptor comprising the LGRAGLTY motif is given herein as SEQ ID NO: 2. In the method according to the invention, a fragment of about 400 bp of the T cell receptor gene from Vpl3.1 T cells is amplified using two primers, wherein the first primer is in the CDR3 region, and the second primer is in the CP region. The Vp-DP-jp region of the T cell receptor gene will be between the CDR3 and CP regions, inclusive. In a preferred embodiment, the primers are the primer pair described above.

Primers according to the invention also include oligonucleotides that are derived from the primers (a) - (b). A sequence is derived from a primer (a) or (b) if it has or contains substantially the same sequence as one of the primers and retains the ability to selectively anneal to approximately the same CDR3 or CP region of the Vp-DP-jp region of the T cell receptor gene from V l3.1 T cells as described above. More particularly, the primer may differ from a primer (a) or (b) in length or by the kind of nucleic acid in one or more positions along the sequence, as long as it retains selectivity for the identified regions of the Vp-Dp-Jp region of the T cell receptor gene from Vpi3.1 T cells. For example, the primer may be an oligonucleotide having at least 15 nucleotides, wherein the 15 nucleotides are identical with a series of 15 contiguous nucleic acids selected or derived from a sequence of the primers (a) - (b). The primer may also be any oligonucleotide of about 30 nucleotides or less comprising a segment having the sequence selected or derived from any of primers (a) - (b). The number of nucleotides in the primer should be high enough to retain selectivity, yet low enough to retain efficiency and operability in primer synthesis and the PCR procedure. The primer may have variations including nucleotide deletions, additions, or substitutions to the extent that the variations to the sequence of primers (a) - (b) retain the ability to act as a primer in the detection of V 13.1 -LGRAGLTY.

The VP 13.1 -LGRAGLTY detection method according to the invention uses a pair of the above primers in a procedure that detects the presence of any Vpi3.1-LGRAGLTY in a sample. The sample to be tested for the presence of Vpi3.1-LGRAGLTY is a nucleic acid, preferably DNA. The DNA can be genomic DNA, cDNA, DNA previously amplified by PCR, or any other form of DNA. The sample can be isolated, directly or indirectly, from any animal or human bodily tissue that expresses T cell receptor β chain genes. A preferred bodily tissue is peripheral blood mononuclear cells (PBMC). If the sample is genomic DNA, it can be isolated directly from the bodily tissue. If the sample is cDNA, it is isolated indirectly by reverse transcription of mRNA directly isolated from the bodily tissue. If the sample is DNA previously amplified by PCR, it is isolated indirectly by amplification of genomic DNA, cDNA, or any other form of DNA.

In a preferred embodiment, a portion of the T cell receptor gene from Vpl3.1 T cells, the portion comprising a sequence encoding the LGRAGLTY motif, is amplified to enhance the ability to detect the presence of Vp 13.1 -LGRAGLTY (5'-CTAGGGCGGGCGGGACTCACCTAC-3 ' (SEQ ID NO: 1)). The amplification can take place via a PCR reaction, using any particular PCR technique or equipment that provides sensitive, selective and rapid amplification of the portion in the sample.

For example, the PCR amplification can follow a procedure wherein a reaction mixture is prepared that contains the following ingredients: 5 μΐ, 10 x PCR buffer Π (100 mM Tris-HCl, pH 8.3, 500 mM C1), 3 μL 25 mM MgCl2, 1 μΐ 10 mM dNTP mix, 0.3 μL Taq polymerase (5 U/uL) (AmpIiTaq Gold, Perkin Elmer, Norwalk, CT), 30 pmol of primer A, and 30 pmol of primer B. In light of the present disclosure, the skilled artisan will be able to select appropriate primers A and B for the purpose of PCR amplification of the portion of the T cell receptor gene from Vpi3.1 T cells. The above mixture is appropriate for amplifying 1 μΐ, of sample DNA. Hereinafter, the DNA to be amplified may be referred to as the "template." Once sample DNA is added to the above reaction mixture, the PCR reaction can be performed with an amplification profile of 1 min at 95°C (denaturation); 20 sec at 56°C (annealing), and 40 sec at 72°C (extension) for a total of 35 cycles.

In the PCR reaction, the template can be heat denatured and annealed to two' oligonucleotide primers. The oligonucleotides bracket an area of the nucleic acid sequence that is to be amplified. A heat stable DNA polymerase is included in the reaction mixture. The - 12 - polymerase elongates the primers annealed to complementary DNA by adding the appropriate complementary nucleotides. Preferred polymerases have the characteristics of being stable at temperatures of at least 95°C, have a processivity of 50-60 and have an extension rate of greater than 50 nucleotides per minute.

Approximately 40 PCR cycles are used in a typical PCR amplification reaction.. However, certain PCR reactions may work with as few as 15 to 20 cycles or as many as 50 cycles. Each cycle consists of a melting step in which the template is heated to a temperature above about 95°C.

The temperature of the PCR reaction is then cooled to allow annealing of the primers to the template. In this annealing step, the reaction temperature is adjusted to between about 55°C to 72°C for approximately 20 seconds. Longer or shorter times may work depending upon the specific reaction.

The temperature of the PCR reaction is then heated to allow maximal elongation of the primers to be effected by the polymerase. In this extension step, the reaction temperature is adjusted to between about 70°C and 75°C for approximately 40 seconds. Higher or lower ■ temperatures and/or longer or shorter times may work depending upon the specific reaction.

In addition, before the first cycle is begun, the reaction mixture can undergo an initial denaturation for a period of about 5 min to 15 min. Similarly, after the final cycle is ended, the reaction mixture can undergo a final extension for a period of about 5 min to 10 min.

Amplification can be performed using a two-step PCR. In this technique, a first PCR' amplification reaction is performed to amplify a first region that is larger than, and comprises, a region of interest. A second PCR amplification reaction is then performed, using the first region as a template, to amplify the region of interest. If either primer from the first PCR reaction can be used in the second PCR reaction, the second PCR reaction is "semi-nested." If neither primer from the first PCR reaction can be used in the second PCR reaction, the second PCR reaction is "nested." In a preferred way of performing the method of the present invention, the νβ 13.1 -LGRAGLTY motif is amplified by two-step PCR. In the first PCR reaction, the sample is amplified using a first primer that anneals to the νβ region of the T cell receptor gene and a second primer that anneals to the C region of the T cell receptor gene, using the reaction mixture and profile disclosed above. The first PCR reaction amplifies a first region that is about 600 bp and extends from Vp through the νβ-ϋβ-Ιβ junction to Cp. The second PCR reaction is nested or semi-nested; a portion of the first region is partially amplified using primer pair (a) -(b). The second PCR reaction amplifies the region of interest.

After amplification of any DNA encoding Vp 13.1 -LGRAGLTY in the sample, the amplification product is detected. This detection may be done by a number of procedures. For example, an aliquot of amplification product can be loaded onto an electrophoresis gel. to which an electric field is applied to separate DNA molecules by size. In another method, an aliquot of amplification product is loaded onto a gel stained with SYBR green, ethidium bromide, or another molecule that will bind to DNA and emit a detectable signal. For example, ethidium bromide binds to DNA and emits visible light when illuminated by ultraviolet light. A dried gel could alternatively contain a radio- or chemically-labeled oligonucleotide (which may hereinafter be termed an "oligonucleotide probe") complementary to a portion of the sequence of the amplified template, from which an autoradiograph is taken by exposing the gel to film.

In another embodiment, the present invention relates to an oligonucleotide probe, comprising (a) an oligonucleotide of about 15 to 30 nucleotides in length, comprising at least 10 contiguous nucleotides of SEQ ID NO: l , or the nucleic acid sequence complementary thereto; and (b) a labeling moiety.

Preferably "(a)" is an oligonucleotide, of about 15 to 30 nucleotides in length, which comprises 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, or 23 contiguous nucleotides of SEQ ID NO. l , or a sequence complementary thereto. Most preferable is an oligonucleotide, of about 15 to 30 nucleotides in length, which comprises the nucleotide sequence of SEQ ID NO: l , or the sequence complementary thereto. Preferably, the labeling moiety is selected from 32P or digoxingenin.

A typical radiolabeled oligonucleotide useful for detection of amplification products produced using primers of the present invention is taken from the νβ-ϋβ-,Ιβ region. If the νβ 13.1 -LGRAGLTY region is amplified by the two-step semi-nested PCR disclosed above, wherein a primer corresponding to the sequence encoding the LGRAGLTY motif is used, any oligonucleotide of about 10 or more nucleotides, and preferably about 18 or more nucleotides, that is complementary to a portion of either strand of the amplified Υβΐ ΐ -LGRAGLTY region - 14 - can be used. More preferably, the oligonucleotide 5'-CTAGGGCGGGCGGGACTCACCTAC- 3' (SEQ ID NO: 1) or the nucleic acid sequence complementary thereto is used as a probe.

The present invention also comprises a test kit, comprising at a first primer (a) of about 15 to 30 nucleotides in length comprising at least 10 contiguous nucleotides of SEQ ID NQ: 1, or an the nucleic acid sequence complementary thereto.

In one preferred embodiment, the test kit further comprises a second primer (b), "wherein the second primer is a nucleic acid sequence of about 15 and 30 nucleotides in length that, does not comprise the sequence of (a) and is found in the region from νβ to Ιβ of the Vpl3.1 T cell receptor gene in T cells, wherein the sequences of (a) and (b) are not found on the same strand of the T cell receptor gene.

