FR3135094A1 - Bacterial heterologous protein expression system - Google Patents
Bacterial heterologous protein expression system Download PDFInfo
- Publication number
- FR3135094A1 FR3135094A1 FR2204127A FR2204127A FR3135094A1 FR 3135094 A1 FR3135094 A1 FR 3135094A1 FR 2204127 A FR2204127 A FR 2204127A FR 2204127 A FR2204127 A FR 2204127A FR 3135094 A1 FR3135094 A1 FR 3135094A1
- Authority
- FR
- France
- Prior art keywords
- sequence
- plasmid
- gene
- seq
- bacteria
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 108090000623 proteins and genes Proteins 0.000 title claims abstract description 107
- 102000004169 proteins and genes Human genes 0.000 title claims abstract description 62
- 230000014509 gene expression Effects 0.000 title claims abstract description 38
- 230000001580 bacterial effect Effects 0.000 title description 4
- 241000894006 Bacteria Species 0.000 claims abstract description 33
- 239000013612 plasmid Substances 0.000 claims description 51
- 101710159752 Poly(3-hydroxyalkanoate) polymerase subunit PhaE Proteins 0.000 claims description 22
- 101710130262 Probable Vpr-like protein Proteins 0.000 claims description 22
- 230000005526 G1 to G0 transition Effects 0.000 claims description 20
- 101150040772 CALY gene Proteins 0.000 claims description 15
- 238000000034 method Methods 0.000 claims description 9
- 101150077915 oppA gene Proteins 0.000 claims description 9
- 241000193830 Bacillus <bacterium> Species 0.000 claims description 8
- 101150056901 NPPC gene Proteins 0.000 claims description 8
- 238000004519 manufacturing process Methods 0.000 claims description 8
- 101150050662 plcB gene Proteins 0.000 claims description 8
- 230000028070 sporulation Effects 0.000 claims description 8
- 101100460773 Geobacillus stearothermophilus nprA gene Proteins 0.000 claims description 7
- 108700007698 Genetic Terminator Regions Proteins 0.000 claims description 6
- 238000000746 purification Methods 0.000 claims description 6
- 108020004999 messenger RNA Proteins 0.000 claims description 5
- 230000000087 stabilizing effect Effects 0.000 claims description 5
- 101150092571 cry1Ac gene Proteins 0.000 claims description 4
- 230000008569 process Effects 0.000 claims description 4
- 238000002360 preparation method Methods 0.000 claims description 3
- 241000193388 Bacillus thuringiensis Species 0.000 abstract description 18
- 229940097012 bacillus thuringiensis Drugs 0.000 abstract description 18
- 101710167800 Capsid assembly scaffolding protein Proteins 0.000 abstract description 8
- 101710113540 ORF2 protein Proteins 0.000 abstract description 8
- 101710090523 Putative movement protein Proteins 0.000 abstract description 8
- 239000013604 expression vector Substances 0.000 abstract description 5
- 238000003259 recombinant expression Methods 0.000 abstract description 4
- 241000192125 Firmicutes Species 0.000 abstract description 2
- 210000004027 cell Anatomy 0.000 description 14
- 239000012634 fragment Substances 0.000 description 14
- 108091034117 Oligonucleotide Proteins 0.000 description 12
- 108020004414 DNA Proteins 0.000 description 11
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 10
- 108090000790 Enzymes Proteins 0.000 description 6
- 102000004190 Enzymes Human genes 0.000 description 6
- 239000013078 crystal Substances 0.000 description 6
- 229940088598 enzyme Drugs 0.000 description 6
- 239000002609 medium Substances 0.000 description 6
- 239000003053 toxin Substances 0.000 description 5
- 231100000765 toxin Toxicity 0.000 description 5
- 108700012359 toxins Proteins 0.000 description 5
- 108010006519 Molecular Chaperones Proteins 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 238000010276 construction Methods 0.000 description 4
- 239000001963 growth medium Substances 0.000 description 4
- 238000013518 transcription Methods 0.000 description 4
- 108091026890 Coding region Proteins 0.000 description 3
- 102000005431 Molecular Chaperones Human genes 0.000 description 3
- 230000006037 cell lysis Effects 0.000 description 3
- 230000000694 effects Effects 0.000 description 3
- 230000012010 growth Effects 0.000 description 3
- 230000000749 insecticidal effect Effects 0.000 description 3
- 230000035897 transcription Effects 0.000 description 3
- 230000009466 transformation Effects 0.000 description 3
- 238000011144 upstream manufacturing Methods 0.000 description 3
- 102100024630 Asc-type amino acid transporter 1 Human genes 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 244000063299 Bacillus subtilis Species 0.000 description 2
- 235000014469 Bacillus subtilis Nutrition 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 239000008118 PEG 6000 Substances 0.000 description 2
- 229920002584 Polyethylene Glycol 6000 Polymers 0.000 description 2
- 101150081875 Slc7a10 gene Proteins 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 230000015556 catabolic process Effects 0.000 description 2
- 239000013611 chromosomal DNA Substances 0.000 description 2
- 230000004186 co-expression Effects 0.000 description 2
- 238000009833 condensation Methods 0.000 description 2
- 230000005494 condensation Effects 0.000 description 2
- 238000002425 crystallisation Methods 0.000 description 2
- 230000008025 crystallization Effects 0.000 description 2
- 230000001461 cytolytic effect Effects 0.000 description 2
- 231100000433 cytotoxic Toxicity 0.000 description 2
- 230000001472 cytotoxic effect Effects 0.000 description 2
- 238000006731 degradation reaction Methods 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- MTHSVFCYNBDYFN-UHFFFAOYSA-N diethylene glycol Chemical compound OCCOCCO MTHSVFCYNBDYFN-UHFFFAOYSA-N 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 230000008707 rearrangement Effects 0.000 description 2
- 230000010076 replication Effects 0.000 description 2
- 210000003705 ribosome Anatomy 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 101150042065 spo0A gene Proteins 0.000 description 2
- 210000000130 stem cell Anatomy 0.000 description 2
- 230000014616 translation Effects 0.000 description 2
- 102100024341 10 kDa heat shock protein, mitochondrial Human genes 0.000 description 1
- 102100038222 60 kDa heat shock protein, mitochondrial Human genes 0.000 description 1
- 102000013142 Amylases Human genes 0.000 description 1
- 108010065511 Amylases Proteins 0.000 description 1
- 241000193755 Bacillus cereus Species 0.000 description 1
- 241000194107 Bacillus megaterium Species 0.000 description 1
- 101100510833 Bacillus subtilis (strain 168) sipW gene Proteins 0.000 description 1
- 108010062877 Bacteriocins Proteins 0.000 description 1
- 108010059013 Chaperonin 10 Proteins 0.000 description 1
- 108010058432 Chaperonin 60 Proteins 0.000 description 1
- 101710151559 Crystal protein Proteins 0.000 description 1
- 108091029865 Exogenous DNA Proteins 0.000 description 1
- 101710089384 Extracellular protease Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 102000018997 Growth Hormone Human genes 0.000 description 1
- 108010051696 Growth Hormone Proteins 0.000 description 1
- 102100023737 GrpE protein homolog 1, mitochondrial Human genes 0.000 description 1
- 102000004447 HSP40 Heat-Shock Proteins Human genes 0.000 description 1
- 108010042283 HSP40 Heat-Shock Proteins Proteins 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 101000829489 Homo sapiens GrpE protein homolog 1, mitochondrial Proteins 0.000 description 1
- 102000004877 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 102000004882 Lipase Human genes 0.000 description 1
- 108090001060 Lipase Proteins 0.000 description 1
- 239000004367 Lipase Substances 0.000 description 1
- 241000193386 Lysinibacillus sphaericus Species 0.000 description 1
- 101150009852 ORF2 gene Proteins 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 101710104379 Periplasmic chaperone Spy Proteins 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 229940092980 adalat Drugs 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 235000019418 amylase Nutrition 0.000 description 1
- 229940025131 amylases Drugs 0.000 description 1
- 230000003698 anagen phase Effects 0.000 description 1
- 239000000427 antigen Substances 0.000 description 1
- 108091007433 antigens Proteins 0.000 description 1
- 102000036639 antigens Human genes 0.000 description 1
- 210000003578 bacterial chromosome Anatomy 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 230000000853 biopesticidal effect Effects 0.000 description 1
- 239000003114 blood coagulation factor Substances 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 230000036755 cellular response Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 101150086784 cry gene Proteins 0.000 description 1
- 101150102059 cry3Aa gene Proteins 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000002050 diffraction method Methods 0.000 description 1
- 239000002158 endotoxin Substances 0.000 description 1
- 238000002270 exclusion chromatography Methods 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- 230000006870 function Effects 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 239000000122 growth hormone Substances 0.000 description 1
- 230000006801 homologous recombination Effects 0.000 description 1
- 238000002744 homologous recombination Methods 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- -1 inhA1 Proteins 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- 235000019421 lipase Nutrition 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- WSFSSNUMVMOOMR-NJFSPNSNSA-N methanone Chemical compound O=[14CH2] WSFSSNUMVMOOMR-NJFSPNSNSA-N 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 230000005012 migration Effects 0.000 description 1
- 238000013508 migration Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 238000007857 nested PCR Methods 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 101150070927 nprA gene Proteins 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 108090000765 processed proteins & peptides Proteins 0.000 description 1
- 102000004196 processed proteins & peptides Human genes 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 230000007928 solubilization Effects 0.000 description 1
- 238000005063 solubilization Methods 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 239000013598 vector Substances 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/32—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Bacillus (G)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/74—Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora
- C12N15/75—Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora for Bacillus
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P21/00—Preparation of peptides or proteins
- C12P21/02—Preparation of peptides or proteins having a known sequence of two or more amino acids, e.g. glutathione
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12R—INDEXING SCHEME ASSOCIATED WITH SUBCLASSES C12C - C12Q, RELATING TO MICROORGANISMS
- C12R2001/00—Microorganisms ; Processes using microorganisms
- C12R2001/01—Bacteria or Actinomycetales ; using bacteria or Actinomycetales
- C12R2001/07—Bacillus
- C12R2001/075—Bacillus thuringiensis
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Microbiology (AREA)
- Biomedical Technology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Medicinal Chemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
La présente invention se rapporte à une cassette d’expression permettant l’expression de protéines hétérologues par des bactéries, de préférence des bactéries Gram positives ; cette cassette se caractérise en ce qu’elle contient la séquence codant pour la protéine ORF2 de Bacillus thuringiensis. La présente invention se rapporte encore à des vecteurs d’expression recombinants comprenant une telle cassette d’expression et à des bactéries, de préférence Gram positives, transformées avec ce vecteur d’expression recombinant.The present invention relates to an expression cassette allowing the expression of heterologous proteins by bacteria, preferably Gram-positive bacteria; this cassette is characterized in that it contains the sequence coding for the ORF2 protein of Bacillus thuringiensis. The present invention also relates to recombinant expression vectors comprising such an expression cassette and to bacteria, preferably Gram positive, transformed with this recombinant expression vector.
