HK40000570B - Capsule for drug delivery systems of target tissue-specific delivery type using carbosilane dendrimer - Google Patents

Capsule for drug delivery systems of target tissue-specific delivery type using carbosilane dendrimer Download PDF

Info

Publication number
HK40000570B
HK40000570B HK19123640.5A HK19123640A HK40000570B HK 40000570 B HK40000570 B HK 40000570B HK 19123640 A HK19123640 A HK 19123640A HK 40000570 B HK40000570 B HK 40000570B
Authority
HK
Hong Kong
Prior art keywords
gly
sequence
capsule
asp
lys
Prior art date
Application number
HK19123640.5A
Other languages
Chinese (zh)
Other versions
HK40000570A (en
Inventor
铃木美穗
幡野健
吉田彰次郎
山下靖弘
Original Assignee
国立大学法人埼玉大学
株式会社Cysay
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 国立大学法人埼玉大学, 株式会社Cysay filed Critical 国立大学法人埼玉大学
Publication of HK40000570A publication Critical patent/HK40000570A/en
Publication of HK40000570B publication Critical patent/HK40000570B/en

Links

Description

Capsule for target tissue-specific delivery-type drug delivery system using carbosilane dendrimer
Technical Field
The present invention relates to a targeting capsule for a target tissue-specific delivery type drug delivery system using a carbosilane dendrimer, which can be used for a drug delivery system.
Background
At present, biopolymers such as antibodies, peptide aptamers, and nucleic acids are attracting attention as next-generation drugs. Such biopolymers are greatly different from conventional pharmaceutical products containing low-molecular-weight compounds as active ingredients in quality control, storage of preparations, administration methods, and other aspects in the production process.
Generally, when a pharmaceutical preparation is administered, depending on the disease to be treated and the nature of the pharmaceutical preparation, the efficiency is affected by how much amount of the active ingredient can be delivered to the target site. For example, it is known that when a protein or an antibody as a biopolymer is used as an active ingredient, antibodies against the protein or antibody are produced depending on the dosage form at the time of administration, and the effectiveness is lowered, thereby causing a problem that the effective rate (therapeutic effect) is also lowered.
Therefore, as a means for appropriately delivering such a drug preparation to a target site, various drug delivery systems (DDS: drug delivery system) are being actively developed. Examples of the carrier used for the DDS include liposomes, micelles, and synthetic resin particles. In addition, as a formulation using such a carrier, for example, there are reported: a preparation in which a ligand that specifically binds to a molecule located at a target site is bound to a liposome or the like (see patent documents 1 and 2); a preparation in which N-acetylglucosamine or another sugar is exposed on the surface of a liposome, synthetic resin particles, or the like (see patent documents 3 and 4); and a preparation in which an antibody is bound to a micelle (see patent document 5); and so on.
Further, a carrier using a dendrimer forming a micelle structure has been developed (see patent documents 6, 7, and 8). Dendrimers are a generic name of regularly branched dendrimers having "dendro" (tree) as a source in greek. Several molecules of dendrimers form a sphere when associated, and a nano-scale space is formed inside the sphere. Therefore, molecules can be incorporated so that various functional groups appear in the space, and the degree of association can be increased to several tens to several hundreds, and the degree of freedom in design is high. Therefore, development of various novel dendrimers is actively being carried out in the field of nanotechnology.
To date, in order to prevent and/or treat diseases caused by viral or bacterial infections, development of a DDS vector using dendrimer has been carried out (see patent document 9).
On the other hand, it is known that a silole group-containing dendrimer (hereinafter referred to as "carbosilane dendrimer" in the present specification) having an AIE (aggregation-induced emission; phenomenon in which non-light-emitting compounds aggregate with each other and cause high-efficiency light emission by irradiation with light of a specific wavelength) effect generally performs fluorescence emission equivalent to the formation of an aggregate when forming a micelle (see non-patent document 1).
The human body is composed of about 60 trillion cells, all of which take in nutrients, hormones, or neurotransmitters and other extracellular information-transmitting substances from the outside of the cells to maintain homeostasis of the human body. In this case, the phenomenon in which various substances present outside the cell are taken into the cell is called endocytosis.
Typical examples of the endocytosis include endocytosis mediated by the caveolae, endocytosis mediated by the lipid raft, macropinocytosis, phagocytosis, receptor-dependent endocytosis, and clathrin-dependent endocytosis.
It is known that even a molecule having a large molecular weight can be taken into a cell by endocytosis, and it has been reported that: the aggregated molecule, which is a complex of the dendrimer and the protein, is formed by mixing the silole-containing carbosilane dendrimer and a labeled protein (for example, green fluorescent protein) in an aqueous solvent or a mixed solvent of the aqueous solvent and an organic solvent.
And also reported that: a liposome (hereinafter, sometimes referred to as "vesicle") or micelle formation which can induce the fluorescent protein to orient outward when the fluorescent protein is supported on a dendrimer; the vesicle can encapsulate, for example, a pigment, a lectin, an antibody, etc. (see patent document 10, hereinafter referred to as "prior art 1").
Documents of the prior art
Patent document
Patent document 1: WO2005/011632
Patent document 2: WO2005/011633
Patent document 3: japanese patent laid-open No. 2007-1923
Patent document 4: japanese laid-open patent publication No. 2009-46413
Patent document 5: japanese laid-open patent publication No. 2014-73975
Patent document 6: japanese laid-open patent publication No. 2001-206885
Patent document 7: japanese patent laid-open No. 2005-120068
Patent document 8: japanese laid-open patent publication No. 2007-238860
Patent document 9: japanese patent No. 5629888
Patent document 10: WO2016/084979
Non-patent literature
Non-patent document 1: chem Commun (Camb). 2009Aug 7; (29): 4332-53.Doi:10.1039/b904665h. Epub 2009May 13
Disclosure of Invention
Problems to be solved by the invention
As described above, studies on carriers for DDS have been actively conducted, but it is very difficult to efficiently deliver a drug containing a biopolymer as an active ingredient to a target site without impairing the properties of the drug.
In the case of oral administration, the biopolymer as an active ingredient cannot reach the intestinal tract and is not absorbed unless the carrier is prevented from being decomposed by a strong acid such as gastric acid. In addition, in the case of intravenous administration (intravenous injection, hereinafter sometimes collectively referred to as "intravenous injection"), although a high concentration of the drug can be temporarily administered into the blood stream, there is a problem other than the decomposition of gastric acid described above, and it is difficult to deliver the drug to a target site at an effective concentration for the following reason. That is, the drug concentration in blood rapidly decreases with time due to excretion into urine, metabolism in the liver, accumulation in various tissues, and the like; moreover, sometimes the targeting property is not achieved and the target is left in blood.
In addition, when the amount of the agent delivered to the target site is increased, serious side effects are sometimes caused. For example, levodopa, which is a therapeutic agent for parkinson's disease, has a very small amount of blood-brain barrier passing through, and therefore its effective rate cannot be improved. Furthermore, when the dose of levodopa is increased, since levodopa-decomposing enzymes are present in the target site other than the brain, serious side effects occur, and thus treatment cannot be continued in practice. On the other hand, administering a small amount of a medicament several times a day causes a problem of increasing the burden on patients and medical staff.
The carrier for a biopolymer must have a high compatibility with the living body, in addition to the property of being able to incorporate therein an active ingredient having a large molecular weight. This is because, if the biocompatibility is low, various reactions occur on the organism side, and the administration of the carrier itself adversely affects the organism. In addition, it is necessary to use a carrier that maintains a stable structure until it is delivered to a target site and can rapidly release the biopolymer as an active ingredient when it is delivered to the target site.
Prior art 1 is an invention excellent in the following respects: can incorporate effective components with large molecular weight into the interior, and has high compatibility with organism. However, it has a problem that the encapsulated model drug cannot be efficiently delivered to the target tissue.
Hitherto, a highly safe carrier for a biopolymer capable of specifically delivering an encapsulated model drug to a target tissue has not been put to practical use, and there is a strong social demand for a carrier having such characteristics and properties.
Means for solving the problems
The present invention has been made under the above-described circumstances, and an object thereof is to provide a capsule for a target tissue-specific delivery type drug delivery system, which can take in compounds and biopolymers having various molecular weights, has high stability in vivo, and can specifically deliver an active ingredient to a target tissue.
The present invention includes the following modes. In one embodiment of the present invention, the present invention relates to a capsule for a target-tissue-specific delivery-type drug delivery system, which is composed of an aggregating molecule, wherein the aggregating molecule is represented by the following formula (I) and comprises a Targeting Sequence Presenting Part (TSPP) composed of a fluorescent protein and a protein or peptide having a targeting recognition site for specific delivery to a target tissue; the aggregating molecules aggregate in an aqueous solvent to form a capsule capable of encapsulating at least 1 molecule selected from the group consisting of proteins, nucleic acids, and hydrophobic molecules having a molecular weight of 20 ten thousand or less.
[ solution 1]
( Wherein T represents a bromine atom or a targeting sequence presenting moiety represented by the following formula (II). And n1 and n2 each represent the number of targeting sequence presenting moieties, and (3-n 1) and (3-n 2) represent the number of bromine atoms. n1 and n2 are integers of 0 to 3 and are not 0 at the same time. )
[ solution 2]
The capsule for a target tissue-specific delivery type drug delivery system preferably has a diameter of 50 to 500 nm. This is because the capsule having a diameter of this size becomes an optimal size for a high osmotic long Retention Effect (Enhanced permeability and Retention Effect) of a neovasculature in the periphery of a cancer cell in drug delivery of an anticancer agent.
Here, from the viewpoint of being able to produce uniform and stable capsules and being able to encapsulate without denaturing proteins and other biopolymers, it is preferable that the aqueous solvent be any buffer selected from the group consisting of physiological saline, phosphate buffered physiological saline (hereinafter sometimes referred to as "PBS"), tris-hcl buffer (hereinafter sometimes referred to as "Tris-hcl buffer"), HEPES buffer (hereinafter sometimes referred to as "HEPES buffer"), sodium citrate buffer (hereinafter sometimes referred to as "citrate buffer"), and carbonic acid-bicarbonate buffer (hereinafter sometimes referred to as "carbonate buffer").
Preferably, the peptide has a tissue-specific delivery function and a function of promoting the uptake of the tissue-specific delivery capsule into cells; the above peptide specifically binds to a target protein selected from the group consisting of a surface antigen, a receptor, a portal, a transporter and a channel, which is expressed in the above target tissue.
Specifically, the peptide preferably has a sequence selected from any one of the groups consisting of SEQ ID Nos. 1 to 3 of the sequence Listing.
DMPGTVLPGG (sequence number 1 of sequence Listing)
VPTDYSGG (sequence number 2 of sequence table)
DMPGTVLPGGGGGSEGEWQ QQQQHQWAKQE (SEQ ID NO: 3 of the sequence Listing)
Preferably, the peptide has a sequence selected from any one of the groups consisting of SEQ ID Nos. 4 to 6 of the sequence Listing.
MASMTGGQQMGGR DMPGTVLPGG MSKGEELFTG VPIPELDG DVNGHKFVS GEGEGEGDATYG KLTLKFISTT GKLPVPWPTL VTTLTYTGVGQC FSRYPDHMKR HDFFKSAMPE GYVQERTISF KDDGNYNYKTRA EVKFEGDTLV NRIELKGGIDF KEDGNILGHK LEYNYNSSHNV YITAKDNG QRKANKTRHN IEDGSVQLAD HYQPIPG GPVLLPVDLSTQSALLKD PNEKRDHMVL LEFVTAAGSGIT DEVDGT DEVYK GG HHHHHHHHHHHHHH (sequence number 4 of sequence listing)
MASMTGGQQMGGR VPTDTDYSGG MSKGEELFTG VPIPELDG DVNGHKFVS GEGEGEGDYG KLTLKFISTT GKLPVPWPTL VTTLTYTGVGQC FSRYPDHMKR HDFFKSAMPE GYVQERTISF NDDGNYDGNYKTRA EVKFEGDTLV NRIELKGGIDF KEDGNILGHK LEYNYNSKN YIITKNG QRKANKTRHN IEDGSVQLAD HYQQPIPD GPVLLPVDSHWNY LSTQSALLKD PNRDHMVL LEFVTAAGSGIT DEVDGT DEVYK GG HHHHHHHHHHHHHH (SEQ ID No. 5 of sequence List)
MASMTGGQQMGGR DMPGTVLPGGGSEGEWQQQQQQQQHQWAKQE MSKGEELFTG VVPILELDGDVNGDVNGHKFGEGEGDATYG KLTLKFISTT GKLPVPWPTL VTTLTYTGVGQC FSRYPDHMKR HDFFAMPE GYVQERTISF KDNYKTRA EVKFEGDTNRIELKGHKLKEDGNILGHYNYNYNV SHITHKQRKANKTRFKTRHN IEDGSVQLAD HYQNTPIGD GPVLNHY LSTQSAKD PNEKHMVL LEFVGSGIT DEVDGTC GGHHHHHHHHHHHHHH (SEQ ID No. 6 of the sequence Listing)
Here, the target tissue is preferably any tissue selected from the group consisting of a normal tissue in which inflammation has occurred, a tissue including cells in which unwanted gene expression is observed, and a tissue including tumor cells.
Here, examples of the normal tissue in which inflammation occurs include tissues having a characteristic feature that is remarkable in autoimmune diseases. Examples of tissues containing cells in which undesirable gene expression is observed include tissues in which the occurrence of a gene mutation such as a single base substitution has been clarified by SNP analysis. Examples of the cells in which the undesirable gene expression is observed include cells derived from the above-mentioned tissue in which the undesirable gene expression is observed. Examples of the tissue composed of tumor cells include a breast cancer tissue, a lung cancer tissue, a liver cancer tissue, and a cervical cancer tissue. The target recognition site includes SEQ ID Nos. 1 to 3 of the sequence Listing, and the target sequence presenting part includes amino acid sequences represented by SEQ ID Nos. 7 to 11 of the sequence Listing.
Preferably, the aggregating molecule represented by formula (I) is an aggregating molecule represented by a molecule having any one structure selected from the group consisting of formulae (III) to (VI) below, and in the formula below, TSPP is a fluorescent protein having a targeting sequence presenting moiety.
[ solution 3]
[ solution 4]
[ solution 5]
[ solution 6]
Here, it is preferable that the fluorescent protein is any one selected from the group consisting of a red fluorescent protein, a yellow fluorescent protein, a blue fluorescent protein and a green fluorescent protein.
In addition, the above-mentioned uptake into the cell is preferably performed by any one of intracellular transfer pathways selected from the group consisting of endocytosis mediated by the cell caveolae, endocytosis mediated by lipid rafts, macropinocytosis, and phagocytosis.
ADVANTAGEOUS EFFECTS OF INVENTION
According to the present invention, it is possible to provide a capsule for a target tissue-specific delivery type drug delivery system, which has all the characteristics required for a carrier capable of delivering a drug or the like. In addition, various drugs containing biopolymers are encapsulated in the capsule for a target tissue-specific delivery drug delivery system, and thus tissue-specific delivery to a target tissue is possible.
Drawings
Fig. 1 is a schematic diagram showing a basic form of a general carbosilane dendrimer.
FIG. 2 is a diagram showing the synthesis scheme for dimethyl dumbbell (1), 6-Br, from dimethylsilane.
Fig. 3 is a graph showing the particle size distribution of the produced micelles.
Fig. 4 is a typical electron micrograph of the produced micelle observed with a scanning microscope (SEM).
Fig. 5 is a graph showing the results of examining the light-emitting characteristics of a complex of GFP and a silole dendrimer represented by formula (X) (hereinafter referred to as "GFP-SD complex").
Fig. 6 is a graph showing the results of examining the particle size distribution of micelles produced in the presence of a drug model.
FIG. 7 shows the results of examination of the emission characteristics of micelles formed from a GFP-silole dendrimer complex having DiI encapsulated therein, when excited at 370 nm.
FIG. 8 shows the results of examining the emission characteristics of micelles formed by GFP-SD complexes when excited at 370 nm. The micelles described above were encapsulated with WGA labeled with Alexa 594.
FIG. 9 is an electrophoretic image of a PCR product after inverse PCR with varying annealing temperatures.
Fig. 10 is a graph showing the results of measuring the fluorescence spectrum of the fluorescent protein-associated driving micelle to which a targeting peptide sequence is bound.
FIG. 11 is a graph showing a distribution of particle diameters of fluorescent protein-associated driven micelles to which a targeting peptide sequence is bound of MCF-7.
Fig. 12 is an electron microscope image observed by a low-temperature low-vacuum scanning electron microscope to determine whether the formed particles are micelles or vesicles.
Fig. 13 is a diagram showing uptake of a targeted protein and micelles comprising the targeted protein into MCF cells.
Fig. 14 is the results of FACS analysis showing differences in uptake of micelles after 24 hours after contacting a549 cells with the micelles of the present invention.
Fig. 15 is the results of FACS analysis showing differences in uptake of micelles after 24 hours after MCF7 cells were contacted with the micelles of the present invention.
Fig. 16 is a graph showing the concentration-dependent change and the change with time of the non-targeted micelle.
Fig. 17 is a graph showing concentration-dependent changes and changes over time of targeted type 1 micelles.
Fig. 18 is a graph showing the temporal changes of non-targeted micelles and targeted micelles.
Fig. 19 is an electrophoresis image showing the result of gel electrophoresis of proteins constituting the capsule.