More preferably said first primer is an oligonucleotide, of about 15 to 30 nucleotides in length, which comprises 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, or 23 contiguous nucleotides of SEQ ID NO:l, or a sequence complementary thereto. Most preferable is an oligonucleotide, of about 15 to 30 nucleotides in length, which comprises the nucleotide sequence of SEQ ID NO:l, or the sequence complementary thereto In this embodiment, the test kit further comprises at least one reagent useful in the amplification of Vpi3.1-LGRAGLTY DNA by PCR techniques as described above. Exemplary reagents that can be included in the kit include, but are not limited to, buffers, deoxynucleoside triphosphates, heat-stable DNA polymerase such as Taq polymerase, V i3.1-LGRAGLTY DNA for positive control, and non-Vpi3.1-LGRAGLTY DNA for negative control. Other reagents that can be included in the test kit are known to one skilled in the art.

In another preferred embodiment, the test kit further comprises a labeling moiety. Preferably the labeling moiety is 32P or digoxingenin.

Another embodiment of the present invention is directed to peptides, of from 8 to approximately 45 amino acid residues in length, comprising the LGRAGLTY motif (i.e. comprising the sequence of SEQ ID NO: 3). In various aspects of this embodiment, of the invention, the peptide comprises 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 or 32 contiguous amino acids of the sequence of SEQ ID NO:32. Preferably the peptide sequence is SEQ ID NO:3 or the sequence is residues 2-21 of SEQ ID NO:32. Most preferably the peptide sequences is residues 2-21 of SEQ ID NO:32. In a preferred - 15 - aspect of this embodiment of the invention the peptides are present as purified peptides. By "purified peptides" it is meant that the majority (greater than 50%) of the polypeptides in the sample are the desired peptide. Preferably, the desired peptides constitute greater than 70% of the peptides in the purified peptide sample. More preferably the peptide constitutes greater than 90% of the peptides in the sample. Even more preferably the peptide constitutes greater than 95% of the polypeptide in the sample. Additionally, the term "purified peptide" indicates that the sample does not contain substances which interfere with the operation of the instant invention.

Peptides according to this aspect of the invention may be from any source compatible with the present invention either natural or synthetic (which may be obtained from commercial sources known to skilled artisans).

Other embodiments of the current invention provide for pharmaceutical compositions comprising the peptides described above. Methods of producing pharmaceutical peptide compositions are known in the art, see for example, U.S. Patent Numbers 6,066,619 and 6,068,850 which are herein incorporated by reference. Various aspects of this embodiment of the instant invention may comprise a pharmaceutically acceptable excipient, carrier, or diluent and do not contain any biologically harmful substances. The pharmaceutical compositions of the present invention may be formulated by one having ordinary skill in the art. Exemplary pharmaceutical formulations are also described in Remington's Pharmaceutical Sciences (Alfonso R. Gennaro Ed., 16th Edition, 1980), which is a standard reference text in the pharmaceutical field, is herein incorporated by reference.

The pharmaceutical compositions may further comprise coloring or stabilizing agents, osmotic agents, antibacterial agents, or any other substances which do not interfere with the function of the composition. The pharmaceutical compositions of the invention, can, for example, be formulated as a solution, suspension, or emulsion in association with a pharmaceutically acceptable parenteral vehicle. The vehicle may contain additives that maintain isotonicity (e.g., sodium chloride or mannitol) and chemical stability (e.g., buffers and preservatives). It should be appreciated that endotoxin contamination should be kept at a safe level, for example, less than 0.5 ng/mg protein. Moreover, for human administration, preparations should meet sterility, pyrogenicity, general safety, and purity standards as required - 16 - by the United States Food and Drug Administration Office of Biological Standards. The formulations may be sterilized by commonly used techniques such as filtration.

The phrase "pharmaceutically acceptable" refers to substances and compositions which do not produce an adverse, allergic, or otherwise untoward reaction when administered to an animal, or a human, as appropriate. A substance which caused any of these adverse effects would be classified as "biologically harmful" within the scope of the present invention. Pharmaceutically acceptable substances and compositions may include, but are not limited to solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents. Except where incompatible with the invention the use of any conventional ingredient is contemplated. Furthermore, supplementary active ingredients which serve some other pharmacologically expedient purpose can also be incorporated into the instant compositions.

The present invention also comprises a method of treating an autoimmune disease. The disease is one in which, for at least some patients, T cell receptors comprising LGRAGLTY are found on νβ13.1 T cells. Other types of T cells, and/or νβ13.1 T cells which lack T cell receptors comprising the LGRAGLTY motif, may be presented by the patient. The method comprises: (a) obtaining MBP83-99 νβ13.1 T cells from a human; (b) detecting the presence of a nucleic acid encoding the LGRAGLTY motif by the method described above; and, if the nucleic acid is detected, (c) administering a pharmaceutical composition comprising one or more peptides of from 9 to approximately 45 amino acid residues in length, to the human; wherein each peptide is comprised of the LGRAGLTY motif.

In various aspects of this method the pharmaceutical composition administered to the human comprises one or more peptides having 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 or 32 contiguous amino acids of the sequence of SEQ ID NO:32. Preferably the peptide sequence is SEQ ID NO:3 or the peptide sequence comprises residues 2-21 of SEQ ID NO:32. Most preferably the peptide sequences is residues 2-21 of SEQ ID O:32.

The autoimmune disease can be any autoimmune disease in which T cell receptors comprising the LGRAGLTY motif are found on Υβ13.1 T cells. Autoimmune diseases - 17 -contemplated by the present invention include, but are not limited to, rheumatoid arthritis, myasthenia gravis, multiple sclerosis, systemic lupus erythematosus, autoimmune thyroiditis (Hashimoto's thyroiditis), Graves' disease, inflammatory bowel disease, autoimmune uveoretinitis, polymyositis, and certain types of diabetes. A preferred autoimmune disease is multiple sclerosis (MS).

If nucleic acid encoding an LGRAGLTY motif is detected by the methods disclosed above, the autoimmune disease can be treated by administering pharmaceutical compositions comprising one or more peptides as described above The pharmaceutical compositions of the ; present invention can be administered alone, or in combination with a T-cell activation marker ! jpeptide. Preferably the pharmaceutical composition is administered in combination with a T-cell activation marker peptide, according to the disclosure of Zhang, U.S. Patent Application 60/099, 102, now published as US No. 6,303,314 and PCT Publication No. 00/50641 , incorporated herein by reference. Administration of the peptide can lead to an immunogenic response, wherein the patient will develop antibodies and T-cell receptors that recognize and bind to the LGRAGLTY motif of T cell receptors found on Vp 13.1 T cells.

Because VP 13.1 -LGRAGLTY can be present in both patients suffering from MS and normal individuals who are not suffering from the disease, it is envisioned that pharmaceutical compositions of the instant invention can be administered to both patients with MS and normal individuals.

In an alternative embodiment, if nucleic acid encoding an LGRAGLTY motif is detected by the methods disclosed above, the autoimmune disease can be monitored by quantifying the nucleic acid. The greater the amount of the nucleic acid present in a sample, such as PBMC, the greater the number of νβ13.1 T cells and the greater the likely severity of symptoms of the autoimmune disease. Also, depending on the time between the presentation of elevated Vp ] 3. i T cell levels and the appearance of symptoms, the clinician may receive an opportunity to apply treatments intended to minimize the severity of the symptoms and/or treat the disease before the symptoms appear.

The following examples are included to demonstrate preferred embodiments of the invention. It should be appreciated by those of skill in the art that the techniques disclosed in the examples which follow represent techniques discovered by the inventor to function well in the practice of the invention, and thus can be considered to constitute preferred modes for its practice. However, those of skill in the art should, in light of the present disclosure, appreciate - 18 - that many changes can be made in the specific embodiments which are disclosed and still obtain a like or similar result without departing from the spirit and scope of the invention.

EXAMPLES Example 1: T cell receptor V6-DB-JB DNA sequence and sequence motifs shared among MBP83-99 specific T cell clones derived from different patients with MS A panel of 20 CD4+ independent T cell clones was generated from seven patients with MS. All T cell clones recognized the 83-99 peptide of myelin basic protein (MBP83-99) in the context of HLA-DR2 as determined by using mouse fibroblast cells (L cells) transfected with DRB1*1501 as antigen-presenting cells. The T cell clones were characterized for TCR V gene rearrangements in reverse-transcript PCR (RT-PCR) using Va- and νβ-specific oligonucleotide primers and subsequently sequenced for the Va-Ja and νβ-ϋβ-Ιβ junctional regions. The sequences of the junctional regions are shown in Tables 1 and 2.

Table 1. summarizes the results of analysis with a panel of 20 independent MBP83-99 specific T cell clones characterized according to their Va gene usage by reverse-transcript PCR using a panel of oligonucleotide primers specific for Va gene families (the sequence of the unique primers used are indicated by being underlined in the DNA sequence corresponding to each clone). The amino acid sequences of the "Va", "n", "Ja", and "Ca" portions of each clone are indicated in Table 1. as follows: the "n" portions are underlined, the "Va" and "Ja" sequences are shown in bold on their respective sides of the "n" sequence, and the "Ca" sequence is shown in normal font without being underlined. The amplified PCR products were hybridized with digoxingenin-labeled Ca cDNA probes and were analyzed subsequently for DNA sequence. · Table 2. summarizes the results of an analysis of a panel of 20 independent MBP83-99 specific T cell clones. The clones were analyzed for νβ gene usage by reverse-transcript PCR using a set of oligonucleotide primers specific for twenty-six νβ gene families (sequence of the specific primer for each clone is indicated by being underlined in the corresponding DNA sequence). The " β", "D", 'Ίβ", and "Οβ" portions of each clone are indicated in Table 2. as follows: the "D" portions are underlined, the "νβ" and 'Μβ" sequences are shown in boldface type on their respective sides of the "D" sequence, and the remaining sequence, "ΰβ", is in - 19 - normal font (not underlined or emboldened). The amplified PCR products were hybridized with digoxingenin-labeled Οβ cDNA probes and were analyzed subsequently for DNA sequence.