Description
La présente invention se rapporte à un nouveau système d’expression par des bactéries de protéines hétérologues sous forme pseudo cristalline, dans un état stable et protégées de la dégradation, ce système présente un avantage significatif en termes de purification desdites protéines.The present invention relates to a new system for expression by bacteria of heterologous proteins in pseudo-crystalline form, in a stable state and protected from degradation, this system presents a significant advantage in terms of purification of said proteins.
La présente invention se rapporte plus particulièrement à une cassette d’expression permettant l’expression de protéines hétérologues par des bactéries, de préférence des bactéries Gram positives ; cette cassette se caractérise en ce qu’elle contient la séquence codant pour la protéine ORF2 deBacillus thuringiensis. La présente invention se rapporte encore à des vecteurs d’expression recombinants comprenant une telle cassette d’expression et à des bactéries, de préférence Gram positives, transformées avec ce vecteur d’expression recombinant.The present invention relates more particularly to an expression cassette allowing the expression of heterologous proteins by bacteria, preferably Gram-positive bacteria; this cassette is characterized in that it contains the sequence coding for the ORF2 protein of Bacillus thuringiensis . The present invention also relates to recombinant expression vectors comprising such an expression cassette and to bacteria, preferably Gram positive, transformed with this recombinant expression vector.
L’utilisation de bactéries recombinantes pour produire des protéines hétérologues d’intérêt, telles que l’insuline et l’hormone de croissance, est connue de longue date et a été largement mise en œuvre, mais elle a aussi montré ses limites. En effet, les bactéries sont incapables de produire des protéines ayant une structure complexe comme les anticorps ou les facteurs de coagulation sanguine. Pour être stables et activesin vivoet donc efficaces chez l’homme, ces protéines doivent subir de multiples modifications post-traductionnelles.The use of recombinant bacteria to produce heterologous proteins of interest, such as insulin and growth hormone, has been known for a long time and has been widely implemented, but it has also shown its limits. Indeed, bacteria are incapable of producing proteins with a complex structure such as antibodies or blood clotting factors. To be stable and active in vivo and therefore effective in humans, these proteins must undergo multiple post-translational modifications.
En particulier, lorsqueE. coliest utilisé pour produire des protéines en grande quantité, celles-ci peuvent se retrouver mal repliées ou former des agrégats insolubles. Pour pallier ce problème, des protéines chaperons peuvent être co-exprimées avec la protéine d’intérêt, augmentant ainsi les chances d’obtenir une protéine correctement repliée et soluble. Cependant, de façon générale, ces méthodes donnent des résultats limités. En effet, lorsque l’expression de protéines formant des agrégats insolubles a été associée à l’expression de protéines chaperons deE. coli(DnaK, DnaJ, GrpE, GroES, GroEL), le résultat montre soit une augmentation très faible de la production de protéine soluble (Malekianet al., 2019, Protein Expression and Purification 160:66-72), soit la nécessité de traiter les agrégats insolublesin vitropar un système de maturation ATP-dépendant (Alfiet al., J Bioscience and. Bioengineering 128:290-295.). Lorsque cette expression est associée à des protéines chaperons d’autres origines, comme Spy (Spheroplast protein Y), l’augmentation de la production de protéines solubles est trop réduite pour présenter un intérêt industriel (Ruanet al., 2020, J. Biotech. 307:130-138).In particular, when E. coli is used to produce proteins in large quantities, they can become misfolded or form insoluble aggregates. To overcome this problem, chaperone proteins can be co-expressed with the protein of interest, thus increasing the chances of obtaining a correctly folded and soluble protein. However, in general, these methods give limited results. Indeed, when the expression of proteins forming insoluble aggregates was associated with the expression of E. coli chaperone proteins (DnaK, DnaJ, GrpE, GroES, GroEL), the result shows either a very weak increase in production of soluble protein (Malekian et al. , 2019, Protein Expression and Purification 160:66-72), or the need to treat insoluble aggregates in vitro by an ATP-dependent maturation system (Alfi et al. , J Bioscience and. Bioengineering 128:290-295.). When this expression is associated with chaperone proteins of other origins, such as Spy (Spheroplast protein Y), the increase in the production of soluble proteins is too reduced to be of industrial interest (Ruan et al. , 2020, J. Biotech . 307:130-138).
Bacillus thuringiensis(Bt) est une bactérie Gram-positive sporulante qui produit d’importantes quantités de protéines insecticides (protéines Cry et Cyt). Celles-ci s’accumulent dans la cellule mère et forment des inclusions cristallines représentant jusqu’à 25% du poids sec de la bactérie. Ces inclusions sont libérées, par lyse cellulaire, à la fin du processus de sporulation (Agaisse et Lereclus, 1995). Cette production massive de protéines dépend de plusieurs facteurs : i) le nombre de copies des gènescryoucyt, ii) la force du promoteur, iii) la stabilité des transcrits, et iv) la formation d’un cristal stable. La capacité de produire certaines de ces toxines (Cry ou Cyt) sous forme cristalline est due, soit à un domaine C-terminal de certaines protéines Cry permettant la formation d’inclusions cristallines, soit à une protéine additionnelle « Helper » qui pourrait avoir un rôle de chaperon intervenant dans la cristallisation des protéines Cyt ou de certaines protéines Cry, dont le domaine C-ter est absent (Adalatet al.2017). Bacillus thuringiensis (Bt) is a spore-forming Gram-positive bacterium that produces large quantities of insecticidal proteins (Cry and Cyt proteins). These accumulate in the mother cell and form crystalline inclusions representing up to 25% of the dry weight of the bacteria. These inclusions are released, by cell lysis, at the end of the sporulation process (Agaisse and Lereclus, 1995). This massive protein production depends on several factors: i) the number of copies of the cry or cyt genes, ii) the strength of the promoter, iii) the stability of the transcripts, and iv) the formation of a stable crystal. The ability to produce certain of these toxins (Cry or Cyt) in crystalline form is due either to a C-terminal domain of certain Cry proteins allowing the formation of crystalline inclusions, or to an additional “Helper” protein which could have a role of chaperone involved in the crystallization of Cyt proteins or certain Cry proteins, of which the C-ter domain is absent (Adalat et al. 2017).
Par la mise au point d’une cassette d’expression originale permettant la co-expression de la protéine ORF2 de Bt et une protéine hétérologue d’intérêt sous le contrôle d’un promoteur fort, les Inventeurs sont parvenus à produire d’importantes quantités de protéines hétérologues (autres que des protéines Cry ou Cyt) dans une souche asporogène de Bt, préférentiellement en phase stationnaire.En absence de lyse cellulaire, la protéine hétérologue ainsi produite s’accumule dans la cellule bactérienne sous forme d’inclusion pseudo cristalline ; ceci apporte un avantage considérable pour la production de protéines instables ou cytotoxiques difficilement exprimées par les méthodes actuelles d’expression chez les microorganismes.By developing an original expression cassette allowing the co-expression of the Bt ORF2 protein and a heterologous protein of interest under the control of a strong promoter, the inventors managed to produce large quantities heterologous proteins (other than Cry or Cyt proteins) in an asporogenic Bt strain, preferably in stationary phase . In the absence of cell lysis, the heterologous protein thus produced accumulates in the bacterial cell in the form of a pseudo-crystalline inclusion; this provides a considerable advantage for the production of unstable or cytotoxic proteins that are difficult to express by current expression methods in microorganisms.
Ainsi, la présente invention se rapporte à unecassette d’expressioncomprenant :Thus, the present invention relates to an expression cassette comprising:
(i) un promoteur fort actif pendant la phase stationnaire ;(i) a strong promoter active during the stationary phase;
(ii) une séquence ayant au moins 80%, de préférence au moins 90%, encore préférentiellement au moins 95% et tout préférentiellement 100% d’identité, avec la séquence SEQ ID N°2 du gène codant ORF2 de Bt de SEQ ID N°1 ; et(ii) a sequence having at least 80%, preferably at least 90%, more preferably at least 95% and most preferably 100% identity, with the sequence SEQ ID No. 2 of the gene encoding ORF2 of Bt of SEQ ID No. 1; And
(iii) la séquence d’un gène codant une protéine hétérologue ;(iii) the sequence of a gene encoding a heterologous protein;
lesdites séquences des gènes codant ORF2 et la protéine hétérologue étant en opéron sous le contrôle dudit promoteur fort.said gene sequences encoding ORF2 and the heterologous protein being in operon under the control of said strong promoter.
Un promoteur fort est un promoteur permettant un niveau de transcription élevé du gène qui se situe en aval.A strong promoter is a promoter allowing a high level of transcription of the gene located downstream.
Le promoteur fort peut provenir de la cellule hôte utilisée pour l’expression de la protéine hétérologue ; il peut aussi s’agir d’un promoteur exogène. Les promoteurs forts sont préférentiellement des promoteurs activés en début de phase stationnaire et/ou qui sont fonctionnels pendant une grande partie de cet état physiologique.The strong promoter may come from the host cell used for expression of the heterologous protein; it can also be an exogenous promoter. Strong promoters are preferentially promoters activated at the start of stationary phase and/or which are functional during a large part of this physiological state.
En particulier, le promoteur fort peut être choisi parmi les promoteurs qui requièrent directement ou indirectement le régulateur Spo0A tels que ceux des gènescalY,inhA1,sipW,ces. Selon ce mode de réalisation, le promoteur fort est le promoteur du gènecalY(numéro d’accès EU604076 dans GenBank) et est désigné PcalYde séquence SEQ ID N°5, PinhA1de SEQ ID N°6 ou Pcesde SEQ ID N°7.In particular, the strong promoter can be chosen from the promoters which directly or indirectly require the Spo0A regulator such as those of the calY , inhA1 , sipW , ces genes. According to this embodiment, the strong promoter is the promoter of the calY gene (access number EU604076 in GenBank) and is designated P calY of sequence SEQ ID No. 5, P inhA1 of SEQ ID No. 6 or P ces of SEQ ID No. 7.