Fig. 20A is a fluorescence microscope image showing uptake of non-targeted micelles in target cells cultured in collagen-coated culture dishes.
Fig. 20B is an optical microscope image showing a state when cells were cultured without micelles in the poly-d-lysine-coated culture dish or the collagen-coated culture dish.
Fig. 20C is a fluorescence microscope image showing uptake of targeted type 1 micelles in target cells cultured in collagen-coated culture dishes.
FIG. 21 is a graph showing a particle size distribution of micelles produced using Tris-HCl buffer (hereinafter sometimes referred to as "buffer").
FIG. 22 is a view showing the results of measurement of fluorescence spectra of micelles prepared using Tris-HCl buffer.
Fig. 23 is a particle size distribution diagram of micelles prepared using HEPES buffer at the time of preparation.
Fig. 24 is a particle size distribution diagram of micelles prepared using HEPES buffer at day 1 after preparation.
Fig. 25 is a graph showing the results of measurement of fluorescence spectra of micelles prepared using HEPES buffer.
Fig. 26 is a particle size distribution diagram of micelles prepared using a sodium citrate buffer at the time of preparation.
Fig. 27 is a particle size distribution diagram of micelles prepared using sodium citrate buffer on day 1 after preparation.
Fig. 28 is a graph showing the results of measurement of fluorescence spectra of micelles prepared using the sodium citrate buffer.
Fig. 29 shows the particle size distribution of micelles prepared using the carbonic acid-bicarbonate buffer.
Fig. 30 is a particle size distribution diagram of micelles prepared using a carbonic acid-bicarbonate buffer after 1 day of preparation.
Fig. 31 is a graph showing the results of measuring the fluorescence spectrum of micelles prepared using a carbonic acid-bicarbonic acid buffer.
Fig. 32 is a graph showing the distribution of micelle particle sizes measured after stirring in a solvent containing BSA.
FIG. 33 is a graph showing the distribution of the particle size of micelles measured after storage at 4 ℃ for 6 days in a solvent containing BSA.
FIG. 34 is a graph showing the results of measurement of fluorescence spectra of micelles when stored at 4 ℃ in a solvent containing BSA.
Fig. 35 is a graph showing the results of an investigation of the correlation between the intracellular uptake rate and the fluorescence lifetime obtained by FACS when MCF7 cells and micelles treated with an inhibitor were cultured.
Fig. 36 is a graph showing the results of an examination of the intracellular uptake rate of micelles using MCF7 cells treated with an endocytosis inhibitor.
Detailed Description
The present invention is described in further detail below. The present invention is a capsule for a target tissue-specific delivery type drug delivery system as described above (hereinafter sometimes referred to as "targeted capsule").
The targeting capsule of the present invention is formed by aggregating the aggregating molecules represented by the following formula (I), and can encapsulate a biopolymer. The aggregating molecule constituting the targeted capsule includes a Targeting Sequence Presenting Part (TSPP) composed of (a 1) a protein or peptide having a target recognition site for specific delivery to a target tissue, and (a 2) a fluorescent protein.
[ solution 7]
Wherein T represents a bromine atom or a targeting sequence presenting part represented by the following formula (II). And n1 and n2 each represent the number of targeting sequence presenting moieties, and (3-n 1) and (3-n 2) each represent the number of bromine atoms. n1 and n2 are integers of 0 to 3 and are not 0 at the same time.
[ solution 8]
The biopolymer encapsulated in the targeting capsule is at least 1 molecule selected from the group consisting of a protein having a molecular weight of 20 ten thousand or less, a nucleic acid, and a hydrophobic molecule, and 2 or more of the proteins may be encapsulated at the same time, or the protein and the nucleic acid and/or the hydrophobic polymer may be encapsulated at the same time.
As described above, the aggregating molecule used in the present invention is a carbosilane dendrimer (hereinafter sometimes referred to as "silole dendrimer"), and is preferably a compound having a parent skeleton represented by the above formula (I) in view of having a targeting sequence presenting moiety (TSPP) schematically represented by the above formula (II) necessary for aggregating and enabling target tissue-specific delivery.
General carbosilane dendrimers have the structures shown in A to C in FIG. 1. The compound shown in FIG. 1A is called fan (0) 3, which has a benzene ring as a core. The compound shown in fig. 1B is called dumbbell (1) 6, and has a structure in which the benzene ring serving as the nucleus of 2 molecules of fan (0) 3 shown in fig. 1A is replaced with silicon (Me-Si-Me) having 2 methyl groups, and 2 molecules of fan (0) 3 other than the nucleus are bonded together. The compound shown in FIG. 1C is called sphere (1) 6, in which the methyl moiety of Me-Si-Me of dumbbell is replaced by (Si) 5 The denucleated molecules of the fan (0) 3 are bonded thereto to form a spherical structure (see FIG. 2).
On the other hand, the carbosilane dendrimers of the present invention have completely different structures from the existing carbosilane dendrimers as shown in the above formulas (I) and (II), and have a targeting sequence presenting part including a protein molecule by a bromine atom bonded to a molecular terminal. Here, the targeting sequence presenting part may be schematically represented by the above formula (II), and is composed of a protein or peptide having a target recognition site for specific delivery to a target tissue, and a fluorescent protein.
In addition, when the protein or peptide having a target recognition site has a sequence represented by seq id nos 1 to 3 of the sequence listing, it is preferable that the target tissue-specific delivery of the DDS capsule formed of the dendrimer is enabled.
The protein constituting the targeting sequence has a single reactive thiol group, and the thiol group is preferably located on the outer side of the folded protein, that is, on the protein surface.
This is because the thiol group reacts with a halogen atom present in the dendrimer and acts to bind the protein to the dendrimer, and therefore, the thiol group cannot participate in the binding even inside the folded protein. Here, the "protein having a thiol group" includes not only a protein originally having a thiol group but also a protein to which a thiol group has been newly introduced by a genetic engineering method or the like, a protein in which a cysteine of a protein having a cysteine has been reduced to a thiol group, and the like.
The position of the thiol group in the protein is not particularly limited, and it may be preferable that the thiol group is present in a specific region on the protein. Furthermore, the light emission characteristics of the capsule may sometimes be controlled. The cysteine contained in the "protein containing cysteine" may be introduced into a desired position by a method of substituting an arbitrary amino acid, a method of inserting the protein into a desired position, or other genetic engineering methods. The introduction of a cysteine residue into a desired amino acid position of a protein can be easily performed by those skilled in the art using site-directed mutagenesis or other well-known genetic engineering methods.
The protein constituting the targeting sequence presenting part is not particularly limited as long as it has an association property (hereinafter, may be referred to as "associativity"), and a fluorescent protein including a green fluorescent protein (hereinafter, a fluorescent protein that emits fluorescence other than green may be collectively referred to as "GFP") and a mutant thereof is preferably used. This is because the carbosilane dendrimer to which such a fluorescent protein is bound emits strong fluorescence when the proteins are associated, and the associated state can be easily detected.
Examples of the GFP that can be used in the present invention include GFP shown by SEQ ID No. 7 of the sequence Listing, GFP shown by SEQ ID No. 8, BFP (blue fluorescent protein) shown by SEQ ID No. 9 of the sequence Listing, YFP shown by SEQ ID No. 10 of the sequence Listing, and CFP, RFP and other GFP derivatives sold by Clontech. In addition, a fluorescent protein derived from actinostemma spicata shown in sequence No. 5 of the sequence listing, or the like may be used, and GFP shown in sequence No. 7 of the sequence listing may be preferably used for the intensity of fluorescence and ease of handling. Furthermore, due to the structural properties, it is conceivable that Azami-Green or other color mutants sold by the MBL company may also be preferably used.
Such GFP can be produced by a known method (for example, see biochem. Biophysis. Acta 1679 (2004) 222-229.
When a micelle is formed using the aggregating carrier, fluorescence is also generated from the portion where the silole groups are aggregated, and Fluorescence Resonance Energy Transfer (FRET) occurs between the fluorescent protein and the silole, resulting in strong Fluorescence. And, when the micelle disintegrates, FRET disappears.
Therefore, when a micelle prepared using the aggregating carrier and the targeting sequence presenting part of the present invention is used as a carrier for drug delivery, the state of the carrier (micelle) in a living body can be monitored using a change in FRET as an indicator. Further, since such monitoring can be performed, the presence position and the presence state of such a carrier can be tracked.
In order to generate FRET between a fluorescent protein and a silole dendrimer, it is important to which position of the fluorescent protein constituting the targeting sequence-presenting moiety is fixed to the silole dendrimer. The position of the above-mentioned fluorescent protein bound to the dendrimer can be easily determined by a person skilled in the art through preliminary experiments or the like. When GFP is used as the fluorescent protein constituting the target sequence presenting part, it is preferable that the dendrimer is bound to the N-terminal region, the C-terminal region, and the loop region adjacent to either the N-terminal region or the C-terminal region, and that amino acids such as cysteine having a thiol group are preferably present in these regions.
Here, the term "N-terminal region" refers to a region protruding from a core portion of about 10 amino acids present near the N-terminal, and the silole dendrimer is bonded to the region. Similarly, the binding to the C-terminal region refers to the binding of a portion protruding from a core portion of about 10 amino acids present in the C-terminal region to the silole dendrimer.
The position of the halogen group supported on the silole dendrimer of the present invention is not particularly limited, but is preferably present in the side chain of the silole dendrimer. More preferably, it is present at the end of the side chain (the position farthest from the silole group) as shown in the above formula (I).
As described above, the silole dendrimer used in the method of the present invention is preferably a compound represented by the formula (I). This compound can be synthesized, for example, as shown in scheme 1 described later, from 1, 2-tolane via a known intermediate 18 to yield a silole nucleus 2 (1, 1-diaryl-2, 3,4, 5-tetraphenylsilole).
Next, use H 2 PtCl 6 ·6H 2 The silole-nucleus dendrimer 3 can be obtained by hydrosilylation of 2 with trichlorosilane as a catalyst and grignard reaction using aryl magnesium bromide. The resulting dendrimer 3 was treated with dichlorohexylborane and then hydrolyzed with hydrogen peroxide in an alkali solution to obtain the hexahydroxy derivative 4. Next, O-mesylation of the hexahydroxy derivative, thereby replacing with bromide anion, can give 5 (Tetrahedron lett.,2007 48.
[ solution 9]
Wherein T represents a bromine atom or a targeting sequence presenting part represented by the above formula (II). And n1 and n2 each represent the number of targeting sequence presenting moieties, and (3-n 1) and (3-n 2) each represent the number of bromine atoms. n1 and n2 are integers of 0 to 3 and are not 0 at the same time.
The protein having a target recognition site constituting the target sequence presenting part is not particularly limited as long as it has an association property. However, the protein is preferably any one fluorescent protein selected from the group consisting of red fluorescent protein, yellow fluorescent protein, blue fluorescent protein and green fluorescent protein.
This is because the above fluorescent protein is easily available, and since the fluorescent protein itself has a large fluorescence intensity, intense fluorescence is generated by FRET. Here, the blue fluorescent protein includes any fluorescent protein exhibiting blue or blue-green fluorescence.
The aggregating molecule of the present invention is prepared by mixing and incubating the protein having a thiol group (targeting sequence presenting moiety) and a dendrimer compound having a halogen group in the side chain (formula (I)), and reacting the thiol group of the protein with the halogen group of the dendrimer compound to bind the protein to the dendrimer compound. In this case, it is preferable that the protein is treated with a reducing agent such as DTT in advance to form a state in which-SH groups are not oxidized. The reaction in the case where 1 molecule of GFP was introduced by this reaction is shown in scheme 1.
[ solution 10]
For example, the reaction shown in scheme 1 above can be carried out in a suitable aqueous solvent. Examples of the aqueous solvent include Phosphate Buffered Saline (PBS), physiological saline, tris-hydrochloric acid buffer, HEPES buffer, citric acid buffer, carbonic acid-bicarbonate buffer, and other water-soluble solvents.
The temperature conditions for carrying out the reaction vary depending on the protein to be used, and the reaction temperature may be lower than the denaturation temperature of the protein to be used, and may be, for example, about 0 to about 50 ℃, preferably about 30 to about 45 ℃, and more preferably about 37 ℃. When GFP is used, the reactivity can be improved in a temperature-dependent manner up to 42 ℃, and therefore GFP is preferably used for preparing an aggregating carrier material for DDS.
The reaction time varies depending on the reaction temperature, and is, for example, about 1 hour to about 24 hours, preferably about 10 hours to about 19 hours, and more preferably about 15 hours to about 18 hours. This is because, by the reaction time of such a degree, the protein having a thiol group to be used is bound to the silole dendrimer and forms a liposome or a micelle at the same time.
That is, with the formation of the protein-dendrimer complex, liposomes or micelles having the following structures are formed: the protein (hydrophilic portion) is present on the water-soluble solvent side, and the portions (hydrophobic portions) of the dendrimer core are associated with each other by the hydrophobic portions. That is, it is considered that the association of the proteins becomes a driving force by binding the above-mentioned associative proteins to the side chains of the dendrimer, and thus liposomes or micelles are formed.
At least 1 or more proteins are bonded to the silole dendrimer by substitution with a halogen atom at the end of a side chain. Therefore, the aggregating carrier material for drug delivery system obtained in the above reaction is obtained as a mixture of the conjugates represented by the above formulas (III) to (VI).
When the protein having a thiol group is a fluorescent protein, the mixing ratio (molar ratio) of the protein to the dendrimer is 1, and the dendrimer may be, for example, 1 to 20, preferably 1:5 to 1: 15. more preferably 1: about 10. However, the ratio depends on the concentration, and the optimum value varies.
In addition, in the above reaction, it is preferable to introduce an amino acid sequence to be a target recognition site into a protein as a target sequence presenting part in advance, from the viewpoint of achieving efficient delivery in DDS described later. The introduction of such a target recognition site is preferably carried out simply by inverse PCR. This is because, by introducing the plasmid encoding the mutant thus prepared into escherichia coli and expressing the plasmid, the mutant protein can be easily obtained, and an aggregating molecule for DDS can be obtained.
By introducing the target recognition site into the protein serving as a target sequence presenting part in advance, the desired drug encapsulated in the targeting capsule for a drug delivery system of the present invention can be specifically delivered to the normal tissue in which inflammation occurs, the tissue in which undesired gene expression is observed, the tissue composed of tumor cells, and the like while maintaining the activity.
The targeted capsule for a drug delivery system having the above-described structure is prepared so as to encapsulate a desired drug therein, thereby enabling the specific delivery of the drug to a target tissue while maintaining the effectiveness of the drug.
Examples
The following examples are merely illustrative and do not limit the scope of the invention.
Example 1 preparation of aggregated molecules and micelles for DDS
In this example, GFP described below was used as a protein for producing a target presenting moiety, and a silole dendrimer was used as a dendrimer.
(1) Preparation of aggregated molecules for DDS
In this example, a compound represented by the following chemical formula (X) (hereinafter sometimes referred to as "dimethyl dumbbell (1) 6-Br") was used as a dendrimer having a halogen group, and GFP (green fluorescent protein) (sequence No. 7) was used as a protein having a thiol group.
[ solution 11]
With respect to GFP (sequence No. 7 of the sequence listing) used herein, according to the method reported by the inventors (see biochim. Biophysis.acta 1679 (2004) 222-229.
First, DTT was added to a 20. Mu.M GFP solution (in PBS) to a final concentration of 1mM, and the mixture was treated at room temperature for 10 minutes to reduce cysteine present on the GFP surface. To 400 to 450. Mu.L of a 20. Mu.M GFP solution (in PBS) reduced with cysteine, 10. Mu.L of 200. Mu.M of the silole dendrimer solution represented by the above formula (VI) (DMSO solvent) was added to give a final concentration of 10-fold molar equivalents, and the resulting mixture was mixed by a vortex mixer.
After mixing, the mixture was left to stand at 37 ℃ and incubated overnight in this state to bind GFP to the above silole dendrimer, thereby forming micelles. The incubation time at this point was about 16 to 18 hours. The characteristics of the micelle particles in the resulting micelle-containing solution were measured by a Dynamic Light Scattering (DLS). The results are shown in Table 1.
[ Table 1]
Average particle diameter [ nm ] of 5 measurements of starting materials and products in PBS at 25 deg.C