Table 1 : TCR Va gene sequence specific for MBP83-99 peptide T CELL Vgene DNA or Va-n-Ja-Ca CLONE Amino (Gen Bank Acid Accession #) Sequence MS7-E3.1 Va22 Amino YFCALSRGGSNYKLTFGKGTLLTVNPNIQN (AFl 17142) Acid (SEQ ID NO: 4) DNA TACTTCTGTGCTCTGAGTAGGGGAGGTAGCAACTATA AACTGACATTTGGAAAAGGAACTCTCTTAACCGTGAA TCCAAATATCCAGAAC (SEQ ID NO: 5) MS7-D2.2 Va9 Amino YYCALKRNFGNEKLTFGTGTRLTHPNIQN (SEQ ID NO: 6) (AFl 17143) Acid DNA TATTACTGTGCTCTAAAAAGAAACTTTGGAAATGAGAAAT TAACCTTTGGGACTGGAACAAGACTCACCATCATACCCAA TATCCAGAAC (SEQ ID NO: 7) MS7-E2.6 Val7 Amino YFCAASPGGSNY LTFGKGTLLTVNPNIQN (SEQ ID NO: 8) (AFl 17144) Acid DNA TACTTCTGTGCAGCAAGCCCCGGAGGTAGCAACTATAAAC TGACATTTGGAAAAGGAACTCTCTTAACCGTGAATCCAAA TATCCAGAAC (SEQ ID NO: 9) MS7-C3.1 V l7 Amino YFCAAMGDFGNEKLTFGTGTRLTHPNION (SEO ID NO: 10) (AFl 17145) Acid DNA TACTTCTGTGCAGCAATGGGGGACTTTGGAAATGAGAAAT TAACCTTTGGGACTGGAACAAGACTCACCATCATACCCAA TATCCAGAAC (SEQ ID NO: 11) MS27- Val7 Amino YFCAAMGDFGNEKLTFGTGTRLTDPNIQN (SEQ ID NO: 12) D7.16 Acid (AFl 17145) DNA TACTTCTGTGCAGCAATGGGGGACTTTGGAAATGAGAAAT TAACCTTTGGGACTGGAACAAGACTCACCATCATACCCAA TATCCAGAAC (SEQ ID NO: 13) MS27-F3.4 V l7 Amino YFCAAMGDFGNEKLTFGTGTRLTHPNION (SEO ID NO: 14) (AFl 17145) Acid DNA TACTTCTGTGCAGCAATGGGGGACTTTGGAAATGAGAAAT TAACCTTTGGGACTGGAACAAGACTCACCATCATACCCAA TATCCAGAAC (SEQ ID NO: 15) MS27- V 22 Amino YFCALSVAGGTSYGKLTFGOGTILTVHPNION D4.4 Acid (SEQ ID NO: 16) (AFl 17146) Table 2: TCR Υβ gene sequence specific for MBP83-99 peptide T CELL Vgene DNA or νβ-ρ_-ΐβ^β CLONE Amino (Gen bank Acid Accession #) Sequence MS7-E3.1 νβ9 Amino YFCASSODRFWGGTVNTEAFFGOGTRLTVVEDLNK (API 17130) Acid (SEQ ID NO: 28) DNA TATTTCTGTGCCAGCAGCCAAGATCGTTTTTGGGGGG GGACGGTGAACACTGAAGCTTTCTTTGGACAAGGCAC CAGACTCACAGTTGTAGAGGACCTGAACAAG (SEQ ID NO: 29) MS7-D2.2 νβΐ Amino YFCASSAMGETQYFGPGTRLLVLEDLKN (AF117131) Acid (SEQ ID NO: 30) DNA TATTTCTGTGCCAGCAGCGCTATGGGAGAGACCCAGT ACTTCGGGCCAGGCACGCGGCTCCTGGTGCTCGAGGA CCTGAAAAAC (SEQ ID NO: 31) MS7-E2.6 νβ13. Amino YFCASSLGRAGLTYEOYFGPGTRLTVTEDL N (AFl 17132) 1 Acid (SEQ ID NO: 32) DNA TACTTCTGTGCCAGCAGCCTAGGGCGGGCGGGACTCA CCTACGAGCAGTACTTCGGGCCGGGCACCAGGCTCAC GGTCACAGAGGACCTGAAAAAC (SEQ ID NO: 33) MS27-C3.1 νβ13. Amino YFCASSLGRAGLTYEOYFGPGTRLTVTEDLKN (AFl 17132) 1 Acid (SEQ ID NO: 34) DNA TACTTCTGTGCCAGCAGCCTAGGGCGGGCGGGACTCA CCTACGAGCAGTACTTCGGGCCGGGCACCAGGCTCAC GGTCACAGAGGACCTGAAAAAC (SEQ ID NO: 35) MS27- νβ13. Amino YCASSLGRAGLTYEOYFGPGTRLTVTEDLKN D7.16 1Y Acid (SEQ ID NO: 36) (AFl 17132) DNA TACTTCTGTGCCAGCAGCCTAGGGCGGGCGGGACTCA CCTACGAGCAGTACTTCGGGCCGGGCACCAGGCTCAC GGTCACAGAGGACCTGAAAAAC (SEQ ID NO: 37) MS27-F3.4 νβ13. Amino YFCASSLGRAGLTYEOYFGPGTRLTVTEDL N (AFl 17132) 1 Acid (SEQ ID NO: 38) DNA TACTTCTGTGCCAGCAGCCTAGGGCGGGCGGGACTCA CCTACGAGCAGTACTTCGGGCCGGGCACCAGGCTCAC GGTCACAGAGGACCTGAAAAAC (SEQ ID NO: 39) MS27- Υβ9 Amino YFCASSPTVNYGYTFGSGTRLTVVEDLNK D4.4 Acid (SEQ ID NO: 40) (AFl 17133) DNA TATTTCTGTGCCAGCAGCCCGACAGTTAACTATnnCTA CACCTTCGGTTCGGGGACCAGGTTAACCGTTGTAGAG GACCTGAACAAG (SEQ ID NO: 41) T CELL Vgene DNA or νβ-ΐΗβ-ΰβ CLONE Amino (Genbank Acid Accession #) Sequence MS32- νβ13. Amino YFCASSYSIRGOGNEOYFGPGTRLTVTEDLKN F5.12 1 Acid (SEQ ID NO: 42) (AFl 17134) DNA TACTTCTGTGCCAGCAGTTACTCGATTAGGGGACAGG GTAACGAGCAGTACTTCGGGCCGGGCACCAGGCTCAC GGTCACAGAGGACCTGAAAAAC (SEQ ID NO: 43) MS32-B9.8 νβ13. Amino YFCASSYSIRGOGNEOYFRPGTRLTVTEDLKN (AFl 17134) 1 Acid (SEQ ID NO: 44) DNA TACTTCTGTGCCAGCAGTTACTCGATTAGGGGACAGG GTAACGAGCAGTACTTCCGGCCGGGCACCAGGCTCAC GGTCACAGAGGACCTGAAAAAC (SEQ ID NO: 45) MS37- νβ7 Amino YLCASSODRVAPQYFGPGTRLLVLEDLKN D9.3 Acid (SEQ ID NO: 46) (AFl 19246) DNA TATCTCTGTGCCAGCAGCCAAGATCGGGTTGCGCCAC AGTACTTCGGGCCAGGCACGCGGCTCCTGGTGCTCGA GGACCTGAAAAAC (SEQ ID NO: 47) MS37-B9.1 νβ17 Amino YLCASSTROGPOETOYFGPGTRLLVLEDL N (AFl 17135) Acid (SEQ ID NO: 48) DNA TATCTCTGTGCCAGTAGTACCCGGCAAGGACCTCAAG AGACCCAGTACTTCGGGCCAGGCACGCGGCTCCTGGT GCTCGAGGACCTGAAAAAC (SEQ ID NO: 49) MS8-D2.7 νβδ Amino YLCASSLGOGAYEOYFGPGTRLTVTEDLKN (AFl 17136) Acid (SEQ ID NO: 50) DNA TATCTCTGTGCCAGCAGCTTAGGACAGGGGGCTTACG AGCAGTACTTCGGGCCGGGCACCAGGCTCACGGTCAC AGAGGACCTGAAAAAC (SEQ ID NO: 51) MS8-A2.7 νβδ Amino YLCASSLGOGAYEOYFGPGTRLTVTEDLKN (AFl 17136) Acid (SEQ ID NO: 52) DNA TATCTCTGTGCCAGCAGCTTAGGACAGGGGGCTTACG AGCAGTACTTCGGGCCGGGCACCAGGCTCACGGTCAC AGAGGACCTGAAAAAC (SEQ ID NO: 53) MS8- νβ8 Amino YLCASSLGOGAYEOYFGPGTRLTVTEDLKN A1.15 Acid (SEQ ID NO: 54) (AFl 17136) DNA TATCTCTGTGCCAGCAGCTTAGGACAGGGGGCTTACG AGCAGTACTTCGGGCCGGGCACCAGGCTCACGGTCAC AGAGGACCTGAAAAAC (SEQ ID NO: 55) MS8-D1.3 Υβ8 Amino YFCASSLOVYSPLHFGNGTRLTVTEDLNK (AFl 17137) Acid (SEQ ID NO: 56) T CELL Vgene DNA or νβ-Γ Γβ-Οβ CLONE Amino (Genbank Acid Accession #) Sequence DNA TACTTCTGTGCCAGCAGTTTACAAGTGTATTCACCCCT CCACTTTGGGAACGGGACCAGGCTCACTGTGACAGAG GACCTGAACAAG (SEQ ID NO: 57) MS33- V l2 Amino Y CAISESIGTGTEAFFGOGTRLTWEDLNK DL2 Acid (SEQ ID NO: 58) (AFl 17138) DNA TACTTCTGTGCCATCAGTGAGTCGATTGGTACGGGAA CTGAAGCTTTCTTTGGACAAGGCACCAGACTCACAGT TGTAGAGGACCTGAACAAG (SEQ ID NO: 59) MS33- νβ12 Amino YFCAISESIGTGTEAFFGQGTRLTWEDLNK D3.3 Acid (SEQ ID NO: 60) (AFl 17138) DNA TACTTCTGTGCCATCAGTGAGTCGATTGGTACGGGAA CTGAAGCTTTCTTTGGACAAGGCACCAGACTCACAGT TGTAGAGGACCTGAACAAG (SEQ ID NO: 61) MS33- V 3 Amino YLCASRDRSYEQYFGPGTRLTVTEDLKN D8.1 Acid (SEQ ID NO: 62) (AFl 17139) DNA TACCTCTGTGCCAGCCGGGACAGGTCCTACGAGCAGT ACTTCGGGCCGGGCACCAGGCTCACGGTCACAGAGGA CCTGAAAAAC (SEQ ID NO: 63) MS9-C.26 νβ12 Amino YFCAISEGSSSGNTIYFGEGSWLTWEDLNK (AFl 17140) Acid (SEQ ID NO: 64) DNA TACTTCTGTGCCATCAGTGAGGGGTCCAGCTCTGGAA ACACCATATATTTTGGAGAGGGAAGTTGGCTCACTGT TGTAGAGGACCTGAACAAG (SEQ ID NO: 65) MS35-C7.2 Υβ2 Amino FYICSAIDGYTFGSGTRLTWEDLN (SEQ ID NO: 66) (AFl 17141) Acid DNA TTCTACATCTGCAGTGCTATAGACGGCTACACCTTCGG TTCGGGGACCAGGTTAACCGTTGTAGAGGACCTGAAC AAG (SEQ ID NO: 67) Although the Va and νβ rearrangements varied between individual MBP83-99 T cell clones, many of these independent T cell clones derived from a given individual shared identical Va and νβ chains with the same Va-Ja and Υβ-Όβ-Ιβ junctional region sequences. The finding is consistent with in vivo clonal expansion of MBP83-99 specific T cells in given patients with MS as reported previously (Vandevyver 1995, Wucheipfenning 1994).