Selon un autre mode de réalisation de l’invention, le promoteur fort peut être choisi parmi les promoteurs qui sont réprimés par le régulateur CodY pendant la phase de croissance exponentielle, le promoteur fort est alors choisi parmi PoppAde SEQ ID N°8 et PnppCde SEQ ID N°9. La répression par CodY est levée en fin de phase exponentielle et ces promoteurs sont donc spécifiquement actifs pendant la phase stationnaire.According to another embodiment of the invention, the strong promoter can be chosen from the promoters which are repressed by the CodY regulator during the exponential growth phase, the strong promoter is then chosen from P oppA of SEQ ID No. 8 and P nppC of SEQ ID No. 9. Repression by CodY is lifted at the end of the exponential phase and these promoters are therefore specifically active during the stationary phase.
Selon encore un autre mode de réalisation de l’invention, le promoteur fort est exprimé pendant la phase stationnaire deBacilluset plus préférentiellement le promoteur fort est régulé positivement par un régulateur choisi parmi PlcR et NprR. Les promoteurs forts sont préférentiellement choisis parmi PpapR(SEQ. ID. N°10), PplcB(SEQ. ID. N°11), PnprA(SEQ. ID. N°12), PnprR(SEQ ID N°13).According to yet another embodiment of the invention, the strong promoter is expressed during the stationary phase of Bacillus and more preferably the strong promoter is positively regulated by a regulator chosen from PlcR and NprR. The strong promoters are preferentially chosen from P papR (SEQ. ID. No. 10), P plcB (SEQ. ID. No. 11), P nprA (SEQ. ID. No. 12), P nprR (SEQ ID. No. 12), 13).
Ainsi, préférentiellement, le promoteur fort actif en phase stationnaire est choisi parmi PcalY, PinhA1, Pces, PoppA, PnppC, PpapR, PplcB, PnprAet PnprR.Thus, preferentially, the strong promoter active in stationary phase is chosen from P calY , P inhA1 , P ces , P oppA , P nppC , P papR , P plcB , P nprA and P nprR .
La protéine ORF2 de Bt de séquence SEQ ID N°1 est co-transcrite avec le gène codant pour la protéine Cry2A et a été décrite comme facteur de cristallisation de cette protéine (Denget al.,Regulation of cry gene expression in Bacillus thuringiensis, Toxins, 2014 ; 6(7) : 2194-2209) ; elle est codée par la séquence nucléique SEQ ID N°2.The Bt ORF2 protein with sequence SEQ ID No. 1 is co-transcribed with the gene coding for the Cry2A protein and has been described as a crystallization factor for this protein (Deng et al. , Regulation of cry gene expression in Bacillus thuringiensis , Toxins, 2014; 6(7): 2194-2209); it is encoded by the nucleic sequence SEQ ID No. 2.
De façon surprenante, les Inventeurs ont mis en évidence que la co-expression du gène de la protéine hétérologue avec le gène codant pour la protéine ORF2 permet de condenser sous forme d’inclusion les protéines hétérologues produites (voir la partie expérimentale ci-après) dans les cellules hôtes et ainsi d’augmenter substantiellement la quantité de protéines hétérologues produites.Surprisingly, the Inventors have demonstrated that the co-expression of the heterologous protein gene with the gene coding for the ORF2 protein makes it possible to condense the heterologous proteins produced into inclusion form (see the experimental part below) in host cells and thus substantially increase the quantity of heterologous proteins produced.
On entend par protéine hétérologue, une protéine qui n’est pas naturellement exprimée par la cellule hôte modifiée par un vecteur d’expression comprenant la cassette d’expression selon l’invention. De préférence, la protéine hétérologue est une protéine d’intérêt industriel ou médical comme des enzymes, telles que protéases, lipases, amylases ; des hormones ; des antigènes, par exemple, utilisables comme immunogènes, des peptides ou des protéines à usage thérapeutique (bactériocines, inhibiteurs ou stimulateurs de la réponse cellulaire, …).By heterologous protein is meant a protein which is not naturally expressed by the host cell modified by an expression vector comprising the expression cassette according to the invention. Preferably, the heterologous protein is a protein of industrial or medical interest such as enzymes, such as proteases, lipases, amylases; hormones; antigens, for example, usable as immunogens, peptides or proteins for therapeutic use (bacteriocins, inhibitors or stimulators of the cellular response, etc.).
Il peut encore s’agir de toxines insecticides cytolytiques naturellement exprimées par Bt et utilisées comme biopesticide ; il pourra en particulier s’agir des protéines de la famille Cry (protéines du cristal) ou des protéines de la famille Cyt (toxines insecticides cytolytiques) ou des protéines Vip3 (toxines actives contre les insectes lépidoptères).They may also be cytolytic insecticidal toxins naturally expressed by Bt and used as a biopesticide; it may in particular be proteins of the Cry family (crystal proteins) or proteins of the Cyt family (cytolytic insecticidal toxins) or Vip3 proteins (toxins active against lepidopteran insects).
La cassette d’expression selon l’invention conduisant à l’expression et à la condensation des protéines hétérologues sous forme d’inclusion au sein des bactéries, son utilisation est particulièrement appropriée à la production de protéines hétérologues cytotoxiques pour la souche productrice ou instables.The expression cassette according to the invention leading to the expression and condensation of heterologous proteins in the form of inclusion within bacteria, its use is particularly suitable for the production of heterologous proteins that are cytotoxic for the producing strain or unstable.
De préférence, la séquence codant ORF2 est clonée encisdu gène codant la protéine hétérologue d’intérêt. Elle est préférentiellement clonée en opéron avec le gène codant la protéine hétérologue d’intérêt.Preferably, the ORF2 coding sequence is cloned in cis of the gene encoding the heterologous protein of interest. It is preferentially cloned in an operon with the gene encoding the heterologous protein of interest.
Selon des modes de réalisations particuliers, la cassette d’expression selon l’invention peut en outre comprendre :According to particular embodiments, the expression cassette according to the invention may further comprise:
- une séquence stabilisatrice de l’ARNm positionnée en aval du promoteur et en amont de la séquence du gène codant ORF2 ; de préférence, il s’agit de STAB-SD de séquence SEQ ID N°3 ; de préférence, la séquence STAB-SD est en aval du +1 de transcription et à une position comprise entre environ 100 et 500, préférentiellement entre 100 et 300 et encore préférentiellement entre 100 et 150 paires de bases en amont du site de liaison ribosomique (dit RBS pour Ribosomal Binding Site) ; et/ou- an mRNA stabilizing sequence positioned downstream of the promoter and upstream of the sequence of the gene coding ORF2; preferably, it is STAB-SD of sequence SEQ ID No. 3; preferably, the STAB-SD sequence is downstream of the transcription +1 and at a position between approximately 100 and 500, preferably between 100 and 300 and even more preferably between 100 and 150 base pairs upstream of the ribosomal binding site ( called RBS for Ribosomal Binding Site); and or
- une séquence terminatrice du gène cry1Ac, désignée, Tcry1Ac, par exemple de séquence présentant au moins 90%, de préférence au moins 95% ou au moins 98%, d’identité avec la SEQ ID N°4, de préférence, il s’agit de la SEQ ID N°4 ; cette séquence est clonée en aval du gène codant la protéine hétérologue.- a terminator sequence of the cry1Ac gene, designated, Tcry1Ac, for example of a sequence presenting at least 90%, preferably at least 95% or at least 98%, of identity with SEQ ID No. 4, preferably, it is This is SEQ ID No. 4; this sequence is cloned downstream of the gene encoding the heterologous protein.
Le choix de ces séquences ne doit toutefois pas être considéré comme limitant du fait qu’il est à la portée de l’homme du métier de substituer ces séquences par des séquences aux fonctions équivalentes.The choice of these sequences should not, however, be considered limiting because it is within the reach of those skilled in the art to substitute these sequences with sequences with equivalent functions.
Ainsi, la cassette d’expression selon l’invention peut comprendre :Thus, the expression cassette according to the invention can comprise:
(i) un promoteur fort actif pendant la phase stationnaire ;(i) a strong promoter active during the stationary phase;
et la séquence stabilisatrice de l’ARNm STAB-SD ;and the mRNA stabilizing sequence STAB-SD;
(ii) la séquence du gène codant ORF2 ;(ii) the sequence of the gene encoding ORF2;
(iii) la séquence d’un gène codant une protéine hétérologue ;(iii) the sequence of a gene encoding a heterologous protein;
ouOr
(i) un promoteur fort actif pendant la phase stationnaire ;(i) a strong promoter active during the stationary phase;
(ii) la séquence du gène codant ORF2 ;(ii) the sequence of the gene encoding ORF2;
(iii) la séquence d’un gène codant une protéine hétérologue ;(iii) the sequence of a gene encoding a heterologous protein;
et la séquence terminatrice du gène cry1Ac, Tcry1Ac ;and the terminator sequence of the cry1Ac gene, Tcry1Ac;
ou encoreor
(i) un promoteur fort actif pendant la phase stationnaire ;(i) a strong promoter active during the stationary phase;
et la séquence stabilisatrice de l’ARNm STAB-SD ;and the mRNA stabilizing sequence STAB-SD;
(ii) la séquence du gène codant ORF2 ;(ii) the sequence of the gene encoding ORF2;
(iii) la séquence d’un gène codant une protéine hétérologue ;(iii) the sequence of a gene encoding a heterologous protein;
et la séquence terminatrice du gène cry1Ac, Tcry1Ac.and the cry1Ac gene terminator sequence, Tcry1Ac.
Selon ces modes de réalisation, le promoteur fort actif pendant la phase stationnaire peut être choisi parmi PcalY, PinhA1, Pces, PoppA, PnppC, PpapR, PplcB, PnprAet PnprR.According to these embodiments, the strong promoter active during the stationary phase can be chosen from P calY , P inhA1 , P ces , P oppA , P nppC , P papR , P plcB , P nprA and P nprR .
La présente invention se rapporte également à un plasmide recombinant comprenant la cassette d’expression selon l’invention.The present invention also relates to a recombinant plasmid comprising the expression cassette according to the invention.