The reaction solution was measured for particle size at 25 ℃ using ZETASIZER NANO-S (manufactured by Malvern Co.) with a laser wavelength of 532 nm. The results are shown in FIG. 3. FIG. 3 (A) shows the particle size distribution of the product obtained by incubating only GFP. FIG. 3 (B) shows the results of examining the particle size distribution of the resulting product obtained by incubating only the silole dendrimer of formula (VI). Fig. 3 (C) shows the results of examining the particle size distribution of the resulting product obtained by mixing GFP and a silole dendrimer of formula (VI) and incubating them. The horizontal axis represents the particle diameter of the obtained product, and the vertical axis represents the percentage of the product in the size shown in the horizontal axis in the whole.
When GFP was incubated with the above silole dendrimer (shown as "GFP-silole only" in Table 1), the resulting micelles had a particle size of about 150nm. In contrast, the particle size observed when GFP alone was incubated was about 4nm, and the particle size observed when the above-mentioned silole dendrimer alone was incubated was about 650nm. It is considered that such a large particle size observed in the incubation with only the above silole dendrimers may be due to the silole dendrimers aggregating with each other to form large aggregates.
Then, the obtained micelle particles were observed with a Scanning Electron Microscope (SEM), and it was confirmed that a large amount of particles having a particle diameter of about 100 to 500nm and a small amount of particles having a particle diameter of about 500nm were present (see FIG. 4).
From the above results, it is clear that the micelles formed by using the aggregated carrier for DDS of the present invention have a particle size of about 100 to 500nm, and many micelles have a particle size of about 100 to 200 nm. Further, from an image of an electron micrograph using an SEM, it was also confirmed that a spherical micelle structure was formed.
(2) Confirmation of fluorescence resonance energy shift
The silole dendrimer used in the present example was confirmed to emit light even when a micelle structure is formed, because it has a property that the hydrophobic silole core portion emits light (exhibits the AIE effect). Therefore, it has been investigated whether or not Fluorescence Resonance Energy Transfer (FRET) occurs between silole and GFP when a micelle composed of a GFP-silole dendrimer in which GFP is bonded to the silole dendrimer is produced.
The experiment of the luminescence property was performed after removing unreacted fluorescent protein and dendrimer (free molecule) from the above reaction solution (see fig. 5). The products of incubation with only silole dendrimers were excited at a wavelength of 370nm (white open square: 9633;), the products of incubation with only GFP were excited at a wavelength of 488nm (white open triangle:. DELTA.), and the products of incubation with GFP and silole dendrimers (micelles of the invention) were excited at a wavelength of 370nm (black circle: 9679;), and the properties of the respective luminescence wavelengths were examined. Regarding micelles composed of a GFP-silole dendrimer complex (a product obtained by incubation of GFP and the silole dendrimer of formula (X)), light emission by FRET from silole to GFP was observed near 510 nm.
As shown in FIG. 5, a peak of luminescence of a silole dendrimer was observed at around 480 nm. In addition, no sharp peak was observed in the luminescence of the combination of GFP and a silole dendrimer, and the peak was observed at around 510 nm. On the other hand, a sharp peak was observed in the light emission of GFP at around 510nm, and this was considered to be caused by FRET from the above silole dendrimer to GFP. When the micelle is disintegrated, the light emission of GFP, which is considered to be caused by FRET, also disappears.
That is, when a molecule (GFP-silole dendrimer complex) in which a dendrimer having an AIE effect is bound to an associated protein such as a fluorescent protein is prepared and a micelle is formed using this molecule, FRET occurs between the dendrimer and the fluorescent protein in a micelle state, and FRET disappears due to the disintegration of the micelle.
As described above, when the micelle of the present invention is used as an aggregating carrier for DDS, the delivered tissue or organ can be confirmed. In addition, even after the micelle delivered into the target tissue or organ is disintegrated, the fluorescence of the fluorescent protein can be traced, and thereby the intracellular environment or the like where the fluorescent protein is delivered can also be sensed.
(3) Encapsulation experiment of drug or the like in micelle composed of GFP-silole dendrimer complex
Next, it was confirmed whether or not micelles encapsulating a drug or the like can be produced using the micelles of the present invention. In the present example, diI (1, 1 '-dioctadecyl-3, 3' -tetramethylindocyanine perchlorate, promokine PK-CA707-60010, manufactured by promocell GmbH), oil orange SS (manufactured by tokyo chemical industry co., ltd., T0553), goat anti-mouse IgG (manufactured by abcam, ab 6708) -Alexa610 (manufactured by Molecular Probes, a 30050), WGA (wheat germ agglutinin, manufactured by Molecular Probes) (WGA-Alexa fluor (registered trademark) 594 conjugate, W11262) were used as model drugs.
mu.M of silole dendrimer represented by the above formula (X) (DMSO solvent) was added to 20. Mu.M of GFP after cysteine reduction at a final concentration of 10-fold molar equivalent, and then either DiI (final concentration: 1. Mu.M, fluorescent dye), orange SS (final concentration: 20. Mu.M, fluorescent dye), goat anti-mouse IgG-Alexa610 (final concentration: 0.1. Mu.M) or WGA (final concentration: 2. Mu.M) was added and mixed with a vortex mixer, and the mixture was left to stand at 37 ℃ for overnight (about 16 to 18 hours).
Whether or not micelles encapsulating each drug were formed in the sample to which each model drug was added was measured, and the particle size of these micelles was measured by the above-described dynamic light scattering method in the case where micelles were formed. The results are shown in Table 2. Here, diI, oil orange SS and goat anti-mouse IgG-Alexa610 were used as drug models.
Particle size distribution when the above model drug is used is shown in fig. 6 a to C. FIG. 6A is a particle size distribution when micelles were produced in the presence of DiI, FIG. 6B is a particle size distribution when micelles were produced in the presence of orange SS, and FIG. 6C is a particle size distribution when micelles were produced in the presence of goat anti-mouse IgG-Alexa 610. The horizontal axis represents the particle size of the obtained micelle, and the vertical axis represents the percentage of the micelle in the size shown in each horizontal axis in the whole. The micelle size was about 95nm with DiI, about 95nm with orange SS and about 180nm with IgG-Alexa 610.
[ Table 2]
Average particle size in PBS at 25 ℃ in 5 measurements [ nm ]
Fig. 7 shows the results of examining the emission characteristics of the micelles encapsulating the fluorescent dye DiI. B in FIG. 7 is an enlarged view of the spectrum of A in FIG. 7 at around 500 nm. The horizontal axis represents wavelength (nm) and the vertical axis represents relative fluorescence intensity (a.u.). Firstly, preparing micelles for encapsulating DiI, and respectively preparing samples for washing the micelles for 3 times by using PBS; then, the reaction solution was filtered through a filter having a pore size of 0.45 μm to remove the free dye; and samples from which free pigments were removed by filtration with a 0.22 μm filter instead of the 0.45 μm filter, and the fluorescence of these samples was measured.
As shown in a and B of fig. 7, when the excitation was carried out at a wavelength of 370nm, a shoulder peak was observed at a wavelength of 480nm, and it was considered that the excitation was caused by the luminescence of silole. The peak near 510nm is considered to be caused by FRET from silole to GFP, and the peak near 570nm is considered to be caused by FRET from silole to DiI. From the above results, it was confirmed that DiI was enclosed in the micelle.
Next, the light emission characteristics of the micelles encapsulating WGA labeled with Alexa594 were investigated (see a and B of fig. 8). Fig. 8 a shows the results of direct measurement of the reaction solution to which Alexa594 marker WGA was added. FIG. 8B shows the results of measurement after removing unreacted proteins (WGA labeled with Alexa594, silole dendrimer, GFP, etc., and other substances not incorporated into micelles) from the reaction mixture by means of an ultrafiltration spin column (Millipore). In fig. 8, the solid line indicates the fluorescence characteristics of a product obtained by mixing a GFP-silole dendrimer complex and WGA, and the dotted line indicates the fluorescence characteristics of a product obtained by mixing GFP and WGA.
In the figure, the solid line shows the results of measurement of micelles in which Alexa 594-labeled WGA is encapsulated in micelles formed of GFP-silole dendrimer complex, and the dotted line shows the results of measurement of micelles in which a mixture of GFP and Alexa 594-labeled WGA is encapsulated (the excitation wavelength is 370nm for all).
FIG. 8A shows the results of direct measurement of a reaction solution not subjected to the ultrafiltration spin column treatment, and in FIG. 8A, fluorescence from silole dendrimer is detected at around 480nm, fluorescence from GFP is detected at around 510nm, and fluorescence from WGA is detected at around 610 nm. On the other hand, as shown in B of fig. 8, when the ultrafiltration spin column treatment is performed, free silole dendrimer, GFP and WGA are removed (dotted line), and thus light emission therefrom is hardly detected. As described above, it was confirmed that Alexa594 marker WGA was encapsulated in the prepared micelle.
Example 2 preparation of fluorescent protein conjugated with targeting peptide sequence
A fluorescent protein conjugated with a targeting peptide sequence, which is conjugated to the micelle of the present invention at the C-terminus and conjugated to a targeting peptide at the N-terminus, which is conjugated to a receptor expressed on the surface of cancer cells, is prepared as follows.
(1) Inverse PCR
(1-1) selection of peptide sequences
The amino acid sequences of the selected peptides introduced into the target binding site are shown in Table 3 below. MCF7-1 is a human breast cancer-derived cell MCF7 (hereinafter sometimes referred to as "targeted type 1") comprising a sequence shown in the following Table 3, and MCF-2 is a mutant of MCF-1 (hereinafter sometimes referred to as "targeted type 2") comprising a sequence shown in the following Table 3. As shown in Table 3 below, MCF7-1+ α stand is another mutant of MCF7-1 (hereinafter, sometimes referred to as "type 1 enhanced type") having a structure in which a short peptide having an α -helical structure (hereinafter, referred to as "α stand") is linked to MCF 7-1.
[ Table 3]
(1-2) preparation of primers
The primers used for reverse PCR of the peptide sequences shown in Table 3 are shown in Table 4 below. These primers were designed in the following manner: in the case of SEQ ID Nos. 1 and 3 of the sequence Listing, the extension reaction was initiated between DM and PGTVLP of the above-mentioned peptide sequence, and in the case of SEQ ID No. 2, the extension reaction was initiated between VP and TDTDYSGG of the above-mentioned peptide sequence. This is because the inverse PCR is performed optimally.
[ Table 4]
(1-3) preparation of template plasmid for inverse PCR
The template plasmid for inverse PCR was prepared by the method described in the following paper.
“Protease-sensitive signalling by chemically engineered intramolecular fluorescent resonance energy transfer mutants of green fluorescent protein.-Miho Suzuki,et al.Biochimica et Biophysica Acta(BBA)-Gene Structure and Expression
Vol 1679, no. 3, no. 2004, 9 and 17 months, page 222-229 "
(1-3-1) plasmid construction of GFPuv5 mutant
GFPuv5 was obtained from pGFPgcn4 as follows. First, a PCR product in which a synonymous mutation for gene manipulation was generated was obtained by reverse PCR using a I167T mutation + 5 'CATTGAAGGGCTCCGGTTCAA (SEQ ID NO: 18) and a reverse primer 5' TTGTGGCGAGTTTTTTTTGAAGTTAG (SEQ ID NO: 19), and then the PCR product was subjected to cyclization treatment to prepare the PCR product. The construct obtained as above was named pGFPgcn5.
Thereafter, the cDNA of GFPuv5 was cloned into pET21a (Novagen) to express the protein. The protein expressed here was purified and named GFPuv5tag. The coding region thereof was amplified with a primer of 5'CTCGACCAT [ ATGGCTAGCATGACTGGTGGACAGCAAATGGGT ] (CGCATGAGTAAAGGAAGAACTTTTCA [ SEQ ID NO. ] (attached to an epitope tag of the first 11 amino acids for 10 proteins of the T7 gene toward the N-terminus of the GFPuv5 series, the attached tag being represented by [ ]), and 5' TGACGTGAATTCATTGTGATGGTGTGTGATG ] ]TTTGTAGAGCTCCATGC [ SEQ ID NO. [ ] provided with a His tag at the C-terminus of the GFPuv5 series (the His tag being represented by [ ]).
The nucleotide sequences shown in SEQ ID Nos. 1 to 3 were inserted into pET21a, and digested with NdeI and EcoRI. The pGFPgcn plasmid was used for gene manipulation and the pET21a plasmid was used for protein expression under the control of the T7 promoter. The nucleotide sequence of the GFPuv5 gene and its mutant gene was confirmed by DNA sequencing (ABI PRISM 3100Genetic Analyzer). In the experiment, 3 other synonymous mutations were found (Ser-30 agt to agc, his-78cat to cac, gln-183caa to cag).
These mutations are not detrimental to the fluorescent protein, and therefore the experiment was continued in a state in which they were included. The fluorescence intensity of purified GFPuv5tag is about 1.9 times that of GFPuv4 tag. Thereafter, any one of the cysteine residues at position 48 or 70 was substituted with a random amino acid by inverse PCR using pGFPgcn5.
5 'CTTAAATTTATTNNKACTGGAAAAAC (SEQ ID NO: 22) and 5' GGTAAGTTTTCCGTATGTTG (SEQ ID NO: 23) as oligonucleotides were used for mutation of cysteine 48, and 5'GTGTTCAANNKTTTTCCCGTTATCCG (SEQ ID NO: 24) and 5' CATACGTCAGAGTAGTGACAAG (SEQ ID NO: 25) were used for mutation of cysteine 70. The resulting plasmid was used to transform a culture of E.coli BL21 (DE 3), screened for strong fluorescence under excitation by sunlight, and selected on agar medium. In the case of position 48, several strongly fluorescent mutants were obtained (Ala, asp, glu, gly, ile, leu, asn, pro, ser, thr, val and Tyr substitutions). However, in the case of the mutant in which the amino acid at position 70 was substituted, only the C70V cysteine mutant provided appropriate fluorescence.
To prepare the double cysteine mutant GFPuv5 having a strong fluorescence intensity, a plasmid having a single mutation was digested with NcoI and EcoRI, and ligated to each region again. Selection was performed using a single mutant. UV5C0 tag (C48S/C70V) showed the highest fluorescence intensity among all recombinants.
Next, cysteines were introduced into positions 6 and 229 by inverse PCR, respectively. In this introduction, a plasmid having a C48S mutation and the following primer set were used for each mutation.
Glu replacement: 5'TGTCTTTTCACTGGAGTTGTCCC (SEQ ID NO: 26) and 5' TTCTCCTTACTCATTTTTTTC (SEQ ID NO: 27)
For Ile substitution: 5 'TGCACACACTGGCATGGATGAGCTC (SEQ ID NO: 28) and 5' CCCAGCAGCAGTTACAAAACTC (SEQ ID NO: 29)
The 3 protease tags containing the trypsin targeting sequence (Gln-Gly-Arg) have various spacer sequences (no spacer, thr spacer or Gly-Thr spacer) and are substituted for the necessary cysteine between His-231 and Asp-234. This construct was obtained using puvC48Stag, the resulting plasmid (template), and the primers shown in table 5 below.
[ Table 5]
(1-3-2) purification of GFPuv5tag mutant
Coli BL21 (DE 3) was transformed with the entire plasmid. Coli (12 mL) in stationary phase after overnight culture was inoculated in LB medium (38 mL) supplemented with ampicillin (50. Mu.g/mL) and IPTG (0.5 mM) and incubated at 37 ℃ for 8 hours. Cells were harvested by centrifugation at 2,500x g for 20 min and resuspended in 10mL of PBS. The cell pellet was lysed in 10mL lysis buffer (pH 8.0) containing 50mM Tris and 8M urea for 15 minutes at room temperature and vortexed. The supernatant was centrifuged at 1,200x g for 15 minutes and mixed with Ni2+ NTA resin (manufactured by Qiagen co.ltd.) suspended in PBS. After washing the resin with PBS and 20mM imidazole in this order, bound GFPuv5tag mutants were eluted with 250mM imidazole solution.
To change the buffer, the eluate was applied to a PD-10 gel electrophoresis filter column (manufactured by Amersham Bioscience co.ltd.) equilibrated with 10-fold diluted PBS. The eluted GFPuv5tag mutant proteins were collected, and their concentrations were quantified using a Coomassie protein detection reagent (manufactured by Pierce). Purified GFPuv5tag mutants were analyzed by 15-% SDS-PAGE.
The nucleotide sequence of the template plasmid for reverse PCR is shown in SEQ ID NO. 26.
(1-4) conditions for PCR
Reaction solutions shown in the following Table 6 were prepared, and inverse PCR was performed under the conditions shown in the following Table 7.
[ Table 6]
[ Table 7]
(1-5) confirmation by electrophoresis
A portion of the PCR reaction solution was subjected to gel electrophoresis at a voltage of 100V for 30 minutes by 0.8% PAGE, and amplified peptides were observed in each sample. The electrophoresis results are shown in FIG. 9.
(2) Removal of independent A sequences and purification of PCR products
The reaction solution of Table 8 below was prepared and reacted at 120 ℃ for 30 minutes to remove the independent A sequence generated by the above PCR. Then, the PCR product was purified using QIAquick (registered trademark) PCR purification kit (manufactured by QIAGEN corporation) according to the instructions attached to the kit.
[ Table 8]
(3) Ligation reaction
Next, reaction solutions shown in Table 9 below were prepared and reacted at 16 ℃ for 3 hours or more to prepare circular plasmids for transformation of E.coli DH 5. Alpha. As described below. According to the mutants, 25 ℃ and 37 ℃ were used, respectively.
[ Table 9]
(4) Transformation of E.coli DH 5. Alpha
A competent cell solution was prepared by thawing 10. Mu.L of E.coli DH 5. Alpha. (manufactured by BioDynamics Laboratory Co.) on ice immediately before use. mu.L of the ligation reaction was added to the competent cell solution and placed on ice for 30 minutes. After incubation at 42 ℃ for 30 seconds, the cells were cooled on ice for 2 minutes. To this was added 90. Mu.L of SOC (manufactured by Toyo Boseki Co., ltd.) medium, and the mixture was reacted at 37 ℃ for 1 hour on a shaker. Thereafter, the cells were inoculated into LB selection medium containing ampicillin (manufactured by Toyo Co., ltd.) and allowed to stand at 37 ℃ evening-night.
(5) Colony PCR
Colony PCR was performed from the colonies obtained by the above transformation, and the putative inserts were confirmed.