Interestingly, as indicated in Tables 1 and 2, an independent T cell clone (clone E2.6) derived from one patient (MS-1) shared the same Vpi3.1 and Val7 with 3 of 4 T cell clones (clones C3.1, D7.16 and F3.4) obtained from another patient (MS-2). νβ13.1 of these T cell* clones shared an identical DNA sequence within the νβ-Όβ-Ιβ junctional region.

Example 2: VB-DB-JB-specific oligonucleotide primers were highly specific and sensitive in detecting corresponding DNA sequences present in original MBP83-99 T cell clones as well as in PBMC containing original MBP83-99 T cells A set of 14 oligonucleotide primers were synthesized according to DNA sequences within the νβ-ϋβ-Ιβ junctional regions of independent MBP83-99 T cell clones and subsequently examined for their specificity in RT-PCR. The DNA sequences of these oligonucleotide primers are shown in Table 3.

Table 3 DNA sequences of Vp-Dp-Jp -specific oligonucleotide primers T cell clone DNA sequence SEQ ID NO MS1-E3.1 AGCAGCCAAGATCGTTTTTGG SEQ ID NO: 68 MS1-E2.6 CTAGGGCGGGCGGGACTCACCTAC SEQ ID NO: 69 MS2-C3.1 CTAGGGCGGGCGGGACTCACCTAC SEQ ID NO: 70 MS2-D4.4 MS3-F5.12 TACTCGATTAGGGGACAGGGTAAC SEQ ID NO: 71 MS3-B9.8 MS4-D9.3 CAAGATCGGGTTGCGCCA SEQ ID NO: 72 MS4-B9.1 ACCCGGCAAGGACCTCAAGAGACC SEQ ID NO: 73 MS5-D2.7 AGCTTAGGACAGGGGGCT SEQ ID NO: 74 MS5-D1.3 MS6-D8.1 GCCAGCCGGGACAGGTCC SEQ ID NO: 75 MS6-D1.2 GAGTAGATTGGTACGGGA SEQ ID NO: 76 MS7-C.26 MS8-C7.2 TACATCTGAAGTGCTATAGAC SEQ ID NO: 77 These Vp-Dp-Jp-specific primers bound exclusively to DNA sequences present in the original MBP83-99 T cell clones and did not bind to the sequences derived from unrelated MBP83-99 T cell clones (Figure 2), suggesting their high specificity for the original Vp-Dp-Jp DNA sequences. The only exception was noted for clone MS 1-E2.6 and clone MS2-C3.1, in which the same primer bound to a Vp-Dp-Jp junctional DNA sequence shared by both T cell clones.

Given the specificity of the Vp-Dp-jp oligonucleotide primers and high sensitivity of PCR detection system, we asked whether this two-step PCR detection system using 5' Vp primers and Vp-Dp-jp-specific oligonucleotide primers could be used to detect corresponding Vp-Dp-Jp DNA sequences present in peripheral blood mononuclear cells (PBMC) specimens from which the MBP83-99 T cell clones originated. The results of two separate experiments showed positive detection of the Vp-Dp-jp sequences in original PBMC specimens. Thus, the findings demonstrated that the PCR detection system where Vp-Dp-Jp sequence served as a fingerprint was specific and sensitive in tracing MBP83-99 T cells present in peripheral blood mononuclear cells by probing identical DNA sequences.

Example 3: The detection of a common Vp-DB-JB DNA sequence in PBMC specimens derived from different patients with MS and healthv individuals Next, we examined whether DNA sequences corresponding to Vp-Dp-Jp junctional regions of the MBP83-99 T cell clones could be detected in PBMC specimens randomly selected from a group of patients with MS and healthy individuals. The same PCR amplification system using primers specific for corresponding Vp families (in the first PCR) and primers specific for Vp-Dp-Jp sequences (in the second semi-nested PCR) was employed. It was combined with Southern blot analysis with corresponding Vp-Dp-Jp probes to perform hybridization. Given the specific requirements of the two-step PCR detection system and specificity of the Vp-Dp-Jp primers and probes, the identified DNA sequences would derive from specific TCR Vp chains and represent either identical or similar to Vp-Dp-Jp sequences of interest.

The results indicated that only one Vp-Dp-Jp oligonucleotide primer (MS1-E2.6, Vpi3.1-LGRAGLTY) detected complementary TCR Vpl3.1 DNA sequence in 15 of 48 (31%) PBMC specimens obtained from different patients with MS. Thus, the finding indicates the presence of MBP83-99 T cells expressing Vp 13.1 -LGRAGLT Y in these patients with MS. Under similar experimental conditions, the same primer also detected corresponding DNA sequence in 5 of 20 (25%) PBMC specimens derived from healthy individuals. The remaining 13 Vp-Dp-Jp primers failed to identify any sequence signals in the same panel of PBMC specimens. The results were reproducible in three separate experiments. The identified DNA products amplified by the E2.6 primer originated from T cells expressing Vpi3.1 because a Vpi3.1-specific primer was used in the first PCR for amplification.

Furthermore, the identified Vpl3.1-LGRAGLTY sequence was also amplified in 13 of 24 (54%) short-term MBP83-99 T cell lines generated from five patients with MS (MS-35, MS36 and MS39) whose PBMC specimens were shown to contain the Vpl3.1-LGRAGLTY sequence. The results thus confirmed that the Vpi3.1-LGRAGLTY DNA sequence detected in the PBMC specimens originated from T cells recognizing MBP83-99. The finding also suggests that MBP83-99 T cells expressing the Vpi3.1-LGRAGLTY sequence represent all or the majority of MBP83-99 T cell lines found in some patients with MS.

A combined PCR-DNA hybridization detection system where Vp-Dp-Jp sequences were used as a fingerprint provided a powerful tool in tracing antigen-specific T cells by detecting identical Vp-Dp-jp junctional sequences. The high specificity and sensitivity of the detection - 27 - system allowed the identification of specific νβ-ϋβ-Ιβ sequences in peripheral blood T cells. The present study demonstrated for the first time that a common subset of Vpi3.1 T cells that recognize the immunodominant 83-99 peptide of MBP and uniformly express an identical νβ-ϋβ-Ιβ sequence is present in approximately 30% of patients with MS. The conclusion is made based on step-wise experiments described herein. First, the identical DNA sequence (νβ13.1-LGRAGLTY) was found among independent MBP83-99 T cell clones derived from different patients with MS. Second, the sequence was identified in cDNA products amplified from TCR νβ13.1 of PBMC specimens obtained from different patients with MS. Third, the DNA sequence was detected in short-term independent MBP83-99 T cell lines generated from PBMC specimens that were shown to contain the V 313.1-LGRAGLTY sequence. MBP83-99 T cells expressing the V 13.1-LGRAGLTY sequence seem to represent all or the majority of the MBP83-99 T cell lines generated from some patients with MS. Finally, the presence of ΎβΟ.Ι-LGRAGLTY sequence in PBMC specimens was confirmed by recombinant DNA cloning and direct DNA sequencing.

Furthermore, it is not surprising that MBP83-99 T cells expressing the common νβ13.1-LGRAGLTY sequence are also present in some healthy individuals. Studies reported so far indicate that MBP-reactive T cells, including T cells recognizing the immunodominant 83-99 peptide, are also present in some healthy individuals (Zhang 1994, Ota 1990). However, there is a functional difference that these T cells undergo in vivo activation and clonal expansion in patients with MS, as opposed to healthy individuals (Zhang 1994).

These νβ13.1 MBP83-99 T cells sharing the common νβ-ϋβ-Ιβ sequence may represent a significant fraction of MBP83-99 T cells found in some patients with MS. This possibility is supported by the observation that the V^13.1-LGRAGLTY sequence was present in 40% of short-term MBP83-99 T cell lines generated from patients with MS after two stimulation cycles.