Les plasmides utilisables selon l’invention comprennent classiquement une origine de réplication et au moins un système de sélection consistant en un ou plusieurs gènes permettant la sélection des bactéries transformées, par exemple des gènes de résistance aux antibiotiques.The plasmids which can be used according to the invention conventionally comprise an origin of replication and at least one selection system consisting of one or more genes allowing the selection of transformed bacteria, for example antibiotic resistance genes.
Tout plasmide, de préférence à haut nombre de copies, adapté à l’hôte bactérien utilisé peut être mis en œuvre.Any plasmid, preferably with a high copy number, adapted to the bacterial host used can be used.
Les plasmides appropriés selon l’invention sont des plasmides permettant une expression dans les bactéries du genreBacillus.The appropriate plasmids according to the invention are plasmids allowing expression in bacteria of the Bacillus genus.
De préférence, les plasmides utilisés sont ceux présentant une forte stabilité ségrégationnelle (par exemple, le plasmide doit rester présent dans la souche pendant au moins 25 générations) et/ou structurale (c’est-à-dire qu’il ne subit pas de remaniements moléculaires au cours de la croissance des bactéries). La stabilité des plasmides dérivés du réplicon pHT1030 (par exemple, les plasmides (pHT304, pHT315 ou pHT370) ou du réplicon pBC16 a été démontré (Lereclus, D., Arantes, O., 1992.spbAlocus ensures the segregational stability of pHT1030, a novel type of Gram-positive replicon.Mol. Microbiol. 7: 35-46 doi: 10.1111/j.1365-2958.1992.tb00835.x ; Arantes, O., Lereclus, D., 1991. Construction of cloning vectors forBacillus thuringiensis.Gene108: 115-119 doi: 10.1016/0378-1119(91)90495-w).Preferably, the plasmids used are those exhibiting strong segregational stability (for example, the plasmid must remain present in the strain for at least 25 generations) and/or structural stability (that is to say, it does not undergo any changes). molecular rearrangements during bacterial growth). The stability of plasmids derived from the pHT1030 replicon (for example, the plasmids (pHT304, pHT315 or pHT370) or from the pBC16 replicon has been demonstrated (Lereclus, D., Arantes, O., 1992. spbA locus ensures the segregational stability of pHT1030, a novel type of Gram-positive replicon. Mol. Microbiol . 7: 35-46 doi: 10.1111/j.1365-2958.1992.tb00835.x; Arantes, O., Lereclus, D., 1991. Construction of cloning vectors for Bacillus thuringiensis . Gene 108: 115-119 doi: 10.1016/0378-1119(91)90495-w).
La stabilité structurale se définit comme une non recombinaison intramoléculaire du plasmide. La stabilité structurale du plasmide pHT1030 et de ses dérivés est démontrée par le fait qu’ils peuvent porter des fragments d’ADN exogène de grande taille (> 10 kb) sans subir de remaniements moléculaires (Lerecluset al., 1989. Transformation and expression of a cloned delta-endotoxin gene inBacillus thuringiensis.FEMS Microbiol . Lett. 60: 211-217).Structural stability is defined as non-intramolecular recombination of the plasmid. The structural stability of the pHT1030 plasmid and its derivatives is demonstrated by the fact that they can carry large exogenous DNA fragments (> 10 kb) without undergoing molecular rearrangements (Lereclus et al ., 1989. Transformation and expression of a cloned delta-endotoxin gene in Bacillus thuringiensis . FEMS Microbiol . Lett . 60: 211-217).
Dans le cas de Bt, on peut utiliser des plasmides dérivés du pHT1030, du pBC16, du pE194, du pC194 et de tout plasmide naturellement présent dans cette bactérie, par exemple le pHT8-1 présent dans les souches BtkurstakiHD73 et Bt 407, le pHT73 présent dans la souche BtkurstakiHD73, ou encore le pBMB299 présent dans la souche BtkurstakiHD1.In the case of Bt, plasmids derived from pHT1030, pBC16, pE194, pC194 and any plasmid naturally present in this bacterium can be used, for example pHT8-1 present in the Bt kurstaki strains HD73 and Bt 407, pHT73 present in the Bt kurstaki HD73 strain, or pBMB299 present in the Bt kurstaki HD1 strain.
De préférence, il s’agit de plasmides à haut nombre de copies notamment dérivés du plasmide pHT1030, tels que pHT3101, pHT304, pHT315 et pHT370 ; préférentiellement le pHT315.Preferably, these are high copy number plasmids in particular derived from the pHT1030 plasmid, such as pHT3101, pHT304, pHT315 and pHT370; preferably pHT315.
La construction de la cassette d’expression selon l’invention et son incorporation dans un plasmide sont réalisées par les techniques de biologie moléculaire bien connues de l’homme du métier tel qu’illustré dans la partie expérimentale.The construction of the expression cassette according to the invention and its incorporation into a plasmid are carried out by molecular biology techniques well known to those skilled in the art as illustrated in the experimental part.
La présente invention se rapporte encore à des bactéries transformées avec un plasmide selon l’invention.The present invention also relates to bacteria transformed with a plasmid according to the invention.
Toute bactérie en phase stationnaire de croissance peut être utilisée.Any bacteria in stationary phase growth can be used.
De préférence, il s’agit de bactéries Gram+ telles que des bactéries du genreBacillus, en particulierBacillus cereus,Bacillus megaterium,Bacillus sphaericus,Bacillus subtilisetBacillus thuringiensis.Preferably, these are Gram+ bacteria such as bacteria of the Bacillus genus, in particular Bacillus cereus , Bacillus megaterium , Bacillus sphaericus , Bacillus subtilis and Bacillus thuringiensis .
De façon encore préférée, on utilisera des souches du genreBacillus, en particulier deBacillus subtiliset Bt, asporogènes (naturelles ou mutant). Les souches asporogènes sont avantageuses en ce qu’elles ne présentent pas de lyse cellulaire, ainsi, les protéines hétérologues produites sont conservées dans la bactérie productrice (cellule mère) et protégées de la dégradation par les protéases extracellulaires.Even more preferably, strains of the Bacillus genus, in particular Bacillus subtilis and Bt, asporogenic (natural or mutant) will be used. Asporogenic strains are advantageous in that they do not exhibit cell lysis, thus the heterologous proteins produced are retained in the producing bacteria (mother cell) and protected from degradation by extracellular proteases.
Afin de supprimer l’activité de sporulation d’une souche de Bt, il est possible d’inactiver tout gène essentiel à la sporulation comme les gènes impliqués dans l’expression des facteurs sigma de sporulation Spo0A, SigE, SigH et SigK ; de préférence, une souche Bt ΔsigE ou ∆spo0A, préférentiellement Bt 407-ΔsigE (Bravoet al., 1996) ou Bt HD73 ∆spo0A, est utilisée.L’inactivation de ces gènes peut être obtenue par interruption ou modification de la séquence codante, ou par délétion de tout ou partie du gène. La délétion est obtenue par double crossing-over entre les régions adjacentes situées en amont et aval du gène, en utilisant des plasmides dont la réplication est thermosensible, par exemple les plasmides pRN5101 (Lereclus et al., 1992) ou pMAD (Arnaud et al., 2004), et en utilisant les protocoles décrits dans ces articles.In order to suppress the sporulation activity of a Bt strain, it is possible to inactivate any gene essential for sporulation such as the genes involved in the expression of the sporulation sigma factors Spo0A, SigE, SigH and SigK; preferably, a Bt ΔsigE or ∆spo0A strain, preferably Bt 407-ΔsigE (Bravo et al ., 1996) or Bt HD73 ∆spo0A , is used . Inactivation of these genes can be achieved by interruption or modification of the coding sequence, or by deletion of all or part of the gene. The deletion is obtained by double crossing-over between the adjacent regions located upstream and downstream of the gene, using plasmids whose replication is temperature sensitive, for example the plasmids pRN5101 (Lereclus et al., 1992) or pMAD (Arnaud et al ., 2004), and using the protocols described in these articles.
De préférence, lorsque le gène de sporulation inactivé estSpo 0 A, le promoteur fort utilisé est choisi parmi PpapR, PoppA, PnppC ,PnprA, PnprRet PplcB, et lorsque le gène de sporulation inactivé est sigE, le promoteur fort est PcalY ,PinhA1ou Pces.Preferably, when the inactivated sporulation gene is Spo 0 A , the strong promoter used is chosen from P papR , P oppA , P nppC , P nprA , P nprR and P plcB , and when the inactivated sporulation gene is sigE, the strong promoter is P calY , P inhA1 or P ces .
Le plasmide selon l’invention peut être introduit dans la bactérie hôte selon les techniques connues de l’homme du métier ; en particulier, la transformation de la bactérie hôte peut être réalisée par électroporation (Lerecluset al., 1989) ou par conjugaison hétérogramique (Tieu-Cuotet al., 1987). La cassette d’expression contenant le gène d’intérêt peut aussi être introduite sur le chromosome bactérien ou sur un plasmide résident par recombinaison homologue (Lerecluset al., 1992).The plasmid according to the invention can be introduced into the host bacteria according to techniques known to those skilled in the art; in particular, the transformation of the host bacteria can be carried out by electroporation (Lereclus et al. , 1989) or by heterogramic conjugation (Tieu-Cuot et al. , 1987). The expression cassette containing the gene of interest can also be introduced onto the bacterial chromosome or onto a resident plasmid by homologous recombination (Lereclus et al. , 1992).
La présente invention se rapporte aussi à un procédé de production d’une protéine hétérologue comprenant les étapes de :The present invention also relates to a process for producing a heterologous protein comprising the steps of:
- préparation d’une bactérie transformée selon l’invention ;- preparation of a transformed bacteria according to the invention;
- culture de ladite bactérie transformée en phase stationnaire ; et- culture of said bacteria transformed into stationary phase; And
- optionnellement, purification de ladite protéine hétérologue.- optionally, purification of said heterologous protein.
La culture de la bactérie transformée est réalisée sur un milieu de culture contenant au moins une source d’azote et de glucose en des concentrations appropriées à une température comprise de préférence entre 25 et 35°C, de manière préférentielle la température est de l’ordre de 30°C ; par exemple, le milieu de culture est le milieu LB.The culture of the transformed bacteria is carried out on a culture medium containing at least one source of nitrogen and glucose in appropriate concentrations at a temperature preferably between 25 and 35°C, preferably the temperature is order of 30°C; for example, the culture medium is LB medium.