(5-1) preparation of reaction solution for PCR
The colony PCR reaction solutions shown in Table 10 below were prepared.
[ Table 10]
The colony PCR reaction solution was placed in a PCR tube, and E.coli grown in the LB medium containing ampicillin was collected and added. PCR was carried out according to the procedure shown in Table 11 below.
[ Table 11]
(5-2) electrophoresis
The PCR reaction solution was electrophoresed on 1.2% agarose gel at 100V for 30 minutes, and the colonies for which amplification was confirmed were transferred to a flask containing LB liquid medium (manufactured by Toyo Co., ltd.) and incubated at 37 ℃.
(6) Purification of plasmids
The plasmid in E.coli cultured in the LB liquid medium was purified using Wizard Plus SV miniprep.DNA purification System (manufactured by Promega) according to the instructions attached to the product. Thereafter, the sequence of the purified plasmid was analyzed by Eurofin Genomics.
(7) Transformation of E.coli BL21 (DE 3)
Coli BL21 (DE 3) competent cells (BioDynamics Laboratory Co., ltd.) 10. Mu.L were thawed on ice immediately before use to prepare a competent cell solution. To the competent cell solution, 1. Mu.l of a plasmid solution containing the target sequence confirmed by the above-mentioned sequencing was added, and the mixture was left on ice for 30 minutes.
After incubation at 42 ℃ for 30 seconds, the cells were cooled on ice for 2 minutes. To this was added 90. Mu.L of SOC (manufactured by Toyo Co., ltd.) medium, and the mixture was reacted at 37 ℃ for 1 hour on a shaker. Afterwards, inoculated into LB selection medium containing ampicillin, and left at 37 ℃ evening-night. The next day, colonies transformed to emit green fluorescence were collected, added to a 1ml flask containing LB liquid medium containing ampicillin, and left to stand at 37 ℃ for a evening for preculture.
(8) Purification of fluorescent proteins incorporating targeting peptide sequences
(8-1) incubation of colonies
4mL of LB liquid medium containing ampicillin was added to a 50mL tube, and 290. Mu.L of the above-mentioned preculture solution was added thereto to prepare 4 samples, which were then cultured on a shaker at 28 ℃ for 4 hours. Thereafter, 43. Mu.L of 100mM IPTG (isopropyl-. Beta. -thiogalactoside) was added and incubated evening-wave at 28 ℃ on a shaker.
(8-2) recovery of protein
The following day, the 4 tubes of the culture solution were collected into 1 tube. 3 tubes after transferring the content were washed with 1ml of PBS (-) buffer solution (Wako pure chemical industries, ltd.) and the washing solution was also added to the collection tube. The tubes in which the cultures were pooled as above were centrifuged at 5,000rpm (centrifuge name: KUBOTA3740, rotor number KUBOTA AF2018, manufactured by Kubota Co., ltd.) at room temperature for 5 minutes.
Thereafter, (i) the supernatant was discarded, and 3ml of PBS (-) buffer was added to the pellet, (ii) the pellet was sufficiently stirred, and then centrifuged at 5,000rpm for 5 minutes. (iii) repeating (i) and (ii) above 2 times. To the precipitated pellet, 4mL of B-PER lysis buffer (manufactured by Reagent corporation) was added, and the mixture was covered with a cap and stirred at room temperature overnight with a shaker.
(8-3) purification Using His tag
Ni-NTA agarose (QlAGEN) 2mL into 15mL tube, (i) 1,000rpm centrifugal 1 minutes, (ii) discard the supernatant, adding 1mL 1x PBS buffer and fully stirring. (iii) repeating the above (i) and (ii) 3 times to prepare Ni-NTA resin.
After the tube containing the above B-PER lysis buffer was centrifuged at 12,000rpm for 10 minutes at room temperature, the supernatant was transferred to a 15mL Falcon tube. Thereto was added 400. Mu.L of the above Ni-NTA resin which was sufficiently stirred, and stirred for 10 minutes at room temperature with a rotary shaker. Thereafter, the mixture was centrifuged at 1,000rpm at room temperature for 1 minute, and the supernatant was discarded. (iii) 4mL of 1XPBS buffer was added thereto and sufficiently stirred, (iv) centrifugation was performed at 1,000rpm at room temperature for 1 minute, and the supernatant was discarded. (iii) and (iv) were repeated 2 times.
Thereafter, (v) 20mM imidazole (Wako pure chemical industries, ltd.) 4mL was added and sufficiently stirred, (vi) at 1,000rpm at room temperature for 1 minute, discarding the supernatant. (vi) and (v) repeated 2 times. To this was added 500. Mu.L of 250mM imidazole, and the mixture was stirred for 10 minutes at room temperature with a rotary shaker. After that, the mixture was centrifuged at 1,000rpm for 1 minute, and the supernatant emitting green fluorescence was loaded into a new 15mL Falcon tube as a protein purification solution for gel filtration.
(8-4) purification by gel filtration
And (3) replacing imidazole in the protein purification solution with a PBS buffer solution, and purifying to obtain the target fluorescent protein combined with the target peptide sequence. In the above operation, NAP5 column from GE Heat Care Japan was used, and purification was carried out according to the instructions attached to the product.
(9) Selection of fluorescent proteins incorporating targeting peptide sequences
The absorbance (280 nm) of the concentration of the fluorescent protein to which the target peptide sequence is bound and the absorbance (488 nm) of the concentration (forming ability) of the chromophore obtained by the above purification procedure are measured according to a conventional method, and the fluorescent protein to which the target peptide sequence is bound is selected as a target fluorescent protein having an a488/a280 value exceeding 1.5. The results are shown in Table 12.
[ Table 12]
Example 3 preparation of capsules (fluorescent protein-associated driven micelles) having targeting peptide sequences bonded thereto
As a protein, a micelle to which a targeting peptide sequence is bound (fluorescent protein-associated driven micelle) was prepared in the same manner as in example 1, using the fluorescent protein to which a targeting peptide sequence was bound prepared in example 2 instead of GFP.
(1) Luminescence property
The luminescence characteristics of the fluorescent protein-associated micelle to which the targeting peptide sequence was bound prepared above were measured in the same manner as in example 1 (see fig. 10). In the example of fig. 10, the reactant represents a complex in which a silole dendrimer is bound to a fluorescent protein to which a targeting peptide sequence is bound, the unreacted product represents a state in which they are not bound, and each value represents the wavelength (nm) of excitation light. In the case of micelles to which the targeting peptide sequence was bound, a luminescence peak was observed at around 510nm as in example 1.
(2) Characteristics of the particles
The particle characteristics of the liposome or micelle having the targeting peptide sequence bound thereto were measured by dynamic light scattering in the same manner as in example 1 (see fig. 11). In fig. 11, the horizontal axis represents the particle size of the obtained micelle, and the vertical axis represents the percentage of the micelle in the size shown on each horizontal axis in the whole. As a result, particles having a particle diameter of about 100nm to 200nm were confirmed in the same manner as in example 1.
As is clear from the above, the fluorescent protein-binding micelle having a targeting peptide sequence also forms a micelle equivalent to that without a targeting sequence. Further, it is presumed that both the micelle obtained in example 1 and the micelle obtained in this example are fluorescent protein association-driving micelles formed by association of fluorescent proteins.
Example 4 DDS micelle/liposome (vesicle) morphology determination experiment
(1) Preparation of elementary liposomes or micelles
Liposomes or micelles were made as follows. First, the GFP-containing solution was concentrated by centrifugation at 14,000Xg for 15 minutes using a 10K Amicon filtration column (manufactured by Amicon Co., ltd.), and then 1XPBS was added thereto to bring the volume to 99. Mu.L. In order to prepare 50. Mu.M/50. Mu.L of micelles using a 20. Mu.M GFP-containing solution, 137.5. Mu.L of GFP was concentrated.
Next, 1. Mu.L of 100mM DTT was added to the solution, and incubated at room temperature for 10 minutes. The whole amount of the incubated solution was applied to a NICK column (manufactured by GE Heat Care Japan) and 365. Mu.L of 1xPBS was added thereto. Further, 380. Mu.L of 1XPBS was added thereto, and almost the entire amount was collected.
Next, GFP contained in the recovered solution was added to the solution in a molar ratio of 1: 10.53. Mu.L of 7.78mM TPS (2, 3,4, 5-tetraphenyl-1, 1-dimethylsilole) was added and the molecules in solution were allowed to aggregate overnight at 37 ℃.
Next, about 380. Mu.L of the overnight-aggregated solution was added to a 100K Amicon filter column and concentrated by centrifugation at 14,000x g for 10 minutes to obtain about 30. Mu.L as the supernatant on the column. To this was added 100. Mu.L of 1XPBS, and washed by centrifugation at 14,000Xg for 10 minutes. This washing operation was repeated 3 times, and about 300. Mu.L of the washing solution was collected.
After centrifugation at 14,000x g for 10 minutes, the column was inverted and the column supernatant was recovered using a bench top centrifuge. The appropriate amount of 1 × PBS was added to the empty column and the volume was 1.2 times the target volume with 1 × PBS. The resulting mixture was allowed to stand at 4 ℃ for 1 day for equilibration, and diluted 20 times to determine the particle size. Fluorescence was measured using Shimadzu RF5300-PC at an excitation wavelength of 370nm and a measurement wavelength of 488nm for a sample diluted 80 times (range 3X 5).
In addition, about 350. Mu.L of the solution after addition to a 100K Amicon filter and centrifugation at 14,000x g for 10 minutes was used as the column underflow. The resulting mixture was diluted 20-fold with 650. Mu.L of the above washing solution, and the particle size was measured. In addition, in the fluorescence measurement, the sample diluted 25 times was measured with an excitation wavelength of 370nm and a measurement wavelength of 488nm (range of 3X 5). The non-targeted liposomes or micelles obtained here were designated as NSS25 and NSS26.
(2) Determination result obtained by electron microscope
Judgment of liposomes or micelles was carried out using a low-temperature low-vacuum scanning electron microscope (manufactured by Hitachi High-Technologies, catalog No. S-3400N), and as a result, the molecules observed were generally liposomes (vesicles). The observation of the sections was performed under an atmosphere of liquid nitrogen.
With this electron microscope, a reflected electron image of an incident electron beam is obtained as a BSE image, and a secondary electron image is obtained as an SE image. In addition, elemental analysis using X-rays was also performed simultaneously. BSE images are shown in fig. 12 (a) to (C). In the figure, the structures indicated by white circles and white arrows are considered to be salt crystals. Structures indicated by black circles and black arrows are considered vesicle-like substances. In the scanning electron microscope image of low resolution, most vesicle-like molecules are mainly observed. Elemental analysis was performed on a part of the sample, and as a result, silicon molecules were detected (see fig. 12).
Example 5 concentration-dependent stability test of liposomes (vesicles) or micelles
(1) Preparation of sample micelle (micelle having target binding site)
Sample micelles in an amount of 50. Mu.M.times.50. Mu.L were prepared as follows. As basic micelles, 16.1 μ M and 31.6 μ M of the non-targeting micelles (NSS 25 and NSS 26) prepared in example 4 above were used, respectively. Targeting micelles using 11.3. Mu.M of MCF 7-containing sequences as target recognition sites (SEQ ID NOS: 12 and 13 of the sequence Listing).
The micellar solutions containing each liposome or micelle were added to an Amicon 10K filter and centrifuged at 14,000x g for 15 min, and the supernatants were recovered separately. Each micelle solution was made up to 99. Mu.L with 1XPBS, 1mM DTT was added thereto, and the mixture was allowed to stand at room temperature for 10 minutes.
Subsequently, each liposome or micelle solution was treated with a NICK column, and 3.21. Mu.L of TPS was added to each of the resulting treated solutions, followed by standing at 37 ℃ overnight.
(2) Confirmation of concentration dependence of liposomes (vesicles) or micelles
Each of the micelle solutions obtained in the above (1) was applied in an amount of 380. Mu.L to an Amicon 100K filter, and centrifuged at 14,000x g for 10 minutes. About 350. Mu.L of the supernatant fluid was collected as a lower solution and about 30. Mu.L of the supernatant fluid remained on the filter.
The supernatant was kept as it was, 100. Mu.L of 1XPBS was added thereto, and centrifuged at 14,000Xg for 10 minutes to recover about 100. Mu.L of the solution passing through the filter. This operation was repeated 3 times, and the resulting solution and the lower solution were combined, diluted 20-fold, and DLS (particle size distribution) was measured in the same manner as in the basic micelle.
The filter containing the supernatant was placed in a table centrifuge (KUBOTA Co., ltd.), centrifuged for 2 to 3 minutes and recovered. Next, an appropriate amount of 1x PBS was added to the emptied filter and left for 10 minutes. Then, the filter was inverted, and the resulting mixture was centrifuged in a desk centrifuge for 2 to 3 minutes, and the solution in the filter was recovered, and 1XPBS was added thereto to make a volume of 60. Mu.L, to prepare a stock solution (1X) of 50. Mu.M/50. Mu.L.
The stock solution was diluted 5-fold, 10-fold and 50-fold with 1 × PBS and left at room temperature for 1 day for equilibration. Thereafter, the particle size measurement and fluorescence measurement were performed in the same manner as in the case of the basic micelle. It was shown that micelles made above the critical micelle concentration may also be stable after 1 month.
Example 6 confirmation test of protein Properties of DDS micelle
(1) Purification of proteins
In order to confirm the physical properties of the constituent proteins of the micelles, the constituent proteins were purified by Ni NTA Super flow (Qiagen) according to the following procedure.
(1-1) elution of protein from aggregated molecules
First, 50. Mu.L of the basic micelle (50. Mu.M/50. Mu.L) was taken and added to a 50mL Falcon tube (manufactured by Falcon Co.), washed with 20mM of imidazole, and then 250mM of imidazole was added. The reaction was carried out overnight using a rotary shaker to elute the protein from the micelles. The Falcon tube was directly set in a centrifuge (manufactured by KUBOTA Co., ltd.), centrifuged at 12,000rpm for 10 minutes, and the resulting supernatant was transferred to a 15mL Falcon tube.
(1-2) preparation of Ni NTA resin syrup
During centrifugation of the Falcon tubes as described above, preparation of Ni NTA resin (contained in Ni NTA Super flow) was performed. First, 2.5mL of Ni NTA agarose was taken, and the preservative was removed. Next, the solution containing Ni NTA agarose gel was shaken well, mixed well, and transferred to a 15mL Falcon tube.
After that, the gel was precipitated by centrifugation at 1,000rpm for 1 minute using a bench centrifuge, the supernatant was removed with a pipette, 1xPBS 1mL was added and mixed with shaking, and vortex mixing was performed. This operation was repeated 3 times. After 3 rd centrifugation, the supernatant was removed by pipette to prepare a slurry. Storage was carried out at 4 ℃ except for the amount used.
(1-3) purification of Each protein
400. Mu.L of the above slurry was dropped into the above constituent protein solution in a 15mL Falcon tube, taking care not to attach the above slurry to the inner wall of the tube. Then, set in a rotary shaker, adjust the storage preset to the fastest, react for 10 minutes.
Then, the tube was removed from the rotary shaker, centrifuged at 1,000prm for 1 minute using an animal cell centrifuge (manufactured by TAITEC Co., ltd.), and the supernatant was discarded. To the pellet remaining in the bottom of the tube, 1xPBS 4mL was added, vortex-mixed, and centrifuged at 1,000rpm for 1 minute using the above centrifuge. This operation was repeated 2 times.
To the resulting pellet was added 4mL of 20mM imidazole and vortexed, and centrifuged at 1,000rpm for 1 minute using the above centrifuge. This operation was repeated 2 times. Next, 500. Mu.L of 250mM imidazole was added to the resulting pellet, set in a rotary shaker, and the storage preset was adjusted to the fastest speed for 10 minutes of reaction. Next, the tube was removed from the rotary shaker, centrifuged at 1,000rpm for 1 minute using the above animal cells centrifuge, and transferred to the above new 15mL Falcon tube.
The pellet left in the old tube was re-dosed with 250mM imidazole, set in the rotary shaker, and the storage preset was adjusted to the fastest, 5 min reaction. Subsequently, the tube was removed from the rotary shaker, centrifuged at 1,000rpm for 1 minute using the above animal cells in a centrifuge, and the supernatant was combined with the previous supernatant. This operation was repeated 5 times.
(1-4) gel electrophoresis
For each protein (GFP) purified as above, gel electrophoresis was performed as follows. First, about 10. Mu.L each of solutions containing 5. Mu.M of each protein was prepared and added to a 1.5mL capped tube. As a molecular weight marker (ladder marker), 10. Mu.L of Precision Protein broad range prepackaged standard (BioRad) was taken and similarly added to a 1.5mL tube. Separation gels (12%) having the compositions shown in Table 13 below and concentrated gels (4%) having the compositions shown in Table 14 below were prepared.
[ Table 13]
Make up of Capacity of
x 4 gel buffer 2.5mL
40% acrylamide gel solution (bis-acrylamide containing 19 3.12mL
10%APS 50μL
TEMED (formal name: tetramethylethylenediamine) 50μL
Distilled water Allowance of
Total amount of 10mL
[ Table 14]
Composition of Capacity of
x 4 concentrated gel buffer 1.25mL
40% acrylamide gel solution (bis-acrylamide containing 19 0.5mL
10%APS 25μL
TEMED (tetramethyl ethylene diamine) 6μL
Distilled water Balance of
Total amount of 5mL
Each purified protein solution and molecular weight marker were applied, and electrophoresis was performed at 200V, 20mA for 60 minutes, followed by further electrophoresis for 75 minutes. In addition, an electrophoresis buffer having a composition shown in table 15 below was used.
[ Table 15]
Make up of Capacity of
2.5mM Tris (2-amino-3-hydroxymethyl-1, 3-propanediol) 3.03g
192mM Glycine 14.4g
0.1%SDS 1g
Distilled water Balance of
Total amount of 1,000mL