The identified common νβ-ϋβ-Ιβ sequence may be used as a specific marker in a quantitative PCR detection system to detect a common subset of MBP83-99 T cells in the blood and cerebrospinal fluid in a large group of MS patients for the purpose of monitoring in vivo clonal expansion and in vivo activity potentially associated with the disease. This method will be superior to conventional cell culture-based assays because in vitro selection and expansion of MBP-reactive T cells are often hampered by various inhibitory factors inherent in cell culture. This is consistent with a recent study where the frequency of MBP-reactive T cells was found to - 28 - be surprisingly high in patients with MS when direct ex vivo analysis was employed to quantify MBP-reactive T cells (Hafler as last author JEM 1997).

Furthermore, synthetic peptides corresponding to the TCR have been shown to induce anti-idiotypic T cell responses to MBP-reactive T cells in patients with MS (Chou et al, J.I.). Therefore, a TCR peptide containing a common CDR3 sequence may be of great potential in eliciting anti-idiotypic T cells to suppress a specific subset of MBP-reactive T cells in a group of patients whose MBP83-99 T cells bear the common CDR3 sequence motif. Immunization with such a common CDR3 peptide would be advantageous over CDR2 peptides or individual-dependent CDR3 peptides as a potential treatment procedure in patients with MS (Vandenbark 1996).

Example 4: Induction of immune responses to immunizing MBP-reactive T cell clones and a 20-mer TCR peptide by T cell vaccination in patients with MS and the generation of B cell lines producing specific antibodies to the TCR peptide incorporating the common CDR3 sequence from immunized patients.

It has been demonstrated that subcutaneous inoculations with irradiated autologous MBP-reactive T cell clones induced substantial anti-idiotypic T cell responses in patients with MS, which correlated with progressive depletion of circulating MBP-reactive T cells used for vaccination (Medaer et al., 1995) Materials and Methods Reagents and peptides Medium used for cell culture was Aim-V serum-free medium (Life Technologies, Grand Island, NY). The immunodominant peptide (residues 83-99) of MBP and two TCR peptides of 20 amino acids were synthesized by Chiron Mimotope (San Diego, CA). The purity of the peptides was greater than 95%.

Estimation of the precursor frequency of MBP-reactive T cells PBMCs were plated at 200,000 cells/well (for a total of 96 wells) in the presence of MBP (40 μg mL). Seven days later, all cultures were restimulated with MBP in the presence of irradiated autologous PBMCs. After another week each well was split into four aliquots (approximately 104 cells per aliquot) and cultured in duplicate with 105 irradiated autologous PMBCs in the presence and the absence of MBP. Cultures were kept for three days and pulsed with [3H]thymidine (Nycomed Amersham, Arlington Heights, IL) at one μθϊ per well during the final 16 hours of culture. Cells were then harvested using an automated cell harvester, and [3H]thymidine incorporation was measured.

A well/culture was defined as specific for MBP or the peptides of MBP when the counts per minute (CPM) were greater than 1000 and exceeded the reference CPM (in the absence of MBP) by at least three fold. The precursor frequency of MBP-reactive T cells was then estimated by dividing the number of specific wells by the total number of PBMCs (19.2 x 106 cells) seeded in the initial culture.

Mvelin-Reactive T cell clones The positively identified T cell lines were cloned using limiting dilution assay in the presence of phytohemaglutinin-protein (PHA-P) at 2 μ^ιηΐ. Cultures were fed with fresh media every three to four days. Growth positive wells were tested for specific reactivity to the MBP83-99 peptide in proliferation assays. The resulting MBP83-99 specific T cell clones were further characterized and used for T cell vaccination.

TCR V gene analysis and DNA sequencing T cell receptor V gene rearrangements of the immunizing MBP-reactive T cell clones were analyzed using reverse-transcribed PCR. TCR a and β chain genes were amplified and directly sequenced as described elsewhere (Vandevyer et al., 1995; Zhang, Y.C.Q. et al. 1998). Briefly, total RNA was extracted from 106 cells of each MBP83-99 reactive T cell clone using R easy mini kit (QIAGEN, Santa Clarita, CA). First-strand cDNA reverse transcribed from total RNA was subjected to PCR amplification with a set of primers specific for TCR Vcc and νβ gene families whose sequences were published (Vandevyer et al., 1995; Zhang, Y.C.Q. et al. 1998). The amplified PCR products were separated in a 1% agarose gel by electrophoresis and stained with ethidium bromide. The visualized PCR products were cut and purified subsequently using a QIAquick® gel extraction kit (QIAGEN, Santa Clarita, CA), before sequence analysis. The purified PCR products were directly sequenced with the T7 sequencing kit (Pharmacia, Uppsala, Sweden). 1.5 μg of template was sequenced with 2 prao of the corresponding V gene primer using the method of dideoxy chain termination.

Immunization of MS patients with irradiated autologous MBP -reactive T cell clones Two patients with clinically definite MS confirmed by magnetic resonance imaging were included in this study. They were diagnosed as having relapsing-remitting MS for more than two years. The patients had not taken any immunomodulatory drugs at least three months prior to the study. Immunizations with irradiated autologous MBP 83 -99 reactive T cell clones was performed as previously described (J. Zhang et al. 1992, 1993). Briefly, MBP83-99 reactive T cell clones was activated and expanded in the presence of PHA seven days prior to injection. T cells were then irradiated at 10,000 rads (using a 60Co source) and thoroughly washed with sterile saline. A total of 4 x 107 cells from two autologous T cell clones was resuspended in 2 ml of sterile saline and were injected subcutaneously in the arms. Each patient received a total of four injections at a two-month interval to achieve adequate immune responses as defined by the proliferation of PBMC to the hnmunizing T cell clones. The protocol was approved by the Institutional Human Subjects Committee at Baylor College of Medicine. Consent forms were obtained from the patients after explaining the experimental procedures. The patients were evaluated for adverse events and disability score (Expanded Disability Scale Score) before and after each immunization. Gadolinium enhanced MRI scans were performed before and at different time points after immunization. The clinical and radiographic evaluation was part of a separate clinical study.

The generation of antibody-producing B cell lines by EBV transformation The method is described elsewhere (J. Zhang, 1989, 1991). Briefly, PBMC were plated out at 20,000 cells/well in microtiter plates (Costar, Cambridge, MA) in the presence of cell-free supernatant of B95.8 line producing EBV (ATCC, Bethesda, MD) and 0.5 μg/ml Cyclosporin A (Sandoz, Basel, Switzerland) to selectively inhibit T cell growth. Cells were cultured for 14 days with changes of medium every 3-4 days. On Day 14, the growth positive wells were visualized and the culture supernatants were harvested for testing. The precursor frequency of B cells producing specific antibodies was estimated by dividing the number of positive wells by the total number of PBMC plated. Positive B cell lines were transferred subsequently to 24-well plates (Costar, Cambridge, MA) for expansion. The B cell lines typically produced 2- 10 μg/ml of relatively pure antibodies. - 3 1 - Detection of anli-TCR antibody by ELISA Culture supernatants were collected from individual B cell lines and tested for the presence of anti-idiotypic antibodies using ELISA. Briefly, microliter plates were coated overnight at 4°C with the motif-positive TCR peptide or the control TCR peptide, respectively, at a concentration of I μg/ml. Wells were then blocked at 37°C for two hours with PBS containing 2% bovine serum albumin (BSA) (Sigma, St. Louis, MO) and washed four times with 0.02% Tween®20 (Sigma, St. Louis, MO) in a 0.9% NaCl solution. Each sample and its control were added to the adjacent wells and incubated for 2 hours. Plates were washed four times and incubated for 30 minutes with a goat anti-human IgG/lgM antibody conjugated with horseradish peroxidase at 1 : 1500 dilution (Sigma, Si. Louis, MO). 0.0125% tetramethylbenzidine/0.008% H2O2 in citrate buffer (pH = 5.0) was used as a substrate, and color development was stopped using 2N H2SO4. Optical densities were measured using an ELISA reader (Biorad, Hercules, CA). Wells containing medium alone served as background control.

Immunoblot analysis Lysates were prepared from a representative MBP-reactive T cell clone (MS7.E2.6) expressing the common CDR3 sequence using a standard method described elsewhere (Hjelmeland et al., 1984). Briefly, 5 x 106 T cells were lysed in 100 μΐ lysis buffer containing 150 M NaCl, 50mM Tris (pH7.6), 0.5% Triton X-100, 1 mM PMSF, 10 μg/ml aprotinin, 10 μg/ml leupeptin. Cell debris were spun down at 13,000 g for 20 min at 4 C. The resulting lysates were electrophoresed using 10% SDS-PAGE. After blotting, nitrocellulose membranes were cut into strips and then blocked with 5% low-fat milk power in Tris-buffered saline containing 0.1 % Tween®20 (milk-TBST). The strips were then incubated with undiluted supernatants in mini-incubation trays for one hour at room temperature. A goat anti-human IgG and IgM (heavy + light chains) coupled to horseradish peroxidase was used as secondary antibody (100 ng/ml in 2% milk - TBST) and incubated with washed strips for 45 min. followed by enhanced chemiluminescent visualization of the proteins on membrane (Amersham, Piscataway, NJ). Supernatant obtained from an EBV-transformed B cell line producing non-reactive antibodies was used as a negative control. A rabbit polyclonal anti-human TCR-beta chain antibody (Santa Cruz Biotechnology, Santa Cruz, CA) was included as a positive control.

Flow cytometry A representative MBP-reactive T cell clone (MS7-E2.6) expressing the common CDR3 sequence was incubated with the anti-idiotypic antibodies derived from individual B cell lines at 4°C for 30 min. Supernatant obtained from an EBV-transformed B cell line producing non- reactive antibodies was used as a control. After washing with FACS-buffer (PBS containing 5% fetal calf serum and 0.01% sodium azide) by centrifugation at 2300 rpm for 2 minutes at 4°C, cells were resuspended and stained with a goat anti-human IgG IgM antibody conjugated with fluorescein (FITC). After two washes the cells were resuspended in 300μ1 FACS-buffer and analyzed by flow cytometry using a FACScan (Becton Dickinson, San Jose, CA). FITC-conjugated anti-Igd was used to detect background staining (Becton Dickinson, San Jose, CA).