La purification de la protéine hétérologue peut être réalisée par centrifugation et solubilisation des cristaux ; en complément, les méthodes de chromatographie d’exclusion, de chromatographie en échange d’ions ou encore de chromatographie d’affinité peuvent être mises en œuvre.Purification of the heterologous protein can be carried out by centrifugation and solubilization of the crystals; in addition, the methods of exclusion chromatography, ion exchange chromatography or even affinity chromatography can be implemented.
La présente invention se rapporte encore à l’utilisation d’une séquence ayant au moins 80%, de préférence au moins 90%, encore préférentiellement au moins 95% et tout préférentiellement 100% d’identité, avec la séquence codant ORF2 de Bt dans une cassette d’expression comprenant également un promoteur fort actif en phase stationnaire et la séquence codant une protéine hétérologue, pour la production de ladite protéine hétérologue.The present invention also relates to the use of a sequence having at least 80%, preferably at least 90%, more preferably at least 95% and most preferably 100% identity, with the ORF2 coding sequence of Bt in an expression cassette also comprising a strong promoter active in stationary phase and the sequence encoding a heterologous protein, for the production of said heterologous protein.
1.1.1.1. Construction du plasmideConstruction of the plasmid selon l’inventionaccording to the invention pHT-Cal’pHT-Cal’ orf2orf2 -- gfpgfp -Tcry1Ac-Tcry1Ac et du plasmide contrôle pHTCal’and the control plasmid pHTCal’ -gfp-gfp -Tcry1Ac-Tcry1Ac
La région promotrice du gènecalY(P calY ) a été amplifiée avec les oligos PcalY1 et PcalY2 à partir de l’ADN chromosomique de la souche BtkurstakiHD73. Le fragment d’ADN obtenu a été digéré par les enzymes Xba1 et Asc1, puis purifié comme fragment XbaI/AscI. La région terminatrice Tcry1aC a été amplifiée avec les oligos Tcry1 et Tcry2 à partir de l’ADN plasmidique de la souche HD73. Le fragment d’ADN obtenu a été digéré par les enzymes Kpn1 et EcoR1, puis purifié comme fragment KpnI/EcoRI. Ces deux fragments d’ADN ont été insérés entre les sites XbaI/AscI et KpnI/EcoRI, respectivement, dans un plasmide pHT315 contenant déjà la région STAB-SD entre les sites AscI et BamHI. Le gèneorf2a été amplifié avec les oligos ORF2(1) et ORF2(2) à partir de l’ADN plasmidique de la souche BtkurstakiHD1. Le gènegfpa été amplifié avec les oligos GFP1 et GFP2 à partir du plasmide pHT304-gfpbte (stock du laboratoire). Ce gènegfpcode pour une protéine GFP marqué à l’aide d’un His-tag. Ces deux fragments d’ADN ont été assemblés par “splicing by overlap extension PCR” et insérés dans le plasmide (préalablement linéarisé par PCR avec les oligos LinP1 et LinP2).The promoter region of the calY gene (P calY ) was amplified with the oligos PcalY1 and PcalY2 from the chromosomal DNA of the Bt kurstaki strain HD73. The DNA fragment obtained was digested with the enzymes Xba1 and Asc1, then purified as an XbaI/AscI fragment. The Tcry1aC terminator region was amplified with oligos Tcry1 and Tcry2 from plasmid DNA of strain HD73. The DNA fragment obtained was digested with the enzymes Kpn1 and EcoR1, then purified as a KpnI/EcoRI fragment. These two DNA fragments were inserted between the XbaI/AscI and KpnI/EcoRI sites, respectively, in a pHT315 plasmid already containing the STAB-SD region between the AscI and BamHI sites. The orf2 gene was amplified with oligos ORF2(1) and ORF2(2) from the plasmid DNA of the Bt kurstaki HD1 strain. The gfp gene was amplified with oligos GFP1 and GFP2 from plasmid pHT304-gfpbte (laboratory stock). This gfp gene encodes a GFP protein tagged with a His-tag. These two DNA fragments were assembled by “splicing by overlap extension PCR” and inserted into the plasmid (previously linearized by PCR with the LinP1 and LinP2 oligos).
Oligonucléotides :Oligonucleotides:
SEQ ID N°14 - PcalY1SEQ ID No. 14 - PcalY1
5’-GCTCTAGAAAGCAAGACTAGTAATATTTATACGAG-3’ site XbaI souligné5'-GC TCTAGA AAGCAAGACTAGTAATATTTATACGAG-3' underlined XbaI site
SEQ DI N°15 - PcalY2SEQ DI No. 15 - PcalY2
5’-GGCGCGCCCACAATCAATTCCCCCTAGCTTT-3’ site AscI souligné5'- GGCCGCC CACAATCAATTCCCCCTAGCTTT-3' underlined AscI site
SEQ ID N°16 - Tcry1SEQ ID No. 16 - Tcry1
5’-GGGGTACCAACTCAGGTTTAAATATCGTTTTC-3’ site KpnI souligné5'-GG GGTACC AACTCAGGTTTAAATATCGTTTTC-3' underlined KpnI site
SEQ ID N°17 - Tcry2SEQ ID No. 17 - Tcry2
5’-GGAATTCCCAAATAAAAAAAGAAAAAGCAGAG-3’ site EcoRI souligné5'-GG AATTCC CAAATAAAAAAAGAAAAAGCAGAG-3' EcoRI site underlined
SEQ ID N°18 - ORF2(1)SEQ ID No. 18 - ORF2(1)
5’-CATTTTATGGATCCCCCAAAGGATTTAACTATGCACGA-3’5’-CATTTATTGGATCCCCCAAAGGATTTAACTATGCACGA-3’
SEQ ID N°19 - ORF2(2)SEQ ID No. 19 - ORF2(2)
5’-CATTCATGGTGTCACCTCCTTAAAAATAAAGTTTTATATTAAAACTAAACTCTTTTGATA-3’5’-CATTCATGGTGTCACCTCCTTAAAAATAAAGTTTTATATTAAAACTAAAACTCTTTTGATA-3’
SEQ ID N°20 - GFP1SEQ ID No. 20 - GFP1
5’-TATCAAAAGAGTTTAGTTTTAATATAAAACTTTATTTTTAAGGAGGTGACACCATGAATG-3’5’-TATCAAAAGAGTTTAGTTTTAATAATAAAACTTTATTTTTAAGGAGGTGACACCATGAATG-3’
SEQ ID N°21 - GFP2SEQ ID No. 21 - GFP2
5’-ACCTGAGTTGGTACCTTAATGATGATGATGATGATGAGA-3’5’-ACCTGAGTTGGTACCTTAATGATGATGATGATGATGAGA-3’
SEQ ID N°22 - LinP1SEQ ID No. 22 - LinP1
5’-GGTACCAACTCAGGTTTAAATATC-3’5’-GGTACCAACTCAGGTTTAAATATC-3’
SEQ ID N°23 - LinP2SEQ ID No. 23 - LinP2
5’-GGATCCATAAAATGATTTTTCAT-3’5’-GGATCCATAAAATGATTTTTCAT-3’
Le plasmide pHT-Cal’orf2-gfp-Tcry1Ac est représenté schématiquement à la
La région promotrice du gènecalY(P calY ) a été amplifiée avec les oligos PcalY1 et PcalY2 à partir de l’ADN chromosomique de la souche BtkurstakiHD73. Le fragment d’ADN obtenu a été digéré par les enzymes Xba1 et Asc1, puis purifié comme fragment XbaI/AscI. La région STAB-SD a été amplifiée avec les oligos StabSD1 et StabSD2 à partir d’un plasmide contenant toute la région promotrice du gènecry3A. Le fragment d’ADN obtenu a été digéré par les enzymes AscI et BamHI, puis purifié comme fragment AscI/BamHI. La région terminatrice Tcry1aC a été amplifiée avec les oligos Tcry1 et Tcry2 à partir de l’ADN plasmidique de la souche HD73. Le fragment d’ADN obtenu a été digéré par les enzymes Kpn1 et EcoR1, puis purifié comme fragment KpnI/EcoRI. Ces trois fragments d’ADN ont été insérés entre les sites XbaI/AscI, AscI/BamHI et KpnI/EcoRI, respectivement, dans un plasmide pHT315. Le gènegfpa été amplifié avec les oligos GFP1’ (GFP1 bis) et GFP2’ à partir du plasmide pHT304-gfpbte (stock du laboratoire) et inséré dans le plasmide (préalablement linéarisé par PCR avec les oligos LinP1 et LinP2).The promoter region of the calY gene (P calY ) was amplified with the oligos PcalY1 and PcalY2 from the chromosomal DNA of the Bt kurstaki strain HD73. The DNA fragment obtained was digested with the enzymes Xba1 and Asc1, then purified as an XbaI/AscI fragment. The STAB-SD region was amplified with oligos StabSD1 and StabSD2 from a plasmid containing the entire promoter region of the cry3A gene. The DNA fragment obtained was digested with the enzymes AscI and BamHI, then purified as an AscI/BamHI fragment. The Tcry1aC terminator region was amplified with oligos Tcry1 and Tcry2 from plasmid DNA of strain HD73. The DNA fragment obtained was digested with the enzymes Kpn1 and EcoR1, then purified as a KpnI/EcoRI fragment. These three DNA fragments were inserted between the XbaI/AscI, AscI/BamHI and KpnI/EcoRI sites, respectively, in a pHT315 plasmid. The gfp gene was amplified with the GFP1' (GFP1 bis) and GFP2' oligos from the pHT304-gfpbte plasmid (laboratory stock) and inserted into the plasmid (previously linearized by PCR with the LinP1 and LinP2 oligos).