The results are shown in FIG. 19. Fig. 19 (a) shows the result before staining, and fig. 19 (B) shows the result after staining with Coomassie Brilliant Blue (CBB). From the results of gel electrophoresis, it was found that the targeting type 2 (MCF 7-2) has a strong fluorescence intensity but low targeting property because the cage structure composed of carbosilane dendrimer is compact. In addition, it was found that in the case of type 1 enhancement (MCF 7-1+ α stand), the cage structure was loose, targeting was high, but fluorescence was weak.
From the above, it is shown that the manner of tightness of the cage-like structure and the structure of the target recognition site are important.
Example 7 drug encapsulation experiments in DDS liposomes or micelles
As an encapsulated medicament, orange OT (Orange OT) was used. A micelle solution was prepared in the same manner as in the basic micelle preparation procedure described above except that 10.28. Mu.L of 7.78mM TPS was carbonized using an 80. Mu.M GFP-containing solution. Then, the ratio of the molar ratio (final concentration) of the compound to GFP was 1:1 manner, 1 μ L of orange OT (8 mM stock solution of orange OT) was added. Next, the ratio of the molar ratio (final concentration) to GFP was 20: diI282 (400. Mu.M stock solution of DiI 282) was added as described above and allowed to ingest overnight at 37 ℃.
Next, the column supernatant was subjected to constant volume with 1xPBS to 1.2 times the target volume, and then passed through a PVDF filter (pore size 0.45 μm or 0.22 μm), and the particle size and fluorescence were measured at the same dilution ratio by treating and recovering the solution in the same procedure as in the preparation of the basic micelle. The supernatant was treated in the same manner as in the preparation of the basic liposome or micelle, and the particle size and fluorescence were measured at the same dilution ratio. With respect to encapsulation of the agent, both hydrophobic and hydrophilic substances are considered, but it is considered that optimization of the conditions for micelle formation needs to be separately performed.
Example 8 cell uptake assay of DDS liposomes or micelles
(1) Experimental methods
For MCS7 cells that reached confluency, cell suspensions (1 × 10) were prepared by exfoliation with 0.25% trypsin solution 9 one/mL). 3mL of each of the cell suspensions was inoculated into 5 collagen-coated plates (MatTek) or poly-d-lysine plates (MatTek).
After the cells were attached to the bottom surfaces of the wells, the medium was removed from each well by a pipette, and an appropriate amount of DMEM (+) was added to repeat the washing operation 3 times so that the attached cells were not peeled off.
450. Mu.L of DMEM (+) was added to each well of the collagen-coated petri dish for 3 hours and 24 hours observation. Next, 50 μ L of 1x PBS was added to wells of the negative control. To 7.3. Mu.L of type 1 enhancing stock solution, 42.7. Mu.L of 1XPBS was added, and 50. Mu.L of the obtained sample 1 was added to each well of 2 petri dishes. In addition, 41.6. Mu.L of 1XPBS was added to 8.4. Mu.L of the stock solution of the non-targeting type, and the resulting sample 2 was added to 2 additional petri dishes.
1X PBS 50. Mu.L was also added to the wells of the negative control of the poly-d-lysine petri dish. In addition, sample 2, in which 41.9. Mu.L of 1XPBS was added to 8.1. Mu.L of stock solution of non-targeting type (NSS 26), was added to one petri dish for 24-hour observation. Immediately thereafter, photograph taking was carried out at 37 ℃ at 5% CO 2 In the presence of (a) for 3 hours or 24 hours. After the completion of the culture, 1mL of DMEM (+) was added to wash the cells. This operation was repeated 3 times.
(2) Observation results Using a confocal microscope FV-100 (FV 1000D manufactured by Olympus corporation)
For DAPI, 460nm luminescence was observed by excitation with 405nm laser, and the dendrimer moiety was observed. Further, light emission at 515 to 520nm was observed for the GFP region. The observation results are shown in fig. 20A to 20C. In each of fig. 20 (a) and 20 (C), the upper layer is a fluorescence microscope image taken 3 hours after the start of the experiment, and the lower layer is a fluorescence microscope image taken 24 hours after the start of the experiment. Comparing the results at 3 hours (upper panel of fig. 20C) and the results observed at 24 hours (lower panel of fig. 20C), it was considered that micelles having targeting property were more accurately taken into target cells even at 24 hours (see fig. 16 to 18).
Fig. 16 (a) and 18 (a) show the results of the non-targeting type (NSS 25), and in addition, fig. 16 (B) and 18 (B) show the results of the non-targeting type (NSS 26). Fig. 18 (C) shows the results for targeted type 1 micelles.
(3) Analytical method
The analysis software used Image J. The fluorescence intensity of each region was quantified, and the disintegration of the micelle and the remaining of the fluorescent protein were confirmed by the ratio of the fluorescence intensity of the micelle to the fluorescence intensity of the fluorescent protein.
For the measurement of FACS, flowJo was used as software for analysis. In the analysis, cell-only data was used to select a cell population that fluoresces itself. Then, the cell population that fluoresces by itself was subtracted from the total data. The results are shown in FIGS. 13 to 15.
FIG. 13 (A) shows the uptake of the HepG 2-targeted type 1 protein (-) (-) and the MCF 7-targeted type 1 protein (-) (-), and FIG. 13 (B) shows the uptake of the HepG 2-targeted type 1 protein (+) (+) and the MCF 7-targeted type 1 protein (+) (+). Fig. 13 (C) shows uptake of HepG 2-targeted type 1 micelle (-) (-) and MCF 7-targeted type 1 micelle (-) (-), and fig. 13 (D) shows uptake of HepG 2-targeted type 1 protein (+) (+) and MCF 7-targeted type 1 protein (+) (+).
Fig. 14 (a) shows the results in the case of no micelle, fig. 14 (B) and 14 (C) show the results in the case of using a non-targeted micelle, and fig. 14 (D) and 14 (E) show the results in the case of using a targeted micelle. The micelles used in fig. 15 (a) to 15 (E) are the same as in fig. 14. The numbers shown in the figure are the number of cells remaining after subtraction of autofluorescence/total number of cells determined. In table 16 below, the autofluorescent cell population was determined 5 times, and the average value thereof is shown.
[ Table 16]
From the above, it was shown that cells can be targeted if their status is good; furthermore, prolonged exposure of the micelle to the cell may result in the uptake of non-targeted micelles in large amounts, also by normal endocytosis. However, targeted micelles are likely to be taken up more rapidly than non-targeted micelles. In addition, it is considered that the taken-up micelles may be disintegrated in cells.
Example 9 formation of fluorescent protein associated driven micelle in Tris HCl buffer
The fluorescent protein-associated driven micelle of the present application was produced using a Tris hydrochloride buffer instead of PBS used for the micelle production in example 1. First, a fluorescent protein (hereinafter sometimes referred to as "MCF7-1 fluorescent protein") having a targeting peptide sequence bound thereto, which contained 50. Mu.M of the peptide sequence of SEQ ID NO. 1 prepared in example 2, was prepared, 219.2. Mu.L of this solution was concentrated by centrifugation at 14,000x g for 15 minutes using a 10K Amicon filter column (manufactured by Amicon Co., ltd.), and 50mM Tris hydrochloric acid buffer (pH 8.0) was added to the solution to make a volume of 99. Mu.L.
Next, 1. Mu.L of 100mM DTT was added to the solution, and incubated at room temperature for 10 minutes. The whole amount of the incubated solution (100. Mu.L) was applied to a NICK column (manufactured by GE Healthcare Japan) which had been washed 5 times with 0.05M Tris-hydrochloric acid buffer solution (pH 8.0) in advance, and eluted with 365. Mu.L of 0.05. Mu.M Tris-hydrochloric acid buffer solution (pH 8.0). 380. Mu.L of 0.05M Tris-hydrochloric acid buffer (pH 8.0) was further added to elute, and almost the entire amount of the eluate was collected.
To the collected solution, 10.28. Mu.L of 7.78mM TPS (manufactured by Youlabo Co., ltd.) was added, and after stirring for 10 minutes, the molecules in the solution were aggregated at 37 ℃ overnight to prepare a micelle reaction solution. The micelle reaction solution was loaded on a 100K Amicon filter column (Merck), concentrated by centrifugation at 14,000x g for 10 minutes, and then 1XPBS was added to the supernatant on the filter column, and washed by centrifugation at 14,000x g for 10 minutes. This washing operation was repeated 3 times to perform buffer exchange. About 300. Mu.L of the washing solution was recovered and collected to obtain a micelle unreacted solution.
The 100K Amicon filter column was inverted, centrifuged with a mini centrifuge, the column supernatant (purified micellar solution) was recovered, an appropriate amount of 1XPBS was added to the emptied Amicon filter column, and allowed to stand for 10 minutes. And inverting the Amicon filter column, centrifuging, recovering, adding 1XPBS, and metering to 160 mu L to obtain the purified micelle solution. In order to confirm the particle size and stability of the formed micelle in a solution, the following experiment was performed.
The obtained purified micelle solution was diluted 20-fold with 1 × PBS to prepare a measurement sample 1 and a measurement sample 2, which were diluted 50-fold. The micelle unreacted solution was diluted 25-fold with 1 × PBS to obtain sample 3 for measurement. To investigate stability in solution, these dilutions were left to stand at room temperature for 4 days.
The particle size of the particles in sample 1 for measurement was measured using ZETASIZER NANO-S (manufactured by Malvern). As a result, it was found that uniform micelles of about 100 to 200nm were formed (FIG. 21). The fluorescence spectrum of the particles in sample 2 for measurement was measured at an excitation wavelength of 370nm and a measurement wavelength of 488nm using RF5300-PC (Shimadzu corporation). The fluorescence spectrum of the particles contained in the measurement sample 3 is measured under the same conditions as in the measurement sample 2.
Fig. 22A shows the measurement results of the above measurement samples 1 to 3 when prepared, and fig. 22B shows the measurement results after 4 days. In the figure, the unreacted product indicates that MCF7-1 fluorescent protein and SD are in an unbound state, and the reactant indicates that they are in a bound state. Each numerical value represents the wavelength (nm) of excitation light. It was confirmed from FIGS. 22A and 22B that a micelle in which MCF7-1 fluorescent protein was bound to SD was formed, and the formed micelle was stable after 4 days.
As described above, it was confirmed that the SD of the present invention forms uniform and stable micelles by binding to GFP having a targeting cue sequence even in Tris-HCl buffer.
Example 10 fluorescent protein-associated driven micelle formation in HEPES buffer
Micelle formation in the buffer, particle size and stability of the formed micelles were confirmed under the same conditions as in example 9, except that Tris hydrochloride buffer (ph 8.0) was replaced with 50mM HEPES buffer (ph 7.6).
As shown in FIG. 23, uniform micelles of about 100 to 200nm were formed. As shown in fig. 24, the micelles remained stable after 1 day of micelle preparation. Fig. 25 (a) shows the results of the measurement performed at the time of micelle formation, and fig. 25 (B) shows the results of the measurement performed on day 1 after micelle formation.
As shown in FIGS. 25A and 25B, it was confirmed from the results of fluorescence measurement that a micelle in which the MCF7-1 fluorescent protein was bound to SD was formed and the micelle was stably present 1 day after micelle formation.
From the above, it was confirmed that uniform and stable micelles were formed even in the case of using HEPES buffer instead of Tris hydrochloride buffer.
Example 11 fluorescent protein associated driven micelle formation in sodium citrate buffer
The formation of micelles in the buffer, and the particle size and stability of the formed micelles were confirmed by setting the conditions as in example 9, except that 50mM sodium citrate buffer (ph 7.6) was used instead of Tris hydrochloric acid buffer (ph 8.0).
As shown in FIG. 26, uniform micelles of about 100 to 200nm were also formed in the sodium citrate buffer. As shown in fig. 27, the particle size of the micelle hardly changed after 1 day from the preparation of the micelle, indicating that the micelle was stably present in the buffer.
Fig. 28 (a) shows the measurement results at the time of micelle formation, fig. 28 (B) shows the measurement results after 1 day of micelle formation, and fig. 28 (C) shows the measurement results after 2 days of micelle formation. As shown in FIGS. 28A to 28C, it was revealed that a micelle in which the MCF7-1 fluorescent protein was bound to SD was formed and the micelle was stably present at least until day 2 after the micelle formation.
From the above, it was confirmed that uniform and stable micelles were formed even in the case of using a sodium citrate buffer instead of a Tris hydrochloride buffer.
Example 12 formation of fluorescent protein association-driven micelle in Carbonic acid-bicarbonate buffer
The formation of micelles in the buffer, and the particle size and stability of the formed micelles were confirmed by setting the conditions as in example 9, except that a carbonic acid-bicarbonic acid buffer (ph 8.0) was used instead of the Tris hydrochloric acid buffer (ph 8.0).
As shown in fig. 29 to 30, uniform micelles of about 100 to 200nm were formed in the carbonic acid-bicarbonic acid buffer, and the particle size was almost unchanged after 1 day of micelle formation, indicating that the micelles were stably present in the buffer.
Fig. 31 (a) shows the measurement results in the case of micelle formation, fig. 31 (B) shows the measurement results after 1 day of micelle formation, and fig. 31 (C) shows the measurement results after 2 days of micelle formation. As shown in FIGS. 31 (A) to 31 (C), it was confirmed that a micelle in which the MCF7-1 fluorescent protein was bound to SD was formed, and the formed micelle was stably present at least until day 2 after the preparation.
(example 13) Effect of proteins in Dispersion Medium on micelles
In vitro experiments were performed to investigate how the co-existing proteins will affect the micelles formed during delivery in vivo. As a model system, the effect of protein (BSA) contained in a dispersion medium on micelle formation was investigated over time. BSA was selected because of its molecular weight comparable to GFP, its ability to produce proteins in large amounts in blood, and its availability.
First, 50. Mu.M of the fluorescent protein-driven micelle prepared in example 3 (having MCF7-1 as a targeting indication sequence, hereinafter sometimes referred to as "MCF7-1 micelle") was concentrated with a 100K Amicon filter column to prepare a 100. Mu.M MCF7-1 micelle solution.
Next, 100. Mu.L of 4% BSA (manufactured by SHIGMA-ALDRICH) was added to 200. Mu.L of 100. Mu.M MCF7-1 micelle solution to prepare a BSA-micelle mixture (sample). In addition, 100. Mu.L of PBS was added to the control to prepare a PBS-micelle mixture (control). The particle size and micelle stability in solution of the samples and the control at the time of preparation and after storage at 4 ℃ were measured under the same conditions as in example 9.
As shown in FIGS. 31 and 33, micelles having a particle size of about 50 to 200nm were formed. In addition, in the case of storage at 4 ℃, there was no change in the micelle particle size even after 6 days, indicating that the micelle existed in a stable state.
Fig. 34 (a) shows the measurement performed at the start of storage, and fig. 34 (B) shows the measurement performed after 6 days of storage. As shown in fig. 34A, no effect on the micelle state was observed even in the BSA-micelle mixed solution. As shown in FIG. 34B, it was confirmed that the fluorescence intensity of the BSA-micelle mixture was slightly higher than that of the 370nm PBS-micelle mixture, and that the state of the micelles was not affected even in the presence of BSA after 6 days of storage.
From the above, it was shown that even if a protein is present in the dispersion medium, micelles are stably present for at least 6 days.
Example 14 study of route of uptake of micelle into cell
Endocytosis inhibitors were used to study the uptake pathway of the micelles of the invention into cells. First, MCF-7 cells that reached confluence were exfoliated with 0.25% trypsin solution to prepare a cell suspension (1X 10) 9 one/mL). The cell suspension was seeded in 35mm culture dishes (12-well parallel culture dishes were used) at 1.5mL each.
After the cells were attached to the bottom surfaces of the wells, the culture medium was removed from each well by a pipette, and a suitable amount of DMEM (+) was added to wash the wells so that the attached cells were not peeled off. This operation was repeated 3 times.
mu.L of DMEM (+) was added to each well, and 1mM chlorpromazine (Wako pure chemical industries, ltd.) prepared in PBS, 500mM methyl-. Beta. -cyclodextrin (Wako pure chemical industries, ltd.) prepared in DMSO or ethanol, and the like were mixed with each wellAnd 1mM cytochalasin B prepared with DMSO or ethanol (manufactured by Wako pure chemical industries, ltd.) were added to separate wells, and the contents were determined by 5% CO at 37 ℃ in each well 2 Was incubated in the incubator of (1) for 30 minutes.
Then, 50. Mu.L of the 50. Mu.M MCF7-1 micelles prepared in example 3 were added to each well, and the CO was concentrated at 37 ℃ and 5% 2 The incubator of (2) for 6 to 7.5 hours. After the culture was completed, 1mL of DMEM (+) was added to wash the cells. This operation was repeated 3 times.
FACS was used to study the correlation of micelle uptake into cells and fluorescence lifetime. As a result, as shown in fig. 35, the cellular uptake rate of micelles had a positive correlation with the fluorescence lifetime.
In addition, each solvent set in which the solvents used for preparation of the inhibitors shown in table 17 and the solvents used for FACS measurement were combined was prepared, and the influence of the solvents used for FACS measurement was examined.
[ Table 17]
As shown in fig. 36, in the case of the cells treated with methyl- β -cyclodextrin or cytochalasin B, the cellular uptake rate of micelles was less than 100%, and the uptake into the cells was suppressed. On the other hand, in the chlorpromazine-treated cells, the uptake rate of the micelle into the cells was higher than 100%, and the intracellular uptake was promoted.
From the above, it is shown that the uptake route of micelles into cells is endocytosis, lipid raft endocytosis, phagocytosis or macropinocytosis.
Industrial applicability
The invention is useful in the field of pharmaceutical formulations, in particular in the field of drug delivery.
Sequence number 1: targeting recognition sequence peptide introduced into GFP (MCF 7-1)
Sequence number 2: targeting recognition sequence peptide introduced into GFP (MCF 7-2)