The inhibition assay ,000 cells of the immunizing MBP-reactive T cell clones (motif-positive and motif-negative T cell clones) were cultured in 150 μΐ with irradiated autologous PBMC (100,000 cells/well) in the presence and absence of the 83-99 peptide of MBP (20 μg ml). Fifty μΐ of undiluted supernatants were added into each well. Cell proliferation was measured after 72 hours in [3H]-thymidine incorporation assays. Supernatant obtained from an EBV-transformed B cell line producing non-reactive antibodies was used as a control.

RESULTS The functional and structural characteristics of the immunizing MBP-reactive T cell clones A panel of four MBP-reactive T cell clones was generated from two patients with relapsing-remitting MS. These T cell clones expressed the CD4 phenotype and recognized the 83-99 immunodominant peptide of MBP in the context of DR4 or DR2 (DRB1*1501) molecules. They were analyzed for TCR V gene rearrangements by RT-PCR using Va and νβ specific primers and subsequently sequenced for the Va- Ja and νβ-ϋβ-Ιβ junctional regions. An independent T cell clone (E2.6) derived from patient MS7 shared the same TCR Veil 7 and νβ13.1 genes with another T cell clone (C3.1) obtained from a different patient (MS27). The two T cell clones had an identical sequence, SEQ ID NO: 3 within the Vpi.3.1- ϋβ-Ιβ junctional region while their Vet 17 chains had two distinct Va-Jcc junctional region sequences. As noted supra, the identified LueGlyArgAlaGlyLeuThrTyr (SEQ ID NO:3) sequence represented a WO 02/1(5434 PCT/USOO/22988 - 33 - common CDR3 motif among Vpi3.1 T cells that recognize the 83-99 irnmunodominant region of MBP in different patients with MS(23).

Induction of the immune responses to the immunizing MBP-reactive T cell clones and a 20-mer ICR p ' eptide by T cell vaccination in patients with MS ■ Each patient received a total of four subcutaneous inoculations with two irradiated autologous MBP-reactive T cell clones (2 x 107 cells per clone) at a two-month interval. The proliferative responses of PBMC to the autologous immunizing T cell clones were examined at two time points corresponding to baseline and two months after the last immunization. As shown in Figure 8A, the proliferative responses to both irradiated immunizing T cell clones were increased in the patients after T cell vaccination and exceeded substantially the baseline value. Furthermore, the responses to the TCR peptide incorporating the common CDR3 sequence (motif-positive peptide, consisting of amino acids 2-21 of SEQ ID NO: 32), as opposed to a control CDR3 peptide (motif-negative peptide, consisting of amino acids 1-20 of SEQ ID NO: 48) derived from a non-immunizing T cell clone, was apparent after vaccination. However, the magnitude of the specific proliferation in response to the motif-positive peptide was considerably lower than that induced by irradiated immunizing T cells (Figure 8 A). The proliferative response to the immunizing T cells correlated inversely with a decline in the frequency of circulating MBP-reactive T cells in the immunized patients (Figure 8B).

The generation of B cell lines producing specific antibodies to the TCR peptide incorporating the common CER3 sequence from immunized patients We then examined whether immunization with irradiated T cells would elicit specific anti-idiotypic antibody responses in the patients. As the whole T cells expressed an array of surface molecules that could interfere with the detection of serum anti-idiotypic antibodies, the TCR peptide incorporating the common CDR3 sequence (motif-positive peptide) was used as the antigen for screening. The 20-mer TCR peptide derived from a non-immunizing MBP-reactive T cell clone (motif-negative peptide) was included in all experiments as a control. The CDR3 sequence of the control peptide was not detected in the immunizing T cell clones.

No specific antibody reactivity to either the TCR peptide or the original immunizing T cells could be detected using ELISA or flow cytometry, when tested with sera derived from the - 34 - two patients (data not shown). To further verify whether anti-idiotypic antibodies were present in the vaccinated patients, we generated a panel of antibody-producing B cell lines from the post-vaccination blood specimens using a cell culture-based technique combining EBV transformation with limiting dilution (see Materials and Methods).

As pre-vaccination PBMC were not available for the experiments, cells obtained from two randomly selected healthy individuals were used as control subjects and analyzed under the same experimental condition. Supernatants of the resulting B cell lines (92 cell lines from each patient/individual) were tested for the presence of antibodies to the motif-positive TCR peptide and the control TCR peptide, respectively, in ELISA. Antibodies were defined as anti-idiotypic when they exhibited specific reactivity to the motif-positive TCR peptide but not the control TCR peptide. As shown in Figure 9, B cells producing specific anti-idiotypic antibodies occurred at the precursor frequency of 1.75 x 10"6 in patients MS7 & and MS27, respectively, as compared to two non-immunized control subjects. In contrast, no specific antibody reactivity to the control peptide was detected in the same supernatants. The results suggest that the high frequency of B cells producing anti-idiotypic antibodies was associated with T cell vaccination.

All of the compositions and/or methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this invention have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the compositions and/or methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the invention. More specifically, it will be apparent that certain agents which are both chemically and physiologically related may be substituted for the agents described herein while the same or similar results would be achieved. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the invention as defined by the* appended claims. - 35 - REFERENCES: All references listed herein, insofar as they are necessary to describe and/or enable the present claims are hereby incorporated by reference.

Hjelmeland, J.M. and Chrambach, A. (1984) "Solubilization of functional membrane proteins" Meth. Enzymol. 104:305-318 Medaer, R.P., Stinissen, L., Raus, J. and Zhang, J. (1995) "Depletion of myelin basic protein- reactive T cells by T cell vaccination: A pilot clinical trial in multiple sclerosis", Lancet 346:807-808.

Vandevyver, C, Mertens, N., van de Elson, P., Medaer, R., Raus, J., and Zhang, J. (1995) "Clonal expansion of myelin basic protein-reactive T cells in patients with multiple sclerosis: restricted T cell receptor V gene rearrangements and DCR3 sequence." Eur. J. Immunol. 25:958-968.

Zhang, J., Lambrechts, J., Heyligen, H., Vandenbark, A., and Raus, J. (1989) "Human B cell lines secreting IgM antibody specific for myelin basic protein." J. Neuroimmunol. 23:249. Zhang, J., Chin, Y., Henderikx, P., Medaer, R.,.Chou, C.H., and Raus, J. (1991) "Antibodies to myelin basic protein and measles virus in multiple sclerosis: precursor frequency analysis of the antibody producing B cells." Atitoimm. 11:27.

Zhang, J., Medaer, R., Hastiim, G., Ying, C. van den Berg-Loonen, E., and Raus, J. (1992) "Myelin basic protein-specific T lymphocytes in multiple sclerosis and controls: precursor frequency, fine specificity, and cytotoxicity." Ann. Neurol. 32:330.