SEQ ID N°14 - PcalY1SEQ ID No. 14 - PcalY1
5’-GCTCTAGAAAGCAAGACTAGTAATATTTATACGAG-3’ site XbaI souligné5'-GC TCTAGA AAGCAAGACTAGTAATATTTATACGAG-3' underlined XbaI site
SEQ DI N°15 - PcalY2SEQ DI No. 15 - PcalY2
5’-GGCGCGCCCACAATCAATTCCCCCTAGCTTT-3’ site AscI souligné5'- GGCCGCC CACAATCAATTCCCCCTAGCTTT-3' underlined AscI site
SEQ ID N°26 - StabSD1SEQ ID No. 26 - StabSD1
5’-GGCGCGCCTCTTGAAAGGAGGGATGCCT-3’ site AscI souligné5'- GGCCGCC TCTTGAAAGGAGGGATGCCT-3' underlined AscI site
SEQ ID N°27 - StabSD2SEQ ID No. 27 - StabSD2
5’-CGGGATCCATAAAATGATTTTTCATAAATC-3’ site BamHI souligné5'-C GGGATCC ATAAAATGATTTTTCATAAATC-3' BamHI site underlined
SEQ ID N°16 - Tcry1SEQ ID No. 16 - Tcry1
5’-GGGGTACCAACTCAGGTTTAAATATCGTTTTC-3’ site KpnI souligné5'-GG GGTACC AACTCAGGTTTAAATATCGTTTTC-3' underlined KpnI site
SEQ ID N°17 - Tcry2SEQ ID No. 17 - Tcry2
5’-GGAATTCCCAAATAAAAAAAGAAAAAGCAGAG-3’ site EcoRI souligné5'-GG AATTCC CAAATAAAAAAAGAAAAAGCAGAG-3' EcoRI site underlined
SEQ ID N°28 - GFP1 bisSEQ ID No. 28 - GFP1 bis
5’- TCATTTTATGGATCCGAAATAAAATGCATCTGTATTTGAA-3’5’- TCATTTTATGGATCCGAAATAAAATGCATCTGTATTTGAA-3’
SEQ ID N°21 - GFP2SEQ ID No. 21 - GFP2
5’-ACCTGAGTTGGTACCTTAATGATGATGATGATGATGAGA-3’5’-ACCTGAGTTGGTACCTTAATGATGATGATGATGATGAGA-3’
SEQ ID N°22 - LinP1SEQ ID No. 22 - LinP1
5’-GGTACCAACTCAGGTTTAAATATC-3’5’-GGTACCAACTCAGGTTTAAATATC-3’
SEQ ID N°23 - LinP2SEQ ID No. 23 - LinP2
5’-GGATCCATAAAATGATTTTTCAT-3’5’-GGATCCATAAAATGATTTTTCAT-3’
1.2.1.2. PréparationPreparation et transformation de la soucheand transformation of the strain asporogèneasporogenic Bt407-ΔsigEBt407-ΔsigE
Le mutant Bt 407-ΔsigE est préparé selon Bravoet al., 1996.The Bt 407-ΔsigE mutant is prepared according to Bravo et al ., 1996.
Les bactéries sont cultivées en milieu LB à 37°C jusqu’à DO600nm= 1 et transformées par électroporation comme décrit dans Lerecluset al., 1989.The bacteria are cultivated in LB medium at 37°C until OD 600nm = 1 and transformed by electroporation as described in Lereclus et al. , 1989.
La souche asporogène Bt407-ΔsigEest transformée avec chacun des deux plasmides construits, pHT304-18-Cal’orf2-gfp-Tcry1Ac et pHTCal’-gfp-Tcry1Ac (plasmide contrôle), puis cultivée en milieu LB a 30°C.The asporogenic strain Bt407-Δ sigE is transformed with each of the two constructed plasmids, pHT304-18-Cal' orf2 - gfp -Tcry1Ac and pHTCal' -gfp -Tcry1Ac (control plasmid), then cultured in LB medium at 30°C.
La culture a été arrêtée 24 h après le début de la culture et les cellules fixées avec du formaldéhyde, puis observées au microscope a fluorescence (
L’observation au microscope à fluorescence des cellules contenant le plasmide contrôle révèle une expression diffuse de la GFP dans les cellules au bout de 24h de culture (
De façon intéressante, lorsque les cellules Bt407-ΔsigE-pHT-Cal’orf2-gfp-Tcry1Ac sont centrifugées afin de stopper leur croissance au bout de 24h et qu’un précipitant connu en cristallographie, le PEG6000, est ajouté à hauteur de 20%, il est observé une augmentation de la taille des cristaux ou des pseudo-cristaux dans les cellules (
A 24h de culture en milieu LB à 30°C, les cellules Bt407-ΔsigE-pHT-Cal’orf2-gfp-Tcry1Ac ainsi que les cellules témoins sont cassées à la French Press à 2 kbar de pression, puis le milieu de culture contenant les cellules cassées est centrifugé afin de séparer la fraction soluble de la fraction insoluble. 2 μg de ces fractions sont déposées sur un gel SDS-page 10% (
After 24 hours of culture in LB medium at 30°C, the Bt407-Δ sigE -pHT-Cal' orf2 - gfp -Tcry1Ac cells as well as the control cells are broken with the French Press at 2 kbar pressure, then the culture medium containing the broken cells is centrifuged in order to separate the soluble fraction from the insoluble fraction. 2 μg of these fractions are deposited on a 10% SDS-page gel (
MLKYHFPNVCEDELINIYSYGDFKGQGKYICLFKIENQSFLFWRNDKGNKIYTNLESISVEIINTNNTYNQSQNVCPQDLVDTYNQSQNVCPQDLVDTYNQSQNVCPQDLVDTYNQSQNVCPQDLVDTYNQSQNVCPQDLVDTYNQSQNVCPQDLVDTYNQSQNVYTQDLIDTYNQSQNVCPQDLVDTYNQSQNVCPQDLVDTYNQSQNVCPQDLVDTYNQSQNVCPQDLNVYTQDLIDTYNQSQNCDCGCKMLKYHFPNVCEDELINIYSYGDFKGQGKYICLFKIENQSFLFWRNDKGNKIYTNLESISVEIINTNNTYNQSQNVCPQDLVDTYNQSQNVCPQDLVDTYNQSQNVCPQDLVDTYNQSQNVCPQDLVDTYNQSQNVCPQDLVDTYNQSQNVCPQDLVDTYNQSQNVYTQDLIDTYNQSQNVCPQDLVDTYNQ SQNVCPQDLVDTYNQSQNVCPQDLVDTYNQSQNVCPQDLNVYTQDLIDTYNQSQNCDCGCK
ATGCTAAAATATCATTTTCCTAATGTATGTGAAGATGAATTAATTAATATATATTCTTATGGGGATTTTAAAGGACAAGGAAAATATATATGCCTCTTTAAAATTGAAAACCAATCATTCTTATTTTGGAGAAACGATAAAGGAAATAAAATATATACAAATTTAGAATCTATCAGTGTAGAAATAATAAACACGAATAATACGTATAATCAAAGTCAGAATGTATGCCCACAAGATTTAGTTGATACGTATAATCAAAGTCAGAATGTATGCCCACAAGATTTAGTTGATACGTATAATCAAAGTCAGAATGTATGCCCACAAGATTTAGTTGATACGTATAACCAAAGTCAGAATGTATGCCCACAAGATTTAGTTGATACGTATAATCAAAGTCAGAATGTATGCCCACAAGATTTAGTTGATACGTATAACCAAAGTCAGAATGTATGCCCACAAGATTTAGTTGATACGTATAACCAAAGTCAGAATGTATACACACAAGATTTAATTGATACGTATAACCAAAGTCAGAATGTATGCCCACAAGATTTAGTTGATACGTATAACCAAAGTCAGAATGTATGCCCACAAGATTTAGTTGATACGTATAACCAAAGTCAGAATGTATGCCCACAAGATTTAGTTGATACGTATAACCAAAGTCAGAATGTATGCCCACAAGATTTGAATGTATACACACAAGATTTAATTGATACGTATAATCAAAGTCAGAATTGTGATTGTGGTTGTAAGATGCTAAAATATCATTTTCCTAATGTATGTGAAGATGAATTAATTAATATATATTCTTATGGGGATTTTAAAGGACAAGGAAAATATATATGCCTCTTTAAAATTGAAAACCAATCATTCTTATTTTGGAGAAACGATAAAGGAAAATAAAATATATACAAATTTAGAATCTATCAGTGTAGAAATAATAAACACGAATAATACGTATAATCAAAGTCAGAATGTATGCCCACAAGATTTAGTTGATACGTATAATCAAAGTCAGAAT GTATGCCCACAAGATTTAGTTGATACGTATAATCAAAGTCAGAATGTATGCCCACAAGATTTAGTTGATACGTATAACCAAAGTCAGAATGTATGCCCACAAGATTTAGTTGATACGTATAATCAAAGTCAGAATGTATGCCCACAAGATTTAGTTGATACGTATAACCAAAGTCAGAATGTATGCCCACAAGATTTAGTTGATACGTATAACCAAAGTCAGAATGTATACACACAAGATTTAATTGATACGTATAACCAAAGTCAGAATGTATGC CCACAAGATTTAGTTGATACGTATAACCAAAGTCAGAATGTATGCCCACAAGATTTAGTTGATACGTATAACCAAAGTCAGAATGTATGCCCACAAGATTTAGTTGATACGTATAACCAAAGTCAGAATGTATGCCCACAAGATTTGAATGTATACACACAAGATTTAATTGATACGTATAATCAAAGTCAGAATTGTGATTGTGGTTGTAAG
gaaaggaggg atgccgaaaggaggg atgcc
aaactcaggt ttaaatatcg ttttcaaatc aattgtccaa gagcagcatt acaaatagataaactcaggt ttaaatatcg ttttcaaatc aattgtccaa gagcagcatt acaaatagat
aagtaatttg ttgtaatgaa aaacggacat cacctccatt gaaacggagt gatgtccgttaagtaatttg ttgtaatgaa aaacggacat cacctccatt gaaacggagt gatgtccgtt
ttactatgtt attttctagt aatacatatg tatagagcaa cttaatcaag cagagatattttactatgtt attttctagt aatacatatg tatagagcaa cttaatcaag cagagatatt
ttcacctatc gatgaaaata tctctgcttt ttcttttttt atttcacctatc gatgaaaata tctctgcttt ttcttttttt at
SEQ ID N°5 -SEQ ID No. 5 - PP calYcalY RégionRegion promotricepromoter duof gèneembarrassed calYcalY deof BacillusBacillus thuringiensisthuringiensis ..