Sequence number 3: targeting recognition sequence peptide (MCF 7-1+ alpha stand) incorporated into GFP
Sequence number 4: MCF 7-1-introduced GFP
Sequence number 5: MCF 7-2-introduced GFP
Sequence number 6: GFP introduced with MCF7-1+ alpha stand
Sequence number 7: amino acid sequence of GFP
Sequence number 8: amino acid sequence of GFP
Sequence number 9: amino acid sequence of BFP
Sequence number 10: amino acid sequence of YFP
Sequence number 11: amino acid sequence of fluorescent protein from actinocongestis japonicus
Sequence number 12: forward primer for amplification of MCF7-1
Sequence number 13: reverse primer for amplification of MCF7-1
Sequence number 14: forward primer for MCF7-2 amplification
Sequence number 15: reverse primer for MCF7-2 amplification
Sequence number 16: forward primer for MCF7-1+ alpha stand amplification
Sequence number 17: reverse primer for MCF7-1+ alpha stand amplification
Sequence number 18: forward primer for reverse PCR
Sequence number 19: reverse primer for reverse PCR
Sequence number 20: forward primer for reverse PCR
Sequence number 21: reverse primer for reverse PCR
Sequence number 22: oligonucleotides
Sequence number 23: oligonucleotides
Sequence number 24: oligonucleotides
Sequence number 25: oligonucleotides
Sequence number 26: forward primer for reverse PCR
Sequence number 27: reverse primer for reverse PCR
Sequence number 28: forward primer for reverse PCR
Sequence number 29: reverse primer for reverse PCR
Sequence number 30: forward primer for reverse PCR
Sequence number 31: reverse primer for reverse PCR
Sequence number 32: forward primer for reverse PCR
Sequence number 33: reverse primer for reverse PCR
Sequence number 34: forward primer for reverse PCR
Sequence listing
<110> national University court \22524
Mason corporation (Quarrymen Co. Ltd)
<120> targeting type Shell for drug delivery System Using Carbosilane Dendrimer (Shell for DDS by using Carbosilane Dendrimer)
<130> P17SU002PCT
<160> 34
<170> PatentIn version 3.5
<210> 1
<211> 10
<212> PRT
<213> human (Homo sapiens)
<220>
<221> PEPTIDE (PEPTIDE)
<222> (1)..(10)
<223> MCF7-1
<400> 1
Asp Met Pro Gly Thr Val Leu Pro Gly Gly
1 5 10
<210> 2
<211> 10
<212> PRT
<213> human (Homo sapiens)
<220>
<221> PEPTIDE (PEPTIDE)
<222> (1)..(10)
<223> MCF7-2
<400> 2
Val Pro Thr Asp Thr Asp Tyr Ser Gly Gly
1 5 10
<210> 3
<211> 29
<212> PRT
<213> human (Homo sapiens)
<220>
<221> PEPTIDE (PEPTIDE)
<222> (1)..(29)
<223> MCF7-1+ alpha stand PEPTIDE (MCF 7-1+ alpha stand PEPTIDE)
<400> 3
Asp Met Pro Gly Thr Val Leu Pro Gly Gly Gly Gly Gly Ser Glu Gly
1 5 10 15
Glu Trp Gln Gln Gln Gln His Gln Trp Ala Lys Gln Glu
20 25
<210> 4
<211> 272
<212> PRT
<213> Victoria multitubular luminous jellyfish (Aequorea victoria)
<220>
<221> PEPTIDE (PEPTIDE)
<222> (1)..(272)
<400> 4
Met Ala Ser Met Thr Gly Gly Gln Gln Met Gly Arg Asp Met Pro Gly
1 5 10 15
Thr Val Leu Pro Gly Gly Met Ser Lys Gly Glu Glu Leu Phe Thr Gly
20 25 30
Val Val Pro Ile Leu Val Glu Leu Asp Gly Asp Val Asn Gly His Lys
35 40 45
Phe Ser Val Ser Gly Glu Gly Glu Gly Asp Ala Thr Tyr Gly Lys Leu
50 55 60
Thr Leu Lys Phe Ile Ser Thr Thr Gly Lys Leu Pro Val Pro Trp Pro
65 70 75 80
Thr Leu Val Thr Thr Leu Thr Tyr Gly Val Gln Cys Phe Ser Arg Tyr
85 90 95
Pro Asp His Met Lys Arg His Asp Phe Phe Lys Ser Ala Met Pro Glu
100 105 110
Gly Tyr Val Gln Glu Arg Thr Ile Ser Phe Lys Asp Asp Gly Asn Tyr
115 120 125
Lys Thr Arg Ala Glu Val Lys Phe Glu Gly Asp Thr Leu Val Asn Arg
130 135 140
Ile Glu Leu Lys Gly Ile Asp Phe Lys Glu Asp Gly Asn Ile Leu Gly
145 150 155 160
His Lys Leu Glu Tyr Asn Tyr Asn Ser His Asn Val Tyr Ile Thr Ala
165 170 175
Asp Lys Gln Arg Asn Gly Ile Lys Ala Asn Phe Lys Thr Arg His Asn
180 185 190
Ile Glu Asp Gly Ser Val Gln Leu Ala Asp His Tyr Gln Gln Asn Thr
195 200 205
Pro Ile Gly Asp Gly Pro Val Leu Leu Pro Asp Asn His Tyr Leu Ser
210 215 220
Thr Gln Ser Ala Leu Leu Lys Asp Pro Asn Glu Lys Arg Asp His Met
225 230 235 240
Val Leu Leu Glu Phe Val Thr Ala Ala Gly Ser Gly Ile Thr Asp Glu
245 250 255
Val Asp Gly Thr Glu Leu Tyr Lys Gly Gly His His His His His His
260 265 270
<210> 5
<211> 272
<212> PRT
<213> Victoria multitubular luminous jellyfish (Aequorea victoria)
<220>
<221> PEPTIDE (PEPTIDE)
<222> (1)..(272)
<400> 5
Met Ala Ser Met Thr Gly Gly Gln Gln Met Gly Arg Val Pro Thr Asp
1 5 10 15
Thr Asp Tyr Ser Gly Gly Met Ser Lys Gly Glu Glu Leu Phe Thr Gly
20 25 30
Val Val Pro Ile Leu Val Glu Leu Asp Gly Asp Val Asn Gly His Lys
35 40 45
Phe Ser Val Ser Gly Glu Gly Glu Gly Asp Ala Thr Tyr Gly Lys Leu
50 55 60
Thr Leu Lys Phe Ile Ser Thr Thr Gly Lys Leu Pro Val Pro Trp Pro
65 70 75 80
Thr Leu Val Thr Thr Leu Thr Tyr Gly Val Gln Cys Phe Ser Arg Tyr
85 90 95
Pro Asp His Met Lys Arg His Asp Phe Phe Lys Ser Ala Met Pro Glu
100 105 110
Gly Tyr Val Gln Glu Arg Thr Ile Ser Phe Asn Asp Asp Gly Asn Tyr
115 120 125
Lys Thr Arg Ala Glu Val Lys Phe Glu Gly Asp Thr Leu Val Asn Arg
130 135 140
Ile Glu Leu Lys Gly Ile Asp Phe Lys Glu Asp Gly Asn Ile Leu Gly
145 150 155 160
His Lys Leu Glu Tyr Asn Tyr Asn Ser His Asn Val Tyr Ile Thr Ala
165 170 175
Asp Lys Gln Arg Asn Gly Ile Lys Ala Asn Phe Lys Thr Arg His Asn
180 185 190
Ile Glu Asp Gly Ser Val Gln Leu Ala Asp His Tyr Gln Gln Asn Thr
195 200 205
Pro Ile Gly Asp Gly Pro Val Leu Leu Pro Asp Asn His Tyr Leu Ser
210 215 220
Thr Gln Ser Ala Leu Leu Lys Asp Pro Asn Asp Lys Arg Asp His Met
225 230 235 240
Val Leu Leu Glu Phe Val Thr Ala Ala Gly Ser Gly Ile Thr Asp Glu
245 250 255
Val Asp Gly Thr Glu Leu Tyr Lys Gly Gly His His His His His His
260 265 270
<210> 6
<211> 292
<212> PRT
<213> Victoria multitubular luminous jellyfish (Aequorea victoria)
<220>
<221> PEPTIDE (PEPTIDE)
<222> (1)..(292)
<400> 6
Met Ala Ser Met Thr Gly Gly Gln Gln Met Gly Arg Asp Met Pro Gly
1 5 10 15
Thr Val Leu Pro Gly Gly Gly Gly Gly Ser Glu Gly Glu Trp Gln Gln
20 25 30
Gln Gln His Gln Trp Ala Lys Gln Glu Met Ser Lys Gly Glu Glu Leu
35 40 45
Phe Thr Gly Val Val Pro Ile Leu Val Glu Leu Asp Gly Asp Val Asn
50 55 60
Gly His Lys Phe Ser Val Ser Gly Glu Gly Glu Gly Asp Ala Thr Tyr
65 70 75 80
Gly Lys Leu Thr Leu Lys Phe Ile Ser Thr Thr Gly Lys Leu Pro Val
85 90 95
Pro Trp Pro Thr Leu Val Thr Thr Leu Thr Tyr Gly Val Gln Cys Phe
100 105 110
Ser Arg Tyr Pro Asp His Met Lys Arg His Asp Phe Phe Lys Ser Ala
115 120 125
Met Pro Glu Gly Tyr Val Gln Glu Arg Thr Ile Ser Phe Lys Asp Asp
130 135 140
Gly Asn Tyr Lys Thr Arg Ala Glu Val Lys Phe Glu Gly Asp Thr Leu
145 150 155 160
Val Asn Arg Ile Glu Leu Lys Gly Ile Asp Phe Lys Glu Asp Gly Asn
165 170 175
Ile Leu Gly His Lys Leu Glu Tyr Asn Tyr Asn Ser His Asn Val Tyr
180 185 190
Ile Thr Ala Asp Lys Gln Arg Asn Gly Ile Lys Ala Asn Phe Lys Thr
195 200 205
Arg His Asn Ile Glu Asp Gly Ser Val Gln Leu Ala Asp His Tyr Gln
210 215 220
Gln Asn Thr Pro Ile Gly Asp Gly Pro Val Leu Leu Pro Asp Asn His
225 230 235 240
Tyr Leu Ser Thr Gln Ser Ala Leu Leu Lys Asp Pro Asn Glu Lys Arg
245 250 255
Asp His Met Val Leu Leu Glu Phe Val Thr Ala Ala Gly Ser Gly Ile
260 265 270
Thr Asp Glu Val Asp Gly Thr Cys Glu Leu Tyr Lys Gly Gly His His
275 280 285
His His His His
290
<210> 7
<211> 263
<212> PRT
<213> Victoria multitubular luminous jellyfish (Aequorea victoria)
<220>
<221> PEPTIDE (PEPTIDE)
<222> (1)..(263)
<223> GFP
<400> 7
Met Ala Ser Met Thr Gly Gly Gln Gln Met Gly Arg Met Ser Lys Gly
1 5 10 15
Glu Glu Leu Phe Thr Gly Val Val Pro Ile Leu Val Glu Leu Asp Gly
20 25 30
Asp Val Asn Gly His Lys Phe Ser Val Ser Gly Glu Gly Glu Gly Asp
35 40 45
Ala Thr Tyr Gly Lys Leu Thr Leu Lys Phe Ile Ser Thr Thr Gly Lys
50 55 60
Leu Pro Val Pro Trp Pro Thr Leu Val Thr Thr Leu Thr Tyr Gly Val
65 70 75 80
Gln Cys Phe Ser Arg Tyr Pro Asp His Met Lys Arg His Asp Phe Phe
85 90 95
Lys Ser Ala Met Pro Glu Gly Tyr Val Gln Glu Arg Thr Ile Ser Phe
100 105 110
Lys Asp Asp Gly Asn Tyr Lys Thr Arg Ala Glu Val Lys Phe Glu Gly
115 120 125
Asp Thr Leu Val Asn Arg Ile Glu Leu Lys Gly Ile Asp Phe Lys Glu
130 135 140
Asp Gly Asn Ile Leu Gly His Lys Leu Glu Tyr Asn Tyr Asn Ser His
145 150 155 160
Asn Val Tyr Ile Thr Ala Asp Lys Gln Lys Asn Gly Ile Lys Ala Asn
165 170 175
Phe Lys Thr Arg His Asn Ile Glu Asp Gly Ser Val Gln Leu Ala Asp
180 185 190
His Tyr Gln Gln Asn Thr Pro Ile Gly Asp Gly Pro Val Leu Leu Pro
195 200 205
Asp Asn His Tyr Leu Ser Thr Gln Ser Ala Leu Leu Lys Asp Pro Asn
210 215 220
Glu Lys Arg Asp His Met Val Leu Leu Glu Phe Val Thr Ala Ala Gly
225 230 235 240
Ser Gly Ile Thr Asp Glu Val Asp Gly Thr Cys Glu Leu Tyr Lys Gly
245 250 255
Gly His His His His His His
260
<210> 8
<211> 258
<212> PRT
<213> Victoria multitubular luminous jellyfish (Aequorea victoria)
<220>
<221> PEPTIDE (PEPTIDE)
<222> (1)..(258)
<223> GFP
<400> 8
Met Ala Ser Met Thr Gly Gly Gln Gln Met Gly Arg Met Ser Lys Gly
1 5 10 15
Glu Glu Leu Phe Thr Gly Val Val Pro Ile Leu Val Glu Leu Asp Gly
20 25 30
Asp Val Asn Gly His Lys Phe Ser Val Ser Gly Glu Gly Glu Gly Asp
35 40 45
Ala Thr Tyr Gly Lys Leu Thr Leu Lys Phe Ile Cys Thr Thr Gly Lys
50 55 60
Leu Pro Val Pro Trp Pro Thr Leu Val Thr Thr Leu Thr Tyr Gly Val
65 70 75 80
Gln Cys Phe Ser Arg Tyr Pro Asp His Met Lys Arg His Asp Phe Phe
85 90 95
Lys Ser Ala Met Pro Glu Gly Tyr Val Gln Glu Arg Thr Ile Ser Phe
100 105 110
Lys Asp Asp Gly Asn Tyr Lys Thr Arg Ala Glu Val Lys Phe Glu Gly
115 120 125
Asp Thr Leu Val Asn Arg Ile Glu Leu Lys Gly Ile Asp Phe Lys Glu
130 135 140
Asp Gly Asn Ile Leu Gly His Lys Leu Glu Tyr Asn Tyr Asn Ser His
145 150 155 160
Asn Val Tyr Ile Thr Ala Asp Lys Gln Lys Asn Gly Ile Lys Ala Asn
165 170 175
Phe Lys Thr Arg His Asn Ile Glu Asp Gly Ser Val Gln Leu Ala Asp
180 185 190
His Tyr Gln Gln Asn Thr Pro Ile Gly Asp Gly Pro Val Leu Leu Pro
195 200 205
Asp Asn His Tyr Leu Ser Thr Gln Ser Ala Leu Leu Lys Asp Pro Asn
210 215 220
Glu Lys Arg Asp His Met Val Leu Leu Glu Phe Val Thr Ala Ala Gly
225 230 235 240
Ile Thr His Gly Met Asp Glu Leu Tyr Lys Gly Gly His His His His
245 250 255
His His
<210> 9
<211> 259
<212> PRT
<213> Victoria multitubular luminous jellyfish (Aequorea victoria)
<220>
<221> PEPTIDE (PEPTIDE)
<222> (1)..(259)
<223> GFP
<400> 9
Met Ala Ser Met Thr Gly Gly Gln Gln Met Gly Arg Met Val Ser Lys
1 5 10 15
Gly Glu Glu Leu Phe Thr Gly Val Val Pro Ile Leu Val Glu Leu Asp
20 25 30
Gly Asp Val Asn Gly His Lys Phe Ser Val Ser Gly Glu Gly Glu Gly
35 40 45
Asp Ala Thr Tyr Gly Lys Leu Thr Leu Lys Phe Ile Cys Thr Thr Gly
50 55 60
Lys Leu Pro Val Pro Trp Pro Thr Leu Val Thr Thr Leu Thr His Gly
65 70 75 80
Val Gln Cys Phe Ser Arg Tyr Pro Asp His Met Lys Gln His Asp Phe
85 90 95
Phe Lys Ser Ala Met Pro Glu Gly Tyr Val Gln Glu Arg Thr Ile Phe
100 105 110
Phe Lys Asp Asp Gly Asn Tyr Lys Thr Arg Ala Glu Val Lys Phe Glu
115 120 125
Gly Asp Thr Leu Val Asn Arg Ile Glu Leu Lys Gly Ile Asp Phe Lys
130 135 140
Glu Asp Gly Asn Ile Leu Gly His Lys Leu Glu Tyr Asn Phe Asn Ser
145 150 155 160
His Asn Val Tyr Ile Met Ala Asp Lys Gln Lys Asn Gly Ile Lys Val
165 170 175
Asn Phe Lys Ile Arg His Asn Ile Glu Asp Gly Ser Val Gln Leu Ala
180 185 190
Asp His Tyr Gln Gln Asn Thr Pro Ile Gly Asp Gly Pro Val Leu Leu
195 200 205
Pro Asp Asn His Tyr Leu Ser Thr Gln Ser Ala Leu Ser Lys Asp Pro
210 215 220
Asn Glu Lys Arg Asp His Met Val Leu Leu Glu Phe Val Thr Ala Ala
225 230 235 240
Gly Ile Thr Leu Gly Met Asp Glu Leu Tyr Lys Gly Gly His His His
245 250 255
His His His
<210> 10
<211> 259
<212> PRT
<213> Victoria multitubular luminous jellyfish (Aequorea victoria)
<220>
<221> PEPTIDE (PEPTIDE)
<222> (1)..(259)
<400> 10
Met Ala Ser Met Thr Gly Gly Gln Gln Met Gly Arg Met Val Ser Lys
1 5 10 15
Gly Glu Glu Leu Phe Thr Gly Val Val Pro Ile Leu Val Glu Leu Asp
20 25 30
Gly Asp Val Asn Gly His Lys Phe Ser Val Ser Gly Glu Gly Glu Gly
35 40 45
Asp Ala Thr Tyr Gly Lys Leu Thr Leu Lys Phe Ile Cys Thr Thr Gly
50 55 60
Lys Leu Pro Val Pro Trp Pro Thr Leu Val Thr Thr Phe Gly Tyr Gly
65 70 75 80
Leu Gln Cys Phe Ala Arg Tyr Pro Asp His Met Lys Gln His Asp Phe
85 90 95
Phe Lys Ser Ala Met Pro Glu Gly Tyr Val Gln Glu Arg Thr Ile Phe
100 105 110
Phe Lys Asp Asp Gly Asn Tyr Lys Thr Arg Ala Glu Val Lys Phe Glu
115 120 125
Gly Asp Thr Leu Val Asn Arg Ile Glu Leu Lys Gly Ile Asp Phe Lys
130 135 140
Glu Asp Gly Asn Ile Leu Gly His Lys Leu Glu Tyr Asn Tyr Asn Ser
145 150 155 160
His Asn Val Tyr Ile Met Ala Asp Lys Gln Lys Asn Gly Ile Lys Val
165 170 175
Asn Phe Lys Ile Arg His Asn Ile Glu Asp Gly Ser Val Gln Leu Ala
180 185 190
Asp His Tyr Gln Gln Asn Thr Pro Ile Gly Asp Gly Pro Val Leu Leu
195 200 205
Pro Asp Asn His Tyr Leu Ser Tyr Gln Ser Ala Leu Ser Lys Asp Pro
210 215 220
Asn Glu Lys Arg Asp His Met Val Leu Leu Glu Phe Val Thr Ala Ala
225 230 235 240
Gly Ile Thr Leu Gly Met Asp Glu Leu Tyr Lys Gly Gly His His His
245 250 255
His His His
<210> 11
<211> 236
<212> PRT
<213> Victoria multi-tube luminous jellyfish (Actinia equina)
<220>
<221> PEPTIDE (PEPTIDE)
<222> (1)..(236)
<220>
<221> PEPTIDE (PEPTIDE)
<222> (1)..(236)
<223> GFP
<400> 11
Met Ala Ser Ser Glu Asp Val Ile Lys Glu Phe Met Arg Phe Lys Val
1 5 10 15
Arg Met Glu Gly Ser Val Asn Gly His Glu Phe Glu Ile Glu Gly Glu
20 25 30
Gly Glu Gly Arg Pro Tyr Glu Gly Thr Gln Thr Ala Lys Leu Lys Val
35 40 45
Thr Lys Gly Gly Pro Leu Pro Phe Ala Trp Asp Ile Leu Ser Pro Gln
50 55 60
Phe Gln Tyr Gly Ser Lys Val Tyr Val Lys His Pro Ala Asp Ile Pro
65 70 75 80
Asp Tyr Lys Lys Leu Ser Phe Pro Glu Gly Phe Lys Trp Glu Arg Val
85 90 95
Met Asn Phe Glu Asp Gly Gly Val Val Thr Val Thr Gln Asp Ser Ser
100 105 110
Leu Gln Asp Gly Cys Phe Ile Tyr Lys Val Lys Phe Ile Gly Val Asn
115 120 125
Phe Pro Ser Asp Gly Pro Val Met Gln Lys Lys Thr Met Gly Trp Glu
130 135 140
Pro Ser Thr Glu Arg Leu Tyr Pro Arg Asp Gly Val Leu Lys Gly Glu
145 150 155 160
Ile His Lys Ala Leu Lys Leu Lys Asp Gly Gly His Tyr Leu Val Glu
165 170 175
Phe Lys Ser Ile Tyr Met Ala Lys Lys Pro Val Gln Leu Pro Gly Tyr
180 185 190
Tyr Tyr Val Asp Ser Lys Leu Asp Ile Thr Ser His Asn Glu Asp Tyr
195 200 205
Thr Ile Val Glu Gln Tyr Glu Arg Thr Glu Gly Arg His His Leu Phe
210 215 220
Leu Gly Thr Cys Gly Gly His His His His His His
225 230 235
<210> 12
<211> 45
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<220>
<223> primers (Primer)
<220>
<221> prim_transcript
<222> (1)..(45)
<400> 12
cctggtactg ttcttcctgg tggtatgagt aaaggagaag aactt 45
<210> 13
<211> 27
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<220>
<223> primers (Primer)
<220>
<221> prim_transcript
<222> (1)..(27)
<223> primers (Primer)
<400> 13
catatcgcga cccatttgct gtccacc 27
<210> 14
<211> 45
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<220>
<223> primers (Primer)
<220>
<221> prim_transcript
<222> (1)..(45)
<223> primer for MCF7-1 (primer for MCF 7-1)
<400> 14
actgatactg attatagtgg aggaatgagt aaaggagaag aactt 45
<210> 15
<211> 27
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<220>
<223> Primer (Primer)
<220>
<221> prim_transcript
<222> (1)..(27)
<223> primer for MCF7-1 (primer for MCF 7-1)
<400> 15
aggaacgcga cccatttgct gtccacc 27
<210> 16
<211> 51
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<220>
<223> primers (Primer)
<220>
<221> prim_transcript
<222> (1)..(51)
<223> primer for MCF7-2 (primer for MCF 7-2)
<400> 16
caacaacaac aacatcaatg ggcaaaacaa gaaatgagta aaggagaaga a 51
<210> 17
<211> 42
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<220>
<223> primers (Primer)
<220>
<221> prim_transcript
<222> (1)..(42)
<223> primer for MCF7-2 (primer for MCF 7-2)
<400> 17
ccattcacct tcactaccac caccaccacc aggaagaaca gt 42
<210> 18
<211> 22
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<220>
<223> primers (Primer)
<220>
<221> prim_transcript
<222> (1)..(22)
<223> primer for MCF7-1+ alpha stand PEPTIDE (primer for MCF7-1+ alpha stand PEPTIDE)
<400> 18
cattgaagat ggctccgttc aa 22
<210> 19
<211> 22
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<220>
<223> primers (Primer)
<220>
<221> prim_transcript
<222> (1)..(22)
<223> primer for MCF7-1+ alpha stand PEPTIDE (primer for MCF7-1+ alpha stand PEPTIDE)
<400> 19
ttgtggcgag ttttgaagtt ag 22
<210> 20
<211> 70
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<220>
<223> Primer (Primer) for inverse PCR
<220>
<221> prim_transcript
<222> (1)..(70)
<223> primer for reverse PCR (primer for inverse PCR)
<400> 20
ctcgaccata tggctagcat gactggtgga cagcaaatgg gtcgcatgag taaaggagaa 60
gaacttttca 70
<210> 21
<211> 54
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<220>
<223> primers (Primer)
<220>
<221> prim_transcript
<222> (1)..(54)
<223> primer for reverse PCR (primer for inverse PCR)
<400> 21
tgacgtgaat tcattagtga tggtgatggt gatgtttgta gagctcatcc atgc 54
<210> 22
<211> 25
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<220>
<223> primers (Primer)
<220>
<221> prim_transcript
<222> (1)..(25)
<223> primer for reverse PCR (primer for inverse PCR)
<220>
<221> misc_feature
<222> (13)..(14)
<223> n is a, c, g, or t
<400> 22
cttaaattta ttnnkactgg aaaac 25
<210> 23
<211> 20
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<220>
<223> primers (Primer)
<220>
<221> prim_transcript
<222> (1)..(20)
<223> primer for reverse PCR (primer for inverse PCR)
<400> 23
ggtaagtttt ccgtatgttg 20
<210> 24
<211> 26
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<220>
<223> Oligonucleotide (Oligonucleotide)
<220>
<221> misc_binding
<222> (1)..(26)
<220>
<221> misc_feature
<222> (9)..(10)
<223> n is a, c, g or t
<400> 24
gtgttcaann kttttcccgt tatccg 26
<210> 25
<211> 22
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<220>
<223> Oligonucleotide (Oligonucleotide)
<220>
<221> misc_binding
<222> (1)..(22)
<400> 25
catacgtcag agtagtgaca ag 22
<210> 26
<211> 23
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<220>
<223> Oligonucleotide (Oligonucleotide)
<220>
<221> misc_binding
<222> (1)..(23)
<400> 26
tgtcttttca ctggagttgt ccc 23
<210> 27
<211> 21
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<220>
<223> Oligonucleotide (Oligonucleotide)
<220>
<221> misc_binding
<222> (1)..(21)
<400> 27
ttctccttta ctcatttttt c 21
<210> 28
<211> 24
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<220>
<223> Primer (Primer)
<220>
<221> prim_transcript
<222> (1)..(24)
<223> primer for reverse PCR (primer for inverse PCR)
<400> 28
tgcacacatg gcatggatga gctc 24
<210> 29
<211> 21
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<220>
<223> Primer (Primer)
<220>
<221> prim_transcript
<222> (1)..(21)
<223> primer for reverse PCR (primer for inverse PCR)
<400> 29
cccagcagca gttacaaact c 21
<210> 30
<211> 33
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<220>
<223> Primer (Primer)
<220>
<221> prim_transcript
<222> (1)..(33)
<223> primer for reverse PCR (primer for inverse PCR)
<400> 30
cagcgccgtt gtgagctcta caaataatga att 33
<210> 31
<211> 21
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<220>
<223> primers (Primer)
<220>
<221> prim_transcript
<222> (1)..(21)
<223> primer for reverse PCR (primer for inverse PCR)
<400> 31
tgtaatccca gcagcagtta c 21
<210> 32
<211> 21
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<220>
<223> primers (Primer)
<220>
<221> prim_transcript
<222> (1)..(21)
<223> primer for reverse PCR (primer for inverse PCR)
<400> 32
acatgtgagc tctacaaata a 21
<210> 33
<211> 18
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<220>
<223> primers (Primer)
<220>
<221> prim_transcript
<222> (1)..(18)
<400> 33
acggccctgt gtaatccc 18
<210> 34
<211> 21
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<220>
<223> primers (Primer)
<220>
<221> prim_transcript
<222> (1)..(21)
<223> primer for reverse PCR (primer for inverse PCR)
<400> 34
ggaacatgtg agctctacaa a 21