Zhang, J., Medaer, R., Stinissen, P., Hafler, D.A., and Raus, J. (1993) "MHC restricted depletion of human myelin basic protein reactive T cells by T cell vaccination." Science 261:1451-1454 Zhang, Y.C.Q., Kozovska, M., Aebischer, I., Li, S., Boehme, S., Crowe, P., Rivera, V.M., and Zhang, J. (1998) "Restricted TCR Va gene rearrangement in T cells recognizing an immunodominant peptide of myelin basic protein in DR2 patients with multiple sclerosis." Int. Immunol. 10:991 154544/2 36 SEQUENCE LISTING <110> Jingwu, Zhang Z. <120> T Cell Receptor VB-DB-JB Sequence and Methods For Its Detection <130> BCOL005 / 10237.0005. CPUS00 <140> <141> <160> 77 <170> Patentln Ver. 2.1 c210> 1 <211> 24 <212> DNA <213> SYNTHETIC <400> 1 ctagggcggg cgggactcac ctac 24 <210> 2 <211> 400 <212> DNA < 13> Homo sapiens <400> 2 catgtctccg ataacccaga ggatttcccg ctcaggctgc tgtcggctgc tccctcccag 60 acatctgtgt acttctgtgc cagcagccta gggcgggcgg gactcaccta cgagcagtac 120 ttcgggccgg gcaccaggct cacggtcaca gaggacctga aaaacgtgtt cccacccgag 180 gtcgctgtgt ttgagccatc agaagcagag atctcccaca cccaaaaggc cacactggta 240 tgcctggcca caggcttcta ccccgaccac gtggagctga gctggtgggt gaatgggaag 300 gaggtgcaca gtggggtcag cacagacccg cagcccctca aggagcagcc cgccctcaat 360 gactccagat actgcctgag cagccgcctg agggtctcgg 400 <210> 3 <211> 8 <212> PRT <213> Homo sapiens <400> 3 Leu Gly Arg Ala Gly Leu Th Tyr 1 5 <210> 4 <211> 30 <212> PRT <213> Homo sapiens <400> 4 Tyr Phe Cys Ala Leu Ser Arg Gly Gly Ser Asn Tyr Lys Leu Thr Phe 154544/2 37 10 15 Gly Lys Gly Thr Leu Leu Thr Val Asn Pro Asn He Gin Asn 25 30 <210> 5 <211> 90 <212> DNA <213> Homo sapiens <400> 5 tacttctgtg ctctgagtag gggaggtagc aactataaac tgacatttgg aaaaggaact 60 ctcttaaccg tgaatccaaa tatccagaac 90 <210> 6 <211> 30 <212> PRT <213> Homo sapiens <400> 6 Tyr Tyr Cys Ala Leu Lys Arg Asn Phe Gly Asn Glu' Lys Leu Thr Phe 1 5 10 15 Gly Thr Gly Thr Arg Leu Thr He He Pro Asn He Gin Asn 25 30 <210> 7 <211> 90 <212> DNA <213> Homo sapiens <400> 7 tattactgtg ctctaaaaag aaactttgga aatgagaaat taacctttgg gactggaaca 60 agactcacca tcatacccaa tatccagaac 90 <210> 8 <211> 30 <212> PRT <213> Homo sapiens <400> 8 Tyr Phe Cys Ala Ala Ser Pro Gly Gly Ser Asn Tyr Lys Leu Thr Phe 1 5 10 15 Gly Lys Gly Thr Leu Leu Thr Val Asn Pro Asn He Gin Asn 25 30 <210> 9 <211> 90 <212 > DNA <213 > Homo sapiens 38 <400> 9 tacttctgtg cagcaagccc cggaggtagc aactataaac tgacatttgg aaaaggaact 60 ctcttaaccg tgaatccaaa tatccagaac 90 <210> 10 <211> 30 <212> PRT <213> Homo sapiens <400> 10 Tyr Phe Cys Ala Ala Met Gly Asp Phe Gly Asn Glu Lys Leu Thr Phe 1 5 10 15 Gly Thr Gly Thr Arg Leu Thr lie He Pro Asn He Gin Asn 25 30 <210> 11 <211> 90 <212> DNA <213> Homo sapiens <400> 11 tacttctgtg cagcaatggg ggactttgga aatgagaaat taacctttgg gactggaaca 60 agactcacca tcatacccaa tatccagaac 90 <210> 12 <211> 30 <212> PRT <213> Homo sapiens <400> 12 Tyr Phe Cys Ala Ala Met Gly Asp Phe Gly Asn Glu Lys Leu Thr Phe 1 5 10 15 Gly Thr Gly Thr Arg Leu Thr He He Pro Asn He Gin Asn 25 30 <210> 13 <211> 90 <212> DNA <213> Homo sapiens <400> 13 tacttctgtg cagcaatggg ggactttgga aatgagaaat taacctttgg gactggaaca 60 agactcacca tcatacccaa tatccagaac 90 <210> 14 <211> 30 <212> PRT <213> Homo sapiens <400> 14 39 Tyr Phe Cys Ala Ala Met Gly Asp Phe Gly Asn Glu Lys Leu Thr Phe 1 ' 5 10 15 Gly Thr Gly Thr Arg Leu Thr He He Pro Asn He Gin Asn 25 30 <210> 15 <211> 90 <212> DNA <213> Homo sapiens <400> 15 tacttctgtg cagcaatggg ggactttgga aatgagaaat taacctttgg gactggaaca 60 agactcacca tcatacccaa tatccagaac 90 <210> 16 <211> 32 <212> PRT <213> Homo sapiens <400> 16 Tyr Phe Cys Ala Leu Ser Val Ala Gly Gly Thr Ser Tyr Gly Lys Leu 1 5 10 15 Thr Phe Gly Gin Gly Thr He Leu Thr Val His Pro Asn He Gin Asn 25 30 <210> 17 <211> 96 <212> DNA <213> Homo sapiens <400> 17 tacttctgtg ctctgagcgt tgctggtggt actagctatg gaaagctgac atttggacaa 60 gggaccatct tgactgtcca tccaaatatc cagaac 96 <210> 18 <211> 33 <212> PRT <213 > Homo sapiens <400 > 18 Tyr Tyr Cys Leu Val Gly Asp Ala Val Arg Pro Gly Gly Gly Asn Lys 1 5 10 15 Leu Thr Phe Gly Thr Gly Thr Gin Leu Lys Val Glu Leu Asn He Gin 25 30 Asn 154544/1 40 <210> 19 <211> 99 <212> DNA <213> Homo sapiens <400> 19 tactactgcc tcgtgggtga cgccgtgagg ccgggaggag gaaacaaact cacctttggg acaggcactc agctaaaagt ggaactcaat atccagaac <210> 20 <211> 33 <212> PRT < 13> Homo sapiens <400> 20 Tyr Tyr Cys Leu Val Gly Asp Ala Val Arg Pro Gly Gly Gly Asn Lys 1 5 10 15 Leu Thr Phe Gly Thr Gly Thr Gin Leu Lye Val Glu Leu Asn He Gin 25 30 Asn <210> 21 <211> 99 <212> DNA <213> Homo sapiens <400> 21 tactactgcc tcgtgggtga cgccgtgagg ccgggaggag gaaacaaact cacctttggg acaggcactc agctaaaagt ggaactcaat atccagaac <210> 22 <211> 29 <212> PRT <213> Homo sapiens <400> 22 Tyr Phe Cys Ala Thr Asp Ala Gly Gly Thr Tyr Lys Tyr He Phe Gly 1 5 10 15 Thr Gly Thr Arg Leu Lys Val Leu Ala Asn He Gin Asn 25 <210> 23 <211> 87 <212> DNA <213> Homo sapiens <400> 23 154544/1 41 tacttctgtg ctacggacgc aggaggaacc tacaaataca tctttggaac aggcaccagg ctgaaggttt tagcaaatat ccagaac <210> 24 <211> 27 <212> PRT <213> Homo sapiens <400> 24 Tyr Tyr Cys Leu Val Gly Asp He Asp Asp Met Arg Phe Gly Ala Gly 1 5 10 15 Thr Arg Leu Thr Val Lys Pro Asn He Gin Asn 25 <210> 25 <211> Bl <212> DNA <213> Homo sapiens <400> 25 tactactgcc tcgtgggtga catcgatgac atgcgctttg gagcagggac cagactgaca 60 gtaaaaccaa atatccagaa c 81 <210> 26 <211> 28 <212 PRT <213 > Homo sapiens <400> 26 Tyr Phe Cys Ala Thr Ser Val Asn Thr Asp Lys Leu He Phe Gly Thr 1 5 10 15 Gly Thr Arg Leu Gin Val Phe Pro Asn He Gin Asn 25 <210> 27 <211> 84 <212? DNA <213 > Homo sapiens <400> 27 tacttctgtg ctacatcggt taacaccgac aagctcatct ttgggactgg gaccagatta 60 caagtctttc caaatatcca gaac 84 <210> 28 <211> 35 <212> PRT <213> Homo sapiens <400> 28 Tyr Phe Cys Ala Ser Ser Gin Asp Arg Phe Trp Gly Gly Thr Val Asn 42 15 Thr Glu Ala Phe Phe Gly Gin Gly Thr Arg Leu Thr Val Val Glu Asp 25 30 Leu Asn Lys <210> 29 <211> 105 <212> DNA <213> Homo sapiens <400> 29 tatttctgtg ccagcagcca agatcgtttt tgggggggga cggtgaacac tgaagctttc 60 tttggacaag gcaccagact cacagttgta gaggacctga acaag 105 <210> 30 <211> 28 <212> PUT <213> Homo sapiens <400> 30 Tyr Phe Cys Ala Ser Ser Ala Met Gly Glu Thr Gin Tyr Phe Gly Pro 1 5 10 15 Gly Thr Arg Leu Leu Val Leu Glu Asp Leu Lys Asn 25 <210> 31 <211> 84 < 12> DNA < 13> Homo sapiens <400> 31 tatttctgtg ccagcagcgc tatgggagag acocagtact tcgggccagg cacgcggctc ctggtgctcg aggacctgaa aaac <210> 32 <211> 32 <212> PRT <213> Homo sapiens <400> 32 Tyr Phe Cys Ala Ser Ser Leu Gly Arg Ala Gly Leu Thr Tyr Glu Gin 1 5 10 ' 15 Tyr Phe Gly Pro Gly Thr Arg Leu Thr Val Thr Glu Asp Leu Lys Asn 25 30 154544/1 43 <210> 33 <211> 96 <212> DNA <213> Homo sapiens <400> 33 tacttctgtg ccagcagcct agggcgggcg ggactcacct acgagcagta cttcgggccg 60 ggcaccaggc tcacggtcac agaggacctg aaaaac 96 <210> 34 <21l> 32 <212> PRT <213> Homo sapiens <400> 34 Tyr Phe Cys Ala Ser Ser Leu Gly Arg Ala Gly Leu Thr Tyr Glu Gin 1 5 10 15 Tyr Phe Gly Pro Gly Thr Arg Leu Thr Val Thr Glu Asp Leu Lys Asn 25 30 <210> 35 <211> 96 <212> DNA <213> Homo sapiens <400> 35 tacttctgtg ccagcagcct agggcgggcg ggactcacct acgagcagta cttcgggccg 60 ggcaccaggc tcacggtcac agaggacctg aaaaac 96 <210> 36 <211> 31 <212> PRT <213> Homo sapiens <400> 36 Phe Cys Ala Ser Ser Leu Gly Arg Ala Gly Leu Thr Tyr Glu Gin Tyr 1 5 10 15 Phe Gly Pro Gly Thr Arg Leu Thr Val Thr Glu Asp Leu Lys Asn 25 30 <210> 37 <211> 96 <212> DNA <213> Homo sapiens <400> 37 tacttctgtg ccagcagcct agggcgggcg ggactcacct acgagcagta cttcgggccg 60 154544/1 44 ggcaccaggc tcacggtcac agaggacctg aaaaac 96 <210> 38 <211> 32 <212 > PRT <213 > Homo sapiens 400> 38 Tyr Phe Cys Ala Ser Ser Leu Gly Arg Ala Gly Leu Thr Tyr Glu Gin 1 5 10 15 Tyr Phe Gly Pro Gly Thr Arg Leu Thr Val Thr Glu Asp Leu Lys Asn 25 30 <210> 39 <211> 96 <212> DNA <213 > Homo sapiens <400> 39 tacttctgtg ccagcagcct agggcgggcg ggactcacct acgagcagta cttcgggccg 60 ggcaccaggc tcacggtcac agaggacctg aaaaac 96 <210> 40 <211> 29 <212> PRT <213 > Homo sapiens <400> 40 Tyr Phe Cys Ala Ser Ser Pro Thr Val Asn Tyr Gly Tyr Thr Phe Gly 1 . 