5’-AAGCAAGACTAGTAATATTTATACGAGTGTGAGGGAACGTTAGCCCTCACCTCTTTGTTTTTCTTTTTTCTTATAGTATTAAATGATTTGAGTGTGAAAAAAGTTATAAATTATCATTGTTTTTTTCTGAAAAGTCTAAATGATATTGAGAAATAAAAATAACTGAAAATATTAATAAATATGTGTTGTGTTTATATAGGGTTGTTCGTTATAATGAACATAAGGTTTTTAAAAAAGAACACATATTAGCTAAGCTAATATAGTTTTCTTTACATCTCTTATTGAAAAATAAGTGATAAAAATATAAAAAAAAGCTAGGGGGAATTGATT-3’5'-AAGCAAGACTAGTAATATTTATACGAGTGTGAGGGAACGTTAGCCCTCACCTCTTTGTTTTTCTTTTTCTTATAGTATTAAATGATTTGAGTGTGAAAAAAGTTATAAATTATCATTGTTTTTTTCTGAAAAGTCTAAATGATATTGAGAAATAAAAATAACTGAAAATATTAATAAATATGTGTTGTGTTTATATAGGGTTTGTTCGT TATAAT GAACA T AAGGTTTTTAAAAAAGAACACATATTAGCTAAGCTA ATATAGTTTTCTTTACATCTCTTATTGAAAAATAAGTGATAAAAATATAAAAAAAAGCTAGGGGGAATTGATT-3'
Soulignée d’un trait : la région 10 (TATAAT) du promoteur.Underlined: region 10 (TATAAT) of the promoter.
Soulignée de deux traits : la région -35 (TTGTGT) du promoteur.Underlined with two lines: the -35 (TTGTGT) region of the promoter.
En gras : le +1 de transcription déterminé par RACE PCR.In bold: the +1 transcription determined by RACE PCR.
SEQ ID N°6 -Région promotrice du gèneinhA1deBacillus thuringiensis - P inhA1 SEQ ID No. 6 - Promoter region of the inhA1 gene of Bacillus thuringiensis - P inhA1
AATTGTGATATATTCGTATGCTAACTATGAAATTTTTACAAATATATTAAAAATATTACATGATATGACTAAATATTGAAAAAATATTGAATTTTTAATAAAATTCAATTTGTAATACATATTATTTATTAGGGGAGGAAATATGGGATGAATTGTGATATATTCGTATGCTAACTATGAAATTTTTACAAATATATTAAAAATATTACATGATATGACTAAATATTGAAAAAATATTGAATTTTTAATAAAATTCAAT TT GTAATACATATTATTTATTAGGGGAGGAAATATGGGATG
AAGTAATCGTTGCCGTACCCGTATGAAATTGAAATAAATAAAATTATTAATATTCTAATAATTCGTATTGCGTGAATATTAATAATTGTTTATAATGAAAATTGTATAATTTTGGTTAATTAACTTGTGCGAAGAAAAGTTAATAATGTATTAAGGAAAATGAATGTTTTTGTATTTTACTTTTTTTAAAAGAGGGAAGTAATCGTTGCCGTACCCGTATGAAATTGAAATAAATAAAATTATTAATATTCTAATAATTCGTATTGCGTGAATATTAATAATTGTT TATAAT GAAAATTG T ATAATTTTGGTTAATTAACTTGTGCGAAGAAAAGTTAATAATGTATTAAGGAAAATGAATGTTTTTGTATTTTACTTTTTTTAAAAGAGGG
SEQ ID N°8Région promotrice du gèneoppAdeBacillus thuringiensis - P oppA SEQ ID No. 8 Promoter region of the oppA gene of Bacillus thuringiensis - P oppA
CTAGACCGTCAAAATATTACTAGAATTATTATACTATAAAAGCTATAATAAGTACTAGGATTAATTTTTTGAAAATTATACGCAATTAAAGGTCTGATTTTAAGATGATGGTAGCAATGTTAATGTATCCCTTTACGAAAAATTTAAAATATAAATATTTTATTAAAAATTTTAACAAAAAAACAAAAAACTATATTCACAATTGTTATATTATATGTATAATGAAAATTGTAGAAACTTGGAGATTATTCTTTCAATTCTACTTTTTAACAAGTGAGGGTACAGGAAGTGCAATTAGGGGAGGCTAGACCGTCAAAATATTACTAGAATTATTATACTATAAAAGCTATAATAAGTACTAGGATTAATTTTTTGAAAATTATACGCAATTAAAGGTCTGATTTTAAGATGATGGTAGCAATGTTAATGTATCCCTTTACGAAAAATTTAAAATATAAATATTTTATTAAAAATTTTAACAAAAAAACAAAAACTATATTCACAATTGTTATATTATATG TATAAT GAAAATT G TAGAAACTTGGAGATTATTCTTTCAATTCTACTTTTTAACAAG TGAGGGTACAGGAAGTGCAATTAGGGGAGG
SEQ ID N°9 -Région promotrice du gènenppCdeBacillus thuringiensis - P nppC SEQ ID No. 9 - Promoter region of the nppC gene of Bacillus thuringiensis - P nppC
ATTCCACTTTTATATAAAAAGATTTTTGAATATTTTTTCAACTTACCCTTGTCAAACATTGTCAATTTATATTAAAATAACAACATACAAAATATTTAGTCTTTTCAGAAAAGATGGAGGGATAGCCATGATTCCACTTTTATATAAAAAGATTTTTGAATATTTTTTCAACTTACCCTTGTCAAACATTGTCAATTTATAT TAAAAT AACAAC A TACAAAATATTTAGTCTTTTCAGAAAAGATGGAGGGATAGCCATG
SEQ ID N°10 -Région promotrice du gènepapRdeBacillus thuringiensis - P papR SEQ ID No. 10 - Promoter region of the papR gene of Bacillus thuringiensis - P papR
CTAGAACCATGAATTAAAAGAATCACTTATAAAAAAAATGAAGAAATAAAAAAGACATAAAGAACAAATATGCATAATTGCATAAAGTCTGGATAATTTTTCATGATATATTTAAAGAAAAAATGCGGCTAGAACCATGAATTAAAAGAATCACTTATAAAAAAAATGAAGAAATAAAAAAGACATAAAGAACAAA TATGCATAATTGCATA AAGTCTGGATAATTTTTCATGA TATATT TAAAGA A AAAATGCGG
SEQ ID N°11 -Région promotrice du gèneplcBdeBacillus thuringiensis - P plcB SEQ ID No. 11 - Promoter region of the plcB gene of Bacillus thuringiensis - P plcB
AGCATGTGTATGCTTTACTCTTTTTTTACATTAGTTTAGACAAGCCTTAATAATAGTTTATTAAAATGAAAGTGTATTCATTCATTATATTCACTGTGTATAAAGTTATAATGATATGAACATTTGCATATTTTAATTTAGTGATAGAAATTTCGTGAAAGGTGGGATATTCTAGTCATAGGTTAACCGGACGACATCATAGGATCCTAACAAAATGTTTACAATAATTCAATTATAAAATGGAGGAGCATGTGTATGCTTTACTCTTTTTTTACATTAGTTTAGACAAGCCTTAATAATAGTTTATTAAAATGAAAGTGTATTCATTCATTATATTCACTGTGTATAAAGTTATAATGA TATGAACATTTGCATA TTTTAATTTAGTGA TAGAAA TTTCGTGAAAGGTGGGA TATTCT AGTCAT A GGTTAACCGGACGACATCATAGGATCCTAACAAAATGTTTACAATAATTCAATTATAAAATGGAGG
SEQ ID N°12 -région promotrice du gènenprAdeBacillus thuringiensis P nprA SEQ ID No. 12 - promoter region of the nprA gene of Bacillus thuringiensis P nprA
TTTTTTCAATATTTGTTCCTCAAAATTCTACAAAACTTGAGAAATAAATTAATTGAATTTTTAGTATATTAATAGTGGAAACATAATGCTAATATGAAACTACTCTTTTTCAAAAAAATTTTTATTAGGGGGAAGGTTCATGTTTTTTCAATATTTGTTCCTCAAAATTCTACAAAACTTGAGAAATAAATTAATTGAATT TTTAGT ATA T TAATAGTGGAAACATAATGCTAATATGAAACTACTCTTTTTCAAAAAAATTTTTATTAGGGGGAAGGTTCATG
SEQ ID N°13 -région promotrice du gèneinhA1deBacillus thuringiensis P nprR SEQ ID No. 13 - promoter region of the inhA1 gene of Bacillus thuringiensis P nprR
GAAGTGAAGTCAAGAGAGAAAAAAATGAAATTATGCATATTTTTTAGAAAATTTATATTTATCAATTTATATTTCTCCGAATTTTATGTATTATTAGAGTAATGGGGTAATGAGAATGGAGGGAAGTGAAGTCAAGAGAGAAAAAAATGAAATTATGCATATTTTTTAGAAAATTTATATTTATCAATTTATATTTCTCCGAATTTTATG TATTAT TAGAGTA A TGGGGTAATGAGAATGGAGG
5’-GCTCTAGAAAGCAAGACTAGTAATATTTATACGAG-3’5'-GC TCTAGA AAGCAAGACTAGTAATATTTATACGAG-3'
5’-GGCGCGCCCACAATCAATTCCCCCTAGCTTT-3’5'- GGCCGCC CACAATCAATTCCCCCTAGCTTT-3'
5’-GGGGTACCAACTCAGGTTTAAATATCGTTTTC-3’5'-GG GGTACC AACTCAGGTTTAAATATCGTTTTC-3'
5’-GGAATTCCCAAATAAAAAAAGAAAAAGCAGAG-3’5'-GG AATTCC CAAATAAAAAAAGAAAAAGCAGAG-3'
5’-CATTTTATGGATCCCCCAAAGGATTTAACTATGCACGA-3’5’-CATTTATTGGATCCCCCAAAGGATTTAACTATGCACGA-3’
5’-CATTCATGGTGTCACCTCCTTAAAAATAAAGTTTTATATTAAAACTAAACTCTTTTGATA-3’5’-CATTCATGGTGTCACCTCCTTAAAAATAAAGTTTTATATTAAAACTAAAACTCTTTTGATA-3’
5’-TATCAAAAGAGTTTAGTTTTAATATAAAACTTTATTTTTAAGGAGGTGACACCATGAATG-3’5’-TATCAAAAGAGTTTAGTTTTAATAATAAAACTTTATTTTTAAGGAGGTGACACCATGAATG-3’
5’-ACCTGAGTTGGTACCTTAATGATGATGATGATGATGAGA-3’5’-ACCTGAGTTGGTACCTTAATGATGATGATGATGATGAGA-3’
5’-GGTACCAACTCAGGTTTAAATATC-3’5’-GGTACCAACTCAGGTTTAAATATC-3’
5’-GGATCCATAAAATGATTTTTCAT-3’5’-GGATCCATAAAATGATTTTTCAT-3’
5’-GCTCTAGAAAGCAAGACTAGTAATATTTATACGAG-3’5'-GC TCTAGA AAGCAAGACTAGTAATATTTATACGAG-3'
5’-GGCGCGCCCACAATCAATTCCCCCTAGCTTT-3’5'- GGCCGCC CACAATCAATTCCCCCTAGCTTT-3'
5’-GGCGCGCCTCTTGAAAGGAGGGATGCCT-3’5'- GGCCGCC TCTTGAAAGGAGGGATGCCT-3'
5’-CGGGATCCATAAAATGATTTTTCATAAATC-3’5'-C GGGATCC ATAAAATGATTTTTCATAAATC-3'
5’- TCATTTTATGGATCCGAAATAAAATGCATCTGTATTTGAA-3’5’- TCATTTTATGGATCCGAAATAAAATGCATCTGTATTTGAA-3’
Claims (13)
(i) un promoteur fort actif en phase stationnaire ;
(ii) une séquence ayant au moins 80% d’identité avec la séquence SEQ ID N°2 du gène codant ORF2 de Bt ; et
(iii) la séquence d’un gène codant une protéine hétérologue ;
lesdites séquences des gènes codant ORF2 et la protéine hétérologue étant en opéron sous le contrôle dudit promoteur fort.Expression cassette including:
(i) a strong promoter active in stationary phase;
(ii) a sequence having at least 80% identity with the sequence SEQ ID No. 2 of the gene encoding ORF2 of Bt; And
(iii) the sequence of a gene encoding a heterologous protein;
said gene sequences encoding ORF2 and the heterologous protein being in operon under the control of said strong promoter.