Claims (10)

1. A capsule for a target tissue-specific delivery-type drug delivery system, which is composed of an aggregate molecule having a target sequence-presenting part and represented by the formula (I),
the capsule for the target tissue-specific delivery type drug delivery system is promoted to be taken into cells through any one intracellular transfer pathway selected from the group consisting of endocytosis mediated by a cell caveolae, endocytosis mediated by a lipid raft, macropinocytosis and phagocytosis,
the Targeting Sequence Presenting Part (TSPP) is composed of a fluorescent protein and a peptide for target tissue-specific delivery, the peptide has a sequence described in any one selected from the group consisting of sequence numbers 1 to 3 of the sequence listing,
DMPGTVLPGG (sequence number 1 of sequence Listing)
VPTDYSGG (sequence number 2 of sequence list)
DMPGTVLPGGGGGSEGEWQ QQQQHQWAKQE (SEQ ID NO: 3 of the sequence Listing)
The aggregating molecules aggregate in an aqueous solvent to constitute a capsule capable of encapsulating at least 1 molecule selected from the group consisting of proteins, nucleic acids and hydrophobic molecules having a molecular weight of 20 ten thousand or less,
[ solution 1]
Wherein T represents a bromine atom or a targeting sequence presenting part represented by the following formula (II), and n1 and n2 each represent the number of the targeting sequence presenting parts, (3-n 1) and (3-n 2) represent the number of bromine atoms, n1 and n2 are integers of 0 to 3 and are not simultaneously 0,
[ solution 2]
2. The capsule for a target tissue-specific delivery type drug delivery system according to claim 1, wherein the capsule has a diameter of 50nm to 500 nm.
3. The capsule for a target tissue-specific delivery type drug delivery system according to claim 1, wherein the aqueous solvent is any one buffer selected from the group consisting of physiological saline, phosphate-buffered physiological saline, tris-hcl buffer, HEPES buffer, sodium citrate buffer, and carbonic acid-bicarbonate buffer.
4. The capsule for a target tissue-specific delivery type drug delivery system according to claim 1, wherein the peptide has a tissue-specific delivery function and a function of promoting the uptake of the aggregates of the tissue-specific delivery into cells, and specifically binds to a target protein selected from the group consisting of a surface antigen, a receptor, a portal, a transporter and a channel expressed in the target tissue.
5. The capsule for a target tissue-specific delivery type drug delivery system according to claim 1, wherein the peptide has a sequence selected from any one of the group consisting of SEQ ID Nos. 4 to 6 of the sequence Listing,
MASMTGGQQMGGR DMPGTVLPGG MSKGEELFTG VPILVELDG DVNGHKKFSVS GEGEGEGEGDATYG KLTLKFISTT GKLPVPWPTL VTTLTYTGVGQC FSRYPDHMKR HDFFKSAMPE GYVQERTISF KDDGNYDGNYNYKTRA EVKFEGDTLV NRIELKGGIDF KEDGNILGHKL LEYNSSHNV YITADGNG QANFKTRFK IEDGSVQLAD HYQQNTPIGD GPVLLPYVLLPYTQLSTQSALLKD PNEKRDHMVL LEFVTAAGSGIT DEVT HHHHHHHH (SEQ ID No. 4 of sequence Listing)
MASMTGGQQMGGR VPTDTDYSGG MSKGEELFTG VPIPELDG DVNGHKFVS GEGEGEGDYG KLTLKFISTT GKLPVPWPTL VTTLTYTGVGQC FSRYPDHMKR HDFFKSAMPE GYVQERTISF NDDGNYDGNYKTRA EVKFEGDTLV NRIELKGGIDF KEDGNILGHK LEYNYNSKN YIITKNG QRKANKTRHN IEDGSVQLAD HYQQPIPD GPVLLPVDSHWNY LSTQSALLKD PNRDHMVL LEFVTAAGSGIT DEVDGT DEVYK GG HHHHHHHHHHHHHH (SEQ ID No. 5 of sequence List)
MASMTGGQQMGGR DMPGTVGGGGGSEGEWQQQQQQQHQWAKQMSKGEELFTG VPILVELDGDVDG DVNGHKFGEGEGDATYG KLTLKFISTT GKLPVPWPTL VTTLTYTGVGQC FSRYPDHMKR HDFFAMPE GYVQERTISF KDNYKTRA EVKFEGDTNRILLNKL KEDGNILGHYNYNYNYNV YITTKQRKANKKFDG HYQQQNTPIGD GPVLNHY TQLSSAKD PNRDHMVL LEFVDAGAAGTAATDEV DEVTC HHHHHH (SEQ ID No. 6 of sequence Listing).
6. The capsule for a target tissue-specific delivery type drug delivery system according to claim 1, wherein the target tissue is any one tissue selected from the group consisting of a normal tissue in which inflammation has occurred, a tissue including a cell in which undesired gene expression is observed, and a tissue composed of tumor cells.
7. The capsule for a target tissue-specific delivery type drug delivery system according to claim 1, wherein the target tissue is a tissue composed of cells in which undesired gene expression is observed.
8. The capsule for a target tissue-specific delivery type drug delivery system according to claim 1, wherein the aggregating molecule represented by formula (I) is an aggregating molecule represented by a molecule having any one structure selected from the group consisting of formulae (III) to (VI) below,
wherein TSPP represents a fluorescent protein having a targeting sequence presenting part,
[ solution 3]
[ solution 4]
[ solution 5]
[ solution 6]
9. The capsule for a target tissue-specific delivery type drug delivery system according to claim 8, wherein the fluorescent protein is any one fluorescent protein selected from the group consisting of red fluorescent protein, yellow fluorescent protein, blue fluorescent protein and green fluorescent protein.
10. A use of a capsule for a target-tissue-specific delivery-type drug delivery system, which is composed of an aggregating molecule having a target-sequence presenting part and represented by the following formula (I) and aggregates the aggregating molecule, in promoting the target-tissue-specific delivery-type capsule to be taken into a cell,
wherein the Targeting Sequence Presenting Part (TSPP) is composed of a fluorescent protein and a protein or peptide for target tissue specific delivery,
the aggregating molecules aggregate in an aqueous solvent to constitute a capsule capable of encapsulating at least 1 molecule selected from the group consisting of proteins, nucleic acids and hydrophobic molecules having a molecular weight of 20 ten thousand or less,
[ solution 1]
Wherein T represents a bromine atom or a targeting sequence presenting part represented by the following formula (II), and n1 and n2 each represent the number of the targeting sequence presenting parts, (3-n 1) and (3-n 2) represent the number of bromine atoms, n1 and n2 are integers of 0 to 3 and are not simultaneously 0,
[ solution 2]
HK19123640.5A 2016-05-27 2017-05-26 Capsule for drug delivery systems of target tissue-specific delivery type using carbosilane dendrimer HK40000570B (en)

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
JP2016-106700 2016-05-27

Publications (2)

Publication Number Publication Date
HK40000570A HK40000570A (en) 2020-02-14
HK40000570B true HK40000570B (en) 2023-09-01

Family

ID=

Similar Documents

Publication Publication Date Title
US8846081B2 (en) Liposome compositions and methods of use thereof
JP4934214B2 (en) Oil body carrier, targeted therapy and / or its use in detection
CN110790829B (en) Application of antibody prepared by using pHLIP extracellular segment as antigen in preparation of antitumor drugs
Xia et al. PM1-loaded recombinant human H-ferritin nanocages: a novel pH-responsive sensing platform for the identification of cancer cells
US10918726B2 (en) Carbosilane dendrimer and aggregatable carrier obtained using said dendrimer for drug delivery system
US10772973B2 (en) Targeted shell for use in drug delivery system utilizing carbosilane dendrimer
KR102461620B1 (en) Endocytosis enhancer for drug delivery system
HK40000570A (en) Capsule for drug delivery systems of target tissue-specific delivery type using carbosilane dendrimer
HK40090445A (en) Use of a target tissue-specific delivery type capsule for a drug delivery system
HK1259626B (en) Targeted shell for use in drug delivery system utilizing carbosilane dendrimer
HK40106318A (en) Endocytosis enhancer for drug delivery systems and preparation method thereof
HK40014054B (en) Endocytosis enhancer for drug delivery systems
HK40014054A (en) Endocytosis enhancer for drug delivery systems
EP4199907A1 (en) Targeted antigen delivery system and uses thereof
WO2013061818A1 (en) Novel peptide complex and hybrid complex thereof, and use of said hybrid complex