5 10 15 Ser Gly Thr Arg Leu Thr Val Val Glu Asp Leu Asn Lys 25 <210> 41 <211> 87 <212 > DNA <213 > Homo sapiens <400> 41 tatttctgtg ccagcagccc gacagttaac tatggctaca ccttcggttc ggggaccagg 60 ttaaccgttg tagaggacct gaacaag 87 <210 42 <211> 32 <212> PRT < 13> Homo sapiens 154544/1 45 <400> 42 Tyr Phe Cys Ala Ser Ser Tyr Ser He Arg Gly Gin Gly Asn Glu Gin 1 5 10 15 Tyr Phe Gly Pro Gly Thr Arg Leu Thr Val Thr Glu Asp Leu Lys Asn 25 30 <2i0> 43 <211> 96 <212> DNA <213> Homo sapiens <400> 43 tacttctgtg ccagcagtta ctcgattagg ggacagggta acgagcagta cttcgggccg 60 ggcaccaggc tcacggtcac agaggacctg aaaaac 96 <210> 44 <211> 32 <212> PRT <213> Homo sapiens <400> 44 Tyr Phe Cys Ala Ser Ser Tyr Ser He Arg Gly Gin Gly Asn Glu Gin 1 5 10 15 Tyr Phe Arg Pro Gly Thr Arg Leu Thr Val Thr Glu Asp Leu Lys Asn · 25 30 <210> 45 <211> 96 <212 > DNA <213> Homo sapiens <400> 45 tacttctgtg ccagcagtta ctcgattagg ggacagggta acgagcagta cttccggccg 60 ggcaccaggc tcacggtcac agaggacctg aaaaac 96 <210> 46 <211> 29 < 12> PRT <213> Homo sapiens <400> 46 Tyr Leu Cys Ala Ser Ser Gin Asp Arg Val Ala Pro Gin Tyr Phe Gly 1 5 !o 15 Pro Gly Thr Arg Leu Leu Val Leu Glu Asp Leu Lys Asn 46 25 <210> 47 <211> 87 <212 > DNA <213 > Homo sapiens <400> 47 tatctctgtg ccagcagcca agatcgggtt gcgccacagt acttcgggcc aggcacgcgg ctcctggtgc tcgaggacct gaaaaac <210> 48 <211> 31 <2 2> PRT <213> Homo sapiens <400> 48 Tyr Leu Cys Ala Ser Ser Thr Arg Gin Gly Pro Gin Glu Thr Gin Tyr 1 5 10 15 Phe Gly Pro Gly Thr Arg Leu Leu Val Leu Glu Asp Leu Lys Asn 25 30 <210> 49 <211> 93 <212> DNA <213> Homo sapiens <400> 49 tatctctgtg ccagtagtac ccggcaagga cctcaagaga cccagtactt cgggccaggc 60 acgcggctcc tggtgctcga ggacctgaaa aac 93 <210> 50 <211> 30 < 12> PRT <213> Homo sapiens <400> 50 Tyr Leu Cys Ala Ser Ser Leu Gly Gin Gly Ala Tyr Glu Gin Tyr Phe 1 5 10 15 Gly Pro Gly Thr Arg Leu Thr Val Thr Glu Asp Leu Lys Asn 25 30 <210 > 51 <211> 90 <212> DNA <213> Homo sapiens <400> 51 tatctctgtg ccagcagctt aggacagggg gcttacgagc agtacttcgg gccgggcacc 60 aggctcacgg tcacagagga cctgaaaaac 90 154544/1 47 210> 52 <211> 30 <212> PRT <213> Homo sapiens <400> 52 Tyr Leu Cys Ala Ser Ser Leu Gly Gin Gly Ala Tyr Glu Gin Tyr Phe 1 5 10 15 Gly Pro Gly Thr Arg Leu Thr Val Thr Glu Asp Leu Lys Asn 25 30 <210> 53 <211> 90 <212> DNA <213> Homo sapiens <400> 53 tatctctgtg ccagcagctt aggacagggg gcttacgagc agtacttcgg gccgggcacc aggctcacgg tcacagagga cctgaaaaac <210> 54 <211> 30 <212> PRT <213> Homo sapiens <400> 54 Tyr Leu Cys Ala Ser Ser Leu Gly Gin Gly Ala Tyr Glu Gin Tyr Phe 1 5 10 15 Gly Pro Gly Thr Arg Leu Thr Val Thr Glu Asp Leu Lys Asn 25 30 <210> 55 <211> 90 <212> DNA <213> Homo sapiens <400> 55 tatctctgtg ccagcagctt aggacagggg gcttacgagc agtacttcgg gccgggcacc aggctcacgg tcacagagga cctgaaaaac <210> 56 <211> 29 < 12> PRT <213> Homo sapiens <400> 56 Tyr Phe Cys Ala Ser Ser Leu Gin Val Tyr Ser Pro Leu His Phe Gly 1 5 10 15 48 Asn Gly Thr Arg Leu Thr Val Thr Glu Asp Leu Asn Lys 25 <210> 57 <211> 87 <212> DNA <213> Homo sapiens <400> 57 tacttctgtg ccagcagttt acaagtgtat tcacccctcc actttgggaa cgggaccagg 60 ctcactgtga cagaggacct gaacaag 87 <210> 58 <211> 31 <212 PRT <213 > Homo sapiens <400> 58 Tyr Phe Cys Ala He Ser Glu Ser He Gly Thr Gly Thr Glu Ala Phe 1 5 10 15 Phe Gly Gin Gly Thr Arg Leu Thr Val Val Glu Asp Leu Asn Lys 25 30 <210> 59 <211> 93 <212> DNA <213> Homo sapiens <400> 59 tacttctgtg ccatcagtga gtcgattggt acgggaactg aagctttctt tggacaaggc accagactca cagttgtaga ggacctgaac aag <2io> eo <211> 31 <212 > PRT <213> Homo sapiens <400> 60 Tyr Phe Cys Ala He Ser Glu Ser He Gly Thr Gly Thr Glu Ala Phe 1 5 10 15 Phe Gly Gin Gly Thr Arg Leu Thr Val Val Glu Asp Leu Asn Lys 25 30 <210> 61 <211> 93 <212> DNA <213> Homo sapiens <400> 61 tacttctgtg ccatcagtga gtcgattggt acgggaactg aagctttctt tggacaaggc 60 49 accagaotca cagttgtaga ggacctgaac aag 93 <210> 62 <211> 28 <212> P T <213> Homo sapiens <400> 62 Tyr Leu Cys Ala Ser Arg Asp Arg Ser Tyr Glu Gin Tyr Phe Gly Pro 1 5 10 15 Gly Thr Arg Leu Thr Val Thr Glu Asp Leu Lys Asn 25 <210> 63 <211> 84 <212> DNA <213> Homo sapiens <400> 63 tacctctgtg ccagccggga caggtcctac gagcagtact tcgggccggg caccaggctc 60 acggtcacag aggacctgaa aaac 84 <210> 64 <211> 31 <212> PRT <213> Homo sapiens <400> 64 Tyr Phe Cys Ala lie Ser Glu Gly Ser Ser Ser Gly Asn Thr lie Tyr 1 5 10 15 Phe Gly Glu Gly Ser Trp Leu Thr Val Val Glu Asp Leu Asn Lys 25 30 <211> 93 <212> DNA <213> Homo sapiens <400> 65 tacttctgtg ccatcagtga ggggtccagc tctggaaaca ccatatattt tggagaggga agttggctca ctgttgtaga ggacctgaac aag <210> 66 <211> 26 <212> PRT <213> Homo sapiens <400> 66 Phe Tyr lie Cys Ser Ala lie Asp Gly Tyr Thr Phe Gly Ser Gly Thr 50 Arg Leu Thr Val Val Glu Asp Leu Asn Lys 25 <210> 67 <211> 78 <212> DNA <213> Homo sapiens <400> 67 ttctacatct gcagtgctat agacggctac accttcggtt cggggaccag gttaaccgtt 60 gtagaggacc tgaacaag 78 <210> 68 <21X> 21 <212> DNA <213> Homo sapiens <400> 68 agcagccaag atcgtttttg g <21l> 24 <212> DNA <213> Homo sapiens <400> 69 ctagggcggg cgggactcac ctac <210> 70 <211> 24 <212> DNA <213> Homo sapiens <400> 70 ctagggcggg cgggactcac ctac 24 <210> 71 <211> 24 <212> DNA <213> Homo sapiens <400> 71 tactcgatta ggggacaggg taac 24 <210> 72 <211> 18 <212> DNA <2l3> Homo sapiens <400> 72 154544/1 51 caagatcggg ttgcgcca 18 <210> 73 <211> 24 <212> DNA <213> Homo sapiens <400> 73 acccggcaag gacctcaaga gacc 24 <210> 74 <211> 18 <212> DNA <213> Homo sapiens <400> 74 agcttaggac agggggct 18 <210> 75 <211> 18 <212> DNA <213> Homo sapiens <400> 75 gccagccggg acaggtcc 18 <210> 76 <211> 18 <212> DNA <213> Homo sapiens <400> 76 gagtagattg gtacggga 18 <210> 77 <211> 21 <212> DNA < 13> Homo sapiens <400> 77 tacatctgaa gtgctataga c 21

Claims (3)

52 154544/2 Claims:

1. A peptide of from 8 to approximately 32 amino acids which consists of amino acids 2-21 of SEQ ID NO: 32.

2. A peptide of from 8 to approximately 32 amino acids which consists of the sequence of SEQ ID NO:

3. For the Applicant, Sanford T. Colb & Co. C:48043