- préparation d’une bactérie transformée selon l’une quelconque des revendications 8 à 11 ;
- culture de ladite bactérie transformée en phase stationnaire ; et
- optionnellement, purification de ladite protéine hétérologue.12. Process for producing a heterologous protein comprising the steps of:
- preparation of a transformed bacteria according to any one of claims 8 to 11;
- culture of said bacteria transformed into stationary phase; And
- optionally, purification of said heterologous protein.
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
FR2204127A FR3135094A1 (en) | 2022-05-02 | 2022-05-02 | Bacterial heterologous protein expression system |
PCT/EP2023/061001 WO2023213652A1 (en) | 2022-05-02 | 2023-04-26 | System for the bacterial expression of heterologous proteins |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
FR2204127 | 2022-05-02 | ||
FR2204127A FR3135094A1 (en) | 2022-05-02 | 2022-05-02 | Bacterial heterologous protein expression system |
Publications (1)
Publication Number | Publication Date |
---|---|
FR3135094A1 true FR3135094A1 (en) | 2023-11-03 |
Family
ID=83280561
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
FR2204127A Pending FR3135094A1 (en) | 2022-05-02 | 2022-05-02 | Bacterial heterologous protein expression system |
Country Status (2)
Country | Link |
---|---|
FR (1) | FR3135094A1 (en) |
WO (1) | WO2023213652A1 (en) |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20030041353A1 (en) * | 2001-04-18 | 2003-02-27 | Henry Daniell | Mutiple gene expression for engineering novel pathways and hyperexpression of foreign proteins in plants |
WO2010141953A2 (en) * | 2009-06-05 | 2010-12-09 | The Ohio State University Research Foundation | Biomaterials, compositions, and methods |
WO2013085540A2 (en) * | 2011-12-09 | 2013-06-13 | The Ohio State University Research Foundation | Cry crystals for the production of antimicrobial proteins |
-
2022
- 2022-05-02 FR FR2204127A patent/FR3135094A1/en active Pending
-
2023
- 2023-04-26 WO PCT/EP2023/061001 patent/WO2023213652A1/en unknown
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20030041353A1 (en) * | 2001-04-18 | 2003-02-27 | Henry Daniell | Mutiple gene expression for engineering novel pathways and hyperexpression of foreign proteins in plants |
WO2010141953A2 (en) * | 2009-06-05 | 2010-12-09 | The Ohio State University Research Foundation | Biomaterials, compositions, and methods |
WO2013085540A2 (en) * | 2011-12-09 | 2013-06-13 | The Ohio State University Research Foundation | Cry crystals for the production of antimicrobial proteins |
Non-Patent Citations (10)
Title |
---|
ALFI ET AL., J BIOSCIENCE AND. BIOENGINEERING, vol. 128, pages 290 - 295 |
ARANTES, O.LERECLUS, D.: "Construction of cloning vectors for Bacillus thuringiensis", GENE, vol. 108, 1991, pages 115 - 119, XP023541604, DOI: 10.1016/0378-1119(91)90495-W |
DATABASE Geneseq [online] 1 August 2013 (2013-08-01), "Bacillus thuringiensis Cry gene, SEQ ID NO: 5.", XP055983307, retrieved from EBI accession no. GSN:BAP70963 Database accession no. BAP70963 * |
DENG ET AL.: "Régulation of cry gene expression in Bacillus thuringiensis", TOXINS, vol. 6, no. 7, 2014, pages 2194 - 2209, XP055368492, DOI: 10.3390/toxins6072194 |
GE BAOXUE ET AL: "Differential effects of helper proteins encoded by the cry2A and cry11A operons on the formation of Cry2A inclusions in Bacillus thuringiensis", 1 January 1998 (1998-01-01), XP055982966, Retrieved from the Internet <URL:https://watermark.silverchair.com/165-1-35.pdf?token=AQECAHi208BE49Ooan9kkhW_Ercy7Dm3ZL_9Cf3qfKAc485ysgAAAu0wggLpBgkqhkiG9w0BBwagggLaMIIC1gIBADCCAs8GCSqGSIb3DQEHATAeBglghkgBZQMEAS4wEQQMOQUyp0gIdPOubrEqAgEQgIICoNrVZ1Uthfnvr0qL294iAGu6vAGGdORlgE37aRvwdEGDREEKKPnTBYAYUzn3Lsz20wu40hr52vObkT7aFB5QL2Nn2cF> [retrieved on 20221118] * |
LERECLUS ET AL.: "Transformation and expression of a cloned delta-endotoxin gene in Bacillus thuringiensis", FEMS MICROBIOL. LETT., vol. 60, 1989, pages 211 - 217 |
LERECLUS, D.ARANTES, O.: "spbA locus ensures the segregational stability of pHT1030, a novel type of Gram-positive replicon", MOL. MICROBIOL., vol. 7, 1992, pages 35 - 46 |
MALEKIAN ET AL., PROTEIN EXPRESSION AND PURIFICATION, vol. 160, 2019, pages 66 - 72 |
RUAN ET AL., J. BIOTECH., vol. 307, 2020, pages 130 - 138 |
WATSON J ET AL: "Expression of Bacillus anthracis protective antigen in transgenic chloroplasts of tobacco, a non-food/feed crop", VACCINE, ELSEVIER, AMSTERDAM, NL, vol. 22, no. 31-32, 22 October 2004 (2004-10-22), pages 4374 - 4384, XP004594134, ISSN: 0264-410X, DOI: 10.1016/J.VACCINE.2004.01.069 * |
Also Published As
Publication number | Publication date |
---|---|
WO2023213652A1 (en) | 2023-11-09 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO1994025612A2 (en) | Nucleotide sequences for the control of the expression of dna sequences in a cellular host | |
Jong et al. | A structurally informed autotransporter platform for efficient heterologous protein secretion and display | |
EP0011562A1 (en) | Saccharomyces cer. transformed by a plasmid | |
JP3976685B2 (en) | Use of ClyA hemolysin for protein secretion | |
Sanchis et al. | Construction of new insecticidal Bacillus thuringiensis recombinant strains by using the sporulation non-dependent expression system of cryIIIA and a site specific recombination vector | |
WO1993003158A1 (en) | System for protein expression and secretion especially in corynebacteria | |
Ge et al. | Differential effects of helper proteins encoded by the cry2A and cry11A operons on the formation of Cry2A inclusions in Bacillus thuringiensis | |
EP0093062B1 (en) | Dna containing a sequence encoding for a crystal protein or a polypeptide having insecticidal properties, microorganisms transformed with such dna, compositions containing said crystal proteins, polypeptide or microorganisms | |
JP5226958B2 (en) | Recombinant microorganism | |
FR3135094A1 (en) | Bacterial heterologous protein expression system | |
JP4850011B2 (en) | Recombinant microorganism | |
CA2113829C (en) | Novel type of gram positive replicon and construction of recombinant vectors containing same | |
CA2197717C (en) | Mycobacteria functional screening and/or expression vectors | |
WO2023213653A1 (en) | Production of proteins of interest in a non-sporulating bacterial strain | |
Ji et al. | Promoters of crystal protein genes do not control crystal formation inside exosporium of Bacillus thuringiensis ssp. finitimus strain YBT-020 | |
Letek et al. | DivIVA uses an N-terminal conserved region and two coiled-coil domains to localize and sustain the polar growth in Corynebacterium glutamicum | |
FR2678947A1 (en) | ORIGIN OF PLASMIDIC REPLICATION INCREASING THE NUMBER OF COPIES OF PLASMID COMPRISING THE SAME. | |
EP0777734B1 (en) | New polypetides having a toxic activity against insects of the dipter family | |
EP0771872A1 (en) | Process of polymerization of nucleic acid sequences and their applications | |
US8435760B2 (en) | Systems for expression of heterologous proteins in M. capsulatus | |
FR2643646A1 (en) | EXPRESSION OF NUCLEOTIDES SEQUENCES ENCODING FOR GAS VESICLES | |
WO2024024427A1 (en) | Method for determining outer membrane detachment in cyanobacterium, device for determining outer membrane detachment in cyanobacterium, and program | |
FR3047011A1 (en) | GENETICALLY MODIFIED BACTERIAL STRAIN PRODUCING KURSTAKINE IN THE CULTURE ENVIRONMENT | |
Nagakubo et al. | Contractile injection systems facilitate sporogenic differentiation of bacteria through the action of a phage tapemeasure protein-related effector. | |
WO2024107843A1 (en) | Stabilized achromosomal dynamic active systems and uses thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PLFP | Fee payment |
Year of fee payment: 2 |
|
PLSC | Publication of the preliminary search report |
Effective date: 20231103 |
|
PLFP | Fee payment |
Year of fee payment: 